BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30014_g1_i1 len=1485 path=[1463:0-1484]

Length=1485
                                                                      Score     E

dbj|BAD90753.1|  gibberellin 20-oxidase-like protein2                   805   0.0      Ipomoea nil [qian niu]
dbj|BAD90752.1|  gibberellin 20-oxidase-like protein                    639   0.0      Ipomoea nil [qian niu]
emb|CDP05268.1|  unnamed protein product                                555   0.0      
emb|CAB82616.1|  gibberellin 20-oxidase                                 549   0.0      Solanum dulcamara [climbing nightshade]
dbj|BAA31689.1|  Ntc12                                                  549   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009610965.1|  PREDICTED: gibberellin 20 oxidase 1-like           546   0.0      
dbj|BAC76428.1|  gibberellin 20-oxidase                                 546   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009614196.1|  PREDICTED: gibberellin 20 oxidase 1-like           546   0.0      
gb|AAT92091.1|  GA 20-oxidase 1                                         546   0.0      Nerium oleander [rose-bay]
gb|AFA35959.1|  gibberellin 20-oxidase                                  545   0.0      
gb|ABS84235.1|  gibberellin biosynthesis protein GA20ox1                545   0.0      Solanum lycopersicum
gb|ADZ96940.1|  gibberellin 20-oxidase                                  544   0.0      
dbj|BAA32156.1|  gibberellin 20-oxidase                                 544   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006362690.1|  PREDICTED: gibberellin 20 oxidase 1-like           543   0.0      
dbj|BAA37127.1|  gibberelin 20-oxidase                                  543   0.0      Lactuca sativa [cultivated lettuce]
ref|NP_001234070.1|  gibberellin 20-oxidase-1                           542   0.0      
ref|XP_009593192.1|  PREDICTED: gibberellin 20 oxidase 1-like           541   0.0      
ref|XP_011076268.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         540   0.0      
dbj|BAG48318.1|  gibberellin 20-oxidase1                                538   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
ref|NP_001289515.1|  gibberellin 20 oxidase 1-like                      537   0.0      
dbj|BAG12318.1|  gibberellin 20-oxidase                                 536   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABQ17965.1|  gibberellin 20-oxidase                                  535   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_002510873.1|  gibberellin 20-oxidase, putative                   534   0.0      Ricinus communis
ref|XP_006357900.1|  PREDICTED: gibberellin 20 oxidase 1-like           532   0.0      
emb|CAQ43616.1|  gibberellin 20-oxidase                                 532   0.0      Helianthus annuus
ref|XP_004246899.1|  PREDICTED: gibberellin 20 oxidase 1-like           531   0.0      
gb|AGV40767.1|  gibberellin 20-oxidase                                  531   0.0      
gb|AAT39975.1|  Gibberellin 20 oxidase 2 , putative                     531   0.0      Solanum demissum
ref|NP_001289511.1|  gibberellin 20 oxidase 1-like                      530   0.0      
ref|XP_006340374.1|  PREDICTED: gibberellin 20 oxidase 1-like           531   0.0      
gb|AHY84729.1|  gibberellin 20 oxidase 1                                530   0.0      
dbj|BAC56962.1|  gibberellin 20-oxidase                                 529   0.0      Populus nigra [black poplar]
ref|XP_002322432.1|  gibberellin 20-oxidase family protein              529   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001234579.1|  gibberellin 20-oxidase-3                           528   0.0      
gb|ACQ91097.1|  gibberellin 20-oxidase                                  527   0.0      
gb|AFS33178.1|  gibberellin 20-oxidase                                  527   0.0      
gb|AFS33155.1|  gibberellin 20-oxidase                                  527   0.0      
gb|AFS33152.1|  gibberellin 20-oxidase                                  527   0.0      
gb|AFS33148.1|  gibberellin 20-oxidase                                  527   0.0      
emb|CAC13037.1|  Ga20 oxidase                                           526   0.0      Solanum tuberosum [potatoes]
gb|AFS33169.1|  gibberellin 20-oxidase                                  526   0.0      
dbj|BAC82102.1|  gibberellin 20-oxidase                                 526   0.0      Populus alba [abele]
gb|AFS33162.1|  gibberellin 20-oxidase                                  526   0.0      
ref|XP_007038527.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    526   0.0      
gb|AFS33151.1|  gibberellin 20-oxidase                                  526   0.0      
gb|AFS33161.1|  gibberellin 20-oxidase                                  526   0.0      
dbj|BAC82104.1|  gibberellin 20-oxidase                                 526   0.0      Populus alba [abele]
gb|AFS33163.1|  gibberellin 20-oxidase                                  526   0.0      
gb|AFS33158.1|  gibberellin 20-oxidase                                  526   0.0      
gb|AFS33159.1|  gibberellin 20-oxidase                                  526   0.0      
gb|AAR83346.1|  gibberellin 20-oxidase                                  526   0.0      Populus tomentosa [Chinese white poplar]
ref|XP_007038526.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    528   0.0      
dbj|BAA37128.1|  gibberellin 20-oxidase                                 525   0.0      Lactuca sativa [cultivated lettuce]
gb|AFS33170.1|  gibberellin 20-oxidase                                  525   0.0      
gb|AFS33171.1|  gibberellin 20-oxidase                                  525   0.0      
emb|CAH59116.1|  gibberellin 20-oxidase                                 525   0.0      Populus tremula [European aspen]
gb|AFS33166.1|  gibberellin 20-oxidase                                  525   0.0      
gb|KDP22353.1|  hypothetical protein JCGZ_26184                         524   0.0      
ref|NP_001234628.1|  gibberellin 20-oxidase-2                           524   0.0      
ref|XP_011041655.1|  PREDICTED: gibberellin 20 oxidase 1-like           525   0.0      
emb|CAQ43617.1|  gibberellin 20-oxidase                                 524   0.0      Helianthus annuus
emb|CAH59132.1|  gibberellin 20-oxidase                                 524   1e-180   Populus tremula [European aspen]
emb|CAC00709.1|  gibberellin 20-oxidase                                 524   1e-180   Populus tremula x Populus tremuloides
ref|XP_006421808.1|  hypothetical protein CICLE_v10005157mg             524   1e-180   
gb|AFS33149.1|  gibberellin 20-oxidase                                  524   1e-180   
emb|CAH59102.1|  gibberellin 20-oxidase                                 524   1e-180   Populus tremula [European aspen]
ref|XP_006490288.1|  PREDICTED: gibberellin 20 oxidase 1-like           524   1e-180   
emb|CAH59135.1|  gibberellin 20-oxidase                                 524   1e-180   Populus tremula [European aspen]
emb|CAH59140.1|  gibberellin 20-oxidase                                 524   2e-180   Populus tremula [European aspen]
emb|CAH59115.1|  gibberellin 20-oxidase                                 523   2e-180   Populus tremula [European aspen]
emb|CAB96202.1|  gibberellin 20-oxidase                                 523   2e-180   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
gb|ADG28675.2|  gibberellin 20-oxidase 3                                523   3e-180   
emb|CAH59134.1|  gibberellin 20-oxidase                                 523   4e-180   Populus tremula [European aspen]
emb|CAH59123.1|  gibberellin 20-oxidase                                 522   6e-180   Populus tremula [European aspen]
emb|CAH59100.1|  gibberellin 20-oxidase                                 522   9e-180   Populus tremula [European aspen]
gb|ACM68923.1|  gibberellin 20-oxidase                                  521   1e-179   Gossypium hirsutum [American cotton]
emb|CAH59118.1|  gibberellin 20-oxidase                                 521   1e-179   Populus tremula [European aspen]
emb|CAH59108.1|  gibberellin 20-oxidase                                 521   1e-179   Populus tremula [European aspen]
emb|CAH59131.1|  gibberellin 20-oxidase                                 521   1e-179   Populus tremula [European aspen]
dbj|BAG48319.1|  gibberellin 20-oxidase2                                521   2e-179   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CAH59097.1|  gibberellin 20-oxidase                                 521   2e-179   Populus tremula [European aspen]
emb|CAH59142.1|  gibberellin 20-oxidase                                 521   2e-179   Populus tremula [European aspen]
emb|CAH59098.1|  gibberellin 20-oxidase                                 521   2e-179   Populus tremula [European aspen]
ref|XP_006357721.1|  PREDICTED: gibberellin 20 oxidase 1-like           520   2e-179   
emb|CAC13036.1|  Ga20 oxidase                                           520   4e-179   Solanum tuberosum [potatoes]
emb|CAH59128.1|  gibberellin 20-oxidase                                 520   7e-179   Populus tremula [European aspen]
ref|XP_010035059.1|  PREDICTED: gibberellin 20 oxidase 1                519   8e-179   
emb|CAH59114.1|  gibberellin 20-oxidase                                 519   2e-178   Populus tremula [European aspen]
emb|CAH59120.1|  gibberellin 20-oxidase                                 518   2e-178   Populus tremula [European aspen]
emb|CAH59112.1|  gibberellin 20-oxidase                                 518   2e-178   Populus tremula [European aspen]
emb|CAH59113.1|  gibberellin 20-oxidase                                 518   3e-178   Populus tremula [European aspen]
gb|AEW67997.1|  gibberellin 20 oxidase 1                                518   4e-178   
emb|CAH59138.1|  gibberellin 20-oxidase                                 518   4e-178   Populus tremula [European aspen]
ref|XP_002318263.1|  gibberellin 20-oxidase family protein              517   6e-178   Populus trichocarpa [western balsam poplar]
ref|XP_009618395.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         515   3e-177   
emb|CAH59110.1|  gibberellin 20-oxidase                                 515   3e-177   Populus tremula [European aspen]
ref|XP_011094550.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         515   4e-177   
gb|KHG26186.1|  Gibberellin 20 oxidase 2 -like protein                  514   6e-177   
emb|CAD21846.1|  gibberellin 20-oxidase 1                               514   9e-177   Fagus sylvatica
ref|XP_007152362.1|  hypothetical protein PHAVU_004G123600g             514   1e-176   
ref|NP_001267911.1|  gibberellin 20-oxidase                             513   1e-176   
gb|ABF61825.1|  gibberellin 20-oxidase                                  513   2e-176   Vitis vinifera
ref|XP_010109056.1|  Gibberellin 20 oxidase 1-D                         511   1e-175   
ref|XP_011030015.1|  PREDICTED: gibberellin 20 oxidase 2-like iso...    511   2e-175   
ref|XP_004308131.1|  PREDICTED: gibberellin 20 oxidase 1-like           507   3e-174   
ref|XP_011030016.1|  PREDICTED: gibberellin 20 oxidase 2-like iso...    506   2e-173   
gb|KHG10567.1|  Gibberellin 20 oxidase 1 -like protein                  505   2e-173   
gb|ABX45092.1|  gibberellin 20-oxidase                                  506   2e-173   Acacia mangium
dbj|BAJ65440.1|  gibberellin 20-oxidase                                 506   2e-173   
gb|KDP20150.1|  hypothetical protein JCGZ_00029                         505   3e-173   
ref|XP_007218118.1|  hypothetical protein PRUPE_ppa006985mg             504   6e-173   
ref|XP_008234320.1|  PREDICTED: gibberellin 20 oxidase 1-D              504   7e-173   
gb|ACJ84607.1|  unknown                                                 503   1e-172   Medicago truncatula
gb|KHG03920.1|  Gibberellin 20 oxidase 2 -like protein                  503   1e-172   
gb|AES62614.2|  gibberellin 20-oxidase                                  503   2e-172   
gb|KHN31555.1|  Gibberellin 20 oxidase 1                                503   2e-172   
gb|ABX45093.1|  gibberellin 20-oxidase                                  502   3e-172   Acacia mangium
ref|XP_006586607.1|  PREDICTED: gibberellin 20-oxidase 1 isoform X1     501   7e-172   
gb|KEH26558.1|  gibberellin 20-oxidase                                  501   1e-171   
ref|XP_010272616.1|  PREDICTED: gibberellin 20 oxidase 1                501   1e-171   
dbj|BAD30034.1|  gibberellin 20-oxidase2                                499   5e-171   Daucus carota [carrots]
ref|XP_002511762.1|  gibberellin 20-oxidase, putative                   499   5e-171   Ricinus communis
ref|XP_011101148.1|  PREDICTED: gibberellin 20 oxidase 1-D              498   2e-170   
ref|XP_004496635.1|  PREDICTED: gibberellin 20 oxidase 2-like           497   2e-170   
gb|AAC49721.1|  GA 20-oxidase                                           497   4e-170   Pisum sativum [garden pea]
emb|CAA62846.1|  gibberellin 20-oxidase                                 497   5e-170   Pisum sativum [garden pea]
gb|AAF29605.1|AF138704_1  gibberellin c20-oxidase                       497   5e-170   Pisum sativum [garden pea]
emb|CAP12881.1|  putative gibberellic acid 20-oxidase                   496   9e-170   Kalanchoe blossfeldiana
gb|ABB00359.1|  gibberellin 20-oxidase                                  494   3e-169   Fragaria x ananassa
gb|AFL46503.1|  gibberellin 20-oxidase                                  495   4e-169   
ref|XP_002272415.2|  PREDICTED: gibberellin 20 oxidase 1-D-like         494   7e-169   Vitis vinifera
emb|CAN77383.1|  hypothetical protein VITISV_006349                     492   2e-168   Vitis vinifera
ref|XP_008376762.1|  PREDICTED: gibberellin 20 oxidase 2-like           493   3e-168   
ref|XP_003555361.1|  PREDICTED: gibberellin 20 oxidase 2-like           492   4e-168   
ref|XP_010255609.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         491   1e-167   
ref|XP_008376499.1|  PREDICTED: gibberellin 20 oxidase 2-like           491   2e-167   
emb|CAD19319.1|  GA20 oxidase                                           490   2e-167   Beta vulgaris [beet]
ref|XP_010667703.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         490   2e-167   
ref|XP_004513658.1|  PREDICTED: gibberellin 20 oxidase 1-like           490   3e-167   
gb|AGG11739.1|  gibberellin 20-oxidase                                  490   3e-167   
dbj|BAB20975.1|  gibberellin 20-oxidase                                 489   5e-167   Malus domestica [apple tree]
dbj|BAJ65441.1|  gibberellin 20-oxidase                                 489   9e-167   
ref|XP_010667721.1|  PREDICTED: gibberellin 20 oxidase 1-like           487   2e-166   
gb|AEF32773.1|  gibberellin 20-oxidase                                  487   5e-166   
gb|KHN15696.1|  Gibberellin 20 oxidase 2                                486   6e-166   
ref|XP_009371252.1|  PREDICTED: gibberellin 20 oxidase 2-like           486   7e-166   
ref|XP_007143346.1|  hypothetical protein PHAVU_007G064800g             486   9e-166   
dbj|BAJ53138.1|  JHL05D22.9                                             485   1e-165   
ref|XP_002301315.1|  gibberellin 20-oxidase family protein              484   2e-165   Populus trichocarpa [western balsam poplar]
ref|XP_006490964.1|  PREDICTED: gibberellin 20 oxidase 2-like           484   3e-165   
gb|ACJ54434.1|  gibberellin 20-oxidase 2                                484   3e-165   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
gb|AIN45172.1|  gibberellin 20 oxidase 1                                483   1e-164   
ref|XP_004308423.1|  PREDICTED: gibberellin 20 oxidase 1-like           483   1e-164   
ref|XP_006445204.1|  hypothetical protein CICLE_v10020694mg             482   2e-164   
emb|CAC83626.1|  gibberellin 20-oxidase                                 482   3e-164   Cucurbita maxima [Boston marrow]
ref|XP_009351069.1|  PREDICTED: gibberellin 20 oxidase 2-like           482   4e-164   
ref|XP_011034875.1|  PREDICTED: gibberellin 20 oxidase 1-like           481   5e-164   
ref|XP_004143646.1|  PREDICTED: gibberellin 20 oxidase 1-like           481   6e-164   
gb|ACD93464.1|  GA 20-oxidase                                           481   1e-163   Dianthus caryophyllus [carnation]
ref|XP_010056257.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         480   2e-163   
dbj|BAD30033.1|  gibberellin 20-oxidase1                                479   6e-163   Daucus carota [carrots]
ref|XP_009380434.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         479   8e-163   
ref|XP_004158105.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    477   3e-162   
ref|XP_007219522.1|  hypothetical protein PRUPE_ppa022540mg             476   6e-162   
ref|XP_006401907.1|  hypothetical protein EUTSA_v10013824mg             476   9e-162   
emb|CDP20566.1|  unnamed protein product                                476   9e-162   
ref|XP_011002082.1|  PREDICTED: gibberellin 20 oxidase 1-like           476   1e-161   
ref|XP_008232827.1|  PREDICTED: gibberellin 20 oxidase 1-like           475   2e-161   
ref|XP_004241098.1|  PREDICTED: gibberellin 20 oxidase 2-like           474   2e-161   
ref|XP_008342965.1|  PREDICTED: gibberellin 20 oxidase 1-like           474   3e-161   
ref|XP_009413747.1|  PREDICTED: gibberellin 20 oxidase 1-D              474   4e-161   
ref|XP_010918994.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         474   4e-161   
ref|XP_003521460.1|  PREDICTED: gibberellin 20 oxidase 2-like           474   6e-161   
gb|KHN04099.1|  Gibberellin 20 oxidase 2                                473   8e-161   
ref|XP_010536506.1|  PREDICTED: gibberellin 20 oxidase 1                473   1e-160   
gb|EYU19501.1|  hypothetical protein MIMGU_mgv1a006917mg                474   1e-160   
ref|XP_002320083.2|  gibberellin 20-oxidase family protein              472   2e-160   Populus trichocarpa [western balsam poplar]
emb|CDY27101.1|  BnaA02g11210D                                          472   3e-160   
ref|XP_011014843.1|  PREDICTED: gibberellin 20 oxidase 1-like           471   3e-160   
gb|ABG46321.1|  gibberellin 20-oxidase 1                                473   3e-160   Rumex palustris
ref|XP_011093186.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         472   4e-160   
ref|XP_008783765.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    475   4e-160   
ref|XP_006280621.1|  hypothetical protein CARUB_v10026585mg             472   4e-160   
ref|XP_008777097.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         471   6e-160   
emb|CDX91609.1|  BnaC02g15510D                                          470   1e-159   
dbj|BAQ02989.1|  gibberellin 20-oxidase                                 469   2e-159   
ref|XP_010934079.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         469   3e-159   
ref|XP_008467255.1|  PREDICTED: gibberellin 20 oxidase 1-like           469   3e-159   
ref|XP_009127272.1|  PREDICTED: gibberellin 20 oxidase 2                469   5e-159   
ref|XP_010443931.1|  PREDICTED: gibberellin 20 oxidase 2                468   6e-159   
dbj|BAM73279.1|  gibberellin 20 oxidase 1                               468   1e-158   
ref|XP_010106746.1|  Gibberellin 20 oxidase 1                           468   1e-158   
emb|CDX99893.1|  BnaC09g28120D                                          468   1e-158   
gb|KFK26790.1|  gibberellin 20-oxidase                                  467   2e-158   
ref|XP_002865876.1|  ATGA20OX2/GA20OX2                                  467   2e-158   
ref|XP_010482524.1|  PREDICTED: gibberellin 20 oxidase 2-like           466   4e-158   
ref|XP_009107150.1|  PREDICTED: gibberellin 20 oxidase 2                466   6e-158   
emb|CDX99892.1|  BnaC09g28130D                                          466   9e-158   
ref|XP_003528896.1|  PREDICTED: gibberellin 20 oxidase 2-like           466   1e-157   
gb|KHN23055.1|  Gibberellin 20 oxidase 1                                463   2e-157   
emb|CDX92707.1|  BnaC07g39650D                                          464   3e-157   
ref|XP_009137526.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    464   5e-157   
ref|XP_009625248.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         463   5e-157   
ref|XP_010442687.1|  PREDICTED: gibberellin 20 oxidase 2-like           462   1e-156   
gb|ABV64511.1|  gibberellin 20 oxidase                                  461   2e-156   Dasypyrum villosum
ref|NP_199994.1|  gibberellin 20 oxidase 2                              462   2e-156   Arabidopsis thaliana [mouse-ear cress]
gb|ACU40944.1|  gibberellin 20 oxidase                                  461   2e-156   Dasypyrum villosum
ref|XP_004510900.1|  PREDICTED: gibberellin 20 oxidase 2-like           461   4e-156   
gb|ACU40945.1|  gibberellin 20 oxidase                                  461   4e-156   Dasypyrum villosum
ref|XP_010438884.1|  PREDICTED: gibberellin 20 oxidase 1 isoform X1     461   4e-156   
ref|XP_006413308.1|  hypothetical protein EUTSA_v10025434mg             461   5e-156   
gb|ACU40942.1|  gibberellin 20 oxidase                                  460   5e-156   Dasypyrum villosum
gb|AAC49211.1|  gibberellin 20-oxidase                                  461   6e-156   Spinacia oleracea
gb|ACU40946.1|  gibberellin 20 oxidase                                  460   7e-156   Dasypyrum villosum
emb|CDY49714.1|  BnaA03g47400D                                          459   1e-155   
gb|ACU40940.1|  gibberellin 20 oxidase                                  459   1e-155   Dasypyrum villosum
gb|AAB67838.1|  gibberellin 20-oxidase                                  459   2e-155   Pisum sativum [garden pea]
sp|O04705.1|GAO1D_WHEAT  RecName: Full=Gibberellin 20 oxidase 1-D...    458   4e-155   Triticum aestivum [Canadian hard winter wheat]
gb|KEH19017.1|  gibberellin 20-oxidase                                  458   4e-155   
gb|ACU40939.1|  gibberellin 20 oxidase                                  457   5e-155   Dasypyrum villosum
gb|AGW24332.1|  GA20ox1                                                 458   9e-155   
gb|AGW24319.1|  GA20ox1                                                 457   1e-154   
gb|ACU40943.1|  gibberellin 20 oxidase                                  457   1e-154   Dasypyrum villosum
gb|AAT49058.1|  GA 20-oxidase 1                                         456   2e-154   Hordeum vulgare subsp. vulgare [barley]
gb|EYU35054.1|  hypothetical protein MIMGU_mgv1a024312mg                455   3e-154   
ref|NP_194272.1|  gibberellin 20 oxidase 1                              456   3e-154   Arabidopsis thaliana [mouse-ear cress]
gb|AGW24323.1|  GA20ox1                                                 456   4e-154   
emb|CDP15474.1|  unnamed protein product                                456   4e-154   
gb|AAC39313.2|  gibberellin 20-oxidase                                  456   5e-154   Arabidopsis thaliana [mouse-ear cress]
sp|O04706.1|GAO1B_WHEAT  RecName: Full=Gibberellin 20 oxidase 1-B...    455   5e-154   Triticum aestivum [Canadian hard winter wheat]
prf||2116434A  gibberellin 20-oxidase                                   456   6e-154
dbj|BAD94705.1|  gibberellin 20-oxidase - Arabidopsis thaliana          455   8e-154   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98998.1|  BnaC09g48370D                                          455   1e-153   
emb|CAA58293.1|  gibberellin 20-oxidase                                 455   1e-153   Arabidopsis thaliana [mouse-ear cress]
gb|AGW24320.1|  GA20ox1                                                 455   1e-153   
ref|XP_010423241.1|  PREDICTED: gibberellin 20 oxidase 3                455   1e-153   
ref|XP_006828892.1|  hypothetical protein AMTR_s00001p00187150          454   2e-153   
gb|ACU40941.1|  gibberellin 20 oxidase                                  454   2e-153   Dasypyrum villosum
emb|CDP15473.1|  unnamed protein product                                454   3e-153   
gb|AAG43043.1|  gibberellin 20-oxidase                                  453   3e-153   Lolium perenne [perennial ryegrass]
emb|CAX46399.1|  putative GA20OX protein                                452   3e-153   Rosa lucieae [memorial rose]
ref|XP_010491324.1|  PREDICTED: gibberellin 20 oxidase 3-like           454   4e-153   
sp|O04707.1|GAO1A_WHEAT  RecName: Full=Gibberellin 20 oxidase 1-A...    453   4e-153   Triticum aestivum [Canadian hard winter wheat]
gb|AGW24312.1|  GA20ox1                                                 454   4e-153   
gb|AGW24331.1|  GA20ox1                                                 454   4e-153   
gb|KFK25093.1|  gibberellin 20-oxidase                                  454   4e-153   
gb|AGW24324.1|  GA20ox1                                                 453   5e-153   
gb|EMS45754.1|  Gibberellin 20 oxidase 1-A                              452   6e-153   
gb|ACU40931.1|  gibberellin 20 oxidase                                  452   6e-153   Dasypyrum villosum
emb|CDX70015.1|  BnaA10g23640D                                          453   9e-153   
ref|XP_006283896.1|  hypothetical protein CARUB_v10005014mg             453   1e-152   
gb|AGW24333.1|  GA20ox1                                                 452   1e-152   
emb|CDY14054.1|  BnaC02g01710D                                          452   1e-152   
gb|ACU40927.1|  gibberellin 20 oxidase                                  451   1e-152   Dasypyrum villosum
gb|AGW24317.1|  GA20ox1                                                 452   2e-152   
ref|XP_007051986.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    456   2e-152   
emb|CBX45611.1|  GA20ox1d protein                                       451   2e-152   
gb|AAG43044.1|  gibberellin 20-oxidase                                  451   3e-152   Lolium perenne [perennial ryegrass]
emb|CBX45609.1|  GA20ox1a protein                                       451   3e-152   
ref|XP_006399201.1|  hypothetical protein EUTSA_v10015436mg             451   3e-152   
emb|CDY55723.1|  BnaA01g35230D                                          451   3e-152   
gb|ACU40937.1|  gibberellin 20 oxidase                                  450   4e-152   Dasypyrum villosum
gb|ACU40935.1|  gibberellin 20 oxidase                                  450   4e-152   Dasypyrum villosum
ref|XP_002873300.1|  YAP169                                             451   5e-152   
gb|ACU40938.1|  gibberellin 20 oxidase                                  450   6e-152   Dasypyrum villosum
gb|AAT28326.1|  gibberellin 20-oxidase                                  451   6e-152   Gossypium hirsutum [American cotton]
dbj|BAJ65439.1|  gibberellin 20-oxidase                                 450   6e-152   
ref|NP_001234363.1|  gibberellin 20-oxidase 4                           450   6e-152   
gb|AGW24310.1|  GA20ox1                                                 450   7e-152   
emb|CDP18069.1|  unnamed protein product                                451   1e-151   
ref|XP_006286817.1|  hypothetical protein CARUB_v10003732mg             450   1e-151   
ref|XP_009122363.1|  PREDICTED: gibberellin 20 oxidase 3                450   1e-151   
emb|CDX94446.1|  BnaC01g17380D                                          450   1e-151   
ref|XP_007134928.1|  hypothetical protein PHAVU_010G087500g             449   1e-151   
gb|ACU40930.1|  gibberellin 20 oxidase                                  449   1e-151   Dasypyrum villosum
gb|ACU40934.1|  gibberellin 20 oxidase                                  449   2e-151   Dasypyrum villosum
gb|ACU40933.1|  gibberellin 20 oxidase                                  449   2e-151   Dasypyrum villosum
gb|AAC39314.2|  gibberellin 20-oxidase                                  449   2e-151   Arabidopsis thaliana [mouse-ear cress]
gb|ACU40929.1|  gibberellin 20 oxidase                                  448   2e-151   Dasypyrum villosum
gb|ACU40936.1|  gibberellin 20 oxidase                                  448   3e-151   
ref|XP_002867611.1|  hypothetical protein ARALYDRAFT_492287             449   3e-151   
emb|CDY58871.1|  BnaA03g55500D                                          449   3e-151   
ref|XP_004306881.1|  PREDICTED: gibberellin 20 oxidase 1-like           449   3e-151   
ref|XP_009771620.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         448   4e-151   
gb|AAY67841.1|  gibberellin 20-oxidase 1                                448   4e-151   
gb|ACU40928.1|  gibberellin 20 oxidase                                  447   6e-151   
emb|CDY05017.1|  BnaAnng01990D                                          448   8e-151   
ref|XP_009139210.1|  PREDICTED: gibberellin 20 oxidase 1-like           449   1e-150   
ref|NP_196337.1|  gibberellin 20 oxidase 3                              447   1e-150   
ref|XP_006339507.1|  PREDICTED: gibberellin 20 oxidase 3-like           446   3e-150   
gb|KFK29044.1|  gibberellin 20-oxidase                                  446   5e-150   
emb|CDP03483.1|  unnamed protein product                                446   6e-150   
dbj|BAB12438.1|  gibberellin 20-oxidase No3                             446   6e-150   
emb|CDX81038.1|  BnaC03g02920D                                          446   6e-150   
ref|XP_009387900.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         453   1e-149   
gb|ACL11802.1|  gibberellin 20-oxidase                                  444   1e-149   
dbj|BAA31690.1|  Ntc16                                                  444   1e-149   
gb|AAG43042.1|  gibberellin 20-oxidase                                  445   1e-149   
ref|XP_009125678.1|  PREDICTED: gibberellin 20 oxidase 3-like           444   2e-149   
gb|KHG00686.1|  Gibberellin 20 oxidase 1 -like protein                  444   4e-149   
emb|CBX45610.1|  GA20ox1b protein                                       442   6e-149   
gb|AAG43045.1|  gibberellin 20-oxidase                                  441   1e-148   
gb|ACM68922.1|  gibberellin 20-oxidase                                  442   2e-148   
ref|XP_010456431.1|  PREDICTED: gibberellin 20 oxidase 3                441   1e-147   
ref|XP_004145052.1|  PREDICTED: gibberellin 20 oxidase 2-like           438   3e-147   
ref|XP_010546074.1|  PREDICTED: gibberellin 20 oxidase 3                439   3e-147   
gb|ABA01489.1|  gibberellin 20-oxidase                                  439   3e-147   
gb|AAW80969.1|  gibberellin 20-oxidase                                  439   4e-147   
ref|XP_006392085.1|  hypothetical protein EUTSA_v10023837mg             436   2e-146   
ref|XP_003592363.1|  Gibberellin 20-oxidase                             432   1e-145   
gb|EPS70054.1|  gibberellin 20-oxidase                                  433   2e-145   
ref|NP_176294.1|  gibberellin 20-oxidase 4                              433   3e-145   
emb|CDP16832.1|  unnamed protein product                                432   4e-145   
ref|XP_008460146.1|  PREDICTED: gibberellin 20 oxidase 1-like           432   5e-145   
gb|ABN42267.1|  gibberellin 20-oxidase                                  427   6e-144   
ref|XP_002463483.1|  hypothetical protein SORBIDRAFT_01g000580          429   1e-143   
ref|XP_003559529.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         429   1e-143   
gb|EPS62210.1|  gibberellin 20-oxidase                                  429   3e-143   
ref|XP_010451198.1|  PREDICTED: gibberellin 20 oxidase 1-like           427   4e-143   
ref|XP_010446240.1|  PREDICTED: gibberellin 20 oxidase 3-like           426   2e-142   
ref|XP_004980980.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         426   3e-142   
ref|XP_010483924.1|  PREDICTED: gibberellin 20 oxidase 3-like           424   9e-142   
ref|NP_001238291.1|  gibberellin 20-oxidase 1                           422   2e-141   
gb|EAY92655.1|  hypothetical protein OsI_14402                          421   1e-140   
emb|CAC13038.1|  Ga20 oxidase                                           417   3e-140   
ref|NP_001051951.1|  Os03g0856700                                       420   4e-140   
ref|XP_010477976.1|  PREDICTED: gibberellin 20 oxidase 3-like           420   5e-140   
gb|AAP21386.1|  putative gibberelin 20-oxidase                          419   6e-140   
ref|XP_009151337.1|  PREDICTED: gibberellin 20 oxidase 3-like           418   3e-139   
gb|KCW72892.1|  hypothetical protein EUGRSUZ_E01336                     416   7e-139   
sp|P93771.2|GAOX1_ORYSJ  RecName: Full=Gibberellin 20 oxidase 1; ...    416   2e-138   
emb|CAA70329.1|  gibberellin 20-oxidase                                 416   2e-138   
ref|NP_001105923.1|  LOC778427                                          415   4e-138   
ref|NP_001241783.1|  gibberellin 20 oxidase 1                           415   4e-138   
emb|CDY52529.1|  BnaC03g75160D                                          415   6e-138   
emb|CBL59326.1|  Gibberellin 20-oxidase                                 412   9e-137   
ref|XP_009113152.1|  PREDICTED: gibberellin 20 oxidase 4-like           411   1e-136   
emb|CDY12880.1|  BnaA09g13940D                                          412   3e-136   
ref|XP_006281598.1|  hypothetical protein CARUB_v10027716mg             409   9e-136   
gb|KGN46220.1|  hypothetical protein Csa_6G075200                       407   3e-135   
ref|XP_010270330.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         403   2e-133   
gb|AHW42465.1|  GA20ox1                                                 403   3e-133   
gb|AGI99537.1|  gibberellin 20-oxidase 1                                402   3e-133   
ref|XP_010269098.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         402   5e-133   
gb|AGW24326.1|  GA20ox1                                                 400   1e-132   
gb|AAD42693.1|AF074709_1  gibberellin 20-oxidase                        401   2e-132   
gb|EYU25034.1|  hypothetical protein MIMGU_mgv1a011602mg                397   2e-132   
gb|AAB48239.1|  gibberellin C-20 oxidase                                400   3e-132   
emb|CCD28482.1|  GA 20-oxidase                                          399   5e-132   
ref|XP_008439144.1|  PREDICTED: gibberellin 20 oxidase 2-like           399   7e-132   
ref|XP_009104229.1|  PREDICTED: gibberellin 20 oxidase 4                399   8e-132   
ref|XP_008783342.1|  PREDICTED: gibberellin 20 oxidase 2-like           399   1e-131   
ref|XP_008805890.1|  PREDICTED: gibberellin 20 oxidase 2                398   2e-131   
ref|XP_004150310.1|  PREDICTED: gibberellin 20 oxidase 2-like           398   2e-131   
ref|NP_001058987.1|  Os07g0169700                                       397   5e-131   
ref|XP_010911046.1|  PREDICTED: gibberellin 20 oxidase 2-like           396   1e-130   
gb|AAT49059.1|  GA 20-oxidase 3                                         394   4e-130   
ref|XP_010908634.1|  PREDICTED: gibberellin 20 oxidase 2                394   1e-129   
ref|XP_004173605.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    389   4e-129   
gb|AES72892.2|  gibberellin 20-oxidase                                  390   3e-128   
ref|XP_003602641.1|  Gibberellin 20 oxidase                             390   4e-128   
gb|KHN02778.1|  Gibberellin 20 oxidase 2                                385   8e-128   
ref|XP_009385199.1|  PREDICTED: gibberellin 20 oxidase 2-like           389   8e-128   
emb|CDY44829.1|  BnaCnng11850D                                          388   3e-127   
ref|XP_011022922.1|  PREDICTED: gibberellin 20 oxidase 1-D-like         387   4e-127   
gb|KHN09624.1|  Gibberellin 20 oxidase 3                                387   6e-127   
emb|CDM85359.1|  unnamed protein product                                386   7e-127   
ref|XP_009414611.1|  PREDICTED: gibberellin 20 oxidase 2-like           385   4e-126   
ref|XP_009396824.1|  PREDICTED: gibberellin 20 oxidase 2-like           385   4e-126   
ref|XP_002310523.1|  gibberellin 20-oxidase family protein              385   4e-126   
ref|XP_010436386.1|  PREDICTED: gibberellin 20 oxidase 1-like           379   1e-125   
gb|ABQ52488.1|  GA 20-oxidase                                           383   2e-125   
ref|XP_002266536.1|  PREDICTED: gibberellin 20 oxidase 2                382   4e-125   
emb|CDP04653.1|  unnamed protein product                                382   5e-125   
ref|XP_009124338.1|  PREDICTED: gibberellin 20 oxidase 4-like           380   2e-124   
emb|CDY64867.1|  BnaAnng19660D                                          380   2e-124   
gb|KHN31167.1|  Gibberellin 20 oxidase 2                                379   5e-124   
ref|XP_003561378.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         379   8e-124   
ref|XP_002284681.1|  PREDICTED: gibberellin 20 oxidase 1-D              378   1e-123   
gb|AGW24321.1|  GA20ox1                                                 375   2e-123   
emb|CDY60083.1|  BnaCnng35700D                                          378   4e-123   
ref|XP_002307041.1|  gibberellin 20-oxidase family protein              377   6e-123   
emb|CAA51744.1|  gibberellin 20-oxidase                                 376   9e-123   
gb|AAB64345.1|  gibberellin 20-oxidase                                  376   1e-122   
ref|NP_001242323.1|  uncharacterized protein LOC100777070               375   3e-122   
ref|XP_007161406.1|  hypothetical protein PHAVU_001G066000g             374   3e-122   
ref|XP_007048446.1|  Gibberellin 20-oxidase, putative                   375   5e-122   
ref|XP_011031154.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         374   5e-122   
gb|ADT91907.1|  GA20 oxidase-like protein                               369   6e-122   
emb|CDP18068.1|  unnamed protein product                                370   6e-122   
ref|XP_004502957.1|  PREDICTED: gibberellin 20 oxidase 2-like           373   2e-121   
ref|XP_010527094.1|  PREDICTED: gibberellin 20 oxidase 2-like           373   2e-121   
ref|XP_010025776.1|  PREDICTED: gibberellin 20 oxidase 2-like           373   2e-121   
ref|XP_008337066.1|  PREDICTED: gibberellin 20 oxidase 2-like           372   3e-121   
gb|AHI62959.1|  gibberellin 20 oxidase 2                                372   4e-121   
emb|CDY72226.1|  BnaCnng76580D                                          367   7e-121   
gb|KEH35367.1|  gibberellin 20-oxidase                                  370   1e-120   
ref|XP_010090818.1|  Gibberellin 20 oxidase 2                           371   1e-120   
gb|KHG00226.1|  hypothetical protein F383_17958                         370   1e-120   
ref|XP_006434316.1|  hypothetical protein CICLE_v10003376mg             369   3e-120   
ref|XP_002456751.1|  hypothetical protein SORBIDRAFT_03g041900          370   4e-120   
ref|XP_003522565.1|  PREDICTED: gibberellin 20 oxidase 2-like           368   5e-120   
ref|XP_009383569.1|  PREDICTED: gibberellin 20 oxidase 2-like           370   6e-120   
ref|XP_011006304.1|  PREDICTED: gibberellin 20 oxidase 2-like           368   8e-120   
gb|KDO83499.1|  hypothetical protein CISIN_1g035820mg                   368   9e-120   
ref|XP_006472882.1|  PREDICTED: gibberellin 20 oxidase 2-like           368   2e-119   
ref|NP_001136858.1|  hypothetical protein                               367   2e-119   
ref|XP_003544714.1|  PREDICTED: gibberellin 20 oxidase 3-like           367   2e-119   
gb|ACM68924.1|  gibberellin 20-oxidase                                  367   3e-119   
ref|XP_006465125.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         367   3e-119   
gb|ABF72027.1|  gibberellin 20-oxidase family protein                   366   6e-119   
ref|XP_006432152.1|  hypothetical protein CICLE_v10003385mg             365   6e-119   
ref|XP_009367490.1|  PREDICTED: gibberellin 20 oxidase 2-like           366   6e-119   
gb|AAY98356.1|  GA 20-oxidase                                           365   8e-119   
ref|XP_006382870.1|  hypothetical protein POPTR_0005s06660g             366   8e-119   
ref|XP_003541973.1|  PREDICTED: gibberellin 20 oxidase 2-like           365   1e-118   
emb|CAB82617.1|  gibberellin n b20-oxidase                              359   1e-118   
gb|KEH43054.1|  gibberellin 20-oxidase                                  365   2e-118   
ref|XP_006280622.1|  hypothetical protein CARUB_v10026585mg             362   2e-118   
gb|ABF70102.1|  gibberellin 20-oxidase, putative                        365   2e-118   
ref|XP_004970813.1|  PREDICTED: gibberellin 20 oxidase 2-like           366   2e-118   
gb|AAT92092.1|  GA 20-oxidase 2                                         363   3e-118   
ref|XP_002306663.1|  gibberellin 20-oxidase family protein              363   3e-118   
ref|XP_004495770.1|  PREDICTED: gibberellin 20 oxidase 2-like           364   4e-118   
tpg|DAA56502.1|  TPA: hypothetical protein ZEAMMB73_262586              364   4e-118   
ref|XP_007137492.1|  hypothetical protein PHAVU_009G131500g             363   4e-118   
gb|EYU35734.1|  hypothetical protein MIMGU_mgv1a020474mg                364   6e-118   
ref|NP_001238302.1|  gibberellin 20-oxidase 2                           360   1e-117   
ref|XP_009406147.1|  PREDICTED: gibberellin 20 oxidase 2-like           363   1e-117   
ref|XP_004292831.1|  PREDICTED: gibberellin 20 oxidase 3-like           362   1e-117   
ref|XP_010674442.1|  PREDICTED: gibberellin 20 oxidase 1-like           363   1e-117   
ref|XP_002527163.1|  gibberellin 20-oxidase, putative                   362   3e-117   
ref|XP_007137788.1|  hypothetical protein PHAVU_009G155400g             361   9e-117   
gb|KHN34840.1|  Gibberellin 20 oxidase 3                                359   9e-117   
ref|XP_003527957.1|  PREDICTED: gibberellin 20 oxidase 2-like           360   1e-116   
emb|CAN78844.1|  hypothetical protein VITISV_013034                     361   2e-116   
ref|XP_002527606.1|  gibberellin 20-oxidase, putative                   360   2e-116   
dbj|BAG80957.1|  GA C20oxidase2                                         360   3e-116   
gb|EMT17460.1|  Gibberellin 20 oxidase 2                                361   3e-116   
ref|XP_009798153.1|  PREDICTED: gibberellin 20 oxidase 2-like           358   5e-116   
dbj|BAG80955.1|  GA C20oxidase2                                         358   9e-116   
ref|XP_010438885.1|  PREDICTED: gibberellin 20 oxidase 1 isoform X2     355   9e-116   
ref|XP_008654721.1|  PREDICTED: uncharacterized protein LOC100276...    359   9e-116   
emb|CCG14216.1|  GA 20-oxidase                                          358   1e-115   
ref|XP_011099713.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         358   1e-115   
ref|XP_008220185.1|  PREDICTED: gibberellin 20 oxidase 2-like           358   1e-115   
gb|KHN46970.1|  Gibberellin 20 oxidase 2                                357   2e-115   
dbj|BAK39011.1|  gibberellin-20 oxidase-2                               357   2e-115   
ref|XP_002520280.1|  gibberellin 20-oxidase, putative                   356   2e-115   
dbj|BAG80954.1|  GA C20oxidase2                                         357   2e-115   
gb|AAN73384.1|  putative gibberellin 20 oxidase                         357   2e-115   
dbj|BAG80962.1|  GA C20oxidase2                                         357   2e-115   
dbj|BAG80956.1|  GA C20oxidase2                                         357   3e-115   
ref|XP_004144295.1|  PREDICTED: gibberellin 20 oxidase 2-like           357   3e-115   
gb|AFW84367.1|  hypothetical protein ZEAMMB73_890121                    360   3e-115   
gb|AER45797.1|  SD1                                                     357   4e-115   
emb|CDM85079.1|  unnamed protein product                                358   4e-115   
ref|XP_008462644.1|  PREDICTED: gibberellin 20 oxidase 2-like           356   5e-115   
ref|NP_001045014.1|  Os01g0883800                                       357   5e-115   
emb|CCD28480.1|  GA 20-oxidase                                          356   5e-115   
ref|XP_010930721.1|  PREDICTED: gibberellin 20 oxidase 2-like           356   6e-115   
gb|AER45907.1|  SD1                                                     356   6e-115   
gb|AIF75110.1|  gibberellin 20-oxidase                                  355   8e-115   
gb|AER45865.1|  SD1                                                     356   9e-115   
ref|XP_004143402.1|  PREDICTED: gibberellin 20 oxidase 2-like           354   1e-114   
gb|ABG33927.1|  gibberellin 20 oxidase                                  355   1e-114   
gb|AER45849.1|  SD1                                                     355   1e-114   
ref|XP_010098730.1|  Gibberellin 20 oxidase 3                           354   2e-114   
dbj|BAG80960.1|  GA C20oxidase2                                         356   2e-114   
ref|XP_004958969.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         355   2e-114   
dbj|BAG80961.1|  GA C20oxidase2                                         354   4e-114   
ref|XP_010679560.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         354   4e-114   
dbj|BAL03272.1|  gibberellin-20 oxidase-2                               353   9e-114   
dbj|BAG80959.1|  GA C20oxidase2                                         353   1e-113   
ref|XP_011006305.1|  PREDICTED: gibberellin 20 oxidase 2                351   2e-113   
ref|XP_010098728.1|  Gibberellin 20 oxidase 2                           352   2e-113   
ref|XP_008441598.1|  PREDICTED: gibberellin 20 oxidase 3                352   3e-113   
gb|KHN09051.1|  Gibberellin 20 oxidase 3                                350   5e-113   
ref|XP_002459391.1|  hypothetical protein SORBIDRAFT_02g003940          350   9e-113   
gb|EYU22811.1|  hypothetical protein MIMGU_mgv1a008725mg                349   2e-112   
ref|XP_004503042.1|  PREDICTED: gibberellin 20 oxidase 3-like           348   4e-112   
dbj|BAG80958.1|  GA C20oxidase2                                         349   4e-112   
ref|XP_002306662.1|  gibberellin 20-oxidase family protein              347   4e-112   
ref|XP_010061910.1|  PREDICTED: gibberellin 20 oxidase 2-like           348   9e-112   
emb|CDY00263.1|  BnaA06g21640D                                          344   9e-112   
ref|XP_007227452.1|  hypothetical protein PRUPE_ppa007673mg             347   1e-111   
ref|XP_007226476.1|  hypothetical protein PRUPE_ppa027207mg             348   1e-111   
ref|XP_008219297.1|  PREDICTED: gibberellin 20 oxidase 3-like           347   2e-111   
ref|XP_007019258.1|  Gibberellin 20-oxidase, putative                   347   2e-111   
ref|XP_008219225.1|  PREDICTED: gibberellin 20 oxidase 3-like           347   2e-111   
emb|CBI24470.3|  unnamed protein product                                343   2e-111   
ref|XP_007226389.1|  hypothetical protein PRUPE_ppa023241mg             346   3e-111   
ref|XP_006432149.1|  hypothetical protein CICLE_v10003206mg             345   5e-111   
gb|AGT52277.1|  gibberellin 20-oxidase                                  338   3e-110   
gb|AGT52275.1|  gibberellin 20-oxidase                                  336   8e-110   
ref|XP_006366931.1|  PREDICTED: gibberellin 20 oxidase 2-like           340   4e-109   
ref|XP_002441117.1|  hypothetical protein SORBIDRAFT_09g020760          342   4e-109   
gb|AGT52269.1|  gibberellin 20-oxidase                                  334   6e-109   
gb|AGT52278.1|  gibberellin 20-oxidase                                  334   7e-109   
gb|AGT52282.1|  gibberellin 20-oxidase                                  334   8e-109   



>dbj|BAD90753.1| gibberellin 20-oxidase-like protein2 [Ipomoea nil]
Length=386

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/386 (99%), Positives = 384/386 (99%), Gaps = 0/386 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAIECMIPTPTPNHERQEIENKPAAAVVFDS VLRHESNIPTEFLWPDHEKPGPYAAREF
Sbjct  1     MAIECMIPTPTPNHERQEIENKPAAAVVFDSPVLRHESNIPTEFLWPDHEKPGPYAAREF  60

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL
Sbjct  61    QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  120

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVV EYFEKTLGQ
Sbjct  121   PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVGEYFEKTLGQ  180

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP
Sbjct  181   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  240

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY
Sbjct  241   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  300

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH
Sbjct  301   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  360

Query  283   YRSDTDTLLNFATWLQQNQTLHATQA  206
             YRSDTDTLLNFATWLQQNQTLHATQA
Sbjct  361   YRSDTDTLLNFATWLQQNQTLHATQA  386



>dbj|BAD90752.1| gibberellin 20-oxidase-like protein [Ipomoea nil]
Length=381

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/386 (78%), Positives = 347/386 (90%), Gaps = 7/386 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAIEC+  TPT +      ++  AAAVVFDSSVLRHE+NIPTEF+WP+HEKPG YAA E 
Sbjct  1     MAIECVTTTPTRS------DDPKAAAVVFDSSVLRHETNIPTEFVWPEHEKPGSYAAPEC  54

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VPVID+AAFRSGDP AVAET KLV+EACKKHGFFLVVNHGVD + +SD +R MDR+F+L
Sbjct  55    PVPVIDLAAFRSGDPAAVAETLKLVNEACKKHGFFLVVNHGVDPDRISDAIRHMDRFFDL  114

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS KEKALRK+GE CGYASSFTGRF+AKLPWKETLSFR+SA+KECSH+VEEYF+++LGQ
Sbjct  115   PLSSKEKALRKVGESCGYASSFTGRFSAKLPWKETLSFRYSAQKECSHIVEEYFQESLGQ  174

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             +FA +G +YQKY N M+ LALEI E+LGMGLGV+RKHFS+F+QENDSV+RLNY PPCQKP
Sbjct  175   DFAHIGLVYQKYSNEMSKLALEIMEVLGMGLGVNRKHFSDFFQENDSVMRLNYCPPCQKP  234

Query  643   ELTLGTGPHCDPTSLTILHQD-SVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             E+TLGTGPHCDPTSLTILHQD SV+GLQV VDNEWR+V+P+PNAFVVNIGDTFMALSNG+
Sbjct  235   EITLGTGPHCDPTSLTILHQDNSVNGLQVCVDNEWRSVSPSPNAFVVNIGDTFMALSNGI  294

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVN+ I RKS+AFFLCPH+DKVVTPPPELVD+THP+LYPDFKWP LLE+TQ 
Sbjct  295   YKSCLHRAVVNSTITRKSMAFFLCPHEDKVVTPPPELVDSTHPRLYPDFKWPTLLEFTQK  354

Query  286   HYRSDTDTLLNFATWLQQNQTLHATQ  209
             HYRSDTDTLL+F+ WLQQNQT HAT 
Sbjct  355   HYRSDTDTLLSFSAWLQQNQTPHATH  380



>emb|CDP05268.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 311/385 (81%), Gaps = 12/385 (3%)
 Frame = -3

Query  1363  MAIECMIPT--------PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKP  1208
             MAI+CMI T         + N ER + +  P   +VFD+SVL+H+++IPT+F+WPDHEKP
Sbjct  1     MAIDCMITTKASASEIMSSSNPERLDQQQNP---LVFDASVLQHQTSIPTQFIWPDHEKP  57

Query  1207  GPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVR  1028
              P  +RE  VP++D+  F SG P A  E  ++V EAC+KHGFFLVVNHGVD  L+SD  R
Sbjct  58    SP-NSRELAVPLVDLGGFLSGSPSAAKEASRIVGEACRKHGFFLVVNHGVDASLISDAHR  116

Query  1027  EMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEE  848
              MD +FE PL  K+KA RK+GEHCGYASSFTGRF++KLPWKETLSF+FSA KE SH+VEE
Sbjct  117   CMDSFFEQPLCEKQKAQRKVGEHCGYASSFTGRFSSKLPWKETLSFQFSAAKESSHIVEE  176

Query  847   YFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLN  668
             YFEKTLG +F  LG +YQ+YCNAM+TL+L I ELLGM LGV R+ F EF++EN+S++RLN
Sbjct  177   YFEKTLGHQFLHLGGVYQEYCNAMSTLSLGIMELLGMSLGVSRESFKEFFEENESIMRLN  236

Query  667   YYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTF  488
             YYPPCQKPELTLGTGPHCDPTSLTILHQD+V GLQVFVD EWR++ P  NAFVVNIGDTF
Sbjct  237   YYPPCQKPELTLGTGPHCDPTSLTILHQDTVGGLQVFVDGEWRSIGPDMNAFVVNIGDTF  296

Query  487   MALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPA  308
             MALSNG YKSC+HRAVVNN+ PRKS+AFFLCP +DKVV+PP ELVD+ +P++YPDF WP 
Sbjct  297   MALSNGRYKSCLHRAVVNNKTPRKSLAFFLCPKEDKVVSPPTELVDSNNPRIYPDFTWPK  356

Query  307   LLEYTQLHYRSDTDTLLNFATWLQQ  233
             LLE+TQ HYR+D  TL  F+ WLQQ
Sbjct  357   LLEFTQKHYRADMHTLQMFSNWLQQ  381



>emb|CAB82616.1| gibberellin 20-oxidase [Solanum dulcamara]
Length=376

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 311/380 (82%), Gaps = 7/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CMI     N +   ++ K    ++FD+S ++ ESNIPT+F+WPDHEKP    A++ 
Sbjct  1     MAIDCMIT----NGKSPMLDEK--KTLIFDASHMKRESNIPTQFIWPDHEKPCA-VAQQL  53

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP+ID+  F SGD  A  +  KLV EAC+ HGFFLVVNHGV+  L+S+  R MD +F+L
Sbjct  54    AVPLIDLRGFLSGDSDAAQQASKLVGEACRSHGFFLVVNHGVEANLISNAHRYMDTFFDL  113

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K+KA RK+GEHCGYASSFTGRF++KLPWKETLSFR+SAE+  SH+VEEYF++TLG+
Sbjct  114   PLSEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSAEENSSHIVEEYFQRTLGE  173

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F  LG +YQ+YCN+MNTL+L I ELLGM LGV++ HF EF++ENDS++RLNYYPPCQKP
Sbjct  174   SFNHLGNVYQEYCNSMNTLSLGIMELLGMSLGVEKSHFKEFFEENDSIMRLNYYPPCQKP  233

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             ELTLGTGPHCDPTSLTILHQD V GLQVFVD+EWR++ PT NAFVVNIGDTFMALSNG Y
Sbjct  234   ELTLGTGPHCDPTSLTILHQDCVGGLQVFVDDEWRSITPTFNAFVVNIGDTFMALSNGRY  293

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP+KDKVV+PP ELVD+ +P++YPDF WP LLE+TQ H
Sbjct  294   KSCLHRAVVNNKTPRKSLAFFLCPNKDKVVSPPNELVDSNNPRIYPDFTWPTLLEFTQKH  353

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+ WLQ N T
Sbjct  354   YRADMNTLQTFSNWLQHNTT  373



>dbj|BAA31689.1| Ntc12 [Nicotiana tabacum]
Length=379

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 310/378 (82%), Gaps = 5/378 (1%)
 Frame = -3

Query  1363  MAIECMIP-TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+CMI    +P     E E KP   ++FD+S ++ E NIPT+F+WPD EKP    ARE
Sbjct  1     MAIDCMITNVKSPILRILEDEKKP---LIFDASQMKREYNIPTQFVWPDDEKPRA-VARE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F SGDPVA  +  +LV EAC+ HGFFLVVNHGV+  L+S+  R MD +F+
Sbjct  57    LPVPLIDLGGFLSGDPVAAQQASRLVGEACRNHGFFLVVNHGVNANLISNAHRYMDMFFD  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+KA RKL EHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF+ T+G
Sbjct  117   LPLSEKQKAQRKLEEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+TL+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSTLSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQDSV GLQVFVDNEWR+++P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWRSISPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF WP LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPTELVDTNNPRIYPDFTWPTLLEFTQK  356

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D +TL  F+ WLQQ
Sbjct  357   HYRADMNTLQTFSNWLQQ  374



>ref|XP_009610965.1| PREDICTED: gibberellin 20 oxidase 1-like, partial [Nicotiana 
tomentosiformis]
Length=372

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/376 (67%), Positives = 309/376 (82%), Gaps = 5/376 (1%)
 Frame = -3

Query  1363  MAIECMIP-TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+CMI    +P     E E KP   ++FD+S ++ E NIPT+F+WPD EKP    ARE
Sbjct  1     MAIDCMITNVKSPILRILEDEKKP---LIFDASQMKREYNIPTQFVWPDDEKPRA-VARE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F SGDPVA  +  +LV EAC+ HGFFLVVNHGV+  L+S+  R MD +F+
Sbjct  57    LPVPLIDLGGFLSGDPVAAQQASRLVGEACRNHGFFLVVNHGVNANLISNAHRYMDMFFD  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+KA RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF+ T+G
Sbjct  117   LPLSEKQKAQRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+TL+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSTLSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQDSV GLQVFVDNEWR+++P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWRSISPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF WP LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPTELVDTNNPRIYPDFTWPTLLEFTQK  356

Query  286   HYRSDTDTLLNFATWL  239
             HYR+D +TL  F+ WL
Sbjct  357   HYRADMNTLQTFSNWL  372



>dbj|BAC76428.1| gibberellin 20-oxidase [Nicotiana tabacum]
Length=379

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 310/378 (82%), Gaps = 5/378 (1%)
 Frame = -3

Query  1363  MAIECMIPT-PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+CMI    +P     E + KP   ++FD+S ++ E NIPT+F+WPD EKP    ARE
Sbjct  1     MAIDCMITNVNSPMLRILEDDKKP---LIFDASQMKREYNIPTQFIWPDDEKPRA-VARE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F SGDPVA  +  +LV EAC+ HGFFLVVNHGV+  L+S+  R MD +F+
Sbjct  57    LPVPLIDLGGFLSGDPVAAQQASRLVGEACRNHGFFLVVNHGVNANLISNAHRYMDMFFD  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+KA RKL EHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF+ T+G
Sbjct  117   LPLSEKQKAQRKLEEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+TL+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSTLSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQDSV GLQVFVDNEWR+V+P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWRSVSPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF WP LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPNELVDTNNPRIYPDFTWPTLLEFTQK  356

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D +TL  F+ WL+Q
Sbjct  357   HYRADMNTLQTFSNWLKQ  374



>ref|XP_009614196.1| PREDICTED: gibberellin 20 oxidase 1-like [Nicotiana tomentosiformis]
Length=377

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/377 (66%), Positives = 309/377 (82%), Gaps = 6/377 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             M ++CMI        R   E      ++FD+SV+++ESNIP++F+WPD+EKP    AR+ 
Sbjct  1     MTVDCMITRNKFTMPRTSKE-----PLIFDASVMKNESNIPSQFIWPDNEKPCA-NARQL  54

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP ID+    SGDP A  +   LV+EAC+KHGFFLV+NHG+DT L+S+  R MD +FEL
Sbjct  55    QVPHIDLGGVLSGDPFATKQAASLVNEACQKHGFFLVINHGIDTNLISNAHRYMDLFFEL  114

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL+ K+KA RK+GEHCGYASSFTGRF++KLPWKETLSF++SAE+  SH+VE+YF++T+G+
Sbjct  115   PLTEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFQYSAEEGSSHIVEDYFQRTMGE  174

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F+ LG+ YQ Y NAM+TL+L I ELLG+ LGV R HF EF+QEN+S++RLNYYPPCQKP
Sbjct  175   NFSHLGKAYQDYSNAMSTLSLGIMELLGLSLGVSRNHFKEFFQENESIMRLNYYPPCQKP  234

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             ELTLGTGPHCDPTSLTILHQDSV GLQVFVDNEWR++ P  NAFVVNIGDTFMALSNG Y
Sbjct  235   ELTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWRSITPNFNAFVVNIGDTFMALSNGRY  294

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+IPRKS+AFFLCP KDKVV+PP ELVD+ +P++YPDF WPALLE+TQ  
Sbjct  295   KSCLHRAVVNNKIPRKSLAFFLCPKKDKVVSPPTELVDSNNPRIYPDFTWPALLEFTQKQ  354

Query  283   YRSDTDTLLNFATWLQQ  233
             YR+D +TL  F++WLQ+
Sbjct  355   YRADMNTLQTFSSWLQK  371



>gb|AAT92091.1| GA 20-oxidase 1 [Nerium oleander]
Length=376

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 313/380 (82%), Gaps = 4/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CM  + +   E  + E KP   +VFD+S+L+H+++IPTEF+WP+HEKP P   RE 
Sbjct  1     MAIDCMFKSKSTVPEMCKDEKKP---LVFDASLLQHQTHIPTEFIWPEHEKPCP-NPREH  56

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP+ID+  F SG+PVA  E  +LV EAC++HGFFLVVNHGVD +L++D  R MD +FEL
Sbjct  57    PVPLIDLGGFLSGNPVAAMEASRLVGEACQEHGFFLVVNHGVDADLIADAHRYMDYFFEL  116

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL  K++A RKLGEHCGYASSFTG+ + KLPWKETLSFRFSAEK  SH+VEEYFEKTLG 
Sbjct  117   PLCDKQRAQRKLGEHCGYASSFTGKISTKLPWKETLSFRFSAEKRSSHMVEEYFEKTLGD  176

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EFA LG +YQ+YCNAM+TL+L I ELLGM LG+ R+ F +F+Q+N+S++RLNYYPPCQKP
Sbjct  177   EFAHLGNVYQEYCNAMSTLSLGIMELLGMSLGISRESFKDFFQDNESIMRLNYYPPCQKP  236

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             ELTLGTGPHCDPTSLTILHQD+V GLQVFVD EWR+++P  +AFVVNIGDTF+ALSNG Y
Sbjct  237   ELTLGTGPHCDPTSLTILHQDTVGGLQVFVDGEWRSISPNVSAFVVNIGDTFVALSNGRY  296

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP +DKVV+PP ELVD+ +P++YPDF W  LLE+TQ H
Sbjct  297   KSCLHRAVVNNKTPRKSLAFFLCPKEDKVVSPPSELVDSNNPRIYPDFTWAKLLEFTQKH  356

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+ WLQQ  +
Sbjct  357   YRADMNTLQIFSNWLQQKNS  376



>gb|AFA35959.1| gibberellin 20-oxidase [Nicotiana attenuata]
Length=379

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/382 (66%), Positives = 309/382 (81%), Gaps = 5/382 (1%)
 Frame = -3

Query  1363  MAIECMIP-TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             M I+CMI    +P     E E +P   + FD+S ++ E NIPT+F+WPD EKP    ARE
Sbjct  1     MTIDCMITNVKSPMLRILEDEKRP---LTFDASQMKREYNIPTQFIWPDDEKPRA-VARE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F SGD +A  +  +LV EAC+ HGFFLVVNHGV+  L+S+  R MD +F 
Sbjct  57    LPVPLIDLGGFLSGDAIAAQQASRLVGEACRNHGFFLVVNHGVNANLISNAHRYMDMFFS  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+KA RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF+ T+G
Sbjct  117   LPLSEKQKAQRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+TL+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSTLSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDCVGGLQVFVDNEWRSISPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD+ +P++YPDF WP+LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKSPRKSLAFFLCPKKDKVVSPPTELVDSNNPRIYPDFTWPSLLEFTQK  356

Query  286   HYRSDTDTLLNFATWLQQNQTL  221
             HYR+D +TL  F+ WLQQ   L
Sbjct  357   HYRADMNTLQTFSNWLQQKTAL  378



>gb|ABS84235.1| gibberellin biosynthesis protein GA20ox1 [Solanum lycopersicum]
Length=378

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/388 (65%), Positives = 311/388 (80%), Gaps = 15/388 (4%)
 Frame = -3

Query  1363  MAIECMIP---TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CMIP   +P  + ++Q          +FD+S ++ ESNIPT+F+WPDHEKP     
Sbjct  1     MAIDCMIPNGRSPMLDEKKQ---------FIFDASHMKRESNIPTQFIWPDHEKPCALV-  50

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
             ++  VP+ID+  F SGDP A  +  +LV EAC+ HGFFLVVNHGVD  L+S+  R MD +
Sbjct  51    QQLHVPLIDLRGFLSGDPDAAQQASELVGEACRGHGFFLVVNHGVDANLISNAHRYMDTF  110

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             FELPL  K+KA RK+GEHCGYASSFTGRF++KLPWKETLSFR+SA+KE SH+VEEYF+ T
Sbjct  111   FELPLLEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSAKKESSHIVEEYFQST  170

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LG+ F  LG +YQ+YCN+MNTL+L I ELLGM LGV++ HF EF++ENDS++RLNYYPPC
Sbjct  171   LGESFNHLGNVYQEYCNSMNTLSLGIMELLGMSLGVEKSHFKEFFEENDSIMRLNYYPPC  230

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKPEL LGTGPHCDPTSLTILHQD V GLQVFVD+EWR+++P  NAFVVNIGDTFMALSN
Sbjct  231   QKPELALGTGPHCDPTSLTILHQDCVGGLQVFVDDEWRSISPNFNAFVVNIGDTFMALSN  290

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVNN+ PRKS+AFFLCP+KDKVV+PP ELVD+ +P++YPDF WP LLE+T
Sbjct  291   GRYKSCLHRAVVNNKTPRKSLAFFLCPNKDKVVSPPNELVDSNNPRIYPDFTWPTLLEFT  350

Query  292   QLHYRSDTDTLLNFATWL--QQNQTLHA  215
             Q HYR+D +TL  F+ WL  Q N T  A
Sbjct  351   QKHYRADMNTLQTFSNWLHDQHNTTTQA  378



>gb|ADZ96940.1| gibberellin 20-oxidase [Capsicum annuum]
Length=375

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/378 (66%), Positives = 313/378 (83%), Gaps = 7/378 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CMI     N +   +++K    +VFD+S L+ ESNIPT+F+WPD EKP    A+E 
Sbjct  1     MAIDCMIT----NGKSPMLDDK--KPLVFDASKLKRESNIPTQFIWPDDEKPCA-VAQEL  53

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              V +ID+  F SGDPVA  +  +LV +AC+ HGFFLVVNHGVD  L+S+  R MD +F++
Sbjct  54    PVSLIDLRGFLSGDPVAAQQASQLVGDACRSHGFFLVVNHGVDANLISNAHRYMDTFFDM  113

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K+KA RK+GEHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF++TLG+
Sbjct  114   PLSEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQRTLGE  173

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F+ LG +YQ+YCN+M+TL+L I ELLGM LG++R HF EF++EN+S++RLNYYPPCQKP
Sbjct  174   SFSHLGNIYQEYCNSMSTLSLGIMELLGMSLGIERSHFKEFFEENESIMRLNYYPPCQKP  233

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             ELTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  NAFVVNIGDTFMALSNG Y
Sbjct  234   ELTLGTGPHCDPTSLTILHQDCVGGLQVFVDNEWRSISPNFNAFVVNIGDTFMALSNGRY  293

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP+KDKVV+PP +LVD+ +P++YPDF WP L E+TQ H
Sbjct  294   KSCLHRAVVNNKTPRKSLAFFLCPNKDKVVSPPSKLVDSNNPRMYPDFTWPTLHEFTQKH  353

Query  283   YRSDTDTLLNFATWLQQN  230
             YR+D +TL NF+ WLQ +
Sbjct  354   YRADMNTLANFSNWLQHS  371



>dbj|BAA32156.1| gibberellin 20-oxidase [Nicotiana tabacum]
Length=379

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 309/378 (82%), Gaps = 5/378 (1%)
 Frame = -3

Query  1363  MAIECMIPT-PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+CMI    +P     E + KP   ++FD+S ++ E NIPT+F+WPD EKP    ARE
Sbjct  1     MAIDCMITNVNSPMLRILEDDKKP---LIFDASQMKREYNIPTQFIWPDDEKPRA-VARE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F SGDPVA  +  +LV EAC+ HGFFLVVNHGV+  L+S+  R MD +F+
Sbjct  57    LPVPLIDLGGFLSGDPVAAQQASRLVGEACRNHGFFLVVNHGVNANLISNAHRYMDMFFD  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+KA RKL EHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF+ T+G
Sbjct  117   LPLSEKQKAQRKLEEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+TL+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSTLSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQDSV GLQVFVDNEWR+V+P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWRSVSPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFL P KDKVV+PP ELVD  +P++YPDF WP LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKTPRKSLAFFLVPKKDKVVSPPNELVDTNNPRIYPDFTWPTLLEFTQK  356

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D +TL  F+ WL+Q
Sbjct  357   HYRADMNTLQTFSNWLKQ  374



>ref|XP_006362690.1| PREDICTED: gibberellin 20 oxidase 1-like [Solanum tuberosum]
Length=378

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/385 (66%), Positives = 309/385 (80%), Gaps = 15/385 (4%)
 Frame = -3

Query  1363  MAIECMI---PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CMI    +P  +  +Q          +FD+S ++ ESNIPT+F+WPDHEKP     
Sbjct  1     MAIDCMITNAKSPMIDETKQ---------FIFDASHMKRESNIPTQFIWPDHEKPCA-VV  50

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
             +E  VP+ID+  F SGD  A  +  KLV EAC+ HGFFLVVNHGVD  L+S+  R MD +
Sbjct  51    QELHVPLIDLRGFLSGDSDAAQQASKLVGEACRSHGFFLVVNHGVDANLISNAHRYMDTF  110

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             F+LPL  K+KA RK+GEHCGYASSFTGRF++KLPWKETLSFR+SAE+E SH+VEEYF++T
Sbjct  111   FDLPLLEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSAEEESSHIVEEYFQRT  170

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LG+ F  LG +YQ+YCN+MNTL+L I ELLGM LGV++ HF EF++ENDS++RLNYYPPC
Sbjct  171   LGESFNHLGNVYQEYCNSMNTLSLGIMELLGMSLGVEKSHFKEFFEENDSIMRLNYYPPC  230

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKPELTLGTGPHCDPTSLTILHQD V GLQVFVD+EWR+++P  NAFVVNIGDTFMALSN
Sbjct  231   QKPELTLGTGPHCDPTSLTILHQDCVGGLQVFVDDEWRSISPNFNAFVVNIGDTFMALSN  290

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVNN+ PRKS+AFFLCP+KDKVV+PP ELVD+ +P++YPDF WP LLE+T
Sbjct  291   GRYKSCLHRAVVNNKTPRKSLAFFLCPNKDKVVSPPNELVDSNNPRIYPDFTWPTLLEFT  350

Query  292   QLHYRSDTDTLLNFATWL--QQNQT  224
             Q HYR+D +TL  F+ WL  Q N T
Sbjct  351   QKHYRADMNTLQTFSNWLHDQHNTT  375



>dbj|BAA37127.1| gibberelin 20-oxidase [Lactuca sativa]
Length=383

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/378 (64%), Positives = 307/378 (81%), Gaps = 1/378 (0%)
 Frame = -3

Query  1363  MAIECMIPTPT-PNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+CMI TP+  +  ++E++     ++VFD+SVL+HE+NIP +F+WPD+EKP    +++
Sbjct  1     MAIDCMIKTPSCMSSLKEELKEDQQRSLVFDASVLQHETNIPQQFIWPDNEKPNSKKSKD  60

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              +VP+ID+  F SG   +  E  KLV  AC+KHGFFLVVNHGVD  L+SD    MD +FE
Sbjct  61    LEVPLIDLGGFLSGRSSSTKEASKLVGNACQKHGFFLVVNHGVDANLISDAQTYMDLFFE  120

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K++A RK GE CGYASSFTGRF++KLPWKETLSFRFSAEK  + +V++YFE T+G
Sbjct  121   LPLSEKQRAQRKAGESCGYASSFTGRFSSKLPWKETLSFRFSAEKNSADIVKDYFENTMG  180

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             +EF  LG++YQ+YCNAM+ L+L I ELLG+ LGV+R HF EF++EN+S++RLNYYP CQK
Sbjct  181   EEFVRLGKVYQEYCNAMSRLSLGIMELLGLSLGVNRSHFKEFFEENNSIMRLNYYPRCQK  240

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PELTLGTGPHCDPTSLTILHQD+V GL+VFVDNEWR++ P  NAFVVNIGDTFMALSNG 
Sbjct  241   PELTLGTGPHCDPTSLTILHQDNVGGLEVFVDNEWRSITPNSNAFVVNIGDTFMALSNGR  300

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF W   LE+TQ 
Sbjct  301   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPKELVDENNPRVYPDFTWATFLEFTQK  360

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D +TL  F+ W++Q
Sbjct  361   HYRADMNTLQAFSNWVEQ  378



>ref|NP_001234070.1| gibberellin 20-oxidase-1 [Solanum lycopersicum]
 gb|AAD15755.1| gibberellin 20-oxidase-1 [Solanum lycopersicum]
Length=378

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/388 (65%), Positives = 310/388 (80%), Gaps = 15/388 (4%)
 Frame = -3

Query  1363  MAIECMI---PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CMI    +P  + ++Q          +FD+S ++ ESNIPT+F+WPDHEKP     
Sbjct  1     MAIDCMITNGKSPMLDEKKQ---------FIFDASHMKRESNIPTQFIWPDHEKPCALV-  50

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
             ++  VP+ID+  F SGDP A  +  +LV EAC+ HGFFLVVNHGVD  L+S+  R MD +
Sbjct  51    QQLHVPLIDLRGFLSGDPDAAQQASELVGEACRGHGFFLVVNHGVDANLISNAHRYMDTF  110

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             FELPL  K+KA RK+GEHCGYASSFTGRF++KLPWKETLSFR+SA+KE SH+VEEYF+ T
Sbjct  111   FELPLLEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSAKKESSHIVEEYFQST  170

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LG+ F  LG +YQ+YCN+MNTL+L I ELLGM LGV++ HF EF++ENDS++RLNYYPPC
Sbjct  171   LGESFNHLGNVYQEYCNSMNTLSLGIMELLGMSLGVEKSHFKEFFEENDSIMRLNYYPPC  230

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKPEL LGTGPHCDPTSLTILHQD V GLQVFVD+EWR+++P  NAFVVNIGDTFMALSN
Sbjct  231   QKPELALGTGPHCDPTSLTILHQDCVGGLQVFVDDEWRSISPNFNAFVVNIGDTFMALSN  290

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVNN+ PRKS+AFFLCP+KDKVV+PP ELVD+ +P++YPDF WP LLE+T
Sbjct  291   GRYKSCLHRAVVNNKTPRKSLAFFLCPNKDKVVSPPNELVDSNNPRIYPDFTWPTLLEFT  350

Query  292   QLHYRSDTDTLLNFATWL--QQNQTLHA  215
             Q HYR+D +TL  F+ WL  Q N T  A
Sbjct  351   QKHYRADMNTLQTFSNWLHDQHNTTTQA  378



>ref|XP_009593192.1| PREDICTED: gibberellin 20 oxidase 1-like [Nicotiana tomentosiformis]
Length=379

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 309/378 (82%), Gaps = 5/378 (1%)
 Frame = -3

Query  1363  MAIECMIP-TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+CMI    +P     E + KP   ++FD+S ++ E NIPT+F+WPD EKP    A+E
Sbjct  1     MAIDCMITNVNSPMLRILEDDKKP---LIFDASQMKREYNIPTQFIWPDDEKPRA-VAQE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+I++  F SGDPVA  +  +LV EAC+ HGFFLVVNHGV+  L+S+  R MD +F+
Sbjct  57    LPVPLIELGGFLSGDPVAAQQASRLVGEACRNHGFFLVVNHGVNAYLISNAHRYMDMFFD  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+K  RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAE++ SH+VEEYF+ T+G
Sbjct  117   LPLSEKQKGQRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEEDSSHIVEEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+TL+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSTLSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+V+P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDCVGGLQVFVDNEWRSVSPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF WP LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPNELVDTNNPRIYPDFTWPTLLEFTQK  356

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D +TL  F+ WL+Q
Sbjct  357   HYRADMNTLQTFSNWLKQ  374



>ref|XP_011076268.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Sesamum indicum]
Length=392

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/381 (65%), Positives = 306/381 (80%), Gaps = 8/381 (2%)
 Frame = -3

Query  1363  MAIECMI------PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGP  1202
             M I CMI      P P  N+ R + + K   ++VFD++VL+HES+IP +F+WPDHEKP  
Sbjct  1     MTINCMIMSETSTPQPASNNNRHKDDQK--KSLVFDATVLQHESSIPPQFVWPDHEKPNC  58

Query  1201  YAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
                 E QVP +D+  F SGD  A     +LV EAC+KHGFFLVVNHGVD  L+SD    M
Sbjct  59    SHTPELQVPFVDLGGFLSGDHDASIRASELVGEACRKHGFFLVVNHGVDANLISDAHHYM  118

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             D +FE PL  K++A RKLGEHCGYASSFTGRF++KLPWKETLSF +SA++  SH+VEEYF
Sbjct  119   DCFFEQPLHEKQRAQRKLGEHCGYASSFTGRFSSKLPWKETLSFEYSAQEGSSHIVEEYF  178

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
             ++TLGQ+FA LG++YQ+YC+AM+ L+L I ELL M LGV+R HF EF++EN+S++RLNYY
Sbjct  179   QRTLGQDFAHLGKVYQEYCSAMSRLSLGIMELLAMSLGVNRSHFKEFFEENESIMRLNYY  238

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+ TLGTGPHCDPTSLTILHQD+V GLQVFVDNEWR++ P  NAFVVNIGDTFMA
Sbjct  239   PPCQKPDQTLGTGPHCDPTSLTILHQDTVGGLQVFVDNEWRSITPNINAFVVNIGDTFMA  298

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVN+  PRKS+AFFLCP KDKVV+PPPELVD+ +P++YPDF+WPALL
Sbjct  299   LSNGRYKSCLHRAVVNSMSPRKSLAFFLCPRKDKVVSPPPELVDSVNPRIYPDFRWPALL  358

Query  301   EYTQLHYRSDTDTLLNFATWL  239
             E+TQ HYR+D +TL  F+ WL
Sbjct  359   EFTQKHYRADMNTLQTFSNWL  379



>dbj|BAG48318.1| gibberellin 20-oxidase1 [Chrysanthemum x morifolium]
Length=390

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 304/380 (80%), Gaps = 3/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CMI T +     +E + K   + VFD+SVL+HE+N+P +F+WPDHEKP    ++E 
Sbjct  14    MAIDCMIKTTSNMPSLKEDQRK---SFVFDASVLKHETNLPQQFIWPDHEKPNSQKSKEL  70

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VP+ID+  F SG   +  E   LV EAC+KHGFFLVVNHGVD  L+SD  R MD +FEL
Sbjct  71    EVPLIDLGGFLSGRSSSTKEASSLVGEACQKHGFFLVVNHGVDANLISDAQRYMDLFFEL  130

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K++A R +GE CGYASSFTGRF++KLPWKETLSFRFSAE+  S++V+EYFE T+G+
Sbjct  131   PLSVKQRAQRNVGESCGYASSFTGRFSSKLPWKETLSFRFSAEENASNIVKEYFENTMGE  190

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF  LG++YQ+YCNAM+ L+L I ELLGM LGV R ++ EF++E++S++RLNYYPPCQKP
Sbjct  191   EFIRLGKVYQEYCNAMSRLSLGIMELLGMSLGVSRAYYKEFFEEHNSIMRLNYYPPCQKP  250

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD+V GL+VFVDNEWR + P  NAFVVNIGDTFMALSNG Y
Sbjct  251   DLTLGTGPHCDPTSLTILHQDNVGGLEVFVDNEWRLIVPNSNAFVVNIGDTFMALSNGRY  310

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++  RKS+AFFLCP KDKVV PP ELVD  +P++YPDF W   LE+TQ H
Sbjct  311   KSCLHRAVVNSKTTRKSLAFFLCPKKDKVVIPPKELVDENNPRIYPDFTWSTFLEFTQKH  370

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+TW++Q  T
Sbjct  371   YRADKNTLQAFSTWVRQKTT  390



>ref|NP_001289515.1| gibberellin 20 oxidase 1-like [Nicotiana sylvestris]
 gb|AAM12870.1|AF494087_1 gibberellin 20-oxidase 1 [Nicotiana sylvestris]
Length=379

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/378 (65%), Positives = 308/378 (81%), Gaps = 5/378 (1%)
 Frame = -3

Query  1363  MAIECMIP-TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             M I+CMI    +P     E E +P   ++FD+S ++ E NIPT+F+WPD EKP    ARE
Sbjct  1     MTIDCMITNVKSPMLRILEDEKRP---LIFDASQMKREYNIPTQFIWPDDEKPRA-TARE  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F SGDPVA  +  +LV EAC+ HGFFLVVNHGV+  L+ +  R MD +F+
Sbjct  57    LPVPLIDLGGFLSGDPVAAQQASRLVGEACRNHGFFLVVNHGVNANLICNAHRFMDMFFD  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+KA RKLGEHCGYASSFTGRF++KLPWKETLSFR+SA+++ S +V+EYF+ T+G
Sbjct  117   LPLSEKQKAQRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAQEDSSRIVKEYFQNTMG  176

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F+ LG +YQ+YCN+M+ L+L I ELLGM LGV R+HF EF++EN+S++RLNYYPPCQK
Sbjct  177   ESFSHLGNVYQEYCNSMSILSLGIMELLGMSLGVGREHFKEFFEENESIMRLNYYPPCQK  236

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  NAFVVNIGDTFMALSNG 
Sbjct  237   PDLTLGTGPHCDPTSLTILHQDCVGGLQVFVDNEWRSISPNFNAFVVNIGDTFMALSNGR  296

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD+ +P++YP+F WP LLE+TQ 
Sbjct  297   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPTELVDSNNPRIYPNFTWPTLLEFTQK  356

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D +TL +F+ WLQQ
Sbjct  357   HYRADMNTLQSFSNWLQQ  374



>dbj|BAG12318.1| gibberellin 20-oxidase [Chrysanthemum x morifolium]
 dbj|BAG12476.1| gibberellin 20-oxidase [Chrysanthemum x morifolium]
Length=377

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/380 (64%), Positives = 305/380 (80%), Gaps = 3/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CMI T +     +E + K   + VFD+SVL+HE+NIP +F+WPDHEKP    ++E 
Sbjct  1     MAIDCMIKTTSNMPSLKEDQRK---SFVFDASVLKHETNIPQQFIWPDHEKPNSQKSKEL  57

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VP+ID+  F SG   +  +   LV EAC+KHGFFLVVNHGVD  L+SD  R MD +FEL
Sbjct  58    EVPLIDLGGFLSGRSSSANDASSLVGEACQKHGFFLVVNHGVDANLISDAQRYMDLFFEL  117

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K++A RK+GE CGYASSFTGRF++KLPWKETLSFRFSAE+  S++V++YFE T+G+
Sbjct  118   PLSVKQRAQRKVGESCGYASSFTGRFSSKLPWKETLSFRFSAEENASNIVKDYFENTMGE  177

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF  LG++YQ+YCNAM+ L+L I ELLGM LGV R ++ +F++E++S++RLNYYPPCQKP
Sbjct  178   EFIRLGKVYQEYCNAMSRLSLGIMELLGMSLGVSRAYYKDFFEEHNSIMRLNYYPPCQKP  237

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD+V GL+VFVDNEWR + P  NAFVVNIGDTFMALSNG Y
Sbjct  238   DLTLGTGPHCDPTSLTILHQDNVGGLEVFVDNEWRLIVPNSNAFVVNIGDTFMALSNGRY  297

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++  RKS+AFFLCP KDKVV PP ELVD  +P++YPDF W   LE+TQ H
Sbjct  298   KSCLHRAVVNSKTTRKSLAFFLCPKKDKVVIPPKELVDENNPRIYPDFTWSTFLEFTQKH  357

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+TW++Q  T
Sbjct  358   YRADKNTLQAFSTWVRQKTT  377



>gb|ABQ17965.1| gibberellin 20-oxidase [Chrysanthemum x morifolium]
Length=377

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/380 (63%), Positives = 305/380 (80%), Gaps = 3/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CMI T +     +E + K   + +FD+SVL+HE+NIP +F+WPDHEKP    ++E 
Sbjct  1     MAIDCMIKTTSNMPSLKEDQRK---SFLFDASVLKHETNIPQQFIWPDHEKPNSQKSKEL  57

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VP+ID+  F SG   +  +   LV EAC+KHGFFLVVNHGVD  L+SD  R MD +FEL
Sbjct  58    EVPLIDLGGFLSGRSSSANDASSLVGEACQKHGFFLVVNHGVDANLISDAQRYMDLFFEL  117

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K++A RK+GE CGYASSFTGRF++KLPWKETLSFRFSAE+  S++V++YFE T+G+
Sbjct  118   PLSVKQRAQRKVGESCGYASSFTGRFSSKLPWKETLSFRFSAEENASNIVKDYFENTMGE  177

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF  LG++YQ+YCNAM+ L+L I ELLGM LGV R ++ +F++E++S++RLNYYPPCQKP
Sbjct  178   EFIRLGKVYQEYCNAMSRLSLGIMELLGMSLGVSRAYYKDFFEEHNSIMRLNYYPPCQKP  237

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD+V GL+VFVDNEWR + P  NAFVVNIGDTFMALSNG Y
Sbjct  238   DLTLGTGPHCDPTSLTILHQDNVGGLEVFVDNEWRLIVPNSNAFVVNIGDTFMALSNGRY  297

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++  RKS+AFFLCP KDKVV PP ELVD  +P++YPDF W   LE+TQ H
Sbjct  298   KSCLHRAVVNSKTTRKSLAFFLCPKKDKVVIPPKELVDENNPRIYPDFTWSTFLEFTQKH  357

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+TW++Q  T
Sbjct  358   YRADKNTLQAFSTWVRQKTT  377



>ref|XP_002510873.1| gibberellin 20-oxidase, putative [Ricinus communis]
 gb|EEF51475.1| gibberellin 20-oxidase, putative [Ricinus communis]
Length=378

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 303/379 (80%), Gaps = 1/379 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAIEC+   P+  H+++E   +   ++VFD+  LR++SNIP +F+WPD EKP    A E 
Sbjct  1     MAIECIKAVPSSVHQKEERSKEEQKSLVFDAKFLRYQSNIPQQFVWPDDEKP-IVNAPEL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP+ID+  F SGDPV+  E  KLV EAC+KHGFFLVVNHGVD +L++D  R MD +FEL
Sbjct  60    AVPLIDLGGFLSGDPVSATEASKLVGEACQKHGFFLVVNHGVDQKLIADAHRYMDNFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K+KA RK+GEHCGYASSFTGRF+ KLPWKETLSFR+SA++    +V++YF  T+G+
Sbjct  120   PLSDKQKAQRKVGEHCGYASSFTGRFSTKLPWKETLSFRYSAQQNSPKLVQDYFHNTMGE  179

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F + G++YQ+YC AM+TL+L I ELLGM LGV + HF EF++ENDS++RLNYYPPCQKP
Sbjct  180   SFLEFGKVYQQYCEAMSTLSLGIMELLGMSLGVSKAHFREFFEENDSIMRLNYYPPCQKP  239

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQV+VDNEWR+++P   AFVVNIGDTFMALSNG Y
Sbjct  240   DLTLGTGPHCDPTSLTILHQDQVGGLQVYVDNEWRSISPNFQAFVVNIGDTFMALSNGKY  299

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN+E  RKS+AFFLCP  DK++TPP +LVD ++P++YPDF W  LLE+TQ H
Sbjct  300   KSCLHRAVVNSETTRKSLAFFLCPKSDKMITPPTKLVDNSNPRIYPDFTWSMLLEFTQKH  359

Query  283   YRSDTDTLLNFATWLQQNQ  227
             YR+D  TL  F+ W+QQ +
Sbjct  360   YRADMKTLEMFSNWVQQRK  378



>ref|XP_006357900.1| PREDICTED: gibberellin 20 oxidase 1-like [Solanum tuberosum]
Length=377

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/381 (65%), Positives = 305/381 (80%), Gaps = 7/381 (2%)
 Frame = -3

Query  1366  TMAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             TMAI+CM+    P  +    E KP   ++FDSSVL+HESNIP +F+WPDHEKP      E
Sbjct  2     TMAIDCMV---MPMIQTSSDEKKP---LIFDSSVLKHESNIPRQFIWPDHEKPSG-GVPE  54

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+ AF SGDP+A     +LVDEACK HGFFLVVNHGVDT L+S   R M+ +FE
Sbjct  55    LDVPLIDLGAFLSGDPIAAKRESRLVDEACKNHGFFLVVNHGVDTNLISLAHRYMNMFFE  114

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K+K  RK G+HCGYASSFT RF++KLPWKETLSF +SA +  SH+V++YF KT+G
Sbjct  115   LPLSNKQKIQRKRGDHCGYASSFTERFSSKLPWKETLSFSYSALQGSSHMVDQYFLKTMG  174

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             ++F+ +G+ YQ+YCNAM+TL+  I ELLG  LGV + HF +F++EN+S++RLNYYP C K
Sbjct  175   EDFSHIGKFYQEYCNAMSTLSSGIMELLGESLGVSKNHFKQFFEENESIMRLNYYPTCLK  234

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+L LGTGPHCDPTSLTILHQDSVSGLQVF+DN+WR+++P  +AFVVNIGDTFMALSNG 
Sbjct  235   PDLALGTGPHCDPTSLTILHQDSVSGLQVFMDNQWRSISPNLSAFVVNIGDTFMALSNGR  294

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV PP ELVD+ +P++YPDF WP LLE+TQ 
Sbjct  295   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVRPPAELVDSNNPRIYPDFTWPTLLEFTQK  354

Query  286   HYRSDTDTLLNFATWLQQNQT  224
             HYR+DT+TL  F+ WLQQ  T
Sbjct  355   HYRADTNTLQFFSNWLQQRTT  375



>emb|CAQ43616.1| gibberellin 20-oxidase [Helianthus annuus]
 emb|CAQ43618.1| gibberellin 20-oxidase [Helianthus annuus]
Length=379

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/377 (63%), Positives = 300/377 (80%), Gaps = 3/377 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+I  P+P    +E   +   ++VFD+SVL+HE NIP +F+WPDHEKP    ++E 
Sbjct  1     MAIDCIIKNPSPMSSLKEDRQR---SLVFDASVLQHEGNIPQQFIWPDHEKPNTQKSKEL  57

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VP+ID+  F SG   +  +   LV EAC+KHGFFLVVNHGVD  L+SD  + MD +FEL
Sbjct  58    EVPLIDLGGFLSGHSCSTKKASNLVGEACQKHGFFLVVNHGVDENLISDAHQYMDLFFEL  117

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K++A RK GE CGYASSFTGRF++KLPWKETLSF++SA++  S +V++YF+  +G+
Sbjct  118   PLSEKQRAQRKAGESCGYASSFTGRFSSKLPWKETLSFQYSADENSSDIVKDYFKDKMGE  177

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF  LG +YQ YCNAMN L+L I ELLGM LGV R HF EF+QEN+S++RLNYYPPCQKP
Sbjct  178   EFIRLGNVYQDYCNAMNRLSLGIMELLGMSLGVSRAHFKEFFQENNSIMRLNYYPPCQKP  237

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD+V GL+VFVDNEWR++ P   AFVVNIGDTFMALSNG Y
Sbjct  238   DLTLGTGPHCDPTSLTILHQDNVGGLEVFVDNEWRSIAPNSQAFVVNIGDTFMALSNGRY  297

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP KDKVV+PP +LVD  +P++YPDF W   LE+TQ H
Sbjct  298   KSCLHRAVVNSKTPRKSLAFFLCPKKDKVVSPPEKLVDQKNPRIYPDFTWSTFLEFTQKH  357

Query  283   YRSDTDTLLNFATWLQQ  233
             YR+D +TL  F+ W+QQ
Sbjct  358   YRADMNTLKAFSNWVQQ  374



>ref|XP_004246899.1| PREDICTED: gibberellin 20 oxidase 1-like [Solanum lycopersicum]
Length=378

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/360 (66%), Positives = 301/360 (84%), Gaps = 4/360 (1%)
 Frame = -3

Query  1306  ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVA  1127
             E KP   ++FDSS +++E NIPT+++WPD EKP    A+E  VP+ID+ +F SGDPVA  
Sbjct  17    EEKP---LIFDSSHMKNEFNIPTQYIWPDDEKPC-VVAQELHVPLIDLMSFFSGDPVATQ  72

Query  1126  ETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYA  947
             +  +LVDEAC+ HGFFLVVNHGV++ L+S+  R MD +F++PL  K+KA RK+GEHCGYA
Sbjct  73    QASRLVDEACRSHGFFLVVNHGVESNLISNAHRYMDTFFDMPLYEKQKARRKIGEHCGYA  132

Query  946   SSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTL  767
             SSFTGRF++KLPWKETLS R++A++  SH+++EYF++TLG+ F +LG +YQ+YCN+MNTL
Sbjct  133   SSFTGRFSSKLPWKETLSLRYTAKENSSHIIKEYFQRTLGESFNNLGNVYQEYCNSMNTL  192

Query  766   ALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILH  587
             +L I ELLG+ LGV + HF EF+++NDS++RLNYYPPC KPELTLGTGPH DPTSLT+LH
Sbjct  193   SLRIMELLGISLGVQKSHFKEFFEDNDSIMRLNYYPPCLKPELTLGTGPHYDPTSLTVLH  252

Query  586   QDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIA  407
             QD VSG QVFVDNEW +++P  NAFVVNIGDTFMALSNG+YKSC+HRAVVNN  PRKS+A
Sbjct  253   QDCVSGFQVFVDNEWYSISPNFNAFVVNIGDTFMALSNGIYKSCLHRAVVNNTTPRKSLA  312

Query  406   FFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             FFLCPHKDKVVTPP ELVD  +P+LYPDF WPALLE+TQ HYR+D +TL  F+ WLQ+N 
Sbjct  313   FFLCPHKDKVVTPPTELVDYNNPRLYPDFTWPALLEFTQKHYRADKNTLQAFSMWLQENN  372



>gb|AGV40767.1| gibberellin 20-oxidase [Camellia sinensis]
Length=383

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 294/378 (78%), Gaps = 2/378 (1%)
 Frame = -3

Query  1363  MAIECMIPT-PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI C+  T             K    +VFD+SVLRHE NIP +F+WPDHEKP    A E
Sbjct  1     MAINCVTNTLSMSPPPPPPPLPKDDQPLVFDASVLRHEQNIPAQFIWPDHEKPCS-TAPE  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP++D+  F SGDP A AE  ++V EAC+KHGFFLVVNHGVD  L+SD    MD +FE
Sbjct  60    LSVPLVDLGGFLSGDPKAAAEASRVVGEACRKHGFFLVVNHGVDATLISDAHSNMDSFFE  119

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPL  K++  RK+GEHCGYASSFTGRF++KLPWKETLSFR+SAE+ CS +V +YF   +G
Sbjct  120   LPLCEKQRVQRKVGEHCGYASSFTGRFSSKLPWKETLSFRYSAEENCSSIVNDYFMNRMG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F   G++YQ YCNAM+TL+L I ELLGM LGV R HF EF++ENDS++RLNYYPPCQK
Sbjct  180   ENFVQFGKVYQDYCNAMSTLSLGIMELLGMSLGVSRAHFKEFFEENDSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+ TLGTGPHCDPTSLTILHQD+V GLQVFVD++W +++P  NAFVVNIGDTFMALSNG 
Sbjct  240   PDQTLGTGPHCDPTSLTILHQDTVGGLQVFVDDQWHSISPNFNAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF WP LLE+TQ 
Sbjct  300   YKSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPTELVDGKNPRIYPDFTWPTLLEFTQK  359

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D  TL  F+ W+QQ
Sbjct  360   HYRADMKTLEAFSNWVQQ  377



>gb|AAT39975.1| Gibberellin 20 oxidase 2 , putative [Solanum demissum]
 gb|AAT40506.1| Gibberellin 20 oxidase 2 , putative [Solanum demissum]
Length=384

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/382 (63%), Positives = 308/382 (81%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIEN----KPAAAVVFDSSVLRHESNIPTEFLWPDHEKPG-PY  1199
             MAI+CMI T   N   +E +     K   ++ FD+S++++ESNIP++F+WPDHEKP    
Sbjct  1     MAIDCMI-TRNNNMTSKEGQEYDIIKTNKSLSFDASLMKNESNIPSQFIWPDHEKPNCAS  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
               RE QVP+ID++   S DP+ + +  +LV+EAC KHGFFLV NHGVDT L+      +D
Sbjct  60    VTRELQVPLIDLSGVLSNDPIEIKKATRLVNEACTKHGFFLVTNHGVDTNLIKKAHVYID  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
             ++FELPL  K+KA R++GEHCGYASSF GRF++KLPWKETLSF++S EK  SH+VE+YF+
Sbjct  120   KFFELPLCEKQKAQRRVGEHCGYASSFIGRFSSKLPWKETLSFQYSDEKGSSHIVEQYFQ  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
             +TLG++F+ +G++YQ+YCNAM+TL+L I ELLG+ LGV + HF EF+QEN+S++RLNYYP
Sbjct  180   RTLGEKFSHIGKIYQEYCNAMSTLSLGIMELLGLSLGVSKNHFKEFFQENESIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
              CQKPELTLGTGPHCDPTSLTILHQDSV GLQVFVDNEW ++ P  NAFVVNIGDTFMAL
Sbjct  240   TCQKPELTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWHSITPNFNAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG YKSC+HRA+VNN++PRKS+ FFLCP KDKVVTPP ELVD+ +P++YPDF WP LLE
Sbjct  300   SNGRYKSCLHRALVNNKVPRKSLTFFLCPKKDKVVTPPIELVDSNNPRIYPDFTWPTLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ  YR+D +TL  F+ WL++
Sbjct  360   FTQKQYRADMNTLQTFSNWLKK  381



>ref|NP_001289511.1| gibberellin 20 oxidase 1-like [Nicotiana sylvestris]
 gb|AAM12871.1|AF494088_1 gibberellin 20-oxidase 2 [Nicotiana sylvestris]
Length=377

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 303/380 (80%), Gaps = 6/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             M ++CMI       +R   E      ++FD+SV+++ESNIP++F+WPD+EKP    ARE 
Sbjct  1     MTVDCMITRNKFTMQRTSKE-----PLIFDASVMKNESNIPSQFIWPDNEKPCA-NAREL  54

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP ID+    SGDP A  +   LV+EAC+KHGFFLV+NHG+DT L+S+  R MD +FEL
Sbjct  55    HVPHIDLGGVLSGDPFATKQAATLVNEACQKHGFFLVINHGIDTNLISNAHRYMDLFFEL  114

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL+ K+KA RK+GEHCGYASSFTGRF++KLPWKETLSF++SAE+  SH+VE+YF++T+G+
Sbjct  115   PLNEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFQYSAEEGSSHIVEDYFQRTMGE  174

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F  LG++YQ Y  AM+TL+L I ELLG+ LGV R HF EF+QEN+S++RLNYYPPCQKP
Sbjct  175   NFCHLGKVYQDYSIAMSTLSLGIMELLGLSLGVSRNHFKEFFQENESIMRLNYYPPCQKP  234

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             ELT GTGPHCDPTS TILHQDSV GLQVFVDNEWR++ P  NAFVVNIGDTFMALSNG Y
Sbjct  235   ELTFGTGPHCDPTSFTILHQDSVGGLQVFVDNEWRSITPNFNAFVVNIGDTFMALSNGRY  294

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KS +HRAVVN +IPRKS+AFFLCP KDKVV+PP ELVD+ +P++YP+F WPALLE+TQ  
Sbjct  295   KSGLHRAVVNTKIPRKSLAFFLCPKKDKVVSPPIELVDSNNPRIYPEFTWPALLEFTQKQ  354

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR D +TL  F+ W+QQ  T
Sbjct  355   YRVDMNTLQTFSNWVQQTTT  374



>ref|XP_006340374.1| PREDICTED: gibberellin 20 oxidase 1-like [Solanum tuberosum]
Length=384

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/380 (63%), Positives = 307/380 (81%), Gaps = 4/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIEN---KPAAAVVFDSSVLRHESNIPTEFLWPDHEKPG-PYA  1196
             MAI+CMI +      +++ E    K   ++ FD+S++++ESNIP++F+WPDHEKP     
Sbjct  1     MAIDCMITSNNNMTSKEDQEYDIIKTNKSLSFDASLMKNESNIPSQFIWPDHEKPNCSSV  60

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
              RE QVP+ID++   S DP+ + +  +LV+EAC KHGFFLV NHGVDT L+      +D+
Sbjct  61    TRELQVPLIDLSGVLSNDPIEIKKATRLVNEACTKHGFFLVTNHGVDTNLIKKAHVYIDK  120

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +FELPL  K+KA R++GEHCGYASSF GRF++KLPWKETLSF++S E+  SH+VE+YF++
Sbjct  121   FFELPLCEKQKAQRRVGEHCGYASSFIGRFSSKLPWKETLSFQYSDEEGSSHIVEQYFQR  180

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             TLG++F+ +G++YQ+YCNAM+TL+L I ELLG+ LGV + HF EF+QEN+S++RLNYYP 
Sbjct  181   TLGEKFSHIGKIYQEYCNAMSTLSLGIMELLGLSLGVSKNHFKEFFQENESIMRLNYYPT  240

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQKPELTLGTGPHCDPTSLTILHQDSV GLQVFVDNEW ++ P  NAFVVNIGDTFMALS
Sbjct  241   CQKPELTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWHSITPNFNAFVVNIGDTFMALS  300

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG YKSC+HRA+VNN+IPRKS+AFFLCP KDKVV PP ELVD+ +P++YPDF WP LLE+
Sbjct  301   NGRYKSCLHRALVNNKIPRKSLAFFLCPKKDKVVAPPIELVDSNNPRIYPDFTWPTLLEF  360

Query  295   TQLHYRSDTDTLLNFATWLQ  236
             TQ  YR+D +TL  F+ WL+
Sbjct  361   TQKQYRADMNTLQTFSNWLK  380



>gb|AHY84729.1| gibberellin 20 oxidase 1 [Camellia lipoensis]
Length=381

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/377 (65%), Positives = 295/377 (78%), Gaps = 2/377 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI C+  T + +        K    +VFD+SVLRHE NIP +F+WPDHEKP    A E 
Sbjct  1     MAINCITNTLSMS-PPPPPLPKDDQPLVFDASVLRHEHNIPAQFVWPDHEKPCS-TAPEL  58

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP +D+  F SGDP A AE  ++V EAC+KHGFFLVVNHGVD  L+SD    MD +FEL
Sbjct  59    SVPHVDLGGFLSGDPKAAAEASRVVGEACRKHGFFLVVNHGVDATLISDAHSNMDSFFEL  118

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL  K++  RK+GEHCGYASSFTGRF++KLPWKETLSFR+SAE+ CS +V +YF   +G+
Sbjct  119   PLCEKQRVQRKVGEHCGYASSFTGRFSSKLPWKETLSFRYSAEENCSSIVNDYFMNRMGE  178

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F   G++YQ YCNAM+TL+L I ELLGM LGV R HF EF++ENDS++RLNYYPPCQKP
Sbjct  179   NFVQFGKVYQDYCNAMSTLSLGIMELLGMSLGVSRAHFKEFFEENDSIMRLNYYPPCQKP  238

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             + TLGTGPHCDPTSLTILHQD+V GLQVFVD++W +++P  NAFVVNIGDTFMALSNG Y
Sbjct  239   DQTLGTGPHCDPTSLTILHQDTVGGLQVFVDDQWHSISPNFNAFVVNIGDTFMALSNGRY  298

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD  +P++YPDF WP LLE+TQ H
Sbjct  299   KSCLHRAVVNNKTPRKSLAFFLCPKKDKVVSPPTELVDGKNPRIYPDFTWPTLLEFTQKH  358

Query  283   YRSDTDTLLNFATWLQQ  233
             YR+D  TL  F+ W+QQ
Sbjct  359   YRADMKTLEAFSNWVQQ  375



>dbj|BAC56962.1| gibberellin 20-oxidase [Populus nigra]
 dbj|BAC56963.1| gibberellin 20-oxidase [Populus nigra]
 gb|AEF32526.1| gibberellin 20-oxidase [Populus simonii x Populus nigra]
Length=385

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/382 (65%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EAC+KHGFFLVVNHGVD  L++     MD
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACQKHGFFLVVNHGVDKTLIAHAHNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AEK  S  +EEYF 
Sbjct  120   TFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEKNSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGRVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSISPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_002322432.1| gibberellin 20-oxidase family protein [Populus trichocarpa]
 gb|ABK96744.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF06559.1| gibberellin 20-oxidase family protein [Populus trichocarpa]
Length=385

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/382 (65%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EAC+KHGFFLVVNHGVD  L++     MD
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACQKHGFFLVVNHGVDKTLIAHAHNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AEK  S  +EEYF 
Sbjct  120   TFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEKNSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGSVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFDENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSISPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|NP_001234579.1| gibberellin 20-oxidase-3 [Solanum lycopersicum]
 gb|AAD15756.1| gibberellin 20-oxidase-3 [Solanum lycopersicum]
Length=379

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/383 (63%), Positives = 314/383 (82%), Gaps = 7/383 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPA-AAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA--  1193
             MAI+ MI   T N+     E++ +  ++ F++S++++ESNIP++F+WPDHEKP  YA+  
Sbjct  1     MAIDYMI---TRNNNMISKEDQVSNKSLSFNASLMKNESNIPSQFIWPDHEKPN-YASVT  56

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
             RE QVP+ID++   S DP+ + +  +LV+EAC KHGFFLVVNHGVDT L+ +    +D++
Sbjct  57    RELQVPLIDLSGVLSNDPIEIKKATRLVNEACTKHGFFLVVNHGVDTNLIKNAHVYIDKF  116

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             F+LPL  K+KA RK+GEHCGYASSF GRF++KLPWKETLSF++S +K  SH+VE+YF++T
Sbjct  117   FQLPLCEKQKAQRKVGEHCGYASSFVGRFSSKLPWKETLSFQYSDQKGSSHIVEDYFQRT  176

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LG++F+ +G++YQ+YCNA++TL+L I ELLG+ LGV + HF EF+Q N+S++RLNYYP C
Sbjct  177   LGEKFSYIGKVYQEYCNAVSTLSLGIMELLGLSLGVSKNHFKEFFQGNESIMRLNYYPTC  236

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKPELTLGTGPHCDPTSLTILHQDSV GLQVFVDNEW  + P  NAFVVNIGDTFMALSN
Sbjct  237   QKPELTLGTGPHCDPTSLTILHQDSVGGLQVFVDNEWHTITPNFNAFVVNIGDTFMALSN  296

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVNN+IPRKS+AFFLCP KDKV+TPP ELVD+ +P++YPDF WP LLE+T
Sbjct  297   GRYKSCLHRAVVNNKIPRKSLAFFLCPKKDKVITPPNELVDSNNPRIYPDFTWPTLLEFT  356

Query  292   QLHYRSDTDTLLNFATWLQQNQT  224
             Q  YR+D +TL  F+ WL++ Q+
Sbjct  357   QKQYRADMNTLQTFSNWLKKTQS  379



>gb|ACQ91097.1| gibberellin 20-oxidase [Populus simonii]
Length=385

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EAC+KHGFFLVVNHGVD  L++     MD
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACQKHGFFLVVNHGVDKTLIAHAHNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AEK  S  +EEYF 
Sbjct  120   TFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEKNSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R++F EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGRVYQDYCEAMSTLSLGIMELLGMSLGVSREYFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSISPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33178.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33155.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33173.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33152.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33164.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33148.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33150.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33153.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33160.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33168.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33174.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33177.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33182.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFZ78607.1| GA20 [Populus tomentosa]
Length=385

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAC13037.1| Ga20 oxidase [Solanum tuberosum subsp. andigenum]
Length=375

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/380 (64%), Positives = 302/380 (79%), Gaps = 7/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CM+    P  +    E  P   ++FDSSVL+HESNIP +F+WPDHEKP      E 
Sbjct  1     MAIDCMV---MPMIQTSSDEKNP---LIFDSSVLKHESNIPRQFIWPDHEKPSG-GVPEL  53

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP+ID+ AF SGDP+A     +LVDEACK HGFFLV NHGVDT L+S   R M+ +FEL
Sbjct  54    DVPLIDLGAFLSGDPIAAKRESRLVDEACKNHGFFLVGNHGVDTNLISLAHRYMNMFFEL  113

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K+   RK G+HCGYASSFT RF++KLPWKETLSF +SA +  SH+V++YF KT+G+
Sbjct  114   PLSNKQMIQRKRGDHCGYASSFTERFSSKLPWKETLSFSYSALQGSSHMVDQYFLKTMGE  173

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             +F+ +G+ YQ+YCNAM+TL+  I ELLG  LGV + HF +F++EN+S++RLNYYP CQKP
Sbjct  174   DFSHIGKFYQEYCNAMSTLSSGIMELLGESLGVSKNHFKQFFEENESIMRLNYYPTCQKP  233

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +L LGTGPHCDPTSLTILHQDSVSGLQVF+DN+WR+++P  +AFVVNIGDTFMALSNG Y
Sbjct  234   DLALGTGPHCDPTSLTILHQDSVSGLQVFMDNQWRSISPNLSAFVVNIGDTFMALSNGRY  293

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP KDKVV PP ELVD+ +P++YPDF WP LLE+TQ H
Sbjct  294   KSCLHRAVVNNKTPRKSLAFFLCPKKDKVVRPPAELVDSNNPRIYPDFTWPTLLEFTQKH  353

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+DT+TL  F+ WLQQ  T
Sbjct  354   YRADTNTLQFFSNWLQQRTT  373



>gb|AFS33169.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>dbj|BAC82102.1| gibberellin 20-oxidase [Populus alba]
 dbj|BAC82103.1| gibberellin 20-oxidase [Populus alba]
Length=385

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33162.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_007038527.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY23028.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=393

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 297/386 (77%), Gaps = 1/386 (0%)
 Frame = -3

Query  1381  SLSFHTMAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGP  1202
             + + H MAI+C+    +  H  ++  N     +VFD SVL+++SNIP EF+WPD EKP  
Sbjct  9     TFTLHAMAIDCVSNLASMPHHPKDERNDEQKQLVFDVSVLKYDSNIPKEFIWPDDEKPC-  67

Query  1201  YAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
               A E QVP+ID+  F SGD  A  E  +LV EAC++HGFFLVVNHGVD  L++D  + M
Sbjct  68    VNAPELQVPLIDLGDFLSGDSAAAKEASRLVGEACQQHGFFLVVNHGVDATLVADAHKYM  127

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             D +FELPLS K++A RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAEK  S +VE+Y 
Sbjct  128   DNFFELPLSEKQRAHRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEKNSSRMVEDYL  187

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
                +G EF   G +YQ YC AM+ L+L I ELL + LGV R HF EF++ENDS++RLNYY
Sbjct  188   VNKMGDEFRQFGRVYQDYCEAMSKLSLGIMELLAISLGVGRAHFREFFEENDSIMRLNYY  247

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P   AFVVNIGDTFMA
Sbjct  248   PPCQKPDLTLGTGPHCDPTSLTILHQDRVGGLQVFVDNEWRSISPNFEAFVVNIGDTFMA  307

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVN+  PRKS+AFFLCP  DKVVTPP ELVDA  P++YPDF WP LL
Sbjct  308   LSNGRYKSCLHRAVVNSHTPRKSLAFFLCPKGDKVVTPPTELVDAYSPRIYPDFTWPMLL  367

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQT  224
             E+TQ HYR+D +TL  F+ W+QQ  +
Sbjct  368   EFTQKHYRADMNTLEVFSNWVQQRNS  393



>gb|AFS33151.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33156.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33167.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 301/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33161.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33172.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>dbj|BAC82104.1| gibberellin 20-oxidase [Populus alba]
 dbj|BAC82105.1| gibberellin 20-oxidase [Populus alba]
 gb|AFS33157.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33179.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33180.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33181.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33163.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33158.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33165.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33159.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33176.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AAR83346.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AAT02537.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ +LRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQILRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN + PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNGQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_007038526.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY23027.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
Length=437

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 297/386 (77%), Gaps = 1/386 (0%)
 Frame = -3

Query  1381  SLSFHTMAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGP  1202
             + + H MAI+C+    +  H  ++  N     +VFD SVL+++SNIP EF+WPD EKP  
Sbjct  53    TFTLHAMAIDCVSNLASMPHHPKDERNDEQKQLVFDVSVLKYDSNIPKEFIWPDDEKPC-  111

Query  1201  YAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
               A E QVP+ID+  F SGD  A  E  +LV EAC++HGFFLVVNHGVD  L++D  + M
Sbjct  112   VNAPELQVPLIDLGDFLSGDSAAAKEASRLVGEACQQHGFFLVVNHGVDATLVADAHKYM  171

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             D +FELPLS K++A RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAEK  S +VE+Y 
Sbjct  172   DNFFELPLSEKQRAHRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEKNSSRMVEDYL  231

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
                +G EF   G +YQ YC AM+ L+L I ELL + LGV R HF EF++ENDS++RLNYY
Sbjct  232   VNKMGDEFRQFGRVYQDYCEAMSKLSLGIMELLAISLGVGRAHFREFFEENDSIMRLNYY  291

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P   AFVVNIGDTFMA
Sbjct  292   PPCQKPDLTLGTGPHCDPTSLTILHQDRVGGLQVFVDNEWRSISPNFEAFVVNIGDTFMA  351

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVN+  PRKS+AFFLCP  DKVVTPP ELVDA  P++YPDF WP LL
Sbjct  352   LSNGRYKSCLHRAVVNSHTPRKSLAFFLCPKGDKVVTPPTELVDAYSPRIYPDFTWPMLL  411

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQT  224
             E+TQ HYR+D +TL  F+ W+QQ  +
Sbjct  412   EFTQKHYRADMNTLEVFSNWVQQRNS  437



>dbj|BAA37128.1| gibberellin 20-oxidase [Lactuca sativa]
Length=369

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/369 (64%), Positives = 294/369 (80%), Gaps = 1/369 (0%)
 Frame = -3

Query  1330  PNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFR  1151
             P+  ++ I  +P   +VFDS +L+HE+NIP +F+WPDHEKP    A+E  VP++D+  F 
Sbjct  2     PSLHKEHINAQPKP-LVFDSLILQHETNIPEQFIWPDHEKPNSQKAKELAVPLVDLRGFL  60

Query  1150  SGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRK  971
             SG   +  E   +V EACKKHGFFLV NHGVD  L+ D  R MD +FELP   K++  RK
Sbjct  61    SGRASSAKEASVVVGEACKKHGFFLVTNHGVDASLIVDAHRYMDLFFELPFLDKQRVQRK  120

Query  970   LGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQK  791
             +GE CGYASSFTGRF++KLPWKETLSF+FS EK+ S +VEEYFEKT+G+EFA LG++YQ+
Sbjct  121   IGESCGYASSFTGRFSSKLPWKETLSFQFSGEKKSSKIVEEYFEKTMGKEFARLGKVYQE  180

Query  790   YCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCD  611
             YCNAM+ L+L I ELLGM LGV++ HF EF++ENDS++RLNYYPPCQKP+LTLGTGPHCD
Sbjct  181   YCNAMSRLSLGIMELLGMSLGVEQSHFKEFFKENDSIMRLNYYPPCQKPDLTLGTGPHCD  240

Query  610   PTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNN  431
             PTSLTILHQD+V GL+VF+DNEWR++ P  N FVVNIGDTFMALSNG Y+SC+HRAVVNN
Sbjct  241   PTSLTILHQDTVGGLEVFIDNEWRSIAPNLNTFVVNIGDTFMALSNGQYRSCLHRAVVNN  300

Query  430   EIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNF  251
             +I RKS+AFFLCP KDKVV+PP ELVD  +P++YPDF W   LE+TQ HYR+D +TL  F
Sbjct  301   KIHRKSLAFFLCPKKDKVVSPPDELVDEKNPRIYPDFTWSTFLEFTQKHYRADMNTLQAF  360

Query  250   ATWLQQNQT  224
               W+QQ  +
Sbjct  361   TNWIQQKNS  369



>gb|AFS33170.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33171.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPQHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59116.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59117.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKSMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+ PLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKFPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AFS33166.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33175.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFVWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|KDP22353.1| hypothetical protein JCGZ_26184 [Jatropha curcas]
 gb|AIC83904.1| gibberellin 20 oxidase [Jatropha curcas]
Length=376

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/379 (64%), Positives = 301/379 (79%), Gaps = 6/379 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MA++C+     P H +++ +NKP   +VFD+SVLR++SN+P +F+WPDHEKP   A  E 
Sbjct  1     MAVDCI--KTMPQHHQEDDQNKP---LVFDASVLRYKSNVPQQFIWPDHEKPTANAP-EL  54

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP ID+  F SGDPVA  E  KLV EACKKHGFFLVVNHGV+ +L+ D  R MD +FEL
Sbjct  55    PVPHIDLGGFLSGDPVAAMEASKLVGEACKKHGFFLVVNHGVNQKLIQDAHRYMDSFFEL  114

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL  K+KA RK+GEHCGYASSFTGRF++KLPWKET+S R+SA+     +V+ Y   T+G+
Sbjct  115   PLCEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETVSVRYSADNNSPKLVQHYLRNTMGE  174

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F++ G +YQ+YC AM+TL+L I ELLGM LGV R+HF EF++ENDS++RLNYYP CQKP
Sbjct  175   TFSEFGRVYQEYCEAMSTLSLGIMELLGMSLGVSREHFREFFEENDSIMRLNYYPQCQKP  234

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQVFVDN+WR+++P   AFVVNIGDTFMALSNG Y
Sbjct  235   DLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNQWRSISPNFQAFVVNIGDTFMALSNGRY  294

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP  D++V+PP ELVD ++P++YPDF WP LLE+TQ H
Sbjct  295   KSCLHRAVVNSKKPRKSLAFFLCPKSDRIVSPPSELVDDSNPRIYPDFTWPMLLEFTQKH  354

Query  283   YRSDTDTLLNFATWLQQNQ  227
             YR+D  TL  F  W+QQ Q
Sbjct  355   YRADMKTLEMFTNWVQQLQ  373



>ref|NP_001234628.1| gibberellin 20-oxidase-2 [Solanum lycopersicum]
 gb|AAD15754.1| gibberellin 20-oxidase-2 [Solanum lycopersicum]
Length=372

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/380 (63%), Positives = 303/380 (80%), Gaps = 10/380 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+CM+  P    E++        +++FDSSVL++ESNIP +F+WPDHEKP  +   E 
Sbjct  1     MAIDCMV-MPMIQDEKK--------SLIFDSSVLKNESNIPRQFIWPDHEKPSGFVG-EL  50

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP+ID+ AF SGDP+A      LVDEACKKHGFFLV NHGVDT L+S   R MD +FEL
Sbjct  51    DVPLIDLGAFLSGDPIAAKRESSLVDEACKKHGFFLVANHGVDTNLISLAHRYMDMFFEL  110

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K+K  RK G+HCGYASSFT RF++KLPWKETLSF +S  +  SH++++YF KT+G+
Sbjct  111   PLSDKQKIQRKRGDHCGYASSFTERFSSKLPWKETLSFPYSTLQGSSHMLDQYFLKTMGE  170

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             +F+ +G+ YQ+YCNAM+TL+  I ELLG  LGV + HF +F++EN+S++RLNYYP C KP
Sbjct  171   DFSHIGKFYQEYCNAMSTLSSGIMELLGESLGVSKNHFKQFFEENESIMRLNYYPTCLKP  230

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +L LGTGPHCDPTSLTILHQD+VSGLQVF+DN+WR+++P  +AFVVNIGDTFMALSNG Y
Sbjct  231   DLALGTGPHCDPTSLTILHQDNVSGLQVFMDNQWRSISPNNSAFVVNIGDTFMALSNGRY  290

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP KDKVV PP ELVD+ +P++YPDF WP L E+TQ H
Sbjct  291   KSCLHRAVVNNKTPRKSLAFFLCPKKDKVVRPPAELVDSNNPRIYPDFTWPTLFEFTQKH  350

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+DT+TL  F+TWLQQ  T
Sbjct  351   YRADTNTLRFFSTWLQQKTT  370



>ref|XP_011041655.1| PREDICTED: gibberellin 20 oxidase 1-like [Populus euphratica]
Length=385

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+P A  E  +LV EAC+KHGFFLVVNHGVD  L++     MD
Sbjct  60    NAPELQVPLVDLGDFLSGNPAAAVEASRLVGEACQKHGFFLVVNHGVDKTLIAHAHNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR++AEK  S  +EEYF 
Sbjct  120   TFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYTAEKNSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G+ FA+ G +YQ YC AM+TL+L I ELLG+ LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEPFAEFGRVYQDYCEAMSTLSLGIMELLGLSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSISPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAQ43617.1| gibberellin 20-oxidase [Helianthus annuus]
 emb|CAQ51273.1| putative gibberellin 20-oxidase [Helianthus annuus]
Length=379

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/380 (63%), Positives = 297/380 (78%), Gaps = 3/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+I  P       E +     ++VFD+ VL+HE+N+P +F+WPDHEKP    ++E 
Sbjct  1     MAIDCIIQNPPTMPSLIEHQQ---TSLVFDALVLQHETNMPQQFIWPDHEKPNSQKSKEL  57

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP +D+  F SG   +V E C+LV EAC+ HGFFLVVNHGVD  L+SD  R MD +FEL
Sbjct  58    DVPTLDLGGFLSGHSGSVKEACRLVGEACENHGFFLVVNHGVDASLISDAQRYMDLFFEL  117

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K +A RK+GE CGYASSFT RF++KLPWKETLSF FSAE+    +VEEYF+  +G+
Sbjct  118   PLSKKLRAQRKVGESCGYASSFTERFSSKLPWKETLSFHFSAEENSYDIVEEYFKSRMGE  177

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF  LG++YQ YCNAM+ L+L I ELLGM LGV R HF EF+++N+S++RLNYYPPCQKP
Sbjct  178   EFVQLGKVYQDYCNAMSRLSLGIMELLGMSLGVSRSHFKEFFKDNNSIMRLNYYPPCQKP  237

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD VSGL+VFV+NEWR++ P  NAFVVNIGDTFMALSNG Y
Sbjct  238   DLTLGTGPHCDPTSLTILHQDKVSGLEVFVENEWRSIAPDSNAFVVNIGDTFMALSNGRY  297

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVNN+ PRKS+AFFLCP +DKVV+PP ELVD  +P++YPDF W   LE+TQ H
Sbjct  298   KSCLHRAVVNNKSPRKSLAFFLCPKRDKVVSPPEELVDENNPRVYPDFTWSTFLEFTQKH  357

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+ W+QQ  +
Sbjct  358   YRADMNTLQAFSNWVQQKTS  377



>emb|CAH59132.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   524 bits (1350),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYQAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAC00709.1| gibberellin 20-oxidase [Populus tremula x Populus tremuloides]
 emb|CAH59122.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59133.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59139.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   524 bits (1350),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_006421808.1| hypothetical protein CICLE_v10005157mg [Citrus clementina]
 gb|ESR35048.1| hypothetical protein CICLE_v10005157mg [Citrus clementina]
Length=383

 Score =   524 bits (1349),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 299/383 (78%), Gaps = 3/383 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+   PT  H+ +E        +VFD+SVL+H++ IP +F+WPD EKP    A E 
Sbjct  1     MAIDCIKNIPTMLHQPKEDYKDEQKPLVFDASVLKHQTQIPKQFIWPDDEKPC-VNAPEL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F S DPVA  E  +LV EAC+KHGFFLVVNHGVD+ L++D  R MD +FEL
Sbjct  60    QVPLIDLGGFLSDDPVAAKEASRLVGEACRKHGFFLVVNHGVDSSLIADAHRYMDHFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSH-VVEEYFEKTLG  827
             PL+ K++A RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAEK  S+ +VE+Y   T+G
Sbjct  120   PLNEKQRARRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEKSLSNNIVEDYLLNTMG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
              EF   G +YQ YC +M+ L+L I ELL + LGVDR HF EF++ENDS++RLNYYPPCQK
Sbjct  180   DEFKQFGRVYQDYCESMSRLSLGIMELLAISLGVDRAHFKEFFEENDSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PELTLGTGPHCDPTSLTILHQD V GLQVFV+NEWR+++P   AFVVNIGDTFMALSNG 
Sbjct  240   PELTLGTGPHCDPTSLTILHQDQVGGLQVFVENEWRSISPNFEAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA-THPKLYPDFKWPALLEYTQ  290
             YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD  + P++YPDF WP LLE+TQ
Sbjct  300   YKSCLHRAVVNSQTTRKSLAFFLCPKNDKVVSPPSELVDTYSSPRIYPDFTWPMLLEFTQ  359

Query  289   LHYRSDTDTLLNFATWLQQNQTL  221
              HYR+D  TL  F  WLQQ + L
Sbjct  360   KHYRADMKTLEVFTNWLQQKKQL  382



>gb|AFS33149.1| gibberellin 20-oxidase [Populus tomentosa]
 gb|AFS33154.1| gibberellin 20-oxidase [Populus tomentosa]
Length=385

 Score =   524 bits (1349),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPNTN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  61    AP-ELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEESSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQV VDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVLVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+Y+SC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYRSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59102.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59104.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   524 bits (1349),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_006490288.1| PREDICTED: gibberellin 20 oxidase 1-like [Citrus sinensis]
 gb|KDO60170.1| hypothetical protein CISIN_1g016776mg [Citrus sinensis]
Length=383

 Score =   524 bits (1349),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 299/383 (78%), Gaps = 3/383 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+   PT  H+ +E        +VFD+SVL+H++ IP +F+WPD EKP    A E 
Sbjct  1     MAIDCIKNIPTMLHQPKEEYKDEQKPLVFDASVLKHQTQIPKQFIWPDDEKPC-VNAPEL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F S DPVA  E  +LV EAC+KHGFFLVVNHGVD+ L++D  R MD +FEL
Sbjct  60    QVPLIDLGGFLSDDPVAAKEASRLVGEACRKHGFFLVVNHGVDSSLIADAHRYMDHFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSH-VVEEYFEKTLG  827
             PL+ K++A RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAEK  S+ +VE+Y   T+G
Sbjct  120   PLNEKQRARRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEKSLSNNIVEDYLLNTMG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
              EF   G +YQ YC +M+ L+L I ELL + LGVDR HF EF++ENDS++RLNYYPPCQK
Sbjct  180   DEFKQFGRVYQDYCESMSRLSLGIMELLAISLGVDRAHFKEFFEENDSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PELTLGTGPHCDPTSLTILHQD V GLQVFV+NEWR+++P   AFVVNIGDTFMALSNG 
Sbjct  240   PELTLGTGPHCDPTSLTILHQDQVGGLQVFVENEWRSISPNFEAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA-THPKLYPDFKWPALLEYTQ  290
             YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD  + P++YPDF WP LLE+TQ
Sbjct  300   YKSCLHRAVVNSQTTRKSLAFFLCPKNDKVVSPPSELVDTYSSPRIYPDFTWPMLLEFTQ  359

Query  289   LHYRSDTDTLLNFATWLQQNQTL  221
              HYR+D  TL  F  WLQQ + L
Sbjct  360   KHYRADMKTLEVFTNWLQQKKQL  382



>emb|CAH59135.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   524 bits (1349),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59140.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59141.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   524 bits (1349),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGVYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59115.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   523 bits (1348),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKDDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAB96202.1| gibberellin 20-oxidase [Citrus sinensis x Citrus trifoliata]
 gb|ACJ54435.1| gibberellin 20-oxidase 1 [Citrus sinensis x Citrus trifoliata]
Length=383

 Score =   523 bits (1347),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 298/383 (78%), Gaps = 3/383 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+   PT  H+ +E        +VFD+SVL+H++ IP +F+WPD EKP    A E 
Sbjct  1     MAIDCIKNIPTMLHQPKEEYKDEQKPLVFDASVLKHQTQIPKQFIWPDDEKPC-VNAPEL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F S DPVA  E  +LV EAC+KHGFFLVVNHGVD+ L++D  R MD +FEL
Sbjct  60    QVPLIDLGGFLSDDPVAAKEASRLVGEACRKHGFFLVVNHGVDSSLIADAHRYMDHFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSH-VVEEYFEKTLG  827
             PL+ K++A RKLGEHCGYASSFTGRF++KLPWKETLSFR+SAEK  S+ +VE+Y   T+G
Sbjct  120   PLNEKQRARRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSAEKSLSNNIVEDYLLNTMG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
              EF   G +YQ YC +M+ L+L I ELL + LGV R HF EF++ENDS++RLNYYPPCQK
Sbjct  180   DEFKQFGRVYQDYCESMSRLSLGIMELLAISLGVGRAHFKEFFEENDSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PELTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P   AFVVNIGDTFMALSNG 
Sbjct  240   PELTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSISPNFEAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA-THPKLYPDFKWPALLEYTQ  290
             YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD  + P++YPDF WP LLE+TQ
Sbjct  300   YKSCLHRAVVNSQTTRKSLAFFLCPKNDKVVSPPSELVDTYSSPRIYPDFTWPMLLEFTQ  359

Query  289   LHYRSDTDTLLNFATWLQQNQTL  221
              HYR+D  TL  F  WLQQ + L
Sbjct  360   KHYRADMKTLEAFTNWLQQKKQL  382



>gb|ADG28675.2| gibberellin 20-oxidase 3 [Ipomoea nil]
Length=372

 Score =   523 bits (1346),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 239/350 (68%), Positives = 291/350 (83%), Gaps = 1/350 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYA-AREFQVPVIDMAAFRSGDPVAVAETCKLV  1109
             ++FD+SV +H+ NIPT+F+WPDHEKP   A A +  VP+ID+A F SGDP A  +  +LV
Sbjct  14    LIFDASVPQHDPNIPTQFIWPDHEKPAADADAPQLAVPLIDLAGFLSGDPAAALQASRLV  73

Query  1108  DEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGR  929
              EACKKHGFFLV NHGVD  L+S   R MD +F+LPLS K+KA RK GEHCGYASSFTGR
Sbjct  74    GEACKKHGFFLVANHGVDATLISHAHRYMDHFFQLPLSDKQKAERKAGEHCGYASSFTGR  133

Query  928   FNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             F++KLPWKE LSF FSA+K    +V +YF+ TLGQ+FA +G++YQ+YCNAM+ L+L I E
Sbjct  134   FSSKLPWKEILSFSFSADKTSHDIVVDYFQTTLGQDFAHIGKIYQEYCNAMSNLSLGIME  193

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLGM LGV  KHF EFYQEN+S++RLNYYPPC+KPELTLGTGPHCDPTSLTILHQD+V G
Sbjct  194   LLGMSLGVSEKHFREFYQENESIMRLNYYPPCRKPELTLGTGPHCDPTSLTILHQDTVGG  253

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQVFVDN+WR++ P  NAFVVNIG+T MALSNG YKSC+HRAVVN++ PRKS+AFFLCP 
Sbjct  254   LQVFVDNQWRSIPPNFNAFVVNIGETLMALSNGKYKSCLHRAVVNSKSPRKSLAFFLCPK  313

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             KDKVV PP ELVD+++P++YPDF WP LLE+TQ HYR+D +TL +F+TWL
Sbjct  314   KDKVVRPPNELVDSSNPRVYPDFTWPTLLEFTQKHYRADMNTLQSFSTWL  363



>emb|CAH59134.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   523 bits (1346),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDHEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGEPCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59123.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   522 bits (1345),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CG+ASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGHASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59100.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   522 bits (1344),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+  S  +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSSKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC A++TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAISTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK++TPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMITPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|ACM68923.1| gibberellin 20-oxidase [Gossypium hirsutum]
Length=379

 Score =   521 bits (1342),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 239/380 (63%), Positives = 297/380 (78%), Gaps = 1/380 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+   P+  H  ++ + +    +VFD+SVL+++ +IP +F+WPDHEKP    A E 
Sbjct  1     MAIDCVSKIPSMPHHPKDEKREEQKQLVFDASVLKYQPDIPKQFIWPDHEKPN-VNAPEL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP ID+  F SGDPV+  E  +LV EAC++HGFFLVVNHGVD  L++D    M  + EL
Sbjct  60    QVPFIDLGGFLSGDPVSAMEASRLVGEACRQHGFFLVVNHGVDATLVADAHSYMGNFLEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL+ K++A RKLGEHCGYASSFTGRF++KLPWKETLSFR+SA+K+ S +VE+Y +  LG 
Sbjct  120   PLNDKQRAQRKLGEHCGYASSFTGRFSSKLPWKETLSFRYSADKKSSKIVEDYLDGKLGD  179

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF   G +YQ YC AM+ L+L I ELL + LGV R HF EF++EN+S++RLNYYPPCQKP
Sbjct  180   EFKHFGRVYQDYCEAMSKLSLGIMELLAISLGVGRSHFREFFEENESIMRLNYYPPCQKP  239

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P   AFVVNIGDTFMALSNG Y
Sbjct  240   DLTLGTGPHCDPTSLTILHQDRVGGLQVFVDNEWRSISPNVEAFVVNIGDTFMALSNGRY  299

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN  IPRKS+AFFLCP  DKVV PP ELVDA +P++YPDF WP LLE+TQ H
Sbjct  300   KSCLHRAVVNRHIPRKSLAFFLCPKGDKVVAPPTELVDAYNPRVYPDFTWPMLLEFTQKH  359

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+ W+QQ  +
Sbjct  360   YRADMNTLEVFSNWVQQRNS  379



>emb|CAH59118.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59119.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59126.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   521 bits (1343),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYQAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59108.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59127.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59130.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   521 bits (1342),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59131.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   521 bits (1342),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYQAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>dbj|BAG48319.1| gibberellin 20-oxidase2 [Chrysanthemum x morifolium]
Length=376

 Score =   521 bits (1341),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 234/354 (66%), Positives = 285/354 (81%), Gaps = 0/354 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFDS +L+HE+NIP +F+WPDHEKP     +E  VP++D+  F SG P +  E   +V 
Sbjct  23    LVFDSLILQHETNIPQQFIWPDHEKPNLQKTKELVVPLVDLGGFLSGRPSSAKEASLVVG  82

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             +ACKKHGFFLV NHGVD  L++D  R MD +FELPLS K++A RKLGE CGYASSFTGRF
Sbjct  83    DACKKHGFFLVTNHGVDASLIADAHRYMDLFFELPLSDKQRAQRKLGESCGYASSFTGRF  142

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
              +KLPWKETLSF+FS EK  ++ V++YFE TLG+EF  LG++YQ+YCNAM+ L+L I EL
Sbjct  143   TSKLPWKETLSFQFSGEKSSANGVKDYFENTLGKEFTRLGKVYQEYCNAMSRLSLGIMEL  202

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LGM LGV R HF EF++ENDS++RLNYYP CQKP+ TLGTGPHCDPTSLTILHQDSV GL
Sbjct  203   LGMSLGVHRAHFKEFFEENDSIMRLNYYPRCQKPDQTLGTGPHCDPTSLTILHQDSVGGL  262

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             +VF+DNEWR++ P  NAFVVNIGDTFMALSNG YKSC+HRAVVNN I RKS+AFFLCP K
Sbjct  263   EVFIDNEWRSIAPNSNAFVVNIGDTFMALSNGRYKSCLHRAVVNNRIHRKSLAFFLCPKK  322

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQT  224
             DKVV+PP ELVD  +P++YPDF W   LE+TQ HYR+D +TL  F+ W+QQ  +
Sbjct  323   DKVVSPPDELVDENNPRIYPDFTWSTFLEFTQKHYRADMNTLQAFSNWIQQKNS  376



>emb|CAH59097.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59106.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59109.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59111.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59124.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59125.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59136.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59137.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   521 bits (1342),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59142.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59143.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   521 bits (1342),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFR  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59098.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   521 bits (1342),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYQAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQEHYRADMKTLEVFTNWLHQ  381



>ref|XP_006357721.1| PREDICTED: gibberellin 20 oxidase 1-like [Solanum tuberosum]
Length=373

 Score =   520 bits (1340),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 237/360 (66%), Positives = 298/360 (83%), Gaps = 4/360 (1%)
 Frame = -3

Query  1306  ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVA  1127
             E KP   ++FD+S +++ESNIPT+++WPD EKP    A+E  VP+ID+  F SGDPVA  
Sbjct  17    EEKP---LIFDASHMKNESNIPTQYIWPDDEKPC-VVAQELHVPLIDLRGFFSGDPVATQ  72

Query  1126  ETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYA  947
             +  +LV EAC+ HGFFLVVNH VD+ L+S   R MD +F++PLS K+KA RK+GEHCGYA
Sbjct  73    QASRLVGEACRSHGFFLVVNHRVDSNLISKAHRYMDTFFDMPLSEKQKAQRKIGEHCGYA  132

Query  946   SSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTL  767
             SSFTGRF++KLPWKETLS R++A++  SH+VEEYF++TLG+ F +LG +YQ+YCN+MNTL
Sbjct  133   SSFTGRFSSKLPWKETLSLRYTAKENSSHIVEEYFQRTLGESFNNLGNVYQEYCNSMNTL  192

Query  766   ALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILH  587
             +L I ELLG+ LGV + HF EF+++N+S++RLNYYPPC KPELTLGTGPH DPTSLT+LH
Sbjct  193   SLRIMELLGISLGVQKSHFKEFFEDNESIMRLNYYPPCLKPELTLGTGPHYDPTSLTVLH  252

Query  586   QDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIA  407
             QD VSGLQVFVDNEW ++ P  NAFVVNIGDTFMALSNG YKSC+HRAVVNN  PRKS+A
Sbjct  253   QDCVSGLQVFVDNEWYSICPNFNAFVVNIGDTFMALSNGRYKSCLHRAVVNNTTPRKSLA  312

Query  406   FFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             FFLCP KDKVV+PP +LVD  +P+LYPDF WPALLE+TQ H+R++T+TL  F+ WLQ+N 
Sbjct  313   FFLCPDKDKVVSPPTKLVDYNNPRLYPDFTWPALLEFTQKHHRAETNTLQAFSMWLQENN  372



>emb|CAC13036.1| Ga20 oxidase [Solanum tuberosum subsp. andigenum]
Length=378

 Score =   520 bits (1338),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 242/379 (64%), Positives = 299/379 (79%), Gaps = 13/379 (3%)
 Frame = -3

Query  1363  MAIECMI---PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CMI    +P  +  +Q          +FD+S ++ ESNIPT+F+WPDHEKP     
Sbjct  1     MAIDCMITNAKSPMIDETKQ---------FIFDASHMKRESNIPTQFIWPDHEKPCA-VV  50

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
             +E  VP+ID+  F SGD  A  +  KLV EAC+ HGFFLVVNHGVD  L+S+  R MD +
Sbjct  51    QELHVPLIDLRGFLSGDSDAAQQASKLVGEACRSHGFFLVVNHGVDANLISNAHRYMDTF  110

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             F+LPL  K+KA RK+GEHCGYASSFTGRF++KLPWKETLSFR+SAE+E SH+VE+ F+  
Sbjct  111   FDLPLLEKQKAQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSAEEESSHIVEDIFKGH  170

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
               +    LG +YQ+YCN+ NTL+L I ELLGM LGV++ HF EF++ENDS++RLNYYPPC
Sbjct  171   WVKILTILGNVYQEYCNSKNTLSLGIMELLGMSLGVEKSHFKEFFEENDSIMRLNYYPPC  230

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKPELTLGTGPHCDPTSLTILHQD V GLQVFVD+EWR+++P  NAFVVNIGDTFMALSN
Sbjct  231   QKPELTLGTGPHCDPTSLTILHQDCVGGLQVFVDDEWRSISPNFNAFVVNIGDTFMALSN  290

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVNN+ PRKS+AFFLCP+KDKVV+PP ELVD+ +P++YPDF WP LLE+T
Sbjct  291   GRYKSCLHRAVVNNKTPRKSLAFFLCPNKDKVVSPPNELVDSNNPRIYPDFTWPTLLEFT  350

Query  292   QLHYRSDTDTLLNFATWLQ  236
             Q HYR+D +TL  F+ W+ 
Sbjct  351   QKHYRADMNTLQTFSNWVH  369



>emb|CAH59128.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59129.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   520 bits (1338),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 299/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ E+DS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNEDDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_010035059.1| PREDICTED: gibberellin 20 oxidase 1 [Eucalyptus grandis]
 gb|KCW46322.1| hypothetical protein EUGRSUZ_K00184 [Eucalyptus grandis]
Length=385

 Score =   519 bits (1337),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 243/384 (63%), Positives = 298/384 (78%), Gaps = 7/384 (2%)
 Frame = -3

Query  1363  MAIECMI----PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MA++C+     P   P H+ +  E+K    +VFD+SV+RH+ +IP +F+WPD EKP   A
Sbjct  1     MAVDCLTSKTSPAMPPQHKDEAREDK--KHLVFDASVIRHQPDIPKQFIWPDEEKPCANA  58

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               +  VP+ID+  F S DP A  E  +LV +AC+KHGFFLVVNHGVD  L+SD  + MD+
Sbjct  59    P-DLAVPLIDLDGFLSKDPSASEEASRLVGDACQKHGFFLVVNHGVDAGLISDAHKYMDK  117

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F LPLS K++A RKLGEHCGYASSFTGRF++KLPWKETLSF +SAEK  ++VVE+YF+ 
Sbjct  118   FFGLPLSEKQRAQRKLGEHCGYASSFTGRFSSKLPWKETLSFGYSAEKSSANVVEDYFKN  177

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             T+G+EF   G +YQ YC AM+ L+L I ELLGM LG+ R HF EF++ NDS++RLNYYPP
Sbjct  178   TMGEEFEQSGRVYQDYCEAMSRLSLGIMELLGMSLGIGRDHFREFFESNDSIMRLNYYPP  237

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P  NAFVVNIGDTFMALS
Sbjct  238   CQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSISPNFNAFVVNIGDTFMALS  297

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NGLYKSC+HRAVVN+  PRKS+AFFLCP  DKVV PP ELV  + P+ YPDF WP LLE+
Sbjct  298   NGLYKSCLHRAVVNSRTPRKSLAFFLCPRSDKVVRPPSELVAMSCPRAYPDFTWPVLLEF  357

Query  295   TQLHYRSDTDTLLNFATWLQQNQT  224
             TQ HYR+D +TL  F  WLQQ  +
Sbjct  358   TQKHYRADMNTLRAFTNWLQQRTS  381



>emb|CAH59114.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   519 bits (1336),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 298/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+T +L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTSSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPENDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59120.1| gibberellin 20-oxidase [Populus tremula]
 emb|CAH59121.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   518 bits (1335),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 242/382 (63%), Positives = 298/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPT---PNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             M I+C+   P+   P+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MTIDCIKTMPSITAPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>emb|CAH59112.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   518 bits (1335),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 298/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL     WL Q
Sbjct  360   FTQKHYRADMKTLEVSTNWLHQ  381



>emb|CAH59113.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   518 bits (1334),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 298/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD   ++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTPIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>gb|AEW67997.1| gibberellin 20 oxidase 1 [Castanea mollissima]
Length=379

 Score =   518 bits (1333),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 238/380 (63%), Positives = 294/380 (77%), Gaps = 1/380 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAIEC+   P+     +E  N+    +VFD+SV +H+ +IP +F+WPD EKP   A  E 
Sbjct  1     MAIECITNIPSMPLPPKEEHNEQQKQLVFDASVFKHQQHIPEQFIWPDEEKPCANAP-EL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F SGDP A  E  +LV +AC KHGFFLVVNHGVD +L++D  + MD +FEL
Sbjct  60    QVPLIDLKGFLSGDPTAAMEASRLVGKACAKHGFFLVVNHGVDDKLIADAHQYMDHFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             P+  K++A RK+GEHCGYASSFTGRF+ KLPWKETLSFR+SA+   S +V +Y   T+G+
Sbjct  120   PMLAKQRAQRKVGEHCGYASSFTGRFSNKLPWKETLSFRYSAQPNSSDIVRDYLSNTMGE  179

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             +F   G +YQ YC AM+TL+L I ELLGM LGV R H+ E+++ENDS++RLNYYPPCQKP
Sbjct  180   DFKPFGRVYQDYCEAMSTLSLGIMELLGMSLGVSRAHYREYFEENDSIMRLNYYPPCQKP  239

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQVFVD EWR+++P  NAFVVNIGDTFMALSNG Y
Sbjct  240   DLTLGTGPHCDPTSLTILHQDQVGGLQVFVDEEWRSISPNFNAFVVNIGDTFMALSNGRY  299

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP  DKVV+PP ELVD   P++YPDF WP LLE+TQ H
Sbjct  300   KSCLHRAVVNSKTPRKSLAFFLCPKNDKVVSPPSELVDTLCPRVYPDFTWPMLLEFTQKH  359

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D  TL  F+ WLQQ  +
Sbjct  360   YRADMKTLEVFSNWLQQKNS  379



>emb|CAH59138.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   518 bits (1333),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 297/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFRYKAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNYYP
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+L LGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTFMAL
Sbjct  240   PCQKPDLPLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD   P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCDPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_002318263.1| gibberellin 20-oxidase family protein [Populus trichocarpa]
 gb|EEE96483.1| gibberellin 20-oxidase family protein [Populus trichocarpa]
Length=385

 Score =   517 bits (1332),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 240/382 (63%), Positives = 300/382 (79%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECM--IPTPTPNHERQEIENK---PAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+  +P+ T +H   + +++      ++VFD+ VLR++S+IP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSKTTHHHHPKDQDQCKDDNKSLVFDAQVLRYQSSIPQQFIWPDHEKPSAN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A +  QVP+ID+  F SG+P A  E  +LV EAC+KHGFFLVVNHGVD  L++  +  MD
Sbjct  61    APK-LQVPLIDLGDFLSGNPDAAMEASRLVGEACQKHGFFLVVNHGVDKTLIAHALNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSF ++AEK  S  +E+YF 
Sbjct  120   NFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFSYTAEKNSSKHIEQYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA  G +YQ YC AM+TL+L I ELLGM LGV R HF E+++ENDS++RLNYYP
Sbjct  180   DRMGEDFAKFGRVYQDYCEAMSTLSLGIMELLGMSLGVSRAHFREYFEENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKPELTLGTGPHCDPTSLTILHQD V GLQV+VDNEW +++P  +AFVVNIGDTFMAL
Sbjct  240   PCQKPELTLGTGPHCDPTSLTILHQDQVGGLQVYVDNEWCSISPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG YKSC+HRAVVN++ PRKS+AFFLCP  DK VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGRYKSCLHRAVVNSQTPRKSLAFFLCPRNDKKVTPPKELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WLQQ
Sbjct  360   FTQKHYRADMKTLEMFTNWLQQ  381



>ref|XP_009618395.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Nicotiana tomentosiformis]
Length=382

 Score =   515 bits (1327),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 239/380 (63%), Positives = 295/380 (78%), Gaps = 6/380 (2%)
 Frame = -3

Query  1363  MAIECMI---PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI CM+    +PT    ++        +++FDSS+L+HESNIPT+F+WPDHEKP    A
Sbjct  1     MAIGCMVTRSKSPTTQTSKEGFTEDEKMSLIFDSSMLKHESNIPTQFIWPDHEKPCAGTA  60

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  +P ID+ +F SGDPVA  +  +LVD AC+ HGFFLVVNHGVDT L+S   R MD +
Sbjct  61    PELHIPHIDLGSFLSGDPVAAKKASRLVDSACRNHGFFLVVNHGVDTNLISLAHRYMDMF  120

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             FELPLS K+KA RK GEHCGYASSFT RF++KLPWKETLSF +SA+     +VEEYF +T
Sbjct  121   FELPLSEKQKAQRKKGEHCGYASSFTERFSSKLPWKETLSFPYSAQ---GGIVEEYFLRT  177

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             +G  F  +G +YQ YC AM+TL+  I ELLG+ LGV R HF +F++EN+S++RLNYYP C
Sbjct  178   MGDNFCHVGNVYQDYCTAMSTLSSGIMELLGVSLGVKRNHFKQFFEENESIMRLNYYPTC  237

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
              KP+LTLGTGPHCDPTSLTILHQDS+ GLQVF DN+WR + P  ++FVVNIGDTFMALSN
Sbjct  238   LKPDLTLGTGPHCDPTSLTILHQDSIGGLQVFEDNKWRFITPNFSSFVVNIGDTFMALSN  297

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVNN+ PRKS+AFFLCP KDKVV+PP ELVD+ +P++YPDF W  LLE+T
Sbjct  298   GRYKSCLHRAVVNNKSPRKSLAFFLCPKKDKVVSPPAELVDSNNPRIYPDFTWATLLEFT  357

Query  292   QLHYRSDTDTLLNFATWLQQ  233
             Q HYR+D +TL  F+ WLQQ
Sbjct  358   QKHYRADMNTLQYFSNWLQQ  377



>emb|CAH59110.1| gibberellin 20-oxidase [Populus tremula]
Length=385

 Score =   515 bits (1327),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 242/382 (63%), Positives = 297/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP---TPNH--ERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P   TP+H  + Q+       + VFD+ VLRH++NIP +F+WPD+EKP   
Sbjct  1     MAIDCIKTMPSITTPHHHPKDQDQCKDDGKSFVFDAQVLRHQTNIPQQFIWPDNEKPN-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
              A E QVP++D+  F SG+PVA  E  +LV EACKKHGFFLVVNHGVD  L++     +D
Sbjct  60    NAPELQVPLVDLGDFLSGNPVAAVEASRLVGEACKKHGFFLVVNHGVDKTLIAHAHNYVD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F+LPLS K+KA RK+GE CGYASSFTGRF +KLPWKETLSFR+ AE+     +EEYF 
Sbjct  120   TFFKLPLSEKQKAQRKIGESCGYASSFTGRFPSKLPWKETLSFRYQAEENSPKHIEEYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++FA+ G +YQ YC AM+TL+L I ELLGM LGV R+HF EF+ ENDS++RLNY+P
Sbjct  180   NRMGEDFAEFGTVYQDYCEAMSTLSLGIMELLGMSLGVSREHFREFFNENDSIMRLNYHP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR++NP  +AFVVNIGDTF AL
Sbjct  240   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWRSINPNFDAFVVNIGDTFTAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  DK+VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKNDKMVTPPHELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WL Q
Sbjct  360   FTQKHYRADMKTLEVFTNWLHQ  381



>ref|XP_011094550.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Sesamum indicum]
Length=391

 Score =   515 bits (1327),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 299/385 (78%), Gaps = 4/385 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTP-NHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             M I CMI   +   H   + + +    ++FD+SV+ H+S+IP +F+WPD EKP P  + E
Sbjct  1     MTIPCMIKNQSSMTHHATKHKKQQEETLIFDASVILHQSHIPPDFIWPDDEKPQPNPS-E  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID+  F  GDP A A    LV +ACK HGFFLVVNHGVD  L+++  R MD +FE
Sbjct  60    LHVPLIDLTGFLVGDPAASARAANLVGQACKHHGFFLVVNHGVDASLIANAHRYMDDFFE  119

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
              PL  K++A RKLGEHCGYASSFTGRF++KLPWKETLSF +S EK  SH+VE+YF +TLG
Sbjct  120   QPLEKKQRAQRKLGEHCGYASSFTGRFSSKLPWKETLSFEYSEEKGSSHIVEDYFCRTLG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             ++FA+LG++YQ YC+AM+TL+  I ELL M LGV   HF+EF++EN+S++RLNYYPPCQK
Sbjct  180   EDFANLGKVYQDYCSAMSTLSTRIMELLSMSLGVAHTHFNEFFRENESIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+ TLGTGPHCDPTS+TILHQD+V GLQVFVD EW+++ P  NAFVVNIGDTFMALSNG 
Sbjct  240   PDETLGTGPHCDPTSVTILHQDNVGGLQVFVDKEWQSIPPNFNAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVN+  PRKS+AFFLCP KDKVV+PP ELVD+ HP+L PDF WP LLE+TQ 
Sbjct  300   YKSCLHRAVVNSRCPRKSLAFFLCPRKDKVVSPPHELVDSNHPRLCPDFTWPTLLEFTQK  359

Query  286   HYRSDTDTLLNFATWLQ--QNQTLH  218
             HYR+D +TL  F+ WLQ  Q QT H
Sbjct  360   HYRADMNTLQTFSHWLQKKQKQTSH  384



>gb|KHG26186.1| Gibberellin 20 oxidase 2 -like protein [Gossypium arboreum]
Length=379

 Score =   514 bits (1325),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 292/380 (77%), Gaps = 1/380 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+    +  H  ++ + +    +VFD+SVL+++ +IP +F+WPD EKP    A E 
Sbjct  1     MAIDCVSKISSMPHHPKDEKREEQKQLVFDASVLKYQPDIPKQFIWPDKEKPS-VNAPEL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP ID+  F SGDPV+  E  +LV EAC++HGFFLVVNHGVD  L++D    M  +FEL
Sbjct  60    QVPFIDLGGFLSGDPVSAMEASRLVGEACRQHGFFLVVNHGVDATLVADAHSYMGNFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             P + K++A RKLGEHCGYASSFTGRF +KLPWKETLSFR+SA+K  S +VE+Y    LG 
Sbjct  120   PFNDKQRAQRKLGEHCGYASSFTGRFTSKLPWKETLSFRYSADKNSSKIVEDYLVGKLGD  179

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF   G +YQ YC AM+ L+L I ELL + LGV R HF EF++EN+S++RLNYYPPCQKP
Sbjct  180   EFKHFGRVYQDYCEAMSKLSLGIMELLAISLGVGRSHFREFFEENESIMRLNYYPPCQKP  239

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQVFVDNEWR+++P   AFVVNIGDTFMALSNG Y
Sbjct  240   DLTLGTGPHCDPTSLTILHQDRVGGLQVFVDNEWRSISPNLEAFVVNIGDTFMALSNGRY  299

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN  IPRKS+AFFLCP  DKVV PP ELVDA +P++YPDF WP LLE+TQ H
Sbjct  300   KSCLHRAVVNRHIPRKSLAFFLCPKGDKVVAPPTELVDAYNPRVYPDFTWPMLLEFTQKH  359

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+ W+QQ  +
Sbjct  360   YRADMNTLEVFSNWVQQRNS  379



>emb|CAD21846.1| gibberellin 20-oxidase 1 [Fagus sylvatica]
Length=379

 Score =   514 bits (1323),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 298/380 (78%), Gaps = 1/380 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+C+    +  H  +E        +VFD+SVLRH++NIP +F+WPD EKP   A  E 
Sbjct  1     MAIDCITNITSMPHPPKEEHKDHQKQLVFDASVLRHQTNIPQQFIWPDEEKPRANAP-EL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F SGDP A  E   LV +AC+KHGFFLVVNHGVD +L++   + +D +FEL
Sbjct  60    QVPLIDLRGFLSGDPTAANEASSLVGKACQKHGFFLVVNHGVDDKLIAHAHQYIDYFFEL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             P+S K++A RK+GEHCGYASSFTGRF+ KLPWKETLSFR SA+ + S++V++Y   T+G+
Sbjct  120   PMSAKQRAQRKVGEHCGYASSFTGRFSFKLPWKETLSFRSSAQPDSSNIVQDYLCNTMGE  179

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             +F   G++YQ YC+AM+TL+L I ELLGM LGV + H+ EF++EN+S++RLNYYPPCQKP
Sbjct  180   DFKPFGKVYQDYCDAMSTLSLGIMELLGMSLGVSQGHYREFFEENESIMRLNYYPPCQKP  239

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQVFVD EWR++ P  NAFVVNIGDTFMALSNG Y
Sbjct  240   DLTLGTGPHCDPTSLTILHQDQVGGLQVFVDEEWRSITPNFNAFVVNIGDTFMALSNGRY  299

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP  DKVV+PP ELVD+  P++YPDF WP LLE+TQ H
Sbjct  300   KSCLHRAVVNSKTPRKSLAFFLCPKNDKVVSPPSELVDSLCPRVYPDFTWPMLLEFTQKH  359

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D  TL  F+ WLQQ  +
Sbjct  360   YRADVKTLEVFSNWLQQKNS  379



>ref|XP_007152362.1| hypothetical protein PHAVU_004G123600g [Phaseolus vulgaris]
 gb|AAC49756.1| gibberellin 20-oxidase [Phaseolus vulgaris]
 gb|ESW24356.1| hypothetical protein PHAVU_004G123600g [Phaseolus vulgaris]
Length=382

 Score =   514 bits (1323),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 241/383 (63%), Positives = 293/383 (77%), Gaps = 4/383 (1%)
 Frame = -3

Query  1363  MAIECMIPTPT---PNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CM    T   P     +   +  A +VFD+S+LRH+ N+P +F+WPD EKP     
Sbjct  1     MAIDCMTNIQTMSQPQKHHHQDNKEDEAPLVFDASLLRHQLNLPKQFIWPDDEKPC-MNV  59

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  VP+ID+  F SGDPVA  E  ++V EAC+KHGFFLVVNHG+D  L+S     MD +
Sbjct  60    PELVVPLIDLRGFLSGDPVATMEAARMVGEACQKHGFFLVVNHGIDANLISHAHSYMDDF  119

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             FE+PL+ K++A RK GEHCGYASSFTGRF++KLPWKETLSF+FSAE++ S +V++Y   T
Sbjct  120   FEVPLTQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQFSAEEKSSTIVKDYLCNT  179

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LGQEF   G +YQ YC+AM+ L+L I ELLGM LGV +  F EF++ENDS++RLNYYPPC
Sbjct  180   LGQEFEQFGRVYQDYCDAMSNLSLGIMELLGMSLGVGKACFREFFEENDSIMRLNYYPPC  239

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW ++NP  NAFVVNIGDTFMALSN
Sbjct  240   QKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSINPNFNAFVVNIGDTFMALSN  299

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD   P+LYPDF WP LLE+T
Sbjct  300   GRYKSCLHRAVVNSKTTRKSLAFFLCPKGDKVVSPPSELVDDLTPRLYPDFTWPMLLEFT  359

Query  292   QLHYRSDTDTLLNFATWLQQNQT  224
             Q HYR+D  TL  F  WLQQ ++
Sbjct  360   QKHYRADMKTLEAFTNWLQQKRS  382



>ref|NP_001267911.1| gibberellin 20-oxidase [Vitis vinifera]
 emb|CAN78788.1| hypothetical protein VITISV_014231 [Vitis vinifera]
 gb|AFD54200.1| gibberellin 20 oxidase 1 [Vitis vinifera]
 gb|AGQ42624.1| GA20ox3 [Vitis vinifera]
Length=382

 Score =   513 bits (1322),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 241/384 (63%), Positives = 297/384 (77%), Gaps = 15/384 (4%)
 Frame = -3

Query  1363  MAIEC-------MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPG  1205
             M+I C       M   PT +H+ QE        +VFD+SVLRH+SNIP +F+WPD EKPG
Sbjct  1     MSIVCVEGNPPSMFNPPTDDHKNQE-------PLVFDASVLRHQSNIPKQFIWPDAEKPG  53

Query  1204  PYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVRE  1025
                A E  VP+ID+  F SGDP A  E  +LV EAC+KHGFFLVVNHGVD +L+    + 
Sbjct  54    D-KATELSVPLIDLGGFLSGDPAAAMEATRLVREACQKHGFFLVVNHGVDDKLIYKAHQY  112

Query  1024  MDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEY  845
             MD +F LPL+ K++A RKLGEHCGYASSF GRF++KLPWKETLSF +SAEK+ S+ V+EY
Sbjct  113   MDSFFGLPLAKKQRAQRKLGEHCGYASSFIGRFSSKLPWKETLSFSYSAEKKSSNAVQEY  172

Query  844   FEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNY  665
             F   +G++F++ G++YQ YC AM+TL+L I ELLGM LG+   HF EF++ENDS++RLNY
Sbjct  173   FLNKMGEDFSEFGQVYQDYCEAMSTLSLVIMELLGMSLGIGGAHFREFFEENDSIMRLNY  232

Query  664   YPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFM  485
             YPPC KP+LTLGTGPHCDPTSLTILHQD V GLQVFVD++W +++P  +AFVVNIGDTFM
Sbjct  233   YPPCLKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDDKWWSISPNFDAFVVNIGDTFM  292

Query  484   ALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             ALSNG YKSC+HRAVVN++ PRKS+AFFLCP KDKVV PP ELVD   P++YPDF W  L
Sbjct  293   ALSNGRYKSCLHRAVVNSQTPRKSLAFFLCPEKDKVVRPPTELVDTNSPRIYPDFTWSNL  352

Query  304   LEYTQLHYRSDTDTLLNFATWLQQ  233
             LE+TQ HYR+D  TL  F++WLQQ
Sbjct  353   LEFTQKHYRADMKTLEVFSSWLQQ  376



>gb|ABF61825.1| gibberellin 20-oxidase [Vitis vinifera]
 gb|ABF61826.1| gibberellin 20-oxidase [Vitis vinifera]
Length=382

 Score =   513 bits (1322),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 241/384 (63%), Positives = 297/384 (77%), Gaps = 15/384 (4%)
 Frame = -3

Query  1363  MAIEC-------MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPG  1205
             M+I C       M   PT +H+ QE        +VFD+SVLRH+SNIP +F+WPD EKPG
Sbjct  1     MSIVCVEGNPPSMFNPPTDDHKNQE-------PLVFDASVLRHQSNIPKQFIWPDAEKPG  53

Query  1204  PYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVRE  1025
                A E  VP+ID+  F SGDP A  E  +LV EAC+KHGFFLVVNHGVD +L+    + 
Sbjct  54    D-KATELSVPLIDLGGFLSGDPAAAMEATRLVREACQKHGFFLVVNHGVDDKLIYKAHQY  112

Query  1024  MDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEY  845
             MD +F LPL+ K++A RKLGEHCGYASSF GRF++KLPWKETLSF +SAEK+ S+ V+EY
Sbjct  113   MDSFFGLPLAKKQRAQRKLGEHCGYASSFIGRFSSKLPWKETLSFSYSAEKKSSNAVQEY  172

Query  844   FEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNY  665
             F   +G++F++ G++YQ YC AM+TL+L I ELLGM LG+   HF EF++ENDS++RLNY
Sbjct  173   FLNKMGEDFSEFGQVYQDYCEAMSTLSLVIMELLGMSLGIGGAHFREFFEENDSIMRLNY  232

Query  664   YPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFM  485
             YPPC KP+LTLGTGPHCDPTSLTILHQD V GLQVFVD++W +++P  +AFVVNIGDTFM
Sbjct  233   YPPCLKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDDKWWSISPNFDAFVVNIGDTFM  292

Query  484   ALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             ALSNG YKSC+HRAVVN++ PRKS+AFFLCP KDKVV PP ELVD   P++YPDF W  L
Sbjct  293   ALSNGRYKSCLHRAVVNSQTPRKSLAFFLCPEKDKVVRPPTELVDTNSPRIYPDFTWSNL  352

Query  304   LEYTQLHYRSDTDTLLNFATWLQQ  233
             LE+TQ HYR+D  TL  F++WLQQ
Sbjct  353   LEFTQKHYRADMKTLEVFSSWLQQ  376



>ref|XP_010109056.1| Gibberellin 20 oxidase 1-D [Morus notabilis]
 gb|EXC20856.1| Gibberellin 20 oxidase 1-D [Morus notabilis]
Length=396

 Score =   511 bits (1317),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 297/379 (78%), Gaps = 5/379 (1%)
 Frame = -3

Query  1348  MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVI  1169
             M  T    H+ +++EN+   ++VFD+SVL H+SNIPT+F+WPD EKP   A  E  VP +
Sbjct  22    MPQTQKNQHKLEQVENQ--NSLVFDASVLSHQSNIPTQFIWPDGEKPCENAP-ELPVPFV  78

Query  1168  DMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFK  989
             D+  F SGDP A AE  +LV EAC+KHGFFLVVNHGVD +L++D  R MD +FELPLS K
Sbjct  79    DLGGFISGDPAAAAEASRLVGEACRKHGFFLVVNHGVDRQLIADAHRYMDDFFELPLSEK  138

Query  988   EKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADL  809
             ++A RK GEHCGYASSFTGRF++KLPWKETLSFR++   +   +V +YF   LG +F   
Sbjct  139   QRAQRKAGEHCGYASSFTGRFSSKLPWKETLSFRYNNPSD--DIVLDYFGNVLGPDFEQF  196

Query  808   GELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLG  629
             G +YQ Y  AM+ L+L I ELLGM LGV R HF EF+Q+NDS++RLNYYPPCQKP+LTLG
Sbjct  197   GRVYQDYSEAMSKLSLGIMELLGMSLGVGRAHFKEFFQDNDSIMRLNYYPPCQKPDLTLG  256

Query  628   TGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMH  449
             TGPHCDPTSLTILHQD V GLQVFVD+EWR+++P  +AFVVNIGDTFMAL+NG YKSC+H
Sbjct  257   TGPHCDPTSLTILHQDQVGGLQVFVDDEWRSISPNFDAFVVNIGDTFMALANGRYKSCLH  316

Query  448   RAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDT  269
             RAVVN+++PRKS+AFFLCP K+KVV+PP ELVD+  P++YPDF WP LLE+TQ HYR+D 
Sbjct  317   RAVVNSKMPRKSLAFFLCPGKEKVVSPPRELVDSLWPRVYPDFTWPMLLEFTQKHYRADM  376

Query  268   DTLLNFATWLQQNQTLHAT  212
              TL  F+ WLQQ + L  T
Sbjct  377   KTLQIFSNWLQQKKQLETT  395



>ref|XP_011030015.1| PREDICTED: gibberellin 20 oxidase 2-like isoform X1 [Populus 
euphratica]
Length=385

 Score =   511 bits (1315),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 297/382 (78%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTP----NHERQEIENK-PAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P+     +H + + + K  + ++VFD+ VL+++S+IP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSKTTHDHHPKDQDQCKDESKSLVFDAQVLKYQSSIPQQFIWPDHEKPSAN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP+ID+  F SG+P A  E  +LV EAC+KHGFFLVVNHGVD  L++  +  MD
Sbjct  61    AP-ELQVPLIDVGDFLSGNPDAAMEASRLVGEACQKHGFFLVVNHGVDKTLIAHALNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSF ++AEK  S  +E+YF 
Sbjct  120   NFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFSYTAEKNSSKHIEQYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++ A  G ++Q YC AM+TL+L I ELLGM LGV R HF E+++ENDS++RLNYYP
Sbjct  180   DRMGEDLAKFGRVFQDYCEAMSTLSLGIMELLGMSLGVSRAHFREYFKENDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKPELTLGTGPHCDPTSLTILHQD V GLQV+ DNEW +++P  +AFVVNIGDTFMAL
Sbjct  240   PCQKPELTLGTGPHCDPTSLTILHQDQVGGLQVYADNEWCSISPNFDAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG YKSC+HRAVVN++ PRKS+AFFLCP  DK VTPP ELVD  +P++YPDF WP LLE
Sbjct  300   SNGRYKSCLHRAVVNSQTPRKSLAFFLCPRNDKTVTPPKELVDTCNPRIYPDFTWPMLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WLQQ
Sbjct  360   FTQKHYRADMKTLEMFTNWLQQ  381



>ref|XP_004308131.1| PREDICTED: gibberellin 20 oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=373

 Score =   507 bits (1306),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 300/380 (79%), Gaps = 8/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MA+ECM    T +H +++ + KP   +VFD+S+LR+E++IP +F+WPD EKP P   RE 
Sbjct  1     MAVECM---KTLSHHKED-DQKP---LVFDASLLRYETDIPKQFIWPDDEKPCP-NTREL  52

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F SG+P A  +  +LV EAC+KHGFFLVVNHGV   L++D  + MD +F L
Sbjct  53    QVPLIDLGDFLSGNPEAAMKASRLVGEACEKHGFFLVVNHGVKESLIADAHQYMDEFFGL  112

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF ++A++  S+VV++Y    +G+
Sbjct  113   PLSEKQRAQRKAGEHCGYASSFTGRFSSKLPWKETLSFSYTADQSSSNVVKDYLCNAMGE  172

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF + G +YQ Y  AM+TL++ I ELLGM LGV R HF EF+ +NDS++RLNYYPPCQKP
Sbjct  173   EFDEFGRVYQDYSEAMSTLSIGIMELLGMSLGVGRTHFKEFFGDNDSIMRLNYYPPCQKP  232

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             + TLGTGPHCDPTSLTILHQD V GL+VFVD EWR+++P  NAFVVNIGDTFMALSNG Y
Sbjct  233   DQTLGTGPHCDPTSLTILHQDQVGGLEVFVDEEWRSISPNLNAFVVNIGDTFMALSNGRY  292

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP  DKVV PP EL+D+++P++YPDF WP LLE+TQ H
Sbjct  293   KSCLHRAVVNSKTPRKSLAFFLCPKDDKVVKPPRELIDSSYPRIYPDFTWPMLLEFTQKH  352

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D  TL  F  WLQ+ ++
Sbjct  353   YRADMKTLQAFTNWLQEQRS  372



>ref|XP_011030016.1| PREDICTED: gibberellin 20 oxidase 2-like isoform X2 [Populus 
euphratica]
Length=384

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 297/382 (78%), Gaps = 7/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTP----NHERQEIENK-PAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+C+   P+     +H + + + K  + ++VFD+ VL+++S+IP +F+WPDHEKP   
Sbjct  1     MAIDCIKTMPSKTTHDHHPKDQDQCKDESKSLVFDAQVLKYQSSIPQQFIWPDHEKPSAN  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
             A  E QVP+ID+  F SG+P A  E  +LV EAC+KHGFFLVVNHGVD  L++  +  MD
Sbjct  61    AP-ELQVPLIDVGDFLSGNPDAAMEASRLVGEACQKHGFFLVVNHGVDKTLIAHALNYMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FELPLS K+KA RK+GE CGYASSFTGRF++KLPWKETLSF ++AEK  S  +E+YF 
Sbjct  120   NFFELPLSEKQKAQRKIGESCGYASSFTGRFSSKLPWKETLSFSYTAEKNSSKHIEQYFH  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++ A  G ++Q YC AM+TL+L I ELLGM LGV R HF E+++ENDS++RLNYYP
Sbjct  180   DRMGEDLAKFG-VFQDYCEAMSTLSLGIMELLGMSLGVSRAHFREYFKENDSIMRLNYYP  238

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKPELTLGTGPHCDPTSLTILHQD V GLQV+ DNEW +++P  +AFVVNIGDTFMAL
Sbjct  239   PCQKPELTLGTGPHCDPTSLTILHQDQVGGLQVYADNEWCSISPNFDAFVVNIGDTFMAL  298

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG YKSC+HRAVVN++ PRKS+AFFLCP  DK VTPP ELVD  +P++YPDF WP LLE
Sbjct  299   SNGRYKSCLHRAVVNSQTPRKSLAFFLCPRNDKTVTPPKELVDTCNPRIYPDFTWPMLLE  358

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+D  TL  F  WLQQ
Sbjct  359   FTQKHYRADMKTLEMFTNWLQQ  380



>gb|KHG10567.1| Gibberellin 20 oxidase 1 -like protein [Gossypium arboreum]
Length=368

 Score =   505 bits (1300),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 235/366 (64%), Positives = 290/366 (79%), Gaps = 2/366 (1%)
 Frame = -3

Query  1330  PNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFR  1151
             P+H + + +++    +VFD+SVL+++S IP +F+WPD EKP   +A E QVP+ID+  F 
Sbjct  2     PHHLKDDSKDE-QKQLVFDASVLKYQSCIPQQFIWPDDEKPCA-SAPELQVPLIDIKGFL  59

Query  1150  SGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRK  971
             SGDPVA  E  +LV EAC++HGFFLVVNHGVD  L++D  R MD +FELPL  K+ A RK
Sbjct  60    SGDPVAAMEASRLVGEACQQHGFFLVVNHGVDATLVADAHRYMDNFFELPLCEKQWAQRK  119

Query  970   LGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQK  791
             +GEHCGYASSFTGRF++KLPWKETLSFR+SA++  S +VE+Y    +G EF   G +YQ 
Sbjct  120   VGEHCGYASSFTGRFSSKLPWKETLSFRYSAQRNASTMVEDYLVNKMGDEFRHFGRVYQS  179

Query  790   YCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCD  611
             YC AM+ L+L I ELL + LGV R HF EF+++NDS++RLNYYP CQKP+LTLGTGPHCD
Sbjct  180   YCEAMSKLSLGIMELLAISLGVGRAHFREFFEDNDSIMRLNYYPLCQKPDLTLGTGPHCD  239

Query  610   PTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNN  431
             PTSLTILHQD V GLQVFVDNEWR+++P   AFVVNIGDTFMALSNG YKSC+HRAVVN+
Sbjct  240   PTSLTILHQDRVGGLQVFVDNEWRSISPNFEAFVVNIGDTFMALSNGRYKSCLHRAVVNS  299

Query  430   EIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNF  251
               PRKS+AFFLCP  DKVVTPP ELVDA  P++YPDF WP LLE+TQ HYR+D +TL  F
Sbjct  300   HTPRKSLAFFLCPKGDKVVTPPKELVDANSPRVYPDFTWPMLLEFTQKHYRADMNTLEVF  359

Query  250   ATWLQQ  233
             + W+QQ
Sbjct  360   SNWVQQ  365



>gb|ABX45092.1| gibberellin 20-oxidase [Acacia mangium]
Length=382

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 299/386 (77%), Gaps = 10/386 (3%)
 Frame = -3

Query  1363  MAIECM------IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGP  1202
             M +EC+      +P P  +  +++ E++P   +VFD+S+LR+E N+P +F+WPD EKP  
Sbjct  1     MVVECITNNLPSMPHPAKHGTKEDKEDEP---LVFDASLLRYEHNLPKQFIWPDEEKPC-  56

Query  1201  YAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
                 E  VP++D+  F SGDPVA  ET KLV EAC+KHGFFLVVNHG+D+ L+S   R M
Sbjct  57    LNPPELVVPLVDLRGFLSGDPVAAMETSKLVSEACRKHGFFLVVNHGIDSRLISHAHRFM  116

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             D +FELPLS K++A RK GEHCGYASSFT RF++KLPWKETLSF+FSA+K   ++V++Y 
Sbjct  117   DDFFELPLSQKQRAQRKTGEHCGYASSFTSRFSSKLPWKETLSFQFSADKNSQNLVKDYL  176

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
              + +G EF   G +YQ+YC AM+ L+L I ELLGM LGV R  F EF+ +N+S++RLNYY
Sbjct  177   CEKVGHEFEQFGMVYQEYCEAMSNLSLVIMELLGMSLGVGRTCFREFFDKNNSIMRLNYY  236

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+LTLGTGPHCDPTSLTILHQD V GLQV+VDNEW ++ P  NAFVVNIGDTFMA
Sbjct  237   PPCQKPDLTLGTGPHCDPTSLTILHQDKVGGLQVYVDNEWHSITPNFNAFVVNIGDTFMA  296

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVN++  RKS+AFFLCP  DKVVTPP ELVD   P++YPDF WP LL
Sbjct  297   LSNGRYKSCLHRAVVNSQTTRKSLAFFLCPGDDKVVTPPSELVDHVSPRIYPDFTWPMLL  356

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQT  224
             E+TQ HYR+D +TL  FA W+Q+N++
Sbjct  357   EFTQKHYRADMNTLEQFANWVQRNKS  382



>dbj|BAJ65440.1| gibberellin 20-oxidase [Torenia fournieri]
 dbj|BAJ76661.1| gibberellin 20-oxidase [Torenia fournieri]
Length=387

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 229/354 (65%), Positives = 290/354 (82%), Gaps = 1/354 (0%)
 Frame = -3

Query  1288  AVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLV  1109
             +++FD+++L H+SNIP +F+WPDHEKP      E +VP+ID+ +F SGDP A     +LV
Sbjct  27    SLIFDATLLNHQSNIPPQFIWPDHEKPCSNPP-ELKVPLIDLGSFLSGDPSASLRASELV  85

Query  1108  DEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGR  929
              EAC+KHGFFLVVNHGVD  L+SD  R MDR+FE PLS K++A RKLGEHCGYASSFTGR
Sbjct  86    GEACRKHGFFLVVNHGVDPSLVSDAHRYMDRFFEQPLSEKQRAQRKLGEHCGYASSFTGR  145

Query  928   FNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             F++KLPWKETLSF +S   + S +VEEYFE+ LG+ FA LG++YQ YC+AM+ L+L I E
Sbjct  146   FSSKLPWKETLSFEYSPRSDSSRIVEEYFERKLGENFAHLGKVYQDYCDAMSKLSLGIME  205

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLGM LGV+R +F +F+Q N+S++RLNYYPPCQKP+ TLGTGPHCDPTSLTILHQD+V G
Sbjct  206   LLGMSLGVNRSYFKDFFQGNESIMRLNYYPPCQKPDQTLGTGPHCDPTSLTILHQDTVGG  265

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQVFVD+EWR++ P  +AFVVNIGDTFMALSNG Y+SC+HRAVVN++  RKS+AFFLCP 
Sbjct  266   LQVFVDDEWRSIRPNFDAFVVNIGDTFMALSNGRYRSCLHRAVVNDKRTRKSLAFFLCPK  325

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             KDK+V+PP ELVD  +P++YPDF+W  LLE+TQ HYR+D +TL  F+ W+ + Q
Sbjct  326   KDKLVSPPCELVDTENPRIYPDFRWLNLLEFTQKHYRADMNTLSFFSKWVVEQQ  379



>gb|KDP20150.1| hypothetical protein JCGZ_00029 [Jatropha curcas]
Length=374

 Score =   505 bits (1300),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 236/370 (64%), Positives = 284/370 (77%), Gaps = 4/370 (1%)
 Frame = -3

Query  1333  TPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
              P H +++ ++KP   +VFD+ V  ++SN+P +F+WPD EKP P A  E  VP ID+  F
Sbjct  9     VPQHHQEDDQDKP---LVFDAKVFSYKSNVPQQFIWPDDEKPTPNAP-ELLVPQIDLGGF  64

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              SGDPVA  E  KLVDEAC+KHGFFL+VNHGVD +L+ D    MD +F LPLS K+KA R
Sbjct  65    LSGDPVAAMEASKLVDEACRKHGFFLIVNHGVDKKLIEDAHLYMDSFFALPLSEKQKAQR  124

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             KLGEHCGYASSFTGRF++KLPWKETLS R+SA+K   +VV +Y   T+G+ F++ G +YQ
Sbjct  125   KLGEHCGYASSFTGRFSSKLPWKETLSLRYSADKNEPNVVHQYLHNTMGETFSEFGRVYQ  184

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +Y   M+ LALEI ELL M LGV R+ F EFY+ENDS+LR+NYYP C KPEL LGTGPH 
Sbjct  185   EYSEVMSNLALEIMELLAMSLGVSRRQFREFYEENDSILRVNYYPQCPKPELALGTGPHS  244

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V GLQVFVDN+W+ ++P   AFVVNIGDTFMALSNG YKSC+HRAVVN
Sbjct  245   DPTSLTILHQDQVGGLQVFVDNQWQNISPNFQAFVVNIGDTFMALSNGKYKSCLHRAVVN  304

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             NE PRKSIAFFLCP  D+VV+PP ELVD  +P+ YPDF WP LLE+TQ HYRSD  TL  
Sbjct  305   NETPRKSIAFFLCPKGDRVVSPPSELVDDDNPRTYPDFTWPMLLEFTQKHYRSDMKTLEA  364

Query  253   FATWLQQNQT  224
             F+ WL Q + 
Sbjct  365   FSNWLPQQKN  374



>ref|XP_007218118.1| hypothetical protein PRUPE_ppa006985mg [Prunus persica]
 gb|EMJ19317.1| hypothetical protein PRUPE_ppa006985mg [Prunus persica]
Length=387

 Score =   504 bits (1299),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 237/391 (61%), Positives = 297/391 (76%), Gaps = 15/391 (4%)
 Frame = -3

Query  1363  MAIECMIPT----------PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHE  1214
             MAIECMI T          P+   E ++ + KP   +VFD+SVLR+++ IP +F+WPD E
Sbjct  1     MAIECMITTRRSTQSMAQPPSLKTEHKQDDQKP---LVFDASVLRYQTEIPKQFIWPDEE  57

Query  1213  KPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDG  1034
             KP      E QVP+ID+  F SG+  A  +   +V EAC+KHGFFLVVNHGVD +L++D 
Sbjct  58    KPCANTP-ELQVPLIDLGGFLSGNKQAATKASTIVGEACQKHGFFLVVNHGVDNQLIADA  116

Query  1033  VREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVV  854
              R MD +F LPLS K++A R LGEHCGYASSFTGRF++KLPWKETLSFR+SA+K  S +V
Sbjct  117   HRYMDDFFGLPLSEKQRAQRLLGEHCGYASSFTGRFSSKLPWKETLSFRYSADKSSSSIV  176

Query  853   EEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLR  674
             ++Y    +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR HF EF+++NDS++R
Sbjct  177   QDYLCSKMGEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAHFKEFFEDNDSIMR  236

Query  673   LNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGD  494
             LNYYPPCQKP+ TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVNIGD
Sbjct  237   LNYYPPCQKPDQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDKWHSISPNLNAFVVNIGD  296

Query  493   TFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATH-PKLYPDFK  317
             TFMALSNG YKSC+HRAVVN++ PRKS+AFFLCP  DKVV PP  LVD T  P++YPDF 
Sbjct  297   TFMALSNGRYKSCLHRAVVNSQTPRKSLAFFLCPRDDKVVKPPNGLVDDTSCPRIYPDFT  356

Query  316   WPALLEYTQLHYRSDTDTLLNFATWLQQNQT  224
             WP LLE+TQ HYR+D  TL  F+ WLQQ  +
Sbjct  357   WPMLLEFTQKHYRADMKTLQVFSNWLQQKSS  387



>ref|XP_008234320.1| PREDICTED: gibberellin 20 oxidase 1-D [Prunus mume]
Length=387

 Score =   504 bits (1298),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 237/391 (61%), Positives = 297/391 (76%), Gaps = 15/391 (4%)
 Frame = -3

Query  1363  MAIECMIPT----------PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHE  1214
             MAIECMI T          P+   E ++ + KP   +VFD+SVLR+++ IP +F+WPD E
Sbjct  1     MAIECMITTRRSTQSMAQPPSLKTEHKQDDQKP---LVFDASVLRYQTEIPEQFIWPDEE  57

Query  1213  KPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDG  1034
             KP      E QVP+ID+  F SG+  A  +   +V EAC+KHGFFLVVNHGVD +L++D 
Sbjct  58    KPCANTP-ELQVPLIDLGGFLSGNKQAATKASTIVGEACQKHGFFLVVNHGVDNQLIADA  116

Query  1033  VREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVV  854
              R MD +F LPLS K++A R LGEHCGYASSFTGRF++KLPWKETLSFR+SA+K  S +V
Sbjct  117   HRYMDDFFGLPLSEKQRAQRLLGEHCGYASSFTGRFSSKLPWKETLSFRYSADKSSSSIV  176

Query  853   EEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLR  674
             ++Y    +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR HF EF+++NDS++R
Sbjct  177   QDYLCSKMGEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAHFKEFFEDNDSIMR  236

Query  673   LNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGD  494
             LNYYPPCQKP+ TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVNIGD
Sbjct  237   LNYYPPCQKPDQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDKWHSISPNLNAFVVNIGD  296

Query  493   TFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATH-PKLYPDFK  317
             TFMALSNG YKSC+HRAVVN++ PRKS+AFFLCP  DKVV PP  LVD T  P++YPDF 
Sbjct  297   TFMALSNGRYKSCLHRAVVNSQTPRKSLAFFLCPRDDKVVKPPNGLVDDTSCPRIYPDFT  356

Query  316   WPALLEYTQLHYRSDTDTLLNFATWLQQNQT  224
             WP LLE+TQ HYR+D  TL  F+ WLQQ  +
Sbjct  357   WPMLLEFTQKHYRADMKTLQVFSNWLQQKSS  387



>gb|ACJ84607.1| unknown [Medicago truncatula]
Length=377

 Score =   503 bits (1296),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 241/382 (63%), Positives = 294/382 (77%), Gaps = 7/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTP--NHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             MAIEC+   P    N E +E E KP   +VFD+SVL+H+ N+PT+F+WPD E+       
Sbjct  1     MAIECITSMPQQLLNQETKEQE-KP---LVFDASVLKHQVNLPTQFIWPDEEQ-ACLNVP  55

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             E  VP ID+  F SGDPVA  E  K+V EACKKHGFFLVVNHG+D +L+SD    MD +F
Sbjct  56    ELHVPFIDLGGFLSGDPVAAMEASKVVGEACKKHGFFLVVNHGIDEKLISDAHAFMDDFF  115

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             ELPLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF+FSA+++  ++V +Y   T+
Sbjct  116   ELPLSQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQFSADEKSPNLVRDYLCNTM  175

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G EF + GE+YQ YC AM+ L+L I E+LGM LGV + HF EF++EN S++RLNYYP CQ
Sbjct  176   GNEFEEFGEVYQDYCKAMSNLSLGIMEILGMSLGVGKAHFREFFEENSSIMRLNYYPTCQ  235

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             KPELTLGTGPHCDPTSLTILHQD V GLQV+VD++W +++P  NAFVVNIGDTFMALSNG
Sbjct  236   KPELTLGTGPHCDPTSLTILHQDQVGGLQVYVDDQWHSISPHFNAFVVNIGDTFMALSNG  295

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
              YKSC+HRAVVN+E  RKS+AFFLCP  DKVVTPP ELVD  +P++YPDF W  LLE+TQ
Sbjct  296   RYKSCLHRAVVNSEKTRKSLAFFLCPLSDKVVTPPCELVDNYNPRIYPDFTWSMLLEFTQ  355

Query  289   LHYRSDTDTLLNFATWLQQNQT  224
              HYR+D  TL  FA W+Q   T
Sbjct  356   KHYRADIKTLEAFAKWVQCKST  377



>gb|KHG03920.1| Gibberellin 20 oxidase 2 -like protein [Gossypium arboreum]
Length=379

 Score =   503 bits (1296),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 285/380 (75%), Gaps = 1/380 (0%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI+ +    +  H  ++ +      +VFD+SVL+ ES IP EF+WPD EKP      E 
Sbjct  1     MAIDSISNIASMTHYPKDEKKDEQKKLVFDASVLKFESQIPKEFIWPDDEKPSANVP-EL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F SGDPVA  E  + + EAC++HGFFLVVNHGVD +LL+D  + MD +F L
Sbjct  60    QVPLIDLGGFLSGDPVATMEASRFISEACQQHGFFLVVNHGVDAKLLADAHKYMDNFFLL  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL  K++A RK+GEHCGYASSFTGRF+ KLPWKETLSFR+SAE   S +VE+Y    +G 
Sbjct  120   PLRQKQRAQRKVGEHCGYASSFTGRFSTKLPWKETLSFRYSAENNSSKMVEDYLLNKMGN  179

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             E   LG +YQ YC AM+ L+L I ELL + LGV R HF EF+ +NDS++RLNYYPPCQKP
Sbjct  180   ELRLLGRVYQDYCEAMSKLSLGIMELLAISLGVGRAHFREFFDKNDSIMRLNYYPPCQKP  239

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW +++P   AFVVNIGDTFMALSNG Y
Sbjct  240   DLTLGTGPHCDPTSLTILHQDRVGGLQVFVDNEWHSISPNFEAFVVNIGDTFMALSNGRY  299

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN+  PRKS+AFFLCP  DKVVTPP ELV    P++YPDF WP LLE+TQ H
Sbjct  300   KSCLHRAVVNSHKPRKSLAFFLCPEGDKVVTPPAELVSQNRPRVYPDFTWPMLLEFTQKH  359

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D +TL  F+ W+QQ  +
Sbjct  360   YRADMNTLQEFSNWVQQRNS  379



>gb|AES62614.2| gibberellin 20-oxidase [Medicago truncatula]
Length=377

 Score =   503 bits (1295),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 241/382 (63%), Positives = 293/382 (77%), Gaps = 7/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTP--NHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             MAIEC+   P    N E +E E KP   +VFD+SVL+H+ N+PT+F+WPD E+       
Sbjct  1     MAIECITSMPQQLLNQETKEQE-KP---LVFDASVLKHQVNLPTQFIWPDEEQ-ACLNVP  55

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             E  VP ID+  F SGDPVA  E  K+V EACKKHGFFLVVNHG+D +L+SD    MD +F
Sbjct  56    ELHVPFIDLGGFLSGDPVAAMEASKVVGEACKKHGFFLVVNHGIDEKLISDAHAFMDDFF  115

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             ELPLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF+FSA+++  ++V +Y   T+
Sbjct  116   ELPLSQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQFSADEKSPNLVRDYLCNTM  175

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G EF   GE+YQ YC AM+ L+L I E+LGM LGV + HF EF++EN S++RLNYYP CQ
Sbjct  176   GNEFEKFGEVYQDYCKAMSNLSLGIMEILGMSLGVGKAHFREFFEENSSIMRLNYYPTCQ  235

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             KPELTLGTGPHCDPTSLTILHQD V GLQV+VD++W +++P  NAFVVNIGDTFMALSNG
Sbjct  236   KPELTLGTGPHCDPTSLTILHQDQVGGLQVYVDDQWHSISPHFNAFVVNIGDTFMALSNG  295

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
              YKSC+HRAVVN+E  RKS+AFFLCP  DKVVTPP ELVD  +P++YPDF W  LLE+TQ
Sbjct  296   RYKSCLHRAVVNSEKTRKSLAFFLCPLSDKVVTPPCELVDNYNPRIYPDFTWSMLLEFTQ  355

Query  289   LHYRSDTDTLLNFATWLQQNQT  224
              HYR+D  TL  FA W+Q   T
Sbjct  356   KHYRADIKTLEAFAKWVQCKST  377



>gb|KHN31555.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=371

 Score =   503 bits (1294),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/374 (63%), Positives = 290/374 (78%), Gaps = 4/374 (1%)
 Frame = -3

Query  1345  IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVID  1166
             +  P  +H+  + +  P   +VFD+S+LRHE N+P +F+WPD EKP      E  VP+ID
Sbjct  1     MSQPQKHHQDHKEDEAP---LVFDASLLRHELNLPKQFIWPDEEKPC-MNVPELAVPLID  56

Query  1165  MAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKE  986
             +  F SGDPVA  E  ++V EAC+KHGFFLVVNHG+D +L+S     MD +FE+PLS K+
Sbjct  57    LGGFISGDPVATMEAARMVGEACQKHGFFLVVNHGIDAKLISHAHSYMDDFFEIPLSQKQ  116

Query  985   KALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLG  806
             +A RK GEHCGYASSFTGRF++KLPWKETLSF++SAE+  S +V++Y   TLG+EF   G
Sbjct  117   RAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQYSAEENSSTIVKDYLCNTLGKEFEQFG  176

Query  805   ELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGT  626
              +YQ YC+AM+ L+L I ELLGM LGV ++ FSEF++EN+S++RLNYYPPCQKP+LTLGT
Sbjct  177   RVYQDYCDAMSNLSLGIMELLGMSLGVGKECFSEFFEENNSIMRLNYYPPCQKPDLTLGT  236

Query  625   GPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHR  446
             GPHCDPTSLTILHQD V GLQVFVDNEW +++P  NAFVVNIGDTFMALSNG YKSC+HR
Sbjct  237   GPHCDPTSLTILHQDQVGGLQVFVDNEWHSISPNFNAFVVNIGDTFMALSNGRYKSCLHR  296

Query  445   AVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTD  266
             AVVN+   RKS+AFFLCP  DKVV+PP ELVD   P++YPDF WP LLE+TQ HYR+D  
Sbjct  297   AVVNSRTTRKSLAFFLCPKGDKVVSPPSELVDDLTPRVYPDFTWPMLLEFTQKHYRADIK  356

Query  265   TLLNFATWLQQNQT  224
             TL  F  WL Q +T
Sbjct  357   TLEAFTNWLLQRKT  370



>gb|ABX45093.1| gibberellin 20-oxidase [Acacia mangium]
Length=382

 Score =   502 bits (1293),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 298/386 (77%), Gaps = 10/386 (3%)
 Frame = -3

Query  1363  MAIECM------IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGP  1202
             M +EC+      +P P  +  +++ E++P   +VFD+S+LR+E N+P +F+WPD EKP  
Sbjct  1     MVVECITNNLPSMPHPAKHGTKEDKEDEP---LVFDASLLRYEHNLPKQFIWPDEEKPC-  56

Query  1201  YAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
                 E  VP++D+  F SGDPVA  ET KLV EAC+KHGFFLVVNH +D+ L+S   R M
Sbjct  57    LNPPELVVPLVDLRGFLSGDPVAAMETSKLVSEACRKHGFFLVVNHRIDSRLISHAHRFM  116

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             D +FELPLS K++A RK GEHCGYASSFT RF++KLPWKETLSF+FSA+K   ++V++Y 
Sbjct  117   DDFFELPLSQKQRAQRKAGEHCGYASSFTSRFSSKLPWKETLSFQFSADKNSQNLVKDYL  176

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
              + +G EF   G +YQ+YC AM+ L+L I ELLGM LGV R  F EF+ +N+S++RLNYY
Sbjct  177   CEKVGHEFEQFGMVYQEYCEAMSNLSLVIMELLGMSLGVGRTCFREFFDKNNSIMRLNYY  236

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+LTLGTGPHCDPTSLTILHQD V GLQV+VDNEW ++ P  NAFVVNIGDTFMA
Sbjct  237   PPCQKPDLTLGTGPHCDPTSLTILHQDKVGGLQVYVDNEWHSITPNFNAFVVNIGDTFMA  296

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVN++  RKS+AFFLCP  DKVVTPP ELVD   P++YPDF WP LL
Sbjct  297   LSNGRYKSCLHRAVVNSQTTRKSLAFFLCPGDDKVVTPPSELVDHVSPRIYPDFTWPMLL  356

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQT  224
             E+TQ HYR+D +TL  FA W+Q+N++
Sbjct  357   EFTQKHYRADMNTLEQFANWVQRNKS  382



>ref|XP_006586607.1| PREDICTED: gibberellin 20-oxidase 1 isoform X1 [Glycine max]
Length=382

 Score =   501 bits (1291),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 293/384 (76%), Gaps = 9/384 (2%)
 Frame = -3

Query  1363  MAIECM-----IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAIEC+     +  P  +H+  + +  P   +VFD+S+LRH+ N+P +F+WPD EKP   
Sbjct  1     MAIECITNIQSMSQPQKHHQEHKEDEAP---LVFDASLLRHQLNLPKQFIWPDEEKPC-M  56

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
                E  VP+ID+  F SGDPVA  E  ++V EAC+KHGFFLVVNHG+D  L+S+    MD
Sbjct  57    NVPELGVPLIDLGGFLSGDPVATMEAARIVGEACQKHGFFLVVNHGIDANLISNAHSYMD  116

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +FE+PLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF++SAE+  S +V++Y  
Sbjct  117   DFFEVPLSQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQYSAEENSSTIVKDYLC  176

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
              TL +EF   G +YQ YC+AM+ L+L I ELLGM LGV +  F EF++EN+S++RLNYYP
Sbjct  177   NTLEKEFEQFGRVYQDYCDAMSNLSLGIMELLGMSLGVGKACFREFFEENNSIMRLNYYP  236

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW +++P  NAFVVNIGDTFMAL
Sbjct  237   PCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSISPNFNAFVVNIGDTFMAL  296

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD   P++YPDF WP LLE
Sbjct  297   SNGRYKSCLHRAVVNSKTTRKSLAFFLCPKGDKVVSPPSELVDDLTPRIYPDFTWPMLLE  356

Query  298   YTQLHYRSDTDTLLNFATWLQQNQ  227
             +TQ HYR+D  TL  F  WL Q +
Sbjct  357   FTQKHYRADMKTLEAFTNWLLQRK  380



>gb|KEH26558.1| gibberellin 20-oxidase [Medicago truncatula]
Length=382

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 290/386 (75%), Gaps = 10/386 (3%)
 Frame = -3

Query  1363  MAIEC------MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGP  1202
             MAIEC      M  +P  NH + E E    +++VFD+S LRH  N+P +F+WPD EKP  
Sbjct  1     MAIECITSTKAMTQSPKQNHGKNEDEE---SSLVFDASFLRHTINLPKQFIWPDEEKPC-  56

Query  1201  YAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
                 E  VP+ID+  F SGDP A  E  K++ EAC+KHGFFLVVNHG+D +L+      M
Sbjct  57    MNVPELDVPLIDLKNFLSGDPFAAMEASKIIGEACEKHGFFLVVNHGIDAKLIEHAHSYM  116

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             D +FE PLS K++A RK+GEHCGYASSFTGRF++KLPWKETLSF+FS EK   ++V++Y 
Sbjct  117   DGFFENPLSQKQRAQRKIGEHCGYASSFTGRFSSKLPWKETLSFQFSDEKNSPNIVKDYL  176

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
               TLG++F + GE+YQKYC AM+TL+L I ELLGM LGV +  F +F++EN S++RLNYY
Sbjct  177   CNTLGEDFEEFGEVYQKYCEAMSTLSLGIMELLGMSLGVGKDCFRDFFEENKSIMRLNYY  236

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW ++ P  NAFVVNIGDTFMA
Sbjct  237   PPCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSIRPNFNAFVVNIGDTFMA  296

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVNN+  RKS+AFFLCP  DKVV PP ELV    P++YPDF WP LL
Sbjct  297   LSNGRYKSCLHRAVVNNKTTRKSLAFFLCPKGDKVVCPPSELVSDLTPRIYPDFTWPMLL  356

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQT  224
             E+TQ +YR+D  TL  F  W+QQ  +
Sbjct  357   EFTQKYYRADMRTLEAFTKWIQQKSS  382



>ref|XP_010272616.1| PREDICTED: gibberellin 20 oxidase 1 [Nelumbo nucifera]
Length=380

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/378 (62%), Positives = 292/378 (77%), Gaps = 2/378 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAA-AVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             M ++C+    +     ++ ENK    ++VFD+SVLR++SNIP +F+WPDHEKP    A E
Sbjct  1     MTVDCIANVTSDGPPPRKDENKEQQPSLVFDASVLRYQSNIPKQFVWPDHEKPSA-DAPE  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              QVP+I+++ F SGDPVA  E  +LV EAC+KHGFFLVVNHGV   L++D  R MD +F+
Sbjct  60    LQVPLINLSGFLSGDPVAAWEASRLVGEACRKHGFFLVVNHGVKARLIADAHRYMDLFFD  119

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             +PL  K++A RK GE CGYASSFTGRF+ KLPWKETLSF +SA ++    VEEYF   LG
Sbjct  120   MPLHEKQRAQRKPGESCGYASSFTGRFSFKLPWKETLSFSYSAHQQPHKTVEEYFLNVLG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             + F + G +YQ+YC AM+TL+L I ELLGM LGV   HF +F++ENDS++RLNYYP CQK
Sbjct  180   EGFREFGRVYQEYCEAMSTLSLGIMELLGMSLGVGPTHFRDFFEENDSIMRLNYYPQCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PELTLGTGPHCDPTSLTILHQD V GLQVFVDN+W +++P P AFVVN+GDTFMALSNG 
Sbjct  240   PELTLGTGPHCDPTSLTILHQDHVGGLQVFVDNKWHSISPNPEAFVVNVGDTFMALSNGQ  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVN++ PRKS+AFFLCP  D VV+PP  LVD+ HP++YPDF W  LLE+TQ 
Sbjct  300   YKSCLHRAVVNSKTPRKSLAFFLCPRADMVVSPPRGLVDSEHPRMYPDFTWLTLLEFTQK  359

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D  TL  F+ WLQQ
Sbjct  360   HYRADMMTLDAFSNWLQQ  377



>dbj|BAD30034.1| gibberellin 20-oxidase2 [Daucus carota]
Length=383

 Score =   499 bits (1286),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 223/350 (64%), Positives = 283/350 (81%), Gaps = 1/350 (0%)
 Frame = -3

Query  1288  AVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLV  1109
             ++VFD S++++E NIP EF+WPDHEKP  +   +  VP++D+  F SGDPVA  +  KLV
Sbjct  19    SLVFDPSIIKNELNIPQEFIWPDHEKPSSHTP-QLDVPLVDVGGFLSGDPVAAEKASKLV  77

Query  1108  DEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGR  929
              +AC++HGFFLV NHGVD  L+SD  + MD +FELPL  K+KA RKLGEHCGYASSFTGR
Sbjct  78    GQACREHGFFLVTNHGVDGNLISDAHKSMDLFFELPLMEKQKAQRKLGEHCGYASSFTGR  137

Query  928   FNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             F++KLPWKETLSF  S +K  S +VE+YF   LG+++A LG++YQ YCNAM+ L+  I E
Sbjct  138   FSSKLPWKETLSFEHSTKKTSSTLVEDYFASALGKDYAKLGKVYQDYCNAMSRLSFGIME  197

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LL + LG+DR HF  F++EN+S++RLNYYP C++PELTLGTGPHCDPTSLTILHQD V G
Sbjct  198   LLAISLGIDRSHFKNFFEENNSIMRLNYYPTCRRPELTLGTGPHCDPTSLTILHQDDVGG  257

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             L+VFVDN+W+++ P P++FVVN+GDTFMALSNG YKSC+HRAVVN + PR+S+AFFLCP 
Sbjct  258   LEVFVDNQWQSIPPNPSSFVVNLGDTFMALSNGKYKSCLHRAVVNKQNPRRSLAFFLCPQ  317

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             KDKVV PP ELVD  +P+LYPDF W ALLE+TQ HYR+D +TL  F++WL
Sbjct  318   KDKVVRPPTELVDQDNPRLYPDFTWSALLEFTQKHYRADMNTLQAFSSWL  367



>ref|XP_002511762.1| gibberellin 20-oxidase, putative [Ricinus communis]
 gb|EEF50431.1| gibberellin 20-oxidase, putative [Ricinus communis]
Length=389

 Score =   499 bits (1286),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 291/359 (81%), Gaps = 1/359 (0%)
 Frame = -3

Query  1300  KPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAET  1121
             +P   +VFD+S+L+H+SNIP++F+WPDHEKP    + +  +P ID+ +F SGD +AV++ 
Sbjct  32    EPQQTLVFDASILQHQSNIPSQFVWPDHEKPC-LDSPQLAIPPIDLGSFLSGDHLAVSKA  90

Query  1120  CKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASS  941
              +LV+EACKKHGFFLVVNHGVD+ L++     M+ +F +P+  K++A R++G+HCGYASS
Sbjct  91    VELVNEACKKHGFFLVVNHGVDSRLIAKAHEYMEMFFSMPMMVKQRAQRRIGDHCGYASS  150

Query  940   FTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLAL  761
             FTGRF++KLPWKETLSFR+  +   S++V+EYF   +G+EF   G++YQ+YC AM+TL+L
Sbjct  151   FTGRFSSKLPWKETLSFRYCDDNNFSNIVQEYFSNVMGEEFRQFGKVYQEYCEAMSTLSL  210

Query  760   EITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQD  581
              I ELLG+ LGV R +F EF++ NDS++RLNYYPPCQKP+LTLGTGPHCDPTSLTILHQD
Sbjct  211   RIMELLGLTLGVGRAYFREFFEGNDSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQD  270

Query  580   SVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFF  401
              V GLQVFVD +W +V+P P AFVVNIGDTFMALSNG++KSC+HRAVVNN   RKS+AFF
Sbjct  271   EVGGLQVFVDEKWHSVHPDPQAFVVNIGDTFMALSNGIFKSCLHRAVVNNRTVRKSLAFF  330

Query  400   LCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQT  224
             LCP+ +KVV PP  LVD+ +P++YPDF WPALLE+TQ +YR+D  TL  FA WLQQ ++
Sbjct  331   LCPNMEKVVKPPKNLVDSNNPRIYPDFTWPALLEFTQKYYRADMKTLDVFANWLQQKKS  389



>ref|XP_011101148.1| PREDICTED: gibberellin 20 oxidase 1-D [Sesamum indicum]
Length=380

 Score =   498 bits (1282),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 225/354 (64%), Positives = 291/354 (82%), Gaps = 1/354 (0%)
 Frame = -3

Query  1288  AVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLV  1109
              +VFD+++L+H+ +IP +F+WP HE+P      E  VP+ID+  F SG+  A     +LV
Sbjct  26    TLVFDATILQHQFDIPPQFIWPVHERPRADPP-ELHVPLIDLGEFLSGNLTAAKRASQLV  84

Query  1108  DEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGR  929
              EAC+KHGFFLV NHGV T+L+S     MDR+FE  L  K++ALRK+GE CGYASSFTGR
Sbjct  85    GEACRKHGFFLVGNHGVSTDLISHAHHHMDRFFEQTLHEKQRALRKVGELCGYASSFTGR  144

Query  928   FNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             F++KLPWKETLSF++SA+++ SH+VEEYF+++LG++FA  G++YQ YC+AM+ L+L I E
Sbjct  145   FSSKLPWKETLSFQYSAQQDSSHIVEEYFKRSLGEDFAHSGKVYQDYCSAMSKLSLGIME  204

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLGM LGV   HF +F++EN+S++RLNYYPPCQKP+ TLGTGPHCDPTSLTILHQD+V G
Sbjct  205   LLGMSLGVRPDHFKQFFEENESIMRLNYYPPCQKPDQTLGTGPHCDPTSLTILHQDTVGG  264

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQVFVD+EW++++P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+E PRKS+AFFLCP 
Sbjct  265   LQVFVDDEWQSISPNLDAFVVNIGDTFMALSNGRYKSCLHRAVVNHESPRKSLAFFLCPK  324

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             KDKVV PP ELVD+ +P+ YPDF+WP LLE+TQ HYR+D +TL  F+TW+QQ+Q
Sbjct  325   KDKVVRPPHELVDSNNPRKYPDFRWPTLLEFTQKHYRADMNTLHTFSTWIQQHQ  378



>ref|XP_004496635.1| PREDICTED: gibberellin 20 oxidase 2-like [Cicer arietinum]
Length=373

 Score =   497 bits (1280),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/383 (62%), Positives = 295/383 (77%), Gaps = 13/383 (3%)
 Frame = -3

Query  1363  MAIECMI---PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+C I   P P PN E +E+        VFD+S+L+++ N+PT+F+WPD EK      
Sbjct  1     MAIDCSITSMPQP-PNQETKEL--------VFDASLLKNQVNLPTQFIWPDEEK-ACLDV  50

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  VP ID+  F SGDPVA  E  KLV EAC+KHGFFLVVNHG+D +L+SD    MD +
Sbjct  51    PELVVPFIDLTGFLSGDPVAAMEASKLVGEACQKHGFFLVVNHGIDKKLISDAHFFMDEF  110

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             FELPL  K++A RK GEHCGYASSFTGRF++KLPWKETLSF+FSA+++  ++V +Y   T
Sbjct  111   FELPLFQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQFSADQKSPNLVRDYLCNT  170

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             +G EF   G++YQ YC AM+ L+L I ELLGM LGV + +F EF+++N S++RLNYYPPC
Sbjct  171   MGNEFEQFGKVYQDYCKAMSNLSLGIMELLGMSLGVGKAYFREFFEKNSSIMRLNYYPPC  230

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             QKPELTLGTGPHCDPTSLTILHQD V GLQV+VDN+W++++P  +AFVVNIGDTFMALSN
Sbjct  231   QKPELTLGTGPHCDPTSLTILHQDQVGGLQVYVDNQWQSISPHFDAFVVNIGDTFMALSN  290

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD ++P++YPDF WP LLE+T
Sbjct  291   GRYKSCLHRAVVNSKKTRKSLAFFLCPLSDKVVSPPCELVDNSNPRIYPDFTWPMLLEFT  350

Query  292   QLHYRSDTDTLLNFATWLQQNQT  224
             Q HYR+D  TL  FA WLQ   T
Sbjct  351   QKHYRADIKTLEAFANWLQCKST  373



>gb|AAC49721.1| GA 20-oxidase [Pisum sativum]
Length=380

 Score =   497 bits (1279),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 230/381 (60%), Positives = 290/381 (76%), Gaps = 2/381 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEI-ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAIEC+  +     ++ +  EN+ ++ +VFD+S L+++ N+P +F+WPD EKP      E
Sbjct  1     MAIECITSSAKLMTQKSDKNENEESSKLVFDASFLKNQLNLPKQFIWPDDEKPC-MNVPE  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID   F SGDP A  E  K + EAC+KHGFFLVVNHG+DT+L+      M+ +FE
Sbjct  60    LDVPLIDFKNFLSGDPFAAMEASKTIGEACEKHGFFLVVNHGIDTKLIEHAHSYMNDFFE  119

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             +PLS K++  RK GEHCGYASSFTGRF++ LPWKETLSF+FS EK  S++V++Y   TLG
Sbjct  120   VPLSQKQRCQRKTGEHCGYASSFTGRFSSNLPWKETLSFQFSDEKNSSNIVKDYLSNTLG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             ++F   GE+YQ+YC AM+ L+L I ELLGM LGV ++ F +F++EN S++RLNYYPPCQK
Sbjct  180   EDFQQFGEVYQEYCEAMSKLSLGIMELLGMSLGVGKECFRDFFEENKSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW ++ P  NAFVVNIGDTFMALSNG 
Sbjct  240   PDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSIRPNFNAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+  RKS+AFFLCP  DKVV+PP ELV+   P++YPDF WP LLE+TQ 
Sbjct  300   YKSCLHRAVVNNKTTRKSLAFFLCPKGDKVVSPPSELVNDLTPRIYPDFTWPMLLEFTQK  359

Query  286   HYRSDTDTLLNFATWLQQNQT  224
             HYR+D  TL  F  W+QQ Q 
Sbjct  360   HYRADMRTLEAFTKWIQQKQN  380



>emb|CAA62846.1| gibberellin 20-oxidase [Pisum sativum]
Length=380

 Score =   497 bits (1279),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 289/381 (76%), Gaps = 2/381 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEI-ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAIEC+  +     ++ +  EN+ ++ +VFD+S L+++ N+P  F+WPD EKP      E
Sbjct  1     MAIECITSSAKLMTQKSDKNENEESSKLVFDASFLKNQLNLPKRFIWPDDEKPC-MNVPE  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID   F SGDP A  E  K + EAC+KHGFFLVVNHG+DT+L+      M+ +FE
Sbjct  60    LDVPLIDFKNFLSGDPFAAMEASKTIGEACEKHGFFLVVNHGIDTKLIEHAHSYMNDFFE  119

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             +PLS K++  RK GEHCGYASSFTGRF++ LPWKETLSF+FS EK  SH+V++Y   TLG
Sbjct  120   VPLSQKQRCQRKTGEHCGYASSFTGRFSSNLPWKETLSFQFSDEKNPSHIVKDYLSNTLG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             ++F   GE+YQ+YC AM+ L+L I ELLGM LGV ++ F +F++EN S++RLNYYPPCQK
Sbjct  180   EDFQQFGEVYQEYCEAMSKLSLGIMELLGMSLGVGKECFRDFFEENKSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW ++ P  NAFVVNIGDTFMALSNG 
Sbjct  240   PDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSIRPNFNAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+  RKS+AFFLCP  DKVV+PP ELV+   P++YPDF WP LLE+TQ 
Sbjct  300   YKSCLHRAVVNNKTTRKSLAFFLCPKGDKVVSPPSELVNDLTPRIYPDFTWPMLLEFTQK  359

Query  286   HYRSDTDTLLNFATWLQQNQT  224
             HYR+D  TL  F  W+QQ Q 
Sbjct  360   HYRADMRTLEAFTKWIQQKQN  380



>gb|AAF29605.1|AF138704_1 gibberellin c20-oxidase [Pisum sativum]
Length=380

 Score =   497 bits (1279),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 230/381 (60%), Positives = 290/381 (76%), Gaps = 2/381 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEI-ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAIEC+  +     ++ +  EN+ ++ +VFD+S L+++ N+P +F+WPD EKP      E
Sbjct  1     MAIECITSSAKLMTQKSDKNENEGSSKLVFDASFLKNQLNLPKQFIWPDDEKPC-MNVPE  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP+ID   F SGDP A  E  K + EAC+KHGFFLVVNHG+DT+L+      M+ +FE
Sbjct  60    LDVPLIDFKNFLSGDPFAAMEASKTIGEACEKHGFFLVVNHGIDTKLIEHAHSYMNDFFE  119

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             +PLS K++  RK GEHCGYASSFTGRF++ LPWKETLSF+FS EK  S++V++Y   TLG
Sbjct  120   VPLSQKQRCQRKTGEHCGYASSFTGRFSSNLPWKETLSFQFSDEKNSSNIVKDYLSNTLG  179

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             ++F   GE+YQ+YC AM+ L+L I ELLGM LGV ++ F +F++EN S++RLNYYPPCQK
Sbjct  180   EDFQQFGEVYQEYCEAMSKLSLGIMELLGMSLGVGKECFRDFFEENKSIMRLNYYPPCQK  239

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW ++ P  NAFVVNIGDTFMALSNG 
Sbjct  240   PDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSIRPNFNAFVVNIGDTFMALSNGR  299

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVNN+  RKS+AFFLCP  DKVV+PP ELV+   P++YPDF WP LLE+TQ 
Sbjct  300   YKSCLHRAVVNNKTTRKSLAFFLCPKGDKVVSPPSELVNDLTPRIYPDFTWPMLLEFTQK  359

Query  286   HYRSDTDTLLNFATWLQQNQT  224
             HYR+D  TL  F  W+QQ Q 
Sbjct  360   HYRADMRTLEAFTKWIQQKQN  380



>emb|CAP12881.1| putative gibberellic acid 20-oxidase [Kalanchoe blossfeldiana]
Length=370

 Score =   496 bits (1276),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 225/350 (64%), Positives = 284/350 (81%), Gaps = 1/350 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+SVL H++ IP +F+WPD EKP P   RE  VP++D+  F + D  A  E  KLV 
Sbjct  14    LVFDASVLSHQTQIPKQFIWPDEEKPLP-NLRELPVPLLDLNGFLAHDAAATNEAAKLVG  72

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EAC+KHGFFLVVNHGVD +LL+D  + MD +F+LPL+ K++A RK+GEHCGYASSFTGRF
Sbjct  73    EACEKHGFFLVVNHGVDAKLLADAHKYMDHFFDLPLAEKQRAQRKVGEHCGYASSFTGRF  132

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
             ++KLPWKETLSFRFSAE+  + +V EYF+ T+G++F  LG +YQ YC AM+ L+L I EL
Sbjct  133   SSKLPWKETLSFRFSAEENKADIVREYFKSTMGEDFEHLGRVYQHYCKAMSRLSLGIMEL  192

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LGM LGV R +F +F++ENDS++RLNYYPPCQKP+ TLGTGPHCDPTSLTILHQD V GL
Sbjct  193   LGMSLGVGRDYFRDFFEENDSIMRLNYYPPCQKPDQTLGTGPHCDPTSLTILHQDQVGGL  252

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVF DNEW +++P  +AFVVNIGDTFMALSNG YKSC+HRAVVN++ PRKS+AFFL P  
Sbjct  253   QVFADNEWWSISPMADAFVVNIGDTFMALSNGRYKSCLHRAVVNSQSPRKSLAFFLSPKG  312

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQ  236
             D+VV+PP +LV+ T P++YPDF WP LLE+TQ HYR+D +TL  F++W+Q
Sbjct  313   DRVVSPPNQLVNPTVPRIYPDFTWPKLLEFTQKHYRADMNTLDAFSSWIQ  362



>gb|ABB00359.1| gibberellin 20-oxidase [Fragaria x ananassa]
Length=373

 Score =   494 bits (1273),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 229/380 (60%), Positives = 295/380 (78%), Gaps = 8/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MA+ CM    T +H +++ + KP   +VFD+S+LR+E++IP +F+WPD EKP P   RE 
Sbjct  1     MAVGCM---KTLSHHKED-DQKP---LVFDASLLRYETDIPKQFIWPDDEKPCP-NTREL  52

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             QVP+ID+  F SG+P A  +  +LV EAC+KHGFFLVVNH V   L++D  + MD +F L
Sbjct  53    QVPLIDLGDFLSGNPEAAMKASRLVGEACEKHGFFLVVNHRVKESLIADAHQYMDEFFGL  112

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PLS K++  RK GEHCGYASSFTGRF++KLPWKETLSF ++A++  S+VV++Y    +G+
Sbjct  113   PLSEKQRTQRKAGEHCGYASSFTGRFSSKLPWKETLSFSYTADQSSSNVVKDYLCNAMGE  172

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF + G +YQ Y  AM+TL++ I ELLGM LGV R HF EF+ +NDS++RLNYYPPCQKP
Sbjct  173   EFDEFGRVYQDYSEAMSTLSIGIMELLGMSLGVGRTHFKEFFGDNDSIMRLNYYPPCQKP  232

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             + TLGTGPHCDPTSLTILHQD V G +VFVD EWR+++P  NAFVVNIGD FMALSNG Y
Sbjct  233   DQTLGTGPHCDPTSLTILHQDQVGGPEVFVDEEWRSISPNLNAFVVNIGDAFMALSNGRY  292

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP  DKVV PP EL+D+++P++YPDF WP LLE+TQ H
Sbjct  293   KSCLHRAVVNSKTPRKSLAFFLCPKDDKVVKPPRELIDSSYPRIYPDFTWPMLLEFTQKH  352

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D  TL  F  WLQ+ ++
Sbjct  353   YRADMKTLQAFTNWLQEQRS  372



>gb|AFL46503.1| gibberellin 20-oxidase [Prunus dulcis]
Length=387

 Score =   495 bits (1274),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 235/388 (61%), Positives = 293/388 (76%), Gaps = 15/388 (4%)
 Frame = -3

Query  1363  MAIECMIPT----------PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHE  1214
             MAIECMI T          P+   E ++ + KP   +VFD+SVLR+++ IP +F+WPD E
Sbjct  1     MAIECMITTRRSTQSMAQPPSLKTEHKQDDQKP---LVFDASVLRYQTEIPKQFIWPDEE  57

Query  1213  KPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDG  1034
             KP      E QVP+ID+  F SG+  A  +   +V EAC+KHGFFLVVNHGVD +L++D 
Sbjct  58    KPCANTP-ELQVPLIDLGGFLSGNKKAATKASTIVGEACQKHGFFLVVNHGVDNQLIADA  116

Query  1033  VREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVV  854
              R M  +F LPLS K++A R LGEHCGYASSFTGRF++KLPWKETLSFR+SA+K  S +V
Sbjct  117   HRYMGDFFGLPLSEKQRAQRLLGEHCGYASSFTGRFSSKLPWKETLSFRYSADKRSSSIV  176

Query  853   EEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLR  674
             ++Y    +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR HF EF+++NDS++R
Sbjct  177   QDYLCSKMGEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAHFKEFFEDNDSIMR  236

Query  673   LNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGD  494
             LNY PPCQKP+ TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVNIGD
Sbjct  237   LNYCPPCQKPDQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDKWHSISPNLNAFVVNIGD  296

Query  493   TFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATH-PKLYPDFK  317
             TFMALSNG YKSC+HRAVVN++ PRKS AFFLCP  DKVV PP  LVD T  P++YPDF 
Sbjct  297   TFMALSNGRYKSCLHRAVVNSQTPRKSPAFFLCPRDDKVVKPPNGLVDDTSCPRIYPDFT  356

Query  316   WPALLEYTQLHYRSDTDTLLNFATWLQQ  233
             WP LLE+TQ HYR+D  TL  F+ WLQQ
Sbjct  357   WPMLLEFTQKHYRADMKTLQVFSNWLQQ  384



>ref|XP_002272415.2| PREDICTED: gibberellin 20 oxidase 1-D-like [Vitis vinifera]
 gb|AGQ42623.1| GA20ox1 [Vitis vinifera]
Length=384

 Score =   494 bits (1271),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 226/382 (59%), Positives = 293/382 (77%), Gaps = 6/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQ-----EIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MA+EC   T      R      +  N    ++VFD+SVL+++S IP++F+WPD EKP   
Sbjct  1     MAMECCTSTMLMPPPRPPLKPLDEANTQHQSLVFDASVLKYQSTIPSQFIWPDEEKPCAK  60

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
                E  VP ID+  F S DP+A++   +LV+EAC+KHGFFLVVNHGVD +L+++  + MD
Sbjct  61    PP-ELLVPPIDLGGFLSADPLAISNAARLVNEACRKHGFFLVVNHGVDAQLVTEAHKNMD  119

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
              +F + LS K++A RK+G+HCGYASSFTGRF+ KLPWKETLSFR+  + + S ++E+YF 
Sbjct  120   FFFNMSLSEKQRAQRKVGDHCGYASSFTGRFSTKLPWKETLSFRYCDDDQSSRIIEKYFS  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
               +G++F   G +YQ+YC AM+ L+L I ELLGM LGV R++F EF++ NDS++RLNYYP
Sbjct  180   NVMGEDFKQFGRVYQQYCEAMSRLSLGIMELLGMSLGVGREYFREFFEGNDSIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP LTLGTGPHCDPTSLTILHQD VSGLQVFVD +W +++P   AFVVNIGDTFMAL
Sbjct  240   PCQKPNLTLGTGPHCDPTSLTILHQDQVSGLQVFVDEKWHSISPNSEAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG+YKSC+HRAVVN++ PRKS+AFFLCP  +KVV+PP  LVDA +P++YPDF W +LLE
Sbjct  300   SNGIYKSCLHRAVVNSQTPRKSLAFFLCPKMEKVVSPPNGLVDANNPRIYPDFTWSSLLE  359

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+DT TL  F+ WLQQ
Sbjct  360   FTQKHYRADTKTLHVFSNWLQQ  381



>emb|CAN77383.1| hypothetical protein VITISV_006349 [Vitis vinifera]
Length=367

 Score =   492 bits (1266),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 284/357 (80%), Gaps = 1/357 (0%)
 Frame = -3

Query  1303  NKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAE  1124
             N    ++VFD+SVL+++S IP++F+WPD EKP      E  VP ID+  F S DP+A++ 
Sbjct  9     NTQHQSLVFDASVLKYQSTIPSQFIWPDEEKPCAKPP-ELLVPPIDLGGFLSADPLAISN  67

Query  1123  TCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYAS  944
               +LV+EAC+KHGFFLVVNHGVD +L+++  + MD +F + LS K++A RK+G+HCGYAS
Sbjct  68    AARLVNEACRKHGFFLVVNHGVDAQLVTEAHKNMDFFFNMSLSEKQRAQRKVGDHCGYAS  127

Query  943   SFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLA  764
             SFTGRF+ KLPWKETLSFR+  + + S ++E+YF   +G++F   G +YQ+YC AM+ L+
Sbjct  128   SFTGRFSTKLPWKETLSFRYCDDDQSSRIIEKYFSNVMGEDFKQFGRVYQQYCEAMSRLS  187

Query  763   LEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQ  584
             L I ELLGM LGV R++F EF++ NDS++RLNYYPPCQKP LTLGTGPHCDPTSLTILHQ
Sbjct  188   LGIMELLGMSLGVGREYFREFFEGNDSIMRLNYYPPCQKPNLTLGTGPHCDPTSLTILHQ  247

Query  583   DSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAF  404
             D VSGLQVFVD +W +++P   AFVVNIGDTFMALSNG+YKSC+HRAVVN++ PRKS+AF
Sbjct  248   DQVSGLQVFVDEKWHSISPNSEAFVVNIGDTFMALSNGIYKSCLHRAVVNSQTPRKSLAF  307

Query  403   FLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQ  233
             FLCP  +KVV+PP  L DA +P++YPDF W +LLE+TQ HYR+DT TL  F+ WLQQ
Sbjct  308   FLCPKMEKVVSPPNGLADANNPRIYPDFTWSSLLEFTQKHYRADTKTLHVFSNWLQQ  364



>ref|XP_008376762.1| PREDICTED: gibberellin 20 oxidase 2-like [Malus domestica]
Length=392

 Score =   493 bits (1269),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 234/396 (59%), Positives = 296/396 (75%), Gaps = 19/396 (5%)
 Frame = -3

Query  1363  MAIECMI-----------PTPTPNHERQ--EIENKPAAAVVFDSSVLRHESNIPTEFLWP  1223
             MA+ECMI           P+P     +Q  E + KP   +VFD+SVLR+++ IP++F+WP
Sbjct  1     MAVECMIKPSSMQTMAQPPSPQTQKTQQHKEDDQKP---LVFDASVLRYQTEIPSQFIWP  57

Query  1222  DHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELL  1043
             D EKP      E +VP+ID+  F SGD  A A+  +LV EAC+KHGFFL+VNHGVD  L+
Sbjct  58    DDEKPCKNTP-ELRVPLIDLGGFLSGDKEAAAKASQLVGEACQKHGFFLIVNHGVDNTLI  116

Query  1042  SDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS  863
             +D  R MD +F +PLS K++A RK GE CGYASSFTGRF++KLPWKETLSF +SAEK   
Sbjct  117   ADAHRCMDDFFGMPLSEKQRAQRKAGESCGYASSFTGRFSSKLPWKETLSFSYSAEKGSI  176

Query  862   HVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDS  683
             +++++YF   +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR +F EF+++NDS
Sbjct  177   NIIQDYFCNKMGEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAYFKEFFEDNDS  236

Query  682   VLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVN  503
             ++RLNYYPPCQKPE TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVN
Sbjct  237   IMRLNYYPPCQKPEQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDQWHSISPNLNAFVVN  296

Query  502   IGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPD  323
             IGDTFMALSNG YKS +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD + P+ YPD
Sbjct  297   IGDTFMALSNGKYKSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTSSPRKYPD  356

Query  322   FKWPALLEYTQLHYRSDTDTLLNFATWLQQ--NQTL  221
             F W  LLE+T  HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   FTWSMLLEFTMKHYRADVKTLQAFSNWVQQKTNQKL  392



>ref|XP_003555361.1| PREDICTED: gibberellin 20 oxidase 2-like [Glycine max]
Length=383

 Score =   492 bits (1266),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 238/382 (62%), Positives = 288/382 (75%), Gaps = 5/382 (1%)
 Frame = -3

Query  1363  MAIECMIPTPT-PNHERQEI--ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+C+   P  P    QE   E +    +VFD+SVLRH+ +IP++F+WPD EK      
Sbjct  1     MAIDCITSIPMMPQAPPQETTKEQQEQQPLVFDASVLRHQLHIPSQFIWPDEEK-ACLDE  59

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  VP ID+  F SGDPVA AE  +LV EAC+KHGFFLVVNHG+D  L+SD    M+ +
Sbjct  60    PELLVPFIDLGGFLSGDPVAAAEASRLVGEACQKHGFFLVVNHGIDQRLISDAHLYMEHF  119

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS-HVVEEYFEK  836
             F LPLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF++SA+K  S  +V++Y   
Sbjct  120   FGLPLSQKQRAQRKPGEHCGYASSFTGRFSSKLPWKETLSFQYSADKNSSPTLVKDYLCS  179

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
              +G EF   G++YQ YC+AM+ L+L I ELLGM LGV R  F EF++EN S++RLNYYPP
Sbjct  180   KMGNEFEQFGKVYQDYCDAMSRLSLGIMELLGMSLGVGRACFREFFEENSSIMRLNYYPP  239

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQKP+LTLGTGPHCDPTSLTILHQD V GLQV VDNEW ++ P  NAFVVN+GDTFMALS
Sbjct  240   CQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVCVDNEWHSIKPDFNAFVVNVGDTFMALS  299

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD   P+LYPDF WP LLE+
Sbjct  300   NGRYKSCLHRAVVNSQTTRKSLAFFLCPRSDKVVSPPCELVDNLGPRLYPDFTWPMLLEF  359

Query  295   TQLHYRSDTDTLLNFATWLQQN  230
             TQ HYR+D  TL  FA WLQ+ 
Sbjct  360   TQKHYRADMKTLEAFANWLQRK  381



>ref|XP_010255609.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Nelumbo nucifera]
Length=381

 Score =   491 bits (1263),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 228/377 (60%), Positives = 286/377 (76%), Gaps = 4/377 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             M ++C         E ++ E +   ++VFD+SVL+++ NIPT+F+WPD EKP   A  E 
Sbjct  1     MTVDCTAIVSLDGREDKKDEQQ---SLVFDASVLQYQPNIPTQFVWPDDEKPSAEAP-EL  56

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VP+I++    SGDPVA  E  +LV EACKKHGFF+VVNHGV+  L++D  R MD +F +
Sbjct  57    RVPLINLGKVLSGDPVAALEASRLVGEACKKHGFFVVVNHGVEARLIADAHRYMDLFFGM  116

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL  K++A RK GE CGYASSFTGRF++KLPWKETLSF + A+ + +  VEEYF   LG+
Sbjct  117   PLHQKQRAQRKPGESCGYASSFTGRFSSKLPWKETLSFSYMADVQSNTTVEEYFLNVLGE  176

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
              F D G  YQ+YC AM+TL++ I ELLGM LGV   H+ +F++ NDS++RLNYYPPCQKP
Sbjct  177   GFRDFGRAYQEYCEAMSTLSVRIMELLGMSLGVGPTHYRDFFEGNDSIMRLNYYPPCQKP  236

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
              LTLGTGPHCDPTSLTILHQD V GLQVFVD +WR+++P   AFVVNIGDTFMALSNG Y
Sbjct  237   LLTLGTGPHCDPTSLTILHQDQVGGLQVFVDGQWRSISPNSEAFVVNIGDTFMALSNGQY  296

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++ PRKS+AFFLCP  DKVV PP  LVD+ HP++YPDF W +LLE+TQ H
Sbjct  297   KSCLHRAVVNSKTPRKSLAFFLCPQVDKVVCPPRGLVDSEHPRMYPDFTWSSLLEFTQKH  356

Query  283   YRSDTDTLLNFATWLQQ  233
             YRSD  TL  F+ WL+Q
Sbjct  357   YRSDMKTLDTFSNWLRQ  373



>ref|XP_008376499.1| PREDICTED: gibberellin 20 oxidase 2-like [Malus domestica]
Length=392

 Score =   491 bits (1263),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 233/396 (59%), Positives = 296/396 (75%), Gaps = 19/396 (5%)
 Frame = -3

Query  1363  MAIECMI-----------PTPTPNHERQ--EIENKPAAAVVFDSSVLRHESNIPTEFLWP  1223
             MA+ECMI           P+P     +Q  E + KP   +VFD+SV R+++ IP++F+WP
Sbjct  1     MAVECMIKPSSLQTMTQPPSPKTQQTQQHKEDDQKP---LVFDASVFRYQTEIPSQFIWP  57

Query  1222  DHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELL  1043
             DHEKP      E QV +ID+  F SGD  AVA+  +LV EAC+KHGFFL+VNHGVD +L+
Sbjct  58    DHEKPCKNTP-ELQVALIDLGGFLSGDKEAVAKASQLVGEACQKHGFFLIVNHGVDNKLI  116

Query  1042  SDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS  863
             +D    MD +F +PLS K++A RK GE CGYASSFTGRF++KLPWKETLSF +SAEK  +
Sbjct  117   ADAHCYMDDFFGMPLSEKQRAERKAGESCGYASSFTGRFSSKLPWKETLSFSYSAEKGST  176

Query  862   HVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDS  683
             + +++YF   +G+EF + G +YQ YC AM+TL++ I ELLG+ LGVDR +F EF+++N+S
Sbjct  177   NFIQDYFCDKMGEEFKEFGRVYQDYCKAMSTLSIGIMELLGLSLGVDRAYFKEFFEDNNS  236

Query  682   VLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVN  503
             ++RLNYYPPCQ+PE TLGTGPHCDPTSLTILH+D V GL+VFVD++W +V P  NAFVVN
Sbjct  237   IMRLNYYPPCQRPEQTLGTGPHCDPTSLTILHEDQVGGLEVFVDDQWHSVTPNLNAFVVN  296

Query  502   IGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPD  323
             IGDTFMALSNG YKS +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD + P+ YPD
Sbjct  297   IGDTFMALSNGKYKSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTSSPRKYPD  356

Query  322   FKWPALLEYTQLHYRSDTDTLLNFATWLQQ--NQTL  221
             F W  LLE+T  HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   FTWSMLLEFTMKHYRADMKTLQVFSNWVQQKSNQKL  392



>emb|CAD19319.1| GA20 oxidase [Beta vulgaris]
Length=389

 Score =   490 bits (1262),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 233/386 (60%), Positives = 289/386 (75%), Gaps = 9/386 (2%)
 Frame = -3

Query  1363  MAIECM---IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CM     TP      ++ +N P   ++FD+S L H+S+IP +F+WPD EKP     
Sbjct  1     MAIDCMRNLSSTPKSYQNSKQEQNNP---LIFDASFLNHQSHIPQQFIWPDGEKPDFIEP  57

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  VP+ID+  F S DP    +  KL+ EAC KHGFFLVVNHGV+ +L+ D    MD +
Sbjct  58    EELAVPLIDLQGFLSDDPEKTLKASKLIGEACLKHGFFLVVNHGVERDLIKDAHNLMDDF  117

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHV--VEEYFE  839
             FE PLS K+KALRKLGEHCGYASSFTGRF+  LPWKETLSF +S ++  S    V++YF 
Sbjct  118   FEEPLSLKQKALRKLGEHCGYASSFTGRFSCNLPWKETLSFNYSPQESSSSKTHVQDYFN  177

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
                G  F  LG  YQ+YC AM+TL+L I ELLG+ LGV R+HF EF++ ++SV+RLNYYP
Sbjct  178   NKFGDSFNHLGTTYQQYCEAMSTLSLRIMELLGLSLGVGRRHFREFFEGHESVMRLNYYP  237

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQ+P+LTLGTGPHCDPTSLTILHQD V GLQVF D +WR+++P  NAFVVNIGDTFMAL
Sbjct  238   PCQRPDLTLGTGPHCDPTSLTILHQDQVGGLQVFADGKWRSISPNFNAFVVNIGDTFMAL  297

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVD-ATHPKLYPDFKWPALL  302
             SNG YKSC+HRAVVN+E PRKS+AFFLCP+KDKVV PP ELVD   +P++YPDF WP LL
Sbjct  298   SNGRYKSCLHRAVVNSEKPRKSLAFFLCPNKDKVVKPPRELVDEENNPRVYPDFTWPLLL  357

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQT  224
             E+TQ HYR+D +TL  F+ W+QQ ++
Sbjct  358   EFTQKHYRADMNTLKVFSQWVQQQRS  383



>ref|XP_010667703.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   490 bits (1262),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 290/391 (74%), Gaps = 9/391 (2%)
 Frame = -3

Query  1363  MAIECM---IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI+CM     TP      ++ +N P   ++FD+S L H+S+IP +F+WPD EKP     
Sbjct  1     MAIDCMRNLSSTPKSYQNSKQEQNNP---LIFDASFLNHQSHIPQQFIWPDGEKPDFIEP  57

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  VP+ID+  F S DP    +  KL+ EAC KHGFFLVVNHGV+ +L+ D    MD +
Sbjct  58    EELAVPLIDLQGFLSDDPEETLKASKLIGEACLKHGFFLVVNHGVERDLIKDAHNLMDDF  117

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHV--VEEYFE  839
             FE PLS K+KALRKLGEHCGYASSFTGRF+  LPWKETLSF +S ++  S    V++YF 
Sbjct  118   FEEPLSLKQKALRKLGEHCGYASSFTGRFSCNLPWKETLSFNYSPQESSSSKTHVQDYFN  177

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
                G  F  LG  YQ+YC AM+TL+L I ELLG+ LGV R+HF EF++ ++SV+RLNYYP
Sbjct  178   NKFGDSFNHLGTTYQQYCEAMSTLSLRIMELLGLSLGVGRRHFREFFEGHESVMRLNYYP  237

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQ+P+LTLGTGPHCDPTSLTILHQD V GLQVF D +WR+++P  NAFVVNIGDTFMAL
Sbjct  238   PCQRPDLTLGTGPHCDPTSLTILHQDQVGGLQVFADGKWRSISPNFNAFVVNIGDTFMAL  297

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVD-ATHPKLYPDFKWPALL  302
             SNG YKSC+HRAVVN+E PRKS+AFFLCP+KDKVV PP ELVD   +P++YPDF WP LL
Sbjct  298   SNGRYKSCLHRAVVNSEKPRKSLAFFLCPNKDKVVKPPRELVDEENNPRVYPDFTWPLLL  357

Query  301   EYTQLHYRSDTDTLLNFATWLQQNQTLHATQ  209
             E+TQ HYR+D +TL  F+ W+QQ ++    +
Sbjct  358   EFTQKHYRADMNTLKVFSQWVQQQRSTQQVE  388



>ref|XP_004513658.1| PREDICTED: gibberellin 20 oxidase 1-like [Cicer arietinum]
Length=388

 Score =   490 bits (1261),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 230/382 (60%), Positives = 287/382 (75%), Gaps = 7/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTP----TPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAIEC+  T      P     + EN+ ++++VFD+S L+H+ N+P +F+WPD EKP    
Sbjct  1     MAIECITNTKHMTQLPKQNEVQNENEESSSLVFDASFLKHQLNLPKQFIWPDDEKPC-MN  59

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               E  VP+ID+  F S DP+A  E CKL+ EAC+KHGFFLVVNHG+D +L+      M+ 
Sbjct  60    VPELVVPLIDLKGFLSNDPLATMEACKLIGEACEKHGFFLVVNHGIDAKLIEHAHSYMND  119

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS--HVVEEYF  842
             +FE+PLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF+FS EK  +   +V++Y 
Sbjct  120   FFEIPLSQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQFSDEKNKNSPKIVKDYL  179

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
               TLG++F   G++YQ YC AM+ L+L I ELLGM LGV +  F +F++EN S++RLNYY
Sbjct  180   CNTLGEDFEQFGDVYQNYCEAMSRLSLGIMELLGMSLGVGKDCFRDFFEENKSIMRLNYY  239

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW ++ P  NAFVVNIGDTFMA
Sbjct  240   PPCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSITPNFNAFVVNIGDTFMA  299

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG YKSC+HRAVVNN+  RKS+AFFLCP  DKVV+PP ELV     ++YPDF WP LL
Sbjct  300   LSNGRYKSCLHRAVVNNKTTRKSLAFFLCPKGDKVVSPPSELVSDLTQRIYPDFTWPMLL  359

Query  301   EYTQLHYRSDTDTLLNFATWLQ  236
             E+TQ HYR+D  TL  F  W+Q
Sbjct  360   EFTQKHYRADMRTLEAFTKWIQ  381



>gb|AGG11739.1| gibberellin 20-oxidase [Malus domestica x Malus honanensis]
Length=392

 Score =   490 bits (1262),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 231/396 (58%), Positives = 297/396 (75%), Gaps = 19/396 (5%)
 Frame = -3

Query  1363  MAIECMI-----------PTPTPNHERQ--EIENKPAAAVVFDSSVLRHESNIPTEFLWP  1223
             MA+ECMI           P+P     +Q  E++ KP   +VFD+SVLR+++ IP++F+WP
Sbjct  1     MAVECMIKPSSMQTMAQPPSPQTQKTQQHKEVDQKP---LVFDASVLRYQTEIPSQFIWP  57

Query  1222  DHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELL  1043
             D EKP      E +VP+ID+  F SGD  A A+  +LV EAC+KHGFFL+VNHGVD +L+
Sbjct  58    DDEKPCKNTP-ELRVPLIDLGGFLSGDKEAAAKASQLVGEACQKHGFFLIVNHGVDNKLI  116

Query  1042  SDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS  863
             +D    MD +F +PLS K++A RK GE CGYASSFT RF++KLPWKETLSF +SAEK  +
Sbjct  117   ADAHCYMDDFFGMPLSEKQRAQRKAGESCGYASSFTDRFSSKLPWKETLSFSYSAEKGST  176

Query  862   HVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDS  683
             +++++YF   +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR +F EF+++NDS
Sbjct  177   NIIQDYFCNKMGEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAYFKEFFEDNDS  236

Query  682   VLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVN  503
             ++RLNYYPPCQKPE TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVN
Sbjct  237   IMRLNYYPPCQKPEQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDQWHSISPNLNAFVVN  296

Query  502   IGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPD  323
             IGDTFMALSNG Y+S +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD + P+ YPD
Sbjct  297   IGDTFMALSNGKYRSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTSSPRKYPD  356

Query  322   FKWPALLEYTQLHYRSDTDTLLNFATWLQQ--NQTL  221
             F W  LLE+T  HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   FTWSMLLEFTMKHYRADVKTLQAFSNWVQQKSNQKL  392



>dbj|BAB20975.1| gibberellin 20-oxidase [Malus domestica]
Length=392

 Score =   489 bits (1260),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 232/396 (59%), Positives = 296/396 (75%), Gaps = 19/396 (5%)
 Frame = -3

Query  1363  MAIECMI-----------PTPTPNHERQ--EIENKPAAAVVFDSSVLRHESNIPTEFLWP  1223
             MA+ECMI           P+P     +Q  E + KP   +VFD+SV R+++ IP++F+WP
Sbjct  1     MAVECMIKPSSLQTMTQPPSPKTQQTQQHKEDDQKP---LVFDASVFRYQTEIPSQFIWP  57

Query  1222  DHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELL  1043
             DHEKP      E QV +ID+  F SGD  AVA+  +LV EAC+KHGFFL+VNHGVD +L+
Sbjct  58    DHEKPCKNTP-ELQVALIDLGGFLSGDKEAVAKASQLVGEACQKHGFFLIVNHGVDNKLI  116

Query  1042  SDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS  863
             +D    MD +F +PLS K++A RK GE CGYASSFTGRF++KLPWKETLSF +SAEK  +
Sbjct  117   ADAHCYMDDFFGMPLSEKQRAERKAGESCGYASSFTGRFSSKLPWKETLSFSYSAEKGST  176

Query  862   HVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDS  683
             + +++YF   +G+EF + G +YQ YC AM+TL++ I ELLG+ LGVDR +F EF+++N+S
Sbjct  177   NFIQDYFCDKMGEEFKEFGRVYQDYCKAMSTLSIGIMELLGLSLGVDRAYFKEFFEDNNS  236

Query  682   VLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVN  503
             ++RLNYYPPCQ+PE TLGTGPHCDPT+LTILH+D V GL+VFVD++W +V P  NAFVVN
Sbjct  237   IMRLNYYPPCQRPEQTLGTGPHCDPTALTILHEDQVGGLEVFVDDQWHSVTPNLNAFVVN  296

Query  502   IGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPD  323
             IGDTFMALSNG YKS +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD + P+ YPD
Sbjct  297   IGDTFMALSNGKYKSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTSSPRKYPD  356

Query  322   FKWPALLEYTQLHYRSDTDTLLNFATWLQQ--NQTL  221
             F W  LLE+T  HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   FTWSMLLEFTMKHYRADMKTLQVFSNWVQQKSNQKL  392



>dbj|BAJ65441.1| gibberellin 20-oxidase [Torenia fournieri]
 dbj|BAJ76662.1| gibberellin 20-oxidase [Torenia fournieri]
Length=390

 Score =   489 bits (1258),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 292/381 (77%), Gaps = 7/381 (2%)
 Frame = -3

Query  1363  MAIECMI---PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             M I C I    T TP+       N    +++FD+++L HESNIP +F+WPDHEKP     
Sbjct  1     MPITCAINHTSTSTPHPTNSTKINDLKRSMIFDATLLNHESNIPPQFVWPDHEKPSSNPP  60

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E +VP IDM  F SGDP A     +LV EACKKHGFFLVVNHGVD EL+S     MDR+
Sbjct  61    -ELEVPFIDMGGFLSGDPAASRRASELVGEACKKHGFFLVVNHGVDRELISLAHLCMDRF  119

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSA--EKECSHVVEEYFE  839
             F+ PL  K+ A R++GEHCGYASSFTGRF++KLPWKETLSF +S    +  S +VE+YF 
Sbjct  120   FQQPLCKKQMAQRRVGEHCGYASSFTGRFSSKLPWKETLSFEYSPIDREGSSPIVEDYFV  179

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
             +TLG+++  LG +YQ YC+AMN L+L I ELLG+ LGV R  F +F+++N+S++RLNYYP
Sbjct  180   RTLGEDYGHLGRVYQDYCDAMNKLSLGIMELLGVSLGVTRTCFRDFFEQNESIMRLNYYP  239

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQKP+ TLGTGPHCDPTSLTILHQD+V GLQVFVD EWR++ P  NAFVVNIGDTFMAL
Sbjct  240   PCQKPDQTLGTGPHCDPTSLTILHQDTVGGLQVFVDQEWRSIRPNINAFVVNIGDTFMAL  299

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHP-KLYPDFKWPALL  302
             SNG+YKSC+HRAVVN++  RKS+AFFLCP KD+VV+PP  L+  ++P ++YPDF+WP+LL
Sbjct  300   SNGIYKSCLHRAVVNDQTARKSLAFFLCPKKDRVVSPPHGLLGCSNPARMYPDFRWPSLL  359

Query  301   EYTQLHYRSDTDTLLNFATWL  239
             E+TQ HYR+D DTL+ F+ W+
Sbjct  360   EFTQKHYRADMDTLMFFSKWI  380



>ref|XP_010667721.1| PREDICTED: gibberellin 20 oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
 gb|ABI95842.1| gibberellin 20-oxidase [Beta vulgaris]
Length=367

 Score =   487 bits (1254),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 279/364 (77%), Gaps = 1/364 (0%)
 Frame = -3

Query  1315  QEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPV  1136
             Q +   P     F++S+L+HE NIPT+F+WPD EKPG     E QVP ID+  F SGDPV
Sbjct  2     QALLTVPTPVPEFNTSILKHEHNIPTQFIWPDDEKPGSQTPPELQVPPIDLGGFLSGDPV  61

Query  1135  AVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHC  956
             AV+ + +L +EACKKHGFFLV NHGVD++LL+     MD +FE P S K++ALRK G+HC
Sbjct  62    AVSNSTRLANEACKKHGFFLVFNHGVDSKLLAKAHEAMDVFFEQPFSQKQRALRKQGDHC  121

Query  955   GYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAM  776
             GYASSF GRF  KLPWKETLSF +SA+ + S++VE+YF   +G EF + G++YQ+YC AM
Sbjct  122   GYASSFVGRFATKLPWKETLSFPYSADHKSSNMVEDYFFNKMGSEFQEFGKVYQEYCKAM  181

Query  775   NTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLT  596
             + L+L I ELLGM LGV+R HF +F++EN+S++RLNYYPPC KP+LTLGTGPHCDPTSLT
Sbjct  182   SNLSLGIMELLGMSLGVERSHFRDFFEENESIMRLNYYPPCLKPDLTLGTGPHCDPTSLT  241

Query  595   ILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRK  416
             ILHQD V GL+VFVD +W ++ P   AFVVNIGDTFMALSNG+YKSC+HRAVVN+E PRK
Sbjct  242   ILHQDHVGGLEVFVDQKWYSIRPNSEAFVVNIGDTFMALSNGIYKSCLHRAVVNSETPRK  301

Query  415   SIAFFLCPHKDKVVTPPPELV-DATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             S+AFFLCP  DKV++PP EL+ D    ++YPDF W   LE+TQ HYR+D  TL  F  WL
Sbjct  302   SLAFFLCPRGDKVISPPNELMEDLKSLRVYPDFTWQLFLEFTQKHYRADMKTLDTFTKWL  361

Query  238   QQNQ  227
             Q  +
Sbjct  362   QNRR  365



>gb|AEF32773.1| gibberellin 20-oxidase [Pyrus communis]
Length=392

 Score =   487 bits (1254),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 231/396 (58%), Positives = 295/396 (74%), Gaps = 19/396 (5%)
 Frame = -3

Query  1363  MAIECMI-----------PTPTPNHERQ--EIENKPAAAVVFDSSVLRHESNIPTEFLWP  1223
             MA+ECMI           P+P     +Q  E + KP   +VFD+SVLR+++ IP++F+WP
Sbjct  1     MAVECMIKPSSMQTMAQPPSPQTQKTQQHKEDDQKP---LVFDASVLRYQTEIPSQFIWP  57

Query  1222  DHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELL  1043
             D EKP      E +VP+ID+  F SGD  A A+  +LV EAC+KHGFFL+VNHGV+ +L+
Sbjct  58    DDEKPCKNTP-ELRVPLIDLGGFLSGDKEAAAKASQLVGEACQKHGFFLIVNHGVNDKLI  116

Query  1042  SDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS  863
             +D  R MD +F +PLS K++A RK GE CGYASSFTGRF++KLPWKETLSF +SA+K  +
Sbjct  117   ADAHRCMDDFFGMPLSEKQRAQRKAGESCGYASSFTGRFSSKLPWKETLSFSYSAKKGST  176

Query  862   HVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDS  683
             +++++YF   +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR +F EF+ +NDS
Sbjct  177   NIIQDYFCNKMGEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAYFKEFFDDNDS  236

Query  682   VLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVN  503
             ++RLNYYPPCQKPE TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVN
Sbjct  237   IMRLNYYPPCQKPEQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDQWHSISPNLNAFVVN  296

Query  502   IGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPD  323
             IGDTFMALSNG YKS +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD   P+ YPD
Sbjct  297   IGDTFMALSNGNYKSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTLSPRKYPD  356

Query  322   FKWPALLEYTQLHYRSDTDTLLNFATWLQQ--NQTL  221
             F W  LLE+   HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   FTWSMLLEFIMKHYRADVKTLQAFSNWVQQKTNQKL  392



>gb|KHN15696.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=372

 Score =   486 bits (1251),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 233/374 (62%), Positives = 284/374 (76%), Gaps = 5/374 (1%)
 Frame = -3

Query  1348  MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVI  1169
             M   P     +++ E +P   +VFD+SVLRH+ +IP++F+WPD EK       E  VP I
Sbjct  1     MPQAPPQETTKEQQEQQP---LVFDASVLRHQLHIPSQFIWPDEEK-ACLDEPELLVPFI  56

Query  1168  DMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFK  989
             D+  F SGDPVA AE  +LV EAC+KHGFFLVVNHG+D  L+SD    M+ +F LPLS K
Sbjct  57    DLGGFLSGDPVAAAEASRLVGEACQKHGFFLVVNHGIDQRLISDAHLYMEHFFGLPLSQK  116

Query  988   EKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS-HVVEEYFEKTLGQEFAD  812
             ++A RK GEHCGYASSFTGRF++KLPWKETLSF++SA+K  S  +V++Y    +G EF  
Sbjct  117   QRAQRKPGEHCGYASSFTGRFSSKLPWKETLSFQYSADKNSSPTLVKDYLCSKMGNEFEQ  176

Query  811   LGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTL  632
              G++YQ YC+AM+ L+L I ELLGM LGV R  F EF++EN S++RLNYYPPCQKP+LTL
Sbjct  177   FGKVYQDYCDAMSRLSLGIMELLGMSLGVGRACFREFFEENSSIMRLNYYPPCQKPDLTL  236

Query  631   GTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCM  452
             GTGPHCDPTSLTILHQD V GLQV VDNEW ++ P  NAFVVN+GDTFMALSNG YKSC+
Sbjct  237   GTGPHCDPTSLTILHQDQVGGLQVCVDNEWHSIKPDFNAFVVNVGDTFMALSNGRYKSCL  296

Query  451   HRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSD  272
             HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD   P+LYPDF WP LLE+TQ HYR+D
Sbjct  297   HRAVVNSQTTRKSLAFFLCPRSDKVVSPPCELVDNLGPRLYPDFTWPMLLEFTQKHYRAD  356

Query  271   TDTLLNFATWLQQN  230
               TL  FA WLQ+ 
Sbjct  357   MKTLEAFANWLQRK  370



>ref|XP_009371252.1| PREDICTED: gibberellin 20 oxidase 2-like [Pyrus x bretschneideri]
Length=381

 Score =   486 bits (1251),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 227/385 (59%), Positives = 292/385 (76%), Gaps = 10/385 (3%)
 Frame = -3

Query  1357  IECMIPTPTPNHER----QEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             ++ M   P+P  ++    +E + KP   +VFD+SVLR+++ IP++F+WPD EKP      
Sbjct  1     MQTMAQPPSPQTQKTQQHKEDDQKP---LVFDASVLRYQTEIPSQFIWPDDEKPCKNTP-  56

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             E +VP+ID+  F SGD  A  +  KLV EAC+KHGFFL+VNHGVD +L++D  R MD +F
Sbjct  57    ELRVPLIDLGGFLSGDKEAAVKASKLVGEACQKHGFFLIVNHGVDDKLIADAHRCMDDFF  116

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
              +PLS K++A RK GE CGYASSFTGRF++KLPWKETLSF +SA+K  ++++++YF   +
Sbjct  117   GMPLSEKQRAQRKAGESCGYASSFTGRFSSKLPWKETLSFSYSAKKGSTNIIQDYFCNKM  176

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR +F EF+ +NDS++RLNYYPPCQ
Sbjct  177   GEEFKEFGRVYQDYSEAMSTLSIGIMELLGLSLGVDRAYFKEFFDDNDSIMRLNYYPPCQ  236

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             KPE TLGTGPHCDPTSLTILHQD V GL+VFVD++W +++P  NAFVVNIGDTFMALSNG
Sbjct  237   KPEQTLGTGPHCDPTSLTILHQDQVGGLEVFVDDQWHSISPNLNAFVVNIGDTFMALSNG  296

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
              YKS +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD   P+ YPDF W  LLE+T 
Sbjct  297   KYKSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTLSPRKYPDFTWSMLLEFTM  356

Query  289   LHYRSDTDTLLNFATWLQQ--NQTL  221
              HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   KHYRADVKTLQAFSNWVQQKTNQKL  381



>ref|XP_007143346.1| hypothetical protein PHAVU_007G064800g [Phaseolus vulgaris]
 gb|AAC49757.1| gibberellin 20-oxidase [Phaseolus vulgaris]
 gb|ESW15340.1| hypothetical protein PHAVU_007G064800g [Phaseolus vulgaris]
Length=385

 Score =   486 bits (1251),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 231/378 (61%), Positives = 284/378 (75%), Gaps = 3/378 (1%)
 Frame = -3

Query  1363  MAIECMIPTPT-PNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI+ M P P  P    QEI+ +    +VFD+S+LRH+ +IP++F+WPD EK       E
Sbjct  1     MAID-MHPIPIMPQPSNQEIKEQDQHPLVFDASLLRHQLHIPSQFVWPDEEK-ACLNEPE  58

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP ID+  F SGDP+A  E  +LV EAC+KHGFFLVVNHG+  +L+SD    MD +F 
Sbjct  59    LPVPFIDLGGFLSGDPLAATEASRLVGEACQKHGFFLVVNHGIQQQLISDAHLYMDHFFA  118

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             LPLS K++A R  GEHCGYASSFTGRF++KLPWKETLSF++S   +   +V++Y    +G
Sbjct  119   LPLSHKQRAQRMPGEHCGYASSFTGRFSSKLPWKETLSFQYSPRNDSQTLVKDYLCDKMG  178

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             +EF   G +YQ YC AM+ L+L I ELLG+ LGV R +F EF++EN+S++RLNYYPPCQK
Sbjct  179   KEFEKFGNVYQDYCEAMSNLSLGIMELLGLSLGVGRGYFREFFEENNSIMRLNYYPPCQK  238

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P+LTLGTGPHCDPTSLTILHQD V GLQV VDNEW ++ P  NAFVVN+GDTFMALSNG 
Sbjct  239   PDLTLGTGPHCDPTSLTILHQDQVGGLQVCVDNEWHSIKPDVNAFVVNVGDTFMALSNGR  298

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVN+E  RKS+AFFLCP  DKVV+PP ELVD   P+LYPDF WP LLE+TQ 
Sbjct  299   YKSCLHRAVVNSETTRKSLAFFLCPRSDKVVSPPCELVDKLSPRLYPDFTWPMLLEFTQK  358

Query  286   HYRSDTDTLLNFATWLQQ  233
             HYR+D  TL  F  WLQ+
Sbjct  359   HYRADMKTLEAFTNWLQR  376



>dbj|BAJ53138.1| JHL05D22.9 [Jatropha curcas]
 gb|KDP28716.1| hypothetical protein JCGZ_14487 [Jatropha curcas]
Length=371

 Score =   485 bits (1249),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/371 (61%), Positives = 290/371 (78%), Gaps = 5/371 (1%)
 Frame = -3

Query  1342  PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDM  1163
             P P    +  E E +P   +VF+  +L+HESNIP++F+WP+ EKP    + + ++P ID+
Sbjct  4     PEPPQRADHVEQEKEP---LVFEL-ILQHESNIPSQFIWPEDEKPC-LDSPQLEIPPIDL  58

Query  1162  AAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEK  983
              +F S DP   A+T +LV+EACKKHGFFLVVNHGVD++L++     MD +F +PL+ K++
Sbjct  59    GSFLSRDPKVEAKTIELVNEACKKHGFFLVVNHGVDSQLIAKAHEYMDIFFRMPLAEKQR  118

Query  982   ALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGE  803
             A RK+GEHCGYASSFTGRF++KLPWKETLSFR+SA+   S++V+EYF   +G +F   G+
Sbjct  119   AQRKIGEHCGYASSFTGRFSSKLPWKETLSFRYSADDNLSNIVQEYFINVMGPDFKQFGQ  178

Query  802   LYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTG  623
             +YQ+YC AMN+L+L I ELLG+ LG+ R +F EF+QENDS++RLN+YPPCQKP+ TLGTG
Sbjct  179   VYQEYCEAMNSLSLGIMELLGISLGLGRAYFREFFQENDSIMRLNHYPPCQKPDFTLGTG  238

Query  622   PHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRA  443
             PHCDPTSLTILHQD V GLQVFVD++W AV P P AFVVNIGDTFMALSNG++KSC+HRA
Sbjct  239   PHCDPTSLTILHQDEVGGLQVFVDDKWHAVRPDPQAFVVNIGDTFMALSNGIFKSCLHRA  298

Query  442   VVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDT  263
             VVNN   RKS+AFFLCP+ +KVV PP  LVD  +P+ YPDF W  LLE+TQ HYR+D  T
Sbjct  299   VVNNRRERKSLAFFLCPNMEKVVKPPHNLVDLKNPRKYPDFTWSTLLEFTQKHYRADMKT  358

Query  262   LLNFATWLQQN  230
             L  F TWLQQN
Sbjct  359   LDVFTTWLQQN  369



>ref|XP_002301315.1| gibberellin 20-oxidase family protein [Populus trichocarpa]
 gb|EEE80588.1| gibberellin 20-oxidase family protein [Populus trichocarpa]
Length=366

 Score =   484 bits (1247),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 218/351 (62%), Positives = 283/351 (81%), Gaps = 1/351 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+S+L+H++NIP++F+WPDHEKP    + +  +P ID  +F +GDP+AV++  +LV+
Sbjct  14    LVFDASILQHQANIPSQFIWPDHEKPC-LESPKLAIPPIDFGSFLTGDPLAVSKATQLVN  72

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EACKKHGFFLVVNHGVD++L++     M+ +F + LS K++A RK+GE  GYASSFTGRF
Sbjct  73    EACKKHGFFLVVNHGVDSKLIAKAHEYMNMFFGIQLSEKQRAQRKIGEQYGYASSFTGRF  132

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
             ++KLPWKETLSFR+ A+ + S +V+EYF   +G+ F   G++YQ+YC AMNTL+L I EL
Sbjct  133   SSKLPWKETLSFRYCADNQSSDIVQEYFLNVMGENFKQFGKVYQEYCEAMNTLSLGIMEL  192

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LG+ LGV R++F +F++ NDS++RLNYYPPCQKP+LTLGTGPHCDPTSLTILHQD V GL
Sbjct  193   LGVSLGVGREYFRDFFEGNDSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDHVGGL  252

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVFVD +W +V+P P AFVVNIGDTF ALSNG++KSC+HRAVVNN   RKS+AFFLCP  
Sbjct  253   QVFVDEKWHSVSPDPEAFVVNIGDTFTALSNGIFKSCLHRAVVNNVTVRKSLAFFLCPKL  312

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQ  233
             DKVV PP  L+D+ +P++YPDF WP L E+TQ HYR+D  TL  F TWLQQ
Sbjct  313   DKVVKPPNTLIDSKNPRVYPDFTWPTLSEFTQKHYRADMKTLDVFTTWLQQ  363



>ref|XP_006490964.1| PREDICTED: gibberellin 20 oxidase 2-like [Citrus sinensis]
Length=372

 Score =   484 bits (1247),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 227/379 (60%), Positives = 287/379 (76%), Gaps = 11/379 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             M+++C   +  P  E+          +VFD+SVL+ +S IP++F+WPD EKP      E 
Sbjct  1     MSMDCYNSSILPTQEQ---------LLVFDASVLQFQSTIPSQFIWPDGEKPS-LELPEL  50

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              +P ID+ +F SGDP  V + C+LVDEACKKHGFFLVVNHGVD+ L+    + MD +F  
Sbjct  51    VIPPIDLCSFLSGDPFEVDKICQLVDEACKKHGFFLVVNHGVDSMLIKKAHKYMDSFFAT  110

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKE-CSHVVEEYFEKTLG  827
              LS K+KA RK+G+HCGY+SSFTGRF+ KLPWKETL+FR+ A  E  S VVE+YF   +G
Sbjct  111   QLSKKQKAQRKIGDHCGYSSSFTGRFSNKLPWKETLTFRYRANDENSSTVVEDYFFNVMG  170

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             Q+F   G++YQ+YC AM++L+L I ELLGM LGV R HF EF+Q +DS++RLNYYPPCQK
Sbjct  171   QDFRQFGKVYQEYCEAMSSLSLGIMELLGMSLGVGRAHFREFFQGHDSIMRLNYYPPCQK  230

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P LTLGTGPHCDPTSLTILHQD V GLQV+VD +W++V+P P+AFVVNIGDTFMALSNG+
Sbjct  231   PNLTLGTGPHCDPTSLTILHQDQVGGLQVYVDEQWQSVSPNPDAFVVNIGDTFMALSNGI  290

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRA VNN   RKS+AFFLCP  DKVVTPP  LV+A +P++YPDF W  LL +TQ 
Sbjct  291   YKSCLHRAAVNNTTVRKSLAFFLCPKMDKVVTPPNNLVNANNPRIYPDFTWHNLLHFTQN  350

Query  286   HYRSDTDTLLNFATWLQQN  230
             ++R+D  TL  F+ WLQQ+
Sbjct  351   YFRADVKTLNAFSAWLQQH  369



>gb|ACJ54434.1| gibberellin 20-oxidase 2 [Citrus sinensis x Citrus trifoliata]
 gb|ACJ54436.1| gibberellin 20-oxidase 2 [Citrus sinensis x Citrus trifoliata]
Length=372

 Score =   484 bits (1246),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 227/379 (60%), Positives = 287/379 (76%), Gaps = 11/379 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             M+++C   +  P  E+          +VFD+SVL+ +S IP++F+WPD EKP      E 
Sbjct  1     MSMDCYNSSILPTQEQ---------LLVFDASVLQFQSTIPSQFIWPDGEKPS-LELPEL  50

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              +P ID+ +F SGDP  V + C+LVDEACKKHGFFLVVNHGVD+ L+    + MD +F  
Sbjct  51    VIPPIDLRSFLSGDPFEVDKICQLVDEACKKHGFFLVVNHGVDSMLIKKAHKYMDSFFAT  110

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKE-CSHVVEEYFEKTLG  827
              LS K+KA RK+G+HCGY+SSFTGRF+ KLPWKETL+FR+ A  E  S VVE+YF   +G
Sbjct  111   QLSKKQKAQRKIGDHCGYSSSFTGRFSNKLPWKETLTFRYRANDENSSTVVEDYFFNVMG  170

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             Q+F   G++YQ+YC AM++L+L I ELLGM LGV R HF EF+Q +DS++RLNYYPPCQK
Sbjct  171   QDFRQFGKVYQEYCEAMSSLSLGIMELLGMSLGVGRAHFREFFQGHDSIIRLNYYPPCQK  230

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             P LTLGTGPHCDPTSLTILHQD V GLQV+VD +W++V+P P+AFVVNIGDTFMALSNG+
Sbjct  231   PNLTLGTGPHCDPTSLTILHQDQVGGLQVYVDEQWQSVSPNPDAFVVNIGDTFMALSNGI  290

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRA VNN   RKS+AFFLCP  DKVVTPP  LV+A +P++YPDF W  LL +TQ 
Sbjct  291   YKSCLHRAAVNNTTVRKSLAFFLCPKMDKVVTPPNNLVNANNPRIYPDFTWHNLLHFTQN  350

Query  286   HYRSDTDTLLNFATWLQQN  230
             ++R+D  TL  F+ WLQQ+
Sbjct  351   YFRADVKTLNAFSAWLQQH  369



>gb|AIN45172.1| gibberellin 20 oxidase 1 [Rosa hybrid cultivar]
Length=378

 Score =   483 bits (1243),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 223/379 (59%), Positives = 291/379 (77%), Gaps = 11/379 (3%)
 Frame = -3

Query  1348  MIPTPTP-------NHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             M+  P P       N  + E E  P   +VFD+ VL++ESNIP +F+WPD +KP P    
Sbjct  1     MLAMPMPPNHPSSLNQTKHENERTP---LVFDAPVLQYESNIPPQFIWPDDDKPCP-ERP  56

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             E  VP ID+  F SGD + V+E  + VDEACKKHGFFL+VNHGVD++L++     MD +F
Sbjct  57    ELHVPPIDLKGFLSGDALIVSEAIRSVDEACKKHGFFLIVNHGVDSQLIAKAHEYMDAFF  116

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
              + L+ K++A RK+G+ CGYASSFTGRF++KLPWKETLSFR+  +++CS VV++YF   +
Sbjct  117   SMKLAEKQRAQRKVGDSCGYASSFTGRFSSKLPWKETLSFRYCTDRQCSTVVKDYFVNVM  176

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G++F + G++YQ+Y  AMN L+  I ELLG+ LGV R++F EF++ NDS++RLNYYP CQ
Sbjct  177   GEDFTEFGKVYQEYGEAMNNLSNGIMELLGLSLGVGREYFKEFFEGNDSIMRLNYYPICQ  236

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             KP+LTLGTGPHCDPTSLTILHQD V GL+VFVD +W A+ P  ++FV+N+GDTFMALSNG
Sbjct  237   KPDLTLGTGPHCDPTSLTILHQDQVGGLEVFVDEKWHAITPILDSFVINVGDTFMALSNG  296

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
             +YKSC+HRAVVNN+I RKS+AFFLCP+KDKVVTPP  LVD   P+LYPDF WP+LLE+TQ
Sbjct  297   IYKSCLHRAVVNNKIVRKSLAFFLCPNKDKVVTPPTSLVDTETPRLYPDFTWPSLLEFTQ  356

Query  289   LHYRSDTDTLLNFATWLQQ  233
              HYR+DT TL  F+ W+ +
Sbjct  357   KHYRADTRTLDAFSDWISR  375



>ref|XP_004308423.1| PREDICTED: gibberellin 20 oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=376

 Score =   483 bits (1242),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 285/373 (76%), Gaps = 1/373 (0%)
 Frame = -3

Query  1348  MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVI  1169
             M P+  P+   Q        ++VFD+ VL++ESNIP +F+WPD+EKP P    E  VP I
Sbjct  3     MPPSNHPSSLNQTKHENERTSLVFDAPVLQYESNIPPQFIWPDNEKPCP-DRLELLVPPI  61

Query  1168  DMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFK  989
             D+  F +GD   V+E  + VDEACKKHGFFL+VNHGVD +L+      MD +F + L+ K
Sbjct  62    DLKGFLTGDASVVSEAIRTVDEACKKHGFFLIVNHGVDFQLIEKAHEYMDAFFSMKLAEK  121

Query  988   EKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADL  809
             ++A RK+G+ CGYASSFTGRF++KLPWKETLSFR  A+ +CS +V++YF   +G++FA+ 
Sbjct  122   QRAQRKVGDSCGYASSFTGRFSSKLPWKETLSFRSCADSQCSTIVKDYFVNVMGEDFAEF  181

Query  808   GELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLG  629
             G++YQ+Y  AMN L   I ELLG+ LGV R++F EF++ NDS++RLNYYP CQKP+LTLG
Sbjct  182   GKVYQEYVEAMNNLTNGIMELLGLSLGVGREYFKEFFEGNDSIMRLNYYPICQKPDLTLG  241

Query  628   TGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMH  449
             TGPHCDPTSLTILHQD V GL+VFVD +W A+ P  ++FV+N+GDTFMALSNG+YKSC+H
Sbjct  242   TGPHCDPTSLTILHQDQVGGLEVFVDEKWHAITPILDSFVINVGDTFMALSNGIYKSCLH  301

Query  448   RAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDT  269
             RAVVNN+  RKS+AFFLCP+KDKVVTPP  LVD   P+LYPDF WP+LLE+TQ HYR+D 
Sbjct  302   RAVVNNKTVRKSLAFFLCPNKDKVVTPPTSLVDTETPRLYPDFTWPSLLEFTQKHYRADI  361

Query  268   DTLLNFATWLQQN  230
              TL  F+ W+ QN
Sbjct  362   RTLDAFSDWISQN  374



>ref|XP_006445204.1| hypothetical protein CICLE_v10020694mg [Citrus clementina]
 gb|ESR58444.1| hypothetical protein CICLE_v10020694mg [Citrus clementina]
 gb|KDO85919.1| hypothetical protein CISIN_1g041132mg [Citrus sinensis]
Length=370

 Score =   482 bits (1241),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 223/353 (63%), Positives = 278/353 (79%), Gaps = 2/353 (1%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+SVL+ +S IP++F+WPD EKP      E  +P ID+ +F SGDP  V + C+LVD
Sbjct  16    LVFDASVLQFQSTIPSQFIWPDGEKPS-LELPELVIPPIDLCSFLSGDPFEVDKICQLVD  74

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EACKKHGFFLVVNHGVD+ L+    + MD +F   LS K+KA RK+G+HCGY+SSFTGRF
Sbjct  75    EACKKHGFFLVVNHGVDSMLIKKAHKYMDSFFATQLSKKQKAQRKIGDHCGYSSSFTGRF  134

Query  925   NAKLPWKETLSFRFSAEKE-CSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             + KLPWKETL+FR+ A  E  S VVE+YF   +GQ+F   G++YQ+YC AM++L+L I E
Sbjct  135   SNKLPWKETLTFRYRANDENSSTVVEDYFFNVMGQDFRQFGKVYQEYCEAMSSLSLGIME  194

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLGM LGV R HF EF+Q +DS++RLNYYPPCQKP LTLGTGPHCDPTSLTILHQD V G
Sbjct  195   LLGMSLGVGRAHFREFFQGHDSIMRLNYYPPCQKPNLTLGTGPHCDPTSLTILHQDQVGG  254

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQV+VD +W++V+P P+AFVVNIGDTFMALSNG+YKSC+HRA VNN   RKS+AFFLCP 
Sbjct  255   LQVYVDEQWQSVSPNPDAFVVNIGDTFMALSNGIYKSCLHRAAVNNTTVRKSLAFFLCPK  314

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQN  230
              DKVVTPP  LV+A +P++YPDF W  LL +TQ ++R+D  TL  F+ WLQQ+
Sbjct  315   MDKVVTPPNNLVNANNPRIYPDFTWHNLLHFTQNYFRADVKTLNAFSAWLQQH  367



>emb|CAC83626.1| gibberellin 20-oxidase [Cucurbita maxima]
Length=378

 Score =   482 bits (1240),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/373 (61%), Positives = 278/373 (75%), Gaps = 9/373 (2%)
 Frame = -3

Query  1357  IECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQV  1178
             +  +  TP   H+         A +VFD+SVLRH+ NIP +F+WPD EKP      E +V
Sbjct  1     MHVVTSTPEARHD--------GAPLVFDASVLRHQHNIPKQFIWPDEEKPAA-TCPELEV  51

Query  1177  PVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPL  998
             P+ID++ F SG+  A AE  +LV EAC+KHGFFLVVNHGVD +L+ +  + MD +FELPL
Sbjct  52    PLIDLSGFLSGEKDAAAEAVRLVGEACEKHGFFLVVNHGVDRKLIGEAHKYMDEFFELPL  111

Query  997   SFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEF  818
             S K+ A RK GEHCGYASSFTGRF++KLPWKETLSFRF+A++  +++V  Y    LG +F
Sbjct  112   SQKQSAQRKAGEHCGYASSFTGRFSSKLPWKETLSFRFAADESLNNLVLHYLNDKLGDQF  171

Query  817   ADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPEL  638
             A  G +YQ YC AM+ L+L I ELLG  LGV+ + F  F+++NDS++RLN+YPPCQKP L
Sbjct  172   AKFGRVYQDYCEAMSGLSLGIMELLGKSLGVEEQCFKNFFKDNDSIMRLNFYPPCQKPHL  231

Query  637   TLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKS  458
             TLGTGPHCDPTSLTILHQD V GLQVFVDN+WR + P  +AFVVNIGDTFMALSNG YKS
Sbjct  232   TLGTGPHCDPTSLTILHQDQVGGLQVFVDNQWRLITPNFDAFVVNIGDTFMALSNGRYKS  291

Query  457   CMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYR  278
             C+HRAVVN+E  RKS+AFFLCP  DKVV PP ELVD  +P+ YPDF W  LL +TQ HYR
Sbjct  292   CLHRAVVNSERTRKSLAFFLCPRNDKVVRPPRELVDTQNPRRYPDFTWSMLLRFTQTHYR  351

Query  277   SDTDTLLNFATWL  239
             +D  TL  F+ WL
Sbjct  352   ADMKTLEAFSAWL  364



>ref|XP_009351069.1| PREDICTED: gibberellin 20 oxidase 2-like [Pyrus x bretschneideri]
Length=392

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 229/396 (58%), Positives = 293/396 (74%), Gaps = 19/396 (5%)
 Frame = -3

Query  1363  MAIECMIPTPT-------------PNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWP  1223
             MA+ECMI   +                + +E + KP   +VFD+SV R+++ IP++F+WP
Sbjct  1     MAVECMIKPSSMQTMTQPPSPQTQQTQQHKEDDQKP---LVFDASVFRYQTEIPSQFIWP  57

Query  1222  DHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELL  1043
             DHEKP      E QV +ID+  F SGD  AVA+  +LV EAC+KHGFFL+VNHGVD +L+
Sbjct  58    DHEKPCKNTP-ELQVALIDLGGFLSGDKEAVAKASQLVGEACQKHGFFLIVNHGVDNKLI  116

Query  1042  SDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS  863
             +D    MD +F +PLS K++  RK GE CGYASSFTGRF++KLPWKETLSF +SAEK  +
Sbjct  117   ADAHCYMDDFFGMPLSEKQRTERKAGESCGYASSFTGRFSSKLPWKETLSFSYSAEKGST  176

Query  862   HVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDS  683
             + +++YF   +G+EF + G +YQ Y  AM+TL++ I ELLG+ LGVDR +F+EF+++NDS
Sbjct  177   NFIQDYFCDKMGEEFKEFGRVYQDYSKAMSTLSIGIMELLGLSLGVDRAYFNEFFEDNDS  236

Query  682   VLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVN  503
             ++RLNYYPPCQ PE TLGTGPHCDPTSLTILHQD V GL+VFVD++W +V+P  N+FVVN
Sbjct  237   IMRLNYYPPCQTPEQTLGTGPHCDPTSLTILHQDEVGGLEVFVDDQWHSVSPNLNSFVVN  296

Query  502   IGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPD  323
             IGDTFMALSNG YKS +HRAVVN+E PRKS+AFFLCP  DKVV PP  LVD + P+ YPD
Sbjct  297   IGDTFMALSNGKYKSGLHRAVVNSETPRKSLAFFLCPRDDKVVKPPSGLVDTSSPRKYPD  356

Query  322   FKWPALLEYTQLHYRSDTDTLLNFATWLQQ--NQTL  221
             F W  LLE+T  HYR+D  TL  F+ W+QQ  NQ L
Sbjct  357   FTWSMLLEFTMKHYRADMKTLQAFSNWVQQKSNQKL  392



>ref|XP_011034875.1| PREDICTED: gibberellin 20 oxidase 1-like [Populus euphratica]
Length=381

 Score =   481 bits (1239),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 284/363 (78%), Gaps = 2/363 (1%)
 Frame = -3

Query  1297  PAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETC  1118
             P   +VFD+S+L+H +N+P++F+WPDHEKP      E  +P ID  +F +GDP+AV++  
Sbjct  16    PPEPLVFDASILQHRANLPSQFIWPDHEKPC-LEPPELSIPPIDFGSFLAGDPLAVSKLA  74

Query  1117  KLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSF  938
             + V+EACKKHGFF++VNHGVD++L++     M+ +F   LS ++ A RK+GE  GYASSF
Sbjct  75    QQVNEACKKHGFFVIVNHGVDSKLIAKAHEGMNMFFGKQLS-EKPAQRKIGEQYGYASSF  133

Query  937   TGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALE  758
             TGRF++KLPWKETLSFR+ A+ + S++V+EYF   +G+EF   G++YQ+YC AMNTL+L 
Sbjct  134   TGRFSSKLPWKETLSFRYCADNQSSNIVQEYFLNVMGEEFKQFGKVYQEYCEAMNTLSLG  193

Query  757   ITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDS  578
             I ELLG+ LGV R++F +F++ NDS++RLNYYPPCQKPELTLGTGPHCDPTSLTILHQD 
Sbjct  194   IMELLGVSLGVGREYFRDFFEGNDSIMRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDH  253

Query  577   VSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFL  398
             VSGLQVFVD +W +V P P AFVVNIGDTFMALSNG++KSC+HRAVVNN   RKS+AFFL
Sbjct  254   VSGLQVFVDEKWHSVTPDPEAFVVNIGDTFMALSNGIFKSCLHRAVVNNVTVRKSLAFFL  313

Query  397   CPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLH  218
             CP  DKVV PP  LVD  +P++YPDF WPAL E+TQ HYR+D  TL  F TWLQQ     
Sbjct  314   CPKMDKVVKPPNTLVDYKNPRVYPDFTWPALSEFTQKHYRADMKTLDVFTTWLQQKNNCG  373

Query  217   ATQ  209
              T+
Sbjct  374   GTK  376



>ref|XP_004143646.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus]
 emb|CBX88043.1| gibberellin 20-oxidase, partial [Cucumis sativus]
 gb|KGN50396.1| Gibberellin 20-oxidase [Cucumis sativus]
Length=373

 Score =   481 bits (1238),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 278/364 (76%), Gaps = 0/364 (0%)
 Frame = -3

Query  1315  QEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPV  1136
             +E  N     +VFD+SVLRH+  IP +F+WPD EKP      E +VP+ID++ F SGD  
Sbjct  10    KEAANNDGVPLVFDASVLRHQHKIPKQFIWPDEEKPSEAGCPEMEVPLIDLSGFLSGDKD  69

Query  1135  AVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHC  956
             +V E  + V EAC+KHGFFLVVNHGVD +L++D  + M+ +FELPL  K++A RK+GEHC
Sbjct  70    SVREAVRHVGEACEKHGFFLVVNHGVDLKLIADAHKYMNEFFELPLCEKQRAQRKVGEHC  129

Query  955   GYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAM  776
             GYASSFTGRF++KLPWKETLSFRFSA++     V  Y    LG  FA+ G +YQ+YC AM
Sbjct  130   GYASSFTGRFSSKLPWKETLSFRFSADESLDDHVFHYLRTKLGDRFANFGRVYQEYCEAM  189

Query  775   NTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLT  596
             + L+L I ELLG  LGV+ ++F  F+++NDS++RLN+YPPCQKP LTLGTGPHCDPTSLT
Sbjct  190   SGLSLGIMELLGKSLGVEGEYFKNFFKDNDSIMRLNFYPPCQKPHLTLGTGPHCDPTSLT  249

Query  595   ILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRK  416
             ILHQD V GLQVFVDN+WR + P  +AFVVNIGDTFMALSNG YKSC+HRAVVN++  RK
Sbjct  250   ILHQDQVGGLQVFVDNQWRLIAPNFDAFVVNIGDTFMALSNGRYKSCLHRAVVNSKRTRK  309

Query  415   SIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQ  236
             S+AFFLCP  DKVV PP ELVD  +P++YPDF W  LL++TQ +YR+D  TL  F+  LQ
Sbjct  310   SLAFFLCPRNDKVVKPPMELVDNENPRIYPDFTWSMLLQFTQNNYRADMKTLEVFSASLQ  369

Query  235   QNQT  224
             Q Q+
Sbjct  370   QQQS  373



>gb|ACD93464.1| GA 20-oxidase [Dianthus caryophyllus]
Length=392

 Score =   481 bits (1237),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/383 (60%), Positives = 290/383 (76%), Gaps = 7/383 (2%)
 Frame = -3

Query  1363  MAIECM--IPTPTPN-HERQEI--ENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI+CM  I + TP  H+   I  +N      VFD+S L H+SNIP +F+WPD +KP   
Sbjct  1     MAIDCMRSISSITPKPHQMGTINDQNNNNKPFVFDASFLNHQSNIPDQFIWPDGDKPSNN  60

Query  1198  AARE-FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
                E   VP++D+  F +G+P AV E  ++V EAC KHGFFLVVNHGV  EL+ +  + M
Sbjct  61    IYLEDLPVPMLDLQGFLTGNPEAVMEASRVVGEACVKHGFFLVVNHGVSNELVRNAHKMM  120

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS-HVVEEY  845
             D +FE PL+ K+KA RKLGEHCGYASSFTGRF++ LPWKETLSF+FS+E+ CS  +V++Y
Sbjct  121   DEFFEEPLAQKQKAQRKLGEHCGYASSFTGRFSSNLPWKETLSFQFSSEESCSSKIVQDY  180

Query  844   FEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNY  665
             F  TLG  F  LG +YQ YC AM+ L+L I ELLG+ LGV R++F EF+Q ++SV+RLNY
Sbjct  181   FTNTLGHNFDHLGTVYQDYCEAMSQLSLGIMELLGLSLGVGRRYFKEFFQGHESVMRLNY  240

Query  664   YPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFM  485
             YPPCQ+P+LTLGTGPHCDPTSLTILHQD V GLQVFVD++WR ++P  NAFVVNIGDTF 
Sbjct  241   YPPCQRPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDDKWRPISPNFNAFVVNIGDTFT  300

Query  484   ALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             ALSNG YKSC+HRAV N E PRKS+AFFLCP KD++V PP  LV+  + ++YPDF WP L
Sbjct  301   ALSNGRYKSCLHRAVTNIEKPRKSLAFFLCPSKDRLVKPPQALVNDENDRVYPDFTWPML  360

Query  304   LEYTQLHYRSDTDTLLNFATWLQ  236
             LE+TQ HYR+D +TL  F+ W+Q
Sbjct  361   LEFTQKHYRADMNTLNAFSKWVQ  383



>ref|XP_010056257.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Eucalyptus grandis]
Length=383

 Score =   480 bits (1236),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 226/382 (59%), Positives = 287/382 (75%), Gaps = 12/382 (3%)
 Frame = -3

Query  1354  ECMIPT-------PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             +C IP        PT +  + E E+ P    VFD+S+L+H++NIP++F+WPD EKP    
Sbjct  3     KCCIPMLPLQPSLPTGDLMKNESEHCP----VFDASILQHQANIPSQFVWPDDEKPSLTK  58

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
             A E  VP++D+  F SGDP AV+E    V++AC+KHGFFLVVNHGVD  L+      +D 
Sbjct  59    APELLVPLVDLGGFLSGDPTAVSEAAWRVNDACRKHGFFLVVNHGVDPRLIKKAHESVDS  118

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F + LS K++A RK GEH GYASSFTGRF++KLPWKETLSFR+SA+ + S  VE+YF  
Sbjct  119   FFRMQLSTKQRAQRKPGEHWGYASSFTGRFSSKLPWKETLSFRYSADGQSSESVEKYFSN  178

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
              +G++F + GE  Q+YC A + L+L I ELLG  LGV R HF EF++ NDS++RLNYYPP
Sbjct  179   VMGEDFREFGETCQEYCEATSNLSLGIMELLGTSLGVGRSHFREFFEGNDSIMRLNYYPP  238

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQKP+ TLGTGPHCDPTSLTILHQD VSGLQVFVD +W +V+P P+ FVVNIGDTFMALS
Sbjct  239   CQKPDQTLGTGPHCDPTSLTILHQDEVSGLQVFVDGKWYSVSPNPDTFVVNIGDTFMALS  298

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHP-KLYPDFKWPALLE  299
             NG+YKSC+HRAVVN++  RKS+AFFLCP +DKVVTPP +LVD     ++YPDF WP  LE
Sbjct  299   NGIYKSCLHRAVVNDQAVRKSLAFFLCPRRDKVVTPPSQLVDRQDSRRIYPDFTWPTFLE  358

Query  298   YTQLHYRSDTDTLLNFATWLQQ  233
             +TQ HYR+DT TL  F+ WL++
Sbjct  359   FTQKHYRADTKTLDAFSDWLRE  380



>dbj|BAD30033.1| gibberellin 20-oxidase1 [Daucus carota]
Length=381

 Score =   479 bits (1232),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 285/367 (78%), Gaps = 2/367 (1%)
 Frame = -3

Query  1336  PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAA  1157
             P  N +    +N   + VVFD+S+++ E+ IP EF+WPDHEKP     +E +VP+ID+ A
Sbjct  9     PPHNFQHSYEDNNHHSQVVFDASIIQKETTIPKEFIWPDHEKPS-LNTQELKVPLIDLGA  67

Query  1156  FRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKAL  977
             F SGDP A  E+  L+ +AC++HGFF+VVNHGVDT L+SD  + M+ +F+LPL  K+KA 
Sbjct  68    FLSGDPSAAKESSILIGQACQEHGFFMVVNHGVDTNLISDAHKFMNLFFDLPLYVKQKAQ  127

Query  976   RKLGEHCGYASSFTGRFNAKLPWKETLSFRFSA-EKECSHVVEEYFEKTLGQEFADLGEL  800
             RKLGE+ GYASSFTGRF +KLPWKET SF++ A E+  S  V++YF   LG +FA LG++
Sbjct  128   RKLGENFGYASSFTGRFASKLPWKETFSFQYCADERMSSTTVKDYFTNKLGPDFAKLGKV  187

Query  799   YQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGP  620
             YQ Y +AM+TL+L+I +LL + LGV R HF   ++++DS++RLNYYPPCQKPELTLGTGP
Sbjct  188   YQDYSHAMSTLSLKIIDLLEISLGVSRSHFKNLFEDHDSIVRLNYYPPCQKPELTLGTGP  247

Query  619   HCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAV  440
             H DPTSLTILHQD V+GL+V VD++WR + P  +AFV+NIGDT MA++NG YKSC+HRAV
Sbjct  248   HSDPTSLTILHQDHVAGLEVLVDDQWRCILPNTSAFVINIGDTLMAMTNGRYKSCLHRAV  307

Query  439   VNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTL  260
             VNNE  RKSIAFFLCP KDKVV PP ELVD  +P+LYPDF W  LL++TQ+HYR+D +TL
Sbjct  308   VNNETARKSIAFFLCPRKDKVVIPPAELVDQKNPRLYPDFTWAELLQFTQMHYRADMNTL  367

Query  259   LNFATWL  239
               F+TWL
Sbjct  368   DAFSTWL  374



>ref|XP_009380434.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Musa acuminata subsp. 
malaccensis]
Length=385

 Score =   479 bits (1232),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 270/362 (75%), Gaps = 1/362 (0%)
 Frame = -3

Query  1309  IENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAV  1130
             IE K A   VF+++VL  E  IP +F+WP+HEKP P A  E  VP+ID+   RSGDP A 
Sbjct  21    IETK-ATPPVFNAAVLSREDYIPEQFVWPEHEKPTPDAHEELSVPLIDLGGLRSGDPAAA  79

Query  1129  AETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGY  950
             A   + V  AC++HGFF VVNH +D ELL++  R  + +F +PL+ K+ A RK GE CGY
Sbjct  80    AAVTRSVAGACERHGFFHVVNHRIDAELLAEAHRAAEAFFAMPLAAKQLARRKPGESCGY  139

Query  949   ASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNT  770
             ASSFTGRF +KLPWKETLSFRFS       VV +Y    LG++F  LGE+YQ+YC AM+ 
Sbjct  140   ASSFTGRFASKLPWKETLSFRFSPSPLAGGVVRDYIVDALGEDFRHLGEVYQRYCEAMSR  199

Query  769   LALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTIL  590
             L+LEI E+LG+ LGV   HF +F++ NDS++RLNYYPPC++PELTLGTGPHCDPTSLTIL
Sbjct  200   LSLEIMEVLGLSLGVGEAHFRDFFEGNDSIMRLNYYPPCRQPELTLGTGPHCDPTSLTIL  259

Query  589   HQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSI  410
             HQD V GLQV  D  WR ++P P+AFVVNIGDTFMALSNG YKSC+HRAVVN E+PRKS+
Sbjct  260   HQDDVRGLQVLADGRWRTISPKPDAFVVNIGDTFMALSNGRYKSCLHRAVVNREVPRKSL  319

Query  409   AFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQN  230
             AFFLCP  D+VV PP  LVDA HP+ YPDF WP LLE+TQ HYR+D  TL  F +W+++ 
Sbjct  320   AFFLCPATDRVVRPPGALVDADHPRAYPDFTWPTLLEFTQKHYRADMKTLDAFTSWIRRA  379

Query  229   QT  224
             + 
Sbjct  380   EA  381



>ref|XP_004158105.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-like 
[Cucumis sativus]
Length=373

 Score =   477 bits (1227),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 277/364 (76%), Gaps = 0/364 (0%)
 Frame = -3

Query  1315  QEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPV  1136
             +E  N     +VFD+SVLRH+  IP +F+WPD EKP      E +VP+ID++ F SGD  
Sbjct  10    KEAANNDGVPLVFDASVLRHQHKIPKQFIWPDEEKPSEAGCPEMEVPLIDLSGFLSGDKD  69

Query  1135  AVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHC  956
             +V E  + V EAC+KHGFFLVVNHGVD +L++D  + M+ +FELPL  K++A RK+GEHC
Sbjct  70    SVREAVRHVGEACEKHGFFLVVNHGVDLKLIADAHKYMNEFFELPLCEKQRAQRKVGEHC  129

Query  955   GYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAM  776
             GYASSFTGRF++KLPWKETLSFRFSA++     V  Y    LG  FA+ G +YQ+YC AM
Sbjct  130   GYASSFTGRFSSKLPWKETLSFRFSADESLDDHVFHYLRTKLGDRFANFGRVYQEYCEAM  189

Query  775   NTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLT  596
             + L+L I ELLG  LGV+ ++F  F++++DS++RL +YPPCQKP LTLGTGPHCDPTSLT
Sbjct  190   SGLSLGIMELLGKSLGVEGEYFKNFFKDDDSIMRLXFYPPCQKPHLTLGTGPHCDPTSLT  249

Query  595   ILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRK  416
             ILHQD V GLQVFVDN+WR + P  +AFVVNIGDTFMALSNG YKSC+HRAVVN++  RK
Sbjct  250   ILHQDQVGGLQVFVDNQWRLIAPNFDAFVVNIGDTFMALSNGRYKSCLHRAVVNSKRTRK  309

Query  415   SIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQ  236
             S+AFFLCP  DKVV PP ELVD  +P++YPDF W  LL++TQ +YR+D  TL  F+  LQ
Sbjct  310   SLAFFLCPRNDKVVKPPMELVDNENPRIYPDFTWSMLLQFTQNNYRADMKTLEVFSASLQ  369

Query  235   QNQT  224
             Q Q+
Sbjct  370   QQQS  373



>ref|XP_007219522.1| hypothetical protein PRUPE_ppa022540mg [Prunus persica]
 gb|EMJ20721.1| hypothetical protein PRUPE_ppa022540mg [Prunus persica]
Length=374

 Score =   476 bits (1225),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 218/349 (62%), Positives = 277/349 (79%), Gaps = 3/349 (1%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+SV +++S+IP++F+WPDHEKP P    E  VP IDM  F +GD   V+    LVD
Sbjct  24    LVFDASVAQYQSSIPSKFIWPDHEKPCPEPP-ELPVPHIDMKGFLTGDTREVSNATCLVD  82

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EAC+KHGFFLVVNHGVD++L++     MD +F + LS K++A RK G+HCGYASSF GRF
Sbjct  83    EACRKHGFFLVVNHGVDSQLIAKAHEYMDLFFGMQLSQKQRAQRKTGDHCGYASSFIGRF  142

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
             ++KLPWKETLSFR+SA+  CS  V +YF   +G++F ++G++YQ+YC A++ L+  I EL
Sbjct  143   SSKLPWKETLSFRYSADSHCS--VNDYFVNVMGEDFKEIGKVYQEYCEAVSNLSSGIMEL  200

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LGM LGV +++F EF++ NDS++RLNYYP CQKP+LTLGTGPHCDPTSLTILHQD V GL
Sbjct  201   LGMSLGVGQEYFREFFEGNDSIMRLNYYPRCQKPDLTLGTGPHCDPTSLTILHQDQVGGL  260

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVFVD +WR+V P P+AFVVNIGDTFMALSNG+YKSC+HRAVVNN   RKS+ FFLCP K
Sbjct  261   QVFVDEKWRSVTPKPDAFVVNIGDTFMALSNGIYKSCLHRAVVNNRTVRKSLTFFLCPKK  320

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             D+VVTPP  LVD+  P++YPDF WP LLE+TQ HYR+D  TL  F+ W+
Sbjct  321   DRVVTPPRGLVDSKSPRMYPDFTWPTLLEFTQKHYRADMKTLDAFSDWI  369



>ref|XP_006401907.1| hypothetical protein EUTSA_v10013824mg [Eutrema salsugineum]
 gb|ESQ43360.1| hypothetical protein EUTSA_v10013824mg [Eutrema salsugineum]
Length=380

 Score =   476 bits (1224),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/383 (58%), Positives = 285/383 (74%), Gaps = 10/383 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQE----IENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAI C   T  P  + QE    +EN     ++F+ S+L  ++ IP +F+WPD EKP    
Sbjct  1     MAIICTTTTTFPAEKEQEPKQDLENDQTLPLIFNPSLLNLQTQIPNQFIWPDEEKPS-IN  59

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               E +VP ID+++  S       E  +L+ +AC KHGFFLVVNHGV   L+SD  R M+R
Sbjct  60    IPELKVPFIDLSSQDS-----TLEASRLIADACNKHGFFLVVNHGVSESLISDAHRLMER  114

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F++PL+ K++A RK GE CGYASSFTGRF+ KLPWKETLSFRFS E   S  V++YF  
Sbjct  115   FFDMPLAGKQRAQRKPGESCGYASSFTGRFSTKLPWKETLSFRFSNENSGSRTVQDYFSD  174

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             TLG+EF   G++YQ YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YPP
Sbjct  175   TLGKEFERFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPP  234

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQ P+LTLGTGPHCDP+SLTILHQD V+GLQVF DN+WR++ P P AFVVNIGDTFMALS
Sbjct  235   CQTPDLTLGTGPHCDPSSLTILHQDHVNGLQVFTDNQWRSILPNPKAFVVNIGDTFMALS  294

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG+YKSC+HRAVVN E  RKS+AFFLCP +DKVV PP E+++ T P+ YPDF WP LLE+
Sbjct  295   NGIYKSCLHRAVVNRESARKSMAFFLCPKRDKVVKPPSEILEKTTPRRYPDFTWPMLLEF  354

Query  295   TQLHYRSDTDTLLNFATWLQQNQ  227
             TQ HYR+D +TL +F+ W   N+
Sbjct  355   TQKHYRADVNTLDSFSKWAIANK  377



>emb|CDP20566.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   476 bits (1225),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 215/379 (57%), Positives = 289/379 (76%), Gaps = 6/379 (2%)
 Frame = -3

Query  1342  PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDM  1163
             P+PT N  + E       ++VFD+S L+++S+IP EF+WPDHEKP P       VP +D+
Sbjct  10    PSPTKNETKDE-----QKSLVFDASFLQNQSHIPHEFIWPDHEKPCPEPPPMLHVPCVDL  64

Query  1162  AAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEK  983
               F S DP+AV+ T +LV +AC +HGFFLVVNHGVD++LL    + MD +F+ PL  K++
Sbjct  65    NGFLSADPLAVSTTTQLVRQACLEHGFFLVVNHGVDSQLLKAAHKSMDFFFDKPLQEKQR  124

Query  982   ALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAE-KECSHVVEEYFEKTLGQEFADLG  806
               RKLG+HCGYASSFT RF++KLPWKETLSFRF A+ ++ +++VE YF   +G+++ + G
Sbjct  125   VQRKLGDHCGYASSFTNRFSSKLPWKETLSFRFCADDQQATNIVESYFLNAMGEDYREFG  184

Query  805   ELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGT  626
             +++QKYC AM++L+L + E+LG+ LGV   HF +F+  NDS++RLNYYPPCQKP+LTLGT
Sbjct  185   KVHQKYCEAMSSLSLRVMEILGISLGVGPIHFRDFFAGNDSIMRLNYYPPCQKPDLTLGT  244

Query  625   GPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHR  446
             GPHCDPTSLTILHQD V GL+V+V+ +W ++ P P AFVVNIGDTFMALSNG+YKSC+HR
Sbjct  245   GPHCDPTSLTILHQDHVGGLEVYVNGKWHSIPPDPEAFVVNIGDTFMALSNGIYKSCLHR  304

Query  445   AVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTD  266
             A+VN++ PRKS+AFFLCP  DKVV+PP ELV + +P+++PDF+W +LLE+TQ HYR+D  
Sbjct  305   AIVNSQTPRKSLAFFLCPKMDKVVSPPKELVSSDYPRMFPDFRWSSLLEFTQKHYRADMK  364

Query  265   TLLNFATWLQQNQTLHATQ  209
             TL  F  WL     L   Q
Sbjct  365   TLDAFVKWLSTEGILKIQQ  383



>ref|XP_011002082.1| PREDICTED: gibberellin 20 oxidase 1-like [Populus euphratica]
Length=387

 Score =   476 bits (1224),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 297/393 (76%), Gaps = 16/393 (4%)
 Frame = -3

Query  1396  ISLSISLSFHTMAIEC----MIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFL  1229
             + + + LS +  A++C    MI  PT    RQ +        VFD+S+L+H++NIP++F+
Sbjct  3     VCVCVCLSLY--AVDCFATNMIMPPTLPPSRQPL--------VFDASILQHQANIPSQFI  52

Query  1228  WPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTE  1049
             WPDHEKP    + +  +P ID  +F +GDP+AV++  +LV+EACKKHGFFLVVNHGV ++
Sbjct  53    WPDHEKPC-LQSPKLAIPPIDFGSFLTGDPLAVSKATQLVNEACKKHGFFLVVNHGVHSK  111

Query  1048  LLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEK-  872
             L++     M+ +F + LS K++A RK+GE  GYASSFTGRF++KLPWKETLSFR+ A+  
Sbjct  112   LIAKAHEYMNMFFGIQLSEKQRAQRKIGEQYGYASSFTGRFSSKLPWKETLSFRYCADND  171

Query  871   ECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQE  692
             + S +V+EYF   +G+ F   G++YQ+YC AMNTL+L I ELLG+ LGV R++F +F++ 
Sbjct  172   QSSEIVQEYFLNVMGENFKQFGKVYQEYCEAMNTLSLGIMELLGVSLGVGREYFRDFFEG  231

Query  691   NDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAF  512
             NDS++RLNYYPPCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFVD +W +V+P P AF
Sbjct  232   NDSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDHVGGLQVFVDEKWHSVSPDPEAF  291

Query  511   VVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKL  332
             VVNIGDTF ALSNG++KSC+HRAVVNN   RKS+AFFLCP  DKVV PP  L+D+ +P+ 
Sbjct  292   VVNIGDTFTALSNGIFKSCLHRAVVNNVTVRKSLAFFLCPKLDKVVKPPNTLIDSKNPRA  351

Query  331   YPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQ  233
             YPDF WP L E+TQ +YR+D  TL  F TWLQQ
Sbjct  352   YPDFTWPTLSEFTQKYYRADMKTLDVFTTWLQQ  384



>ref|XP_008232827.1| PREDICTED: gibberellin 20 oxidase 1-like [Prunus mume]
Length=377

 Score =   475 bits (1222),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/348 (62%), Positives = 275/348 (79%), Gaps = 3/348 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD+SV +++S+IP++F+WPDHEKP P    E  VP IDM  F +GD   V+   +LVDE
Sbjct  28    VFDASVAQYQSSIPSKFIWPDHEKPCPEPP-ELPVPHIDMKGFLTGDTREVSNATRLVDE  86

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC+KHGFFLVVNHGVD++L++     MD +F + LS K++A RK G+HCGYASSF GRF+
Sbjct  87    ACRKHGFFLVVNHGVDSQLIAKAHEYMDLFFGMQLSQKQRAQRKTGDHCGYASSFIGRFS  146

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR+SA+  C+  V +YF   +G++F + G++YQ+YC A++ L+  I ELL
Sbjct  147   SKLPWKETLSFRYSADSHCT--VNDYFVNVMGEDFKEFGKVYQEYCEAVSNLSNGIMELL  204

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             GM LGV +++F EF++ NDS++RLNYYP CQKP+LTLGTGPHCDPTSLTILHQD V GLQ
Sbjct  205   GMSLGVGQEYFREFFEGNDSIMRLNYYPRCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQ  264

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             VFVD +WR+V P P+AFVVNIGDTFMALSNG+YKSC+HRAVVNN   RKS+ FFLCP KD
Sbjct  265   VFVDEKWRSVTPKPDAFVVNIGDTFMALSNGIYKSCLHRAVVNNRTVRKSLTFFLCPKKD  324

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             +VVTPP  LVD   P++YPDF WP LLE+TQ HYR+D  TL  F+ W+
Sbjct  325   RVVTPPRGLVDTKSPRMYPDFTWPTLLEFTQKHYRADMKTLDAFSDWI  372



>ref|XP_004241098.1| PREDICTED: gibberellin 20 oxidase 2-like [Solanum lycopersicum]
Length=363

 Score =   474 bits (1220),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 218/355 (61%), Positives = 273/355 (77%), Gaps = 13/355 (4%)
 Frame = -3

Query  1288  AVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLV  1109
             +++FD+S ++H              K      +E   P+ID+  F SGDP  + E  +LV
Sbjct  20    SLIFDASQMKHG-------------KKDCAIPQELHAPLIDLGGFFSGDPTTMQEASRLV  66

Query  1108  DEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGR  929
              EACK HGFFLVVNHGVD  L+S+  R MD +F LPLS K KA RK+GEHCGYASSFTG 
Sbjct  67    GEACKSHGFFLVVNHGVDENLISNAHRNMDMFFSLPLSEKLKAERKIGEHCGYASSFTGT  126

Query  928   FNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             F +KLPWKETLSF++SA++  SH+VEEYF+KT+G+ F +LG++YQ+YCN+M+ L+L I E
Sbjct  127   FLSKLPWKETLSFQYSAKEHSSHIVEEYFQKTMGKSFNNLGKVYQEYCNSMSKLSLRIME  186

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLGM LGV +++F +F+++N+S++R+NYYPPC  PELTLGT PH DPTSLTILHQD VSG
Sbjct  187   LLGMSLGVQKENFKDFFEDNESIMRINYYPPCHNPELTLGTWPHYDPTSLTILHQDGVSG  246

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQVFVDNEW ++NP  NAFVVNIGDTFMALSNG++KSC+HRAVVNN IPRKS+ FFLCP 
Sbjct  247   LQVFVDNEWHSINPNYNAFVVNIGDTFMALSNGIFKSCLHRAVVNNYIPRKSLVFFLCPD  306

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQT  224
             KDKVV PP ELVD   P++YPDF WP LLE+TQ H+ +DT+TL  F+ WLQ N  
Sbjct  307   KDKVVRPPTELVDFNKPRIYPDFTWPTLLEFTQKHHPADTNTLQAFSNWLQHNNV  361



>ref|XP_008342965.1| PREDICTED: gibberellin 20 oxidase 1-like [Malus domestica]
Length=376

 Score =   474 bits (1220),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/367 (60%), Positives = 279/367 (76%), Gaps = 6/367 (2%)
 Frame = -3

Query  1336  PTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAA  1157
             P  N   +E E  P   +VFD+SV +++S+IP++F+WPDHEKP    + E   P++D+  
Sbjct  12    PPMNETNKENEETP---LVFDASVAQYQSSIPSKFIWPDHEKPCS-ESPELPAPLVDLKG  67

Query  1156  FRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKAL  977
             F SGD   V    +LVDEACKKHGFFL+VNHGVD +L+      MD +F + LS K++A 
Sbjct  68    FLSGDTCEVLNATRLVDEACKKHGFFLIVNHGVDLQLVGKAHEYMDSFFGMQLSQKQRAQ  127

Query  976   RKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELY  797
             RK GEHCGYASSF GRF++KLPWKETLSFR+SA+ + S  V +YF   +G++F D G++Y
Sbjct  128   RKAGEHCGYASSFVGRFSSKLPWKETLSFRYSADNQSS--VNDYFVNVMGEDFRDFGKVY  185

Query  796   QKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPH  617
             Q+YC+AMN L+  I ELLGM LGV R +F EF++ NDS++RLNYYP CQKP+LTLGTGPH
Sbjct  186   QEYCDAMNNLSNAIMELLGMSLGVGRNYFKEFFEGNDSIMRLNYYPMCQKPDLTLGTGPH  245

Query  616   CDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVV  437
             CDPTSLTILHQD V GLQVFVD++W +V P  +AFVVNIGDTFMALSNG+YKSC+HRAVV
Sbjct  246   CDPTSLTILHQDQVGGLQVFVDDKWHSVTPKLDAFVVNIGDTFMALSNGIYKSCLHRAVV  305

Query  436   NNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLL  257
             NN+  RKS+ FFLCP KD+VVTPP  LVD+  P+ YPDF WP  LE+TQ HYR+D  TL 
Sbjct  306   NNKTVRKSLTFFLCPKKDRVVTPPRGLVDSNSPRKYPDFTWPTFLEFTQKHYRADMRTLD  365

Query  256   NFATWLQ  236
              F+ W++
Sbjct  366   AFSDWIR  372



>ref|XP_009413747.1| PREDICTED: gibberellin 20 oxidase 1-D [Musa acuminata subsp. 
malaccensis]
Length=385

 Score =   474 bits (1220),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 212/353 (60%), Positives = 269/353 (76%), Gaps = 0/353 (0%)
 Frame = -3

Query  1297  PAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETC  1118
             P   ++FD++    +++IP +F+WP+ E P P A  E  VP+ID++   SGDP A A   
Sbjct  26    PGTPLIFDAAFHSRQASIPEQFVWPEGEAPTPDAHEELVVPLIDLSGIMSGDPAAAAAIT  85

Query  1117  KLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSF  938
               V +AC++HGFF VVNHG+D   L++  R ++ +F +PL+ K++A R+ GE CGYASSF
Sbjct  86    GSVADACQRHGFFQVVNHGIDAGFLAEAHRCVEAFFVMPLAEKQRAQRRTGESCGYASSF  145

Query  937   TGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALE  758
              GRF  KLPWKETLSFRFS       +VE+Y  +TLG++F   GE+YQ+YC AM+ L+L+
Sbjct  146   AGRFANKLPWKETLSFRFSPSPLAGDIVEDYIVRTLGEDFRYSGEVYQRYCEAMSNLSLQ  205

Query  757   ITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDS  578
             I E+LG+ LGV R HF EF++ NDS++RLNYYPPCQ+PELTLGTGPHCDPTSLTILHQD 
Sbjct  206   IMEVLGLSLGVGRAHFREFFEGNDSIMRLNYYPPCQRPELTLGTGPHCDPTSLTILHQDD  265

Query  577   VSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFL  398
             V GLQVF D +WR + P P+AFVVNIGDTFMALSNG YKSC+HRAVVN+++PRKS+AFFL
Sbjct  266   VQGLQVFADGKWRTICPKPDAFVVNIGDTFMALSNGRYKSCLHRAVVNSKVPRKSLAFFL  325

Query  397   CPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             CP  DKVV PP ELVDA HP+ YPDF WPALLE+TQ HYR+D  TL  F +W+
Sbjct  326   CPATDKVVRPPAELVDADHPRAYPDFTWPALLEFTQKHYRADMKTLDAFTSWI  378



>ref|XP_010918994.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Elaeis guineensis]
 ref|XP_010918995.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Elaeis guineensis]
Length=386

 Score =   474 bits (1220),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 268/353 (76%), Gaps = 0/353 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+++L   S+IP +F+WP+ +KP P A  E  VP+ID+  F SGDP A AE  +LV 
Sbjct  29    LVFDAAILSQRSDIPVQFVWPEEDKPTPDADEELTVPLIDLGGFLSGDPAATAEVSRLVA  88

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EAC +HGFF VVNHG+ + LL++    ++ +F +PL+ K++A RK GE CGYASSFT RF
Sbjct  89    EACGRHGFFQVVNHGIPSGLLAEAHSCIEAFFSMPLAEKQRAQRKPGESCGYASSFTARF  148

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
               +LPWKETLSFRFS+      +V+ YF  TLG++F   G +YQ YC AM+ L+LEI E+
Sbjct  149   ADRLPWKETLSFRFSSSPLSPDIVQSYFVHTLGEDFRHFGRIYQDYCEAMSRLSLEIMEV  208

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LGM LGV R HF EF+Q NDS++RLNYYP CQKPELTLGTGPHCDPTSLTILHQD V GL
Sbjct  209   LGMSLGVGRAHFREFFQGNDSIMRLNYYPRCQKPELTLGTGPHCDPTSLTILHQDDVGGL  268

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVF D +WRA++P P+AFVVNIGDTFMALSNG YKSC+HRAVVN+++ RKS+AFFLCP  
Sbjct  269   QVFTDGKWRAISPNPDAFVVNIGDTFMALSNGRYKSCLHRAVVNSKVARKSLAFFLCPEM  328

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             +K+V PP  LVDA HP+ YPDF W  LL++TQ HYR+D  TL  F  W+ Q +
Sbjct  329   NKIVRPPEGLVDAGHPRAYPDFTWSTLLQFTQKHYRADMKTLDAFTKWILQAE  381



>ref|XP_003521460.1| PREDICTED: gibberellin 20 oxidase 2-like [Glycine max]
Length=382

 Score =   474 bits (1219),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 283/367 (77%), Gaps = 5/367 (1%)
 Frame = -3

Query  1339  TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMA  1160
             T   NH+  E + +      FD S++ ++SNIP++F+WPDHEKP      E  +P ID+ 
Sbjct  16    TSAENHDNMEGQKQLHH---FDESLMPNQSNIPSQFIWPDHEKPC-LTPPELHIPPIDLK  71

Query  1159  AFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKA  980
             AF SGDP AV+  C   +EACKKHGFFLVVNHGVD +L++   + +D +F + LS K+KA
Sbjct  72    AFLSGDPQAVSAICAEANEACKKHGFFLVVNHGVDRKLIAQAHKLIDDFFCMQLSQKQKA  131

Query  979   LRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGEL  800
              RK+GEHCGYA+SF GRF++KLPWKETLSF +SA+K  S  VE+YF   +G++F   G +
Sbjct  132   QRKIGEHCGYANSFIGRFSSKLPWKETLSFHYSADKS-SKSVEDYFLNVMGEDFRKFGSV  190

Query  799   YQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGP  620
             +Q+YC AM+ L+L I ELLGM LGV R+ F +F++ N+SV+RLNYYPPCQKPEL LGTGP
Sbjct  191   FQEYCEAMSKLSLGIMELLGMTLGVGRECFRDFFEGNESVMRLNYYPPCQKPELALGTGP  250

Query  619   HCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAV  440
             HCDPTSLTILHQD V GLQVFVD  W +V P  +AFVVNIGDTFMALSNGL+KSCMHRAV
Sbjct  251   HCDPTSLTILHQDQVEGLQVFVDGRWYSVAPKEDAFVVNIGDTFMALSNGLFKSCMHRAV  310

Query  439   VNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTL  260
             VNN+I RKS+AFFLCP++DKVVTPP +L+   +P+ YPDF WP+LLE+TQ HYRSDT+TL
Sbjct  311   VNNKIVRKSLAFFLCPNRDKVVTPPKDLISNENPRTYPDFTWPSLLEFTQKHYRSDTETL  370

Query  259   LNFATWL  239
               F+ WL
Sbjct  371   DAFSRWL  377



>gb|KHN04099.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=382

 Score =   473 bits (1218),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 283/367 (77%), Gaps = 5/367 (1%)
 Frame = -3

Query  1339  TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMA  1160
             T   NH+  E + +      FD S++ ++SNIP++F+WPDHEKP      E  +P ID+ 
Sbjct  16    TSAENHDNMEGQKQLHH---FDESLMPNQSNIPSQFIWPDHEKPC-LTPPELHIPPIDLK  71

Query  1159  AFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKA  980
             AF SGDP AV+  C   +EACKKHGFFLVVNHGVD +L++   + +D +F + LS K+KA
Sbjct  72    AFLSGDPQAVSAICAEANEACKKHGFFLVVNHGVDRKLIAQAHKLIDDFFCMQLSQKQKA  131

Query  979   LRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGEL  800
              RK+GEHCGYA+SF GRF++KLPWKETLSF +SA+K  S  VE+YF   +G++F   G +
Sbjct  132   QRKIGEHCGYANSFMGRFSSKLPWKETLSFHYSADKS-SKSVEDYFLNVMGEDFRKFGSV  190

Query  799   YQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGP  620
             +Q+YC AM+ L+L I ELLGM LGV R+ F +F++ N+SV+RLNYYPPCQKPEL LGTGP
Sbjct  191   FQEYCEAMSKLSLGIMELLGMTLGVGRECFRDFFEGNESVMRLNYYPPCQKPELALGTGP  250

Query  619   HCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAV  440
             HCDPTSLTILHQD V GLQVFVD  W +V P  +AFVVNIGDTFMALSNGL+KSCMHRAV
Sbjct  251   HCDPTSLTILHQDQVEGLQVFVDGRWYSVAPKEDAFVVNIGDTFMALSNGLFKSCMHRAV  310

Query  439   VNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTL  260
             VNN+I RKS+AFFLCP++DKVVTPP +L+   +P+ YPDF WP+LLE+TQ HYRSDT+TL
Sbjct  311   VNNKIVRKSLAFFLCPNRDKVVTPPEDLISNENPRTYPDFTWPSLLEFTQKHYRSDTETL  370

Query  259   LNFATWL  239
               F+ WL
Sbjct  371   DAFSRWL  377



>ref|XP_010536506.1| PREDICTED: gibberellin 20 oxidase 1 [Tarenaya hassleriana]
Length=389

 Score =   473 bits (1217),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 290/388 (75%), Gaps = 11/388 (3%)
 Frame = -3

Query  1363  MAIECMIPTP----TPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAI  +  +P     P H+ ++  +    ++VF+ S+L  +S+IP +F+WPD +KP    
Sbjct  1     MAINRITTSPHKENKPKHDEEDDSDHVQTSLVFNPSLLNLKSDIPKQFIWPDCDKPS-ID  59

Query  1195  AREFQVPVIDMAAF----RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVR  1028
             A E  VP ID+  F     S    +  +  +LV +ACKKHGFFLV+NHGV+ +L+SD  +
Sbjct  60    APELDVPFIDLGHFLSNNSSSSSSSTLQVSRLVADACKKHGFFLVLNHGVEEDLISDAHK  119

Query  1027  EMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEE  848
              MDR+F++PL+ K++A RK G  CGYASSFTGRF+ KLPWKETLSFRFS E   S  V++
Sbjct  120   YMDRFFDMPLAEKQRAQRKAGGSCGYASSFTGRFSDKLPWKETLSFRFSNENNPSKTVQD  179

Query  847   YFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLN  668
             YF   +GQEF   G++YQ+YC AM+ L+L+I ELLG+ LGV+R+HF EF++ENDS++RLN
Sbjct  180   YFHGAMGQEFEPFGKVYQEYCEAMSALSLKIMELLGLSLGVNREHFREFFEENDSIMRLN  239

Query  667   YYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTF  488
             YYPPCQKP+LTLGTGPHCDPTSLTILHQD+V+GLQVFVDN+WR++ P P AFVVNIGDTF
Sbjct  240   YYPPCQKPDLTLGTGPHCDPTSLTILHQDNVNGLQVFVDNQWRSIRPNPKAFVVNIGDTF  299

Query  487   MALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATH--PKLYPDFKW  314
             MALSNG Y+SC+HRAVVN+E  RKS+AFFLCP KD+VV PP EL+D T   P+ YPDF W
Sbjct  300   MALSNGRYRSCLHRAVVNSESARKSLAFFLCPKKDRVVKPPSELLDITGSTPRKYPDFTW  359

Query  313   PALLEYTQLHYRSDTDTLLNFATWLQQN  230
                LE+TQ HYR+D +TL  F+ WL  N
Sbjct  360   SMFLEFTQKHYRADMNTLQAFSNWLTTN  387



>gb|EYU19501.1| hypothetical protein MIMGU_mgv1a006917mg [Erythranthe guttata]
Length=426

 Score =   474 bits (1221),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 274/347 (79%), Gaps = 7/347 (2%)
 Frame = -3

Query  1345  IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVID  1166
             +P PT +      EN    + +FD+ +L+H+ +IP++F+WP HE+P      E QVP+ID
Sbjct  14    VPQPTKH------ENDQKRSPIFDAKLLQHQLDIPSQFVWPHHERPRANPP-ELQVPLID  66

Query  1165  MAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKE  986
             +  F SGDP A A    LV +AC+KHGFFLVVNHGV  +L+SDG R MD +F+ PL  K+
Sbjct  67    LGGFLSGDPTASARASMLVGQACRKHGFFLVVNHGVSPDLISDGHRCMDHFFDQPLHEKQ  126

Query  985   KALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLG  806
             KALRK GEHCGYASSFTGRF++KLPWKETLSF++SA +  SH+VE+YF KTLG +F  LG
Sbjct  127   KALRKAGEHCGYASSFTGRFSSKLPWKETLSFQYSAHEASSHIVEDYFHKTLGDDFDHLG  186

Query  805   ELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGT  626
             ++YQ+YC AMN L+L I ELLGM LGV + HF +F++EN+S++RLNYYPPC+KP+ TLGT
Sbjct  187   KVYQQYCGAMNKLSLGIMELLGMSLGVRQDHFKQFFEENESIMRLNYYPPCRKPDQTLGT  246

Query  625   GPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHR  446
             GPHCDPTSLTILHQD ++GLQVFVD+EWR++ P  +AFVVNIGDTFMALSNG YKSC+HR
Sbjct  247   GPHCDPTSLTILHQDKINGLQVFVDDEWRSITPNSDAFVVNIGDTFMALSNGRYKSCLHR  306

Query  445   AVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             AVVN+E  RKS+AFFLCP KDKVV PP ELVD+ +P+LYPDF    L
Sbjct  307   AVVNSESSRKSLAFFLCPKKDKVVRPPHELVDSDNPRLYPDFSLKQL  353



>ref|XP_002320083.2| gibberellin 20-oxidase family protein [Populus trichocarpa]
 gb|EEE98398.2| gibberellin 20-oxidase family protein [Populus trichocarpa]
Length=384

 Score =   472 bits (1215),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 281/359 (78%), Gaps = 2/359 (1%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+S+L+H++N+P++F+WPDHEKP      E  +P ID  +F +GDP+AV++  + V+
Sbjct  23    LVFDASILQHQANLPSQFIWPDHEKPC-LEPPELAIPPIDFGSFLTGDPLAVSKLAQQVN  81

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EACKKHGFF++VNHGVD++L++     M+ +F   LS ++   RK+GE  GYASSFTGRF
Sbjct  82    EACKKHGFFVIVNHGVDSKLIAKAHEGMNMFFGKQLS-EKPVQRKIGEQYGYASSFTGRF  140

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
             ++KLPWKETLSFR+ A+ + S++V+EYF   +G+EF   G++YQ+YC AMNTL+L I EL
Sbjct  141   SSKLPWKETLSFRYCADNQSSNIVQEYFLNVMGEEFKQFGKVYQEYCEAMNTLSLGIMEL  200

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LG+ LGV  ++F +F++ NDS++RLNYYPPCQKPELTLGTGPHCDPTSLTILHQD VSGL
Sbjct  201   LGVSLGVGNEYFRDFFEGNDSIMRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDHVSGL  260

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVFV+ +W +V P P AFVVNIGDTFMALSNG++KSC+HRAVVNN   RKS+AFFLCP  
Sbjct  261   QVFVEEKWHSVTPDPEAFVVNIGDTFMALSNGIFKSCLHRAVVNNVTVRKSLAFFLCPKM  320

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHATQ  209
             DKVV PP  LVD  +P++YPDF W AL E+TQ HYR+D  TL  F TWLQQ      T+
Sbjct  321   DKVVKPPNTLVDYKNPRVYPDFTWLALSEFTQKHYRADMKTLDVFTTWLQQKNNCGGTK  379



>emb|CDY27101.1| BnaA02g11210D [Brassica napus]
Length=377

 Score =   472 bits (1214),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 281/383 (73%), Gaps = 9/383 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHE--RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             MAI C   +P    +  +Q  EN     +VF+ S+L  +S IP +F+WPD EKP      
Sbjct  1     MAIICTTASPAEKEQEPKQSFENDQTPPIVFNPSLLNLQSQIPNQFIWPDEEKPS-----  55

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
                +PV+++         +  E  +L+ EAC KHGFFLVVNHGV   L+SD  R M  +F
Sbjct  56    -IDIPVLNVPFIDLSSQDSTLEASRLIAEACTKHGFFLVVNHGVSESLISDAHRLMGSFF  114

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             ++PL+ K++A RKLGE  GYASSFTGRF+ KLPWKETLSFRFS E   S  V++YF  TL
Sbjct  115   DMPLAGKQRAQRKLGESSGYASSFTGRFSTKLPWKETLSFRFSNENNGSRTVQDYFSCTL  174

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             GQEF   G +YQ+YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YPPCQ
Sbjct  175   GQEFEQFGNVYQEYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPPCQ  234

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
              P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMALSNG
Sbjct  235   TPDLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWRSIPPNPKAFVVNIGDTFMALSNG  294

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
             ++KSC+HRAVVN E  RKS+AFFLCP +DKVV PP E++D T P+ YPDF WP  LE+TQ
Sbjct  295   IFKSCLHRAVVNRESARKSMAFFLCPKRDKVVKPPSEILDKT-PRRYPDFTWPMFLEFTQ  353

Query  289   LHYRSDTDTLLNFATWLQQNQTL  221
              HYR+D +TL +F+ W+  N+ L
Sbjct  354   KHYRADENTLDSFSNWVITNKNL  376



>ref|XP_011014843.1| PREDICTED: gibberellin 20 oxidase 1-like [Populus euphratica]
Length=367

 Score =   471 bits (1213),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 280/352 (80%), Gaps = 2/352 (1%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+S+L+H++NIP++F+WPDHEKP    + +  +P ID  +F +GDP+AV++  +LV+
Sbjct  14    LVFDASILQHQANIPSQFIWPDHEKPC-LQSPKLAIPPIDFGSFLTGDPLAVSKATQLVN  72

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EACKKHGFFLVVNHGV ++L++     M+ +F + LS K++A RK+GE  GYASSFTGRF
Sbjct  73    EACKKHGFFLVVNHGVHSKLIAKAHEYMNMFFGIQLSEKQRAQRKIGEQYGYASSFTGRF  132

Query  925   NAKLPWKETLSFRFSAEK-ECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             ++KLPWKETLSFR+ A+  + S +V+EYF   +G+ F   G++YQ+YC AMNTL+L I E
Sbjct  133   SSKLPWKETLSFRYCADNDQSSEIVQEYFLNVMGENFKQFGKVYQEYCEAMNTLSLGIME  192

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLG+ LGV R++F +F++ NDS++RLNYYPPCQKP+LTLGTGPHCDPTSLTILHQD V G
Sbjct  193   LLGVSLGVGREYFRDFFEGNDSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDHVGG  252

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQVFVD +W +V+P P AFVVNIGDTF ALS G++KSC+HRAVVNN   RKS+AFFLCP 
Sbjct  253   LQVFVDEKWHSVSPDPEAFVVNIGDTFTALSKGIFKSCLHRAVVNNVTVRKSLAFFLCPK  312

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQ  233
              DKVV PP  L+D+ +P+ YPDF WP L E+TQ +YR+D  TL  F TWLQQ
Sbjct  313   LDKVVKPPNTLIDSKNPRAYPDFTWPTLSEFTQKYYRADMKTLDVFTTWLQQ  364



>gb|ABG46321.1| gibberellin 20-oxidase 1 [Rumex palustris]
Length=399

 Score =   473 bits (1216),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 228/392 (58%), Positives = 291/392 (74%), Gaps = 7/392 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAIECM  T   +HE ++   +   ++VFDS +LR++++IP EF+WPD EKP   AA E 
Sbjct  1     MAIECMHKT---DHEVKQ--GREPLSLVFDSKILRNQASIPKEFIWPDDEKPDHEAA-EL  54

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VPVIDM  F   +  +     KLV EA  KHGFFLV NHGV+ EL+    + M  +FEL
Sbjct  55    EVPVIDMEGFCREETKSTNNASKLVQEAFMKHGFFLVKNHGVEAELIKHTHKYMREFFEL  114

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEK-ECSHVVEEYFEKTLG  827
             PL  K++  RKLGEHCGYASSFT RF+ KLPWKETLSF +S E+   + VVEEYF   + 
Sbjct  115   PLVEKQRVQRKLGEHCGYASSFTTRFSCKLPWKETLSFPYSPEEANNTKVVEEYFNSKMT  174

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             ++FA +G+LYQ+YC AMN L+L I ELLG+ LGV R++F +++Q NDSV+RLNYYPPCQ+
Sbjct  175   KDFAHMGKLYQEYCEAMNKLSLRIMELLGLSLGVGRQYFRDYFQGNDSVMRLNYYPPCQE  234

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PEL LGTGPHCDPTSLTILHQD V+GLQVFVD EWR + P  + FVVNIGDTFMALSNG 
Sbjct  235   PELALGTGPHCDPTSLTILHQDHVNGLQVFVDGEWRFIYPRFDTFVVNIGDTFMALSNGK  294

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             YKSC+HRAVVN+  PRKS+AFFLCP +D +V PP ELV+ + P++YPDF WP  LE+TQ 
Sbjct  295   YKSCLHRAVVNDTSPRKSLAFFLCPKEDLIVCPPNELVNESSPRVYPDFTWPIFLEFTQK  354

Query  286   HYRSDTDTLLNFATWLQQNQTLHATQA*AAVA  191
             HYR+D +TLLNF+ W+++   +  +   ++V 
Sbjct  355   HYRADMNTLLNFSRWVRERNQVQQSDGSSSVC  386



>ref|XP_011093186.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Sesamum indicum]
Length=388

 Score =   472 bits (1214),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 283/378 (75%), Gaps = 3/378 (1%)
 Frame = -3

Query  1345  IPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVID  1166
             I  P  +H    +   P+    F  S L+H+S+IP +F+WPDHEKP P+      VP ID
Sbjct  14    INKPPHHHPVFNLNRMPSEQRSF--SFLQHQSHIPPQFIWPDHEKPCPHPPPRLDVPPID  71

Query  1165  MAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKE  986
             +    SGDP AV+   +LVD+AC+KHGFFLVVNH +D +L+ +  R  D +F +PL  KE
Sbjct  72    LGGVLSGDPEAVSNAARLVDQACRKHGFFLVVNHDIDMKLVDEVHRGTDFFFGMPLEKKE  131

Query  985   KALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLG  806
             +ALRK+G+HCGYASSFT RF++KLPWKETLSFR+SA++  S++VE YF   +G+++A  G
Sbjct  132   RALRKIGDHCGYASSFTNRFSSKLPWKETLSFRYSADRHLSNIVECYFLDVMGEDYAAFG  191

Query  805   ELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGT  626
             ++ Q+YC AMN+L L + ELLG+ LGV   +F +F++ NDS++RLNYYP CQKP+L LGT
Sbjct  192   KVCQRYCEAMNSLCLNLMELLGISLGVGGGYFRDFFEGNDSIMRLNYYPTCQKPDLALGT  251

Query  625   GPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHR  446
             GPHCDPT+LTILHQD V GLQV+VD +W ++ P P AFVVNIGDTFMALSNG+YK C+HR
Sbjct  252   GPHCDPTTLTILHQDDVGGLQVYVDEKWHSITPNPQAFVVNIGDTFMALSNGIYKGCLHR  311

Query  445   AVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTD  266
             AVVN+  PRKS+AFFLCP  DK+V+PP ELV   +P++YPDF WP LLE+TQ HYRSD  
Sbjct  312   AVVNSTTPRKSLAFFLCPRMDKIVSPPKELVSEGNPRIYPDFTWPVLLEFTQKHYRSDMK  371

Query  265   TLLNFATWLQQNQTLHAT  212
             TL  F  WL+Q + +H++
Sbjct  372   TLEAFVNWLRQKR-IHSS  388



>ref|XP_008783765.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-D [Phoenix 
dactylifera]
Length=465

 Score =   475 bits (1222),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 216/353 (61%), Positives = 272/353 (77%), Gaps = 0/353 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD++VL   S+IP EF+WP+ +KP P AA E  VP+ID+  F SGDP AVAE  +LV 
Sbjct  108   LVFDAAVLSQRSDIPVEFVWPEEDKPTPDAAEELSVPLIDLGGFLSGDPTAVAEVSRLVG  167

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EAC ++GFF VVNHG+ + LL++  R ++ +F +PL+ K++A RK G+ CGYASSFTGRF
Sbjct  168   EACSRYGFFHVVNHGIPSALLAEANRCVEAFFLMPLAEKQRAQRKPGDSCGYASSFTGRF  227

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
               +LPWKETLSFRFS+      +V++YF  TLG++F   G +YQ YCNAM+ L+L I E+
Sbjct  228   ANRLPWKETLSFRFSSSPLSPDIVQDYFVHTLGEDFRHFGTVYQDYCNAMSKLSLAIMEI  287

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LGM LGV R ++ EF++ NDS++RLNYYPPCQKP+LTLGTGPHCDPTSLTILHQD V GL
Sbjct  288   LGMSLGVGRAYYREFFEGNDSMMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDDVGGL  347

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVF D +W  V+P PNA VVNIGDTFMALSNG YKSC+HRAVVN+++ RKS AFFLCP  
Sbjct  348   QVFADGKWHTVSPKPNALVVNIGDTFMALSNGRYKSCLHRAVVNSKVARKSFAFFLCPEM  407

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             +K+V PP  LV A HP+ YPDF W ALLE+TQ HYR+DT+TL  F  W+ Q +
Sbjct  408   NKIVRPPLGLVGADHPRAYPDFTWSALLEFTQKHYRADTNTLDAFTKWILQAE  460



>ref|XP_006280621.1| hypothetical protein CARUB_v10026585mg [Capsella rubella]
 gb|EOA13519.1| hypothetical protein CARUB_v10026585mg [Capsella rubella]
Length=384

 Score =   472 bits (1214),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 222/384 (58%), Positives = 285/384 (74%), Gaps = 11/384 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTP---NHE--RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI C   T +P   +HE  +Q++EN     ++F+ S+L  +S IP +F+WPD EKP P 
Sbjct  1     MAIICTTTTTSPAEKDHEPKQQDLENDQTPPLIFNPSLLNLQSQIPNQFIWPDEEKPKPS  60

Query  1198  A-AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREM  1022
                 E  VP ID+++  S       E  +L+ EAC KHGFFLVVNHGV   L+S+  R M
Sbjct  61    VDIPELNVPFIDLSSQDS-----TLEASRLIAEACTKHGFFLVVNHGVSESLVSEANRLM  115

Query  1021  DRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYF  842
             +R+F++P + K++A RK GE CGYASSFTGRF+ KLPWKETLSFRFS E   S  V++YF
Sbjct  116   ERFFDMPPAGKQRAQRKPGESCGYASSFTGRFSTKLPWKETLSFRFSNENSGSRTVQDYF  175

Query  841   EKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYY  662
               TLGQEF   G++YQ YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+Y
Sbjct  176   SDTLGQEFEHFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHY  235

Query  661   PPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMA  482
             PPCQ P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMA
Sbjct  236   PPCQTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVDNQWRSILPNPKAFVVNIGDTFMA  295

Query  481   LSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALL  302
             LSNG++KSC+HRAVVN E  RKS+AFFLCP KDKVV PP E+++    + YPDF W   L
Sbjct  296   LSNGIFKSCLHRAVVNRESARKSMAFFLCPKKDKVVRPPSEILEKNKTRKYPDFTWSMFL  355

Query  301   EYTQLHYRSDTDTLLNFATWLQQN  230
             E+TQ HYR+D +TL +F+ W+  N
Sbjct  356   EFTQKHYRADVNTLDSFSNWVISN  379



>ref|XP_008777097.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Phoenix dactylifera]
Length=389

 Score =   471 bits (1213),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 218/371 (59%), Positives = 272/371 (73%), Gaps = 1/371 (0%)
 Frame = -3

Query  1339  TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMA  1160
             TP P       +  P   +VFD+++L    +IP +F+WP+ +KP P AA E  VP+ID+ 
Sbjct  15    TPEPRLMSSSAQQTPPP-LVFDAAILSQRPDIPVQFVWPEEDKPTPDAAEELTVPLIDLG  73

Query  1159  AFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKA  980
              F SGDP A AE  + V EAC++HGFF VVNHG+ + LLS+    ++ +F +PLS K++A
Sbjct  74    GFLSGDPAATAEVSRRVGEACERHGFFQVVNHGIPSALLSEVHSCVEAFFSMPLSEKQRA  133

Query  979   LRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGEL  800
              RK GE CGYASSFTGRF  +LPWKETLSFRFS      ++V++YF  TLG++F   G +
Sbjct  134   QRKPGESCGYASSFTGRFANRLPWKETLSFRFSPSPLSPNIVQDYFVHTLGEDFRHFGTI  193

Query  799   YQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGP  620
             YQ YC AM+ L+LEI E+LGM LGV R HF EF+Q NDS++RLNYYP CQKPEL LGTGP
Sbjct  194   YQNYCEAMSRLSLEIMEVLGMSLGVGRAHFREFFQGNDSIMRLNYYPRCQKPELVLGTGP  253

Query  619   HCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAV  440
             HCDPTSLTILHQD V GLQVF D +WR ++P  NAFVVNIGDTFMALSNG YKSC+HRAV
Sbjct  254   HCDPTSLTILHQDDVGGLQVFTDGKWRTISPKLNAFVVNIGDTFMALSNGRYKSCLHRAV  313

Query  439   VNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTL  260
             VN+++ RKS+AFFLCP  +K+V PP  LV+A HP+ YPDF W  LLE+TQ HYR+D  TL
Sbjct  314   VNSKVARKSLAFFLCPEMNKIVRPPEGLVNAGHPRAYPDFTWSTLLEFTQKHYRADMKTL  373

Query  259   LNFATWLQQNQ  227
               F  W+ Q +
Sbjct  374   DAFTKWILQAE  384



>emb|CDX91609.1| BnaC02g15510D [Brassica napus]
Length=378

 Score =   470 bits (1210),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/382 (58%), Positives = 279/382 (73%), Gaps = 10/382 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHE---RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI C  PT     E   +Q  EN     +VF+ S+L  +S IP +F+WPD EKP     
Sbjct  1     MAIICTTPTSPAEKEQEPKQSFENDQTPPIVFNPSLLNLQSQIPNQFIWPDEEKPS----  56

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
                 +PV+D+         +  E  +L+ EAC +HGFFLVVNHGV   L+SD  R M  +
Sbjct  57    --IDIPVLDVPFIDLSSQDSTLEASRLIAEACTQHGFFLVVNHGVSESLISDAHRLMGSF  114

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             F++PL+ K++A RKLGE  GYA SFTGRF+ KLPWKETLSFRFS E   S  V++YF  T
Sbjct  115   FDMPLAGKQRAQRKLGESSGYAGSFTGRFSTKLPWKETLSFRFSNENNGSRTVQDYFSCT  174

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LGQEF   G +YQ+YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YPPC
Sbjct  175   LGQEFEQFGNVYQEYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPPC  234

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             Q P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMALSN
Sbjct  235   QTPDLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWRSIPPNPKAFVVNIGDTFMALSN  294

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G++KSC+HRAVVN E  RKS+AFFLCP +DKVV PP E++D T P+ YPDF WP  LE+T
Sbjct  295   GIFKSCLHRAVVNRESARKSMAFFLCPKRDKVVKPPSEILDKT-PRRYPDFTWPMFLEFT  353

Query  292   QLHYRSDTDTLLNFATWLQQNQ  227
             Q HYR+D +TL +F+ W+  N+
Sbjct  354   QKHYRADANTLDSFSNWVITNK  375



>dbj|BAQ02989.1| gibberellin 20-oxidase [Rorippa aquatica]
Length=382

 Score =   469 bits (1208),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 272/353 (77%), Gaps = 6/353 (2%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVA----VAETC  1118
             ++F+ S+L  + NIP +F+WPD EKP      E +VP+ID+  F S DPV+      E  
Sbjct  27    LIFNPSILNLQPNIPNQFIWPDDEKPS-IDVPELEVPLIDLKKFMS-DPVSPSSSTLEAS  84

Query  1117  KLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSF  938
             +L+ EAC KHGFFLVVNHG++  L+SD    M R+F++PLS K++ LRK GE CGYASSF
Sbjct  85    RLISEACTKHGFFLVVNHGINEALISDAHEYMGRFFDMPLSVKQRVLRKPGESCGYASSF  144

Query  937   TGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALE  758
             TGRF+ KLPWKETLSFRFS EK  S  VE+YF   LG  F   G++YQ+YC AM++L+L+
Sbjct  145   TGRFSTKLPWKETLSFRFSDEKSLSKTVEDYFCDALGHGFEPFGKVYQEYCEAMSSLSLK  204

Query  757   ITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDS  578
             I ELLG+ LGV+R +F EF++ENDS++RLNYYPPCQKP+LTLGTGPHCDPTSLTILHQD 
Sbjct  205   IMELLGLSLGVNRDYFREFFEENDSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDH  264

Query  577   VSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFL  398
             V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN E  RKS+AFFL
Sbjct  265   VNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNNRYKSCLHRAVVNCESERKSLAFFL  324

Query  397   CPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             CP KD+VV PP EL+D+  P+ YPDF W   LE+TQ HYR+D +TL  F+ WL
Sbjct  325   CPRKDRVVKPPRELLDSITPRRYPDFTWSLFLEFTQKHYRADMNTLQAFSDWL  377



>ref|XP_010934079.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Elaeis guineensis]
Length=369

 Score =   469 bits (1207),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 268/350 (77%), Gaps = 0/350 (0%)
 Frame = -3

Query  1288  AVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLV  1109
             ++VFD++VL    +IP EF+WP+ +KP P AA E  VP+ID+  F SGDP AVA+  +LV
Sbjct  10    SLVFDAAVLSQRPDIPVEFVWPEEDKPTPDAAEELSVPLIDLGDFLSGDPAAVADVSRLV  69

Query  1108  DEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGR  929
              EAC +HGFF VVNHG+ + L +   R +D +F +PL+ K++A RK GE CGYASSFTGR
Sbjct  70    GEACSRHGFFHVVNHGIPSALFAKAHRCVDGFFSMPLAEKQRAQRKPGESCGYASSFTGR  129

Query  928   FNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
             F  +LPWKETLSFRFS+     ++V++YF +TLG++F   G +YQ YCNAM+ L+L I E
Sbjct  130   FANRLPWKETLSFRFSSSPLSPNIVQDYFVRTLGEDFLHFGTVYQDYCNAMSKLSLAIME  189

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             ++G  LGV R ++ EF++ NDS++RLNYYPPCQKP+L LGTGPHCDPTSLTILHQD V G
Sbjct  190   IIGTSLGVGRAYYREFFEGNDSIMRLNYYPPCQKPDLALGTGPHCDPTSLTILHQDDVGG  249

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             LQVF D +WR V+P P+A VVNIGDTFMALSNG YKSC+HRAVVN+++ RKS AFFL P 
Sbjct  250   LQVFTDGKWRTVSPKPDALVVNIGDTFMALSNGRYKSCLHRAVVNSKVARKSFAFFLSPE  309

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
              +K+V PP  LVDA HP+ YPDF W ALLE+TQ HYR+D +TL  F  W+
Sbjct  310   MNKIVRPPVGLVDAEHPRAYPDFTWSALLEFTQKHYRADMNTLDAFTKWM  359



>ref|XP_008467255.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis melo]
Length=375

 Score =   469 bits (1207),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 216/353 (61%), Positives = 272/353 (77%), Gaps = 0/353 (0%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD+S LR++  IP +F+WPD EKP      E +VP+ID++ F SGD  +V E  + V 
Sbjct  20    LVFDASFLRYQHKIPKQFIWPDEEKPSEQQCPEMEVPLIDLSGFLSGDKDSVREAVRHVG  79

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EAC+KHGFFLVVNHGVD +L++D  + M+ +FELPL  K++A RK+GEHCGYASSFTGRF
Sbjct  80    EACEKHGFFLVVNHGVDLKLIADAHKYMNDFFELPLCEKQRAQRKVGEHCGYASSFTGRF  139

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
             ++KLPWKETLSFRFSA++     V  Y    LG  F + G +YQ+YC AM+ L+L I EL
Sbjct  140   SSKLPWKETLSFRFSADESLDDHVFHYLRTKLGDRFVNFGRVYQEYCEAMSGLSLGIMEL  199

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LG  LGV  ++F  F+++NDS++RLN+YPPCQKP+LTLGTGPHCDPTSLTILHQD V GL
Sbjct  200   LGKSLGVGGEYFKNFFKDNDSIMRLNFYPPCQKPDLTLGTGPHCDPTSLTILHQDQVGGL  259

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVFVDN+WR + P  +AFVVNIGDTFMALSNG YKSC+HRAVVN++  RKS+AFFLCP  
Sbjct  260   QVFVDNQWRLIAPNFDAFVVNIGDTFMALSNGRYKSCLHRAVVNSKRTRKSLAFFLCPRN  319

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             DKVV PP ELVD  +P++YPDF W  LL++TQ +YR+D  TL  F+  LQQ +
Sbjct  320   DKVVKPPRELVDNENPRIYPDFTWSMLLQFTQNNYRADMKTLEVFSASLQQQR  372



>ref|XP_009127272.1| PREDICTED: gibberellin 20 oxidase 2 [Brassica rapa]
Length=377

 Score =   469 bits (1206),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/383 (57%), Positives = 279/383 (73%), Gaps = 9/383 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHE--RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             MAI C   +P    +  +Q  EN     +VF+ S+L  +S IP +F+WPD EKP      
Sbjct  1     MAIICTTASPAEKEQEPKQSFENDQTPPIVFNPSLLNLQSQIPNQFIWPDEEKPS-----  55

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
                +PV+++         +  E  +L+ EAC KHGFFLVVNHGV   L+SD  R M  +F
Sbjct  56    -IDIPVLNVPFIDLSSQDSTLEASRLIAEACTKHGFFLVVNHGVSESLISDAHRLMGSFF  114

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             ++PL+ K++A RKLGE  GYASSFTGRF+ KLPWKETLSFRFS E   S  V++YF  TL
Sbjct  115   DMPLAGKQRAQRKLGESSGYASSFTGRFSTKLPWKETLSFRFSNENNGSRTVQDYFSCTL  174

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             GQEF   G +YQ+YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YPPCQ
Sbjct  175   GQEFEQFGNVYQEYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPPCQ  234

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
              P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMALSNG
Sbjct  235   TPDLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWRSIPPNPKAFVVNIGDTFMALSNG  294

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
             ++KSC+HRAVVN E  RKS+ FFLCP +DKVV PP E++D   P+ YPDF WP  LE+TQ
Sbjct  295   IFKSCLHRAVVNRESARKSMTFFLCPKRDKVVKPPSEILDKI-PRRYPDFTWPMFLEFTQ  353

Query  289   LHYRSDTDTLLNFATWLQQNQTL  221
              HYR+D +TL +F+ W+  N+ L
Sbjct  354   KHYRADENTLDSFSNWVITNKNL  376



>ref|XP_010443931.1| PREDICTED: gibberellin 20 oxidase 2 [Camelina sativa]
Length=381

 Score =   468 bits (1205),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 221/383 (58%), Positives = 282/383 (74%), Gaps = 10/383 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTP---NHE-RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAI C   T +P    HE +Q++EN     ++F+ S+L  ++ IP +F+WPD EKP    
Sbjct  1     MAILCTTTTTSPAEKEHEPKQDLENDQTPPLIFNPSLLNLQTQIPNQFIWPDEEKPS-ID  59

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               E  VP ID++   S       E  +L+ EAC KHGFFLVVNHGV   L+S+  R M+R
Sbjct  60    IPELNVPFIDLSRQDS-----TLEASRLIAEACTKHGFFLVVNHGVSESLISEAQRLMER  114

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F++PLS K++A RK GE CGYASSFTGRF+ KLPWKETLSFRFS E   S  V+ YF  
Sbjct  115   FFDMPLSGKQRAQRKPGESCGYASSFTGRFSTKLPWKETLSFRFSNENSGSRTVQNYFSD  174

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             TLGQEF   G++YQ YC AM++L+L+I ELLG+ LGV+  +F  F++ENDS++RLN+YPP
Sbjct  175   TLGQEFEHFGKVYQDYCEAMSSLSLKIMELLGLSLGVNGDYFRGFFEENDSIMRLNHYPP  234

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQ P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMALS
Sbjct  235   CQTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVDNQWRSILPNPKAFVVNIGDTFMALS  294

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG++KSC+HRAVVN E  RKS+AFFLCP KDKVV PP E+++    + YPDF W   LE+
Sbjct  295   NGIFKSCLHRAVVNRECARKSMAFFLCPKKDKVVRPPSEILEKMKTRKYPDFTWSMFLEF  354

Query  295   TQLHYRSDTDTLLNFATWLQQNQ  227
             TQ HYR+D +TL +F+ W+  N+
Sbjct  355   TQKHYRADVNTLDSFSNWVISNK  377



>dbj|BAM73279.1| gibberellin 20 oxidase 1 [Raphanus sativus]
Length=381

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 219/377 (58%), Positives = 279/377 (74%), Gaps = 3/377 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MA+ C+  +    H  +       + ++F+ S+L  + NIP +F+WPDHEKP   A  E 
Sbjct  1     MAVSCVRTSSEQEHTPKLGLGNSQSPLIFNPSMLNLQPNIPDQFIWPDHEKPCTEAP-EL  59

Query  1183  QVPVIDMAAF--RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             +VP+ID+  F   S  P A  E  +L+ EAC KHGFFLVVNHG+  EL+SD    M R+F
Sbjct  60    EVPLIDLKDFLSNSSSPSATLEASRLISEACSKHGFFLVVNHGISEELISDAHEYMARFF  119

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             ++PLS K++  RK GE CGYASSFTGRF+ KLPWKETLSFRF  +K   + V++YF   L
Sbjct  120   DMPLSEKQRVQRKPGESCGYASSFTGRFSTKLPWKETLSFRFCDDKNSPNTVQDYFCHAL  179

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G EF  LG++YQ+YC AM+ L+L+I ELLG+ LGV R +F  F++ENDS++RLNYYPPCQ
Sbjct  180   GHEFEPLGKVYQEYCEAMSFLSLKIMELLGLSLGVSRDYFRAFFEENDSIMRLNYYPPCQ  239

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             KP+LTLGTGPHCDPTSLTILHQD V+GLQV V+N+WR+++P P AFVVNIGDTFMALSN 
Sbjct  240   KPDLTLGTGPHCDPTSLTILHQDHVNGLQVLVENQWRSISPNPKAFVVNIGDTFMALSNN  299

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
              YKSC+HRAVVN+   RKS+AFFLCP KD+VV PP EL+++  P+ YPDF W  LLE+TQ
Sbjct  300   RYKSCLHRAVVNSRSERKSLAFFLCPKKDRVVKPPRELLNSITPRRYPDFTWSMLLEFTQ  359

Query  289   LHYRSDTDTLLNFATWL  239
              HYR+D +TL  F+ WL
Sbjct  360   KHYRADMNTLQAFSDWL  376



>ref|XP_010106746.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC11713.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=379

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 274/354 (77%), Gaps = 5/354 (1%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKP--GPYAAREFQVPVIDMAAFRSGDPVAVAETCKL  1112
             +VF++S+L+++SNIP+EF+WPDHEKP  GP    E  +P ID+  F SGD +A++   + 
Sbjct  27    LVFNASILQYQSNIPSEFVWPDHEKPCSGP---PELVIPPIDLKGFFSGDSLAISNAIQQ  83

Query  1111  VDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTG  932
             V+EACKKHGFFLVVNHG+D++L++     MD +F + LS K++A RK+GEHCGYASSFTG
Sbjct  84    VNEACKKHGFFLVVNHGIDSQLIAKAHEYMDLFFGMRLSEKQRAQRKIGEHCGYASSFTG  143

Query  931   RFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEIT  752
             RF+ KLPWKETLSFR+ A  +   +VE+YF   +G++F  LG++YQ+YC  M+ L+L I 
Sbjct  144   RFSTKLPWKETLSFRYCARGQFPDIVEDYFVNVMGEDFRQLGKVYQEYCEVMSNLSLGIM  203

Query  751   ELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVS  572
             ELLGM LGV R+ F EF++ NDS++RLNYYP CQKP+ TLGTGPHCDPTSLTILHQD V 
Sbjct  204   ELLGMSLGVGREFFREFFRGNDSIMRLNYYPICQKPDQTLGTGPHCDPTSLTILHQDHVG  263

Query  571   GLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCP  392
             GLQVFVD +W  ++P P+AFVVNIGDTFMALSNG+YKSC+HRAVVN+   RKS+AFFL P
Sbjct  264   GLQVFVDEKWHNISPNPDAFVVNIGDTFMALSNGIYKSCLHRAVVNSNTVRKSLAFFLSP  323

Query  391   HKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQN  230
               DK++ PP  LV    P++YPDF W +LLE+TQ HYR+D  TL  F  W+ QN
Sbjct  324   KMDKLIIPPRSLVSPNTPRMYPDFTWSSLLEFTQKHYRADMKTLNAFTEWISQN  377



>emb|CDX99893.1| BnaC09g28120D [Brassica napus]
Length=380

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 280/383 (73%), Gaps = 10/383 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQE----IENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAI C  PT +P  + QE    +EN     ++F+ S+L  +S IP +F+WPD EKP    
Sbjct  1     MAIICTTPTTSPAEKEQEPKQDLENDQTPPLIFNPSLLNVQSQIPNQFIWPDKEKPS-ID  59

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               E  VP ID++   S D     E  +L+ EAC KHGFFLVVNHGV   L+SD  R M+ 
Sbjct  60    IPELNVPFIDLS---SQD--TTLEASRLIAEACTKHGFFLVVNHGVSESLISDAHRYMES  114

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F++PL+ K++A RK GE  GYASSFTGRF+ KLPWKETLSF FS E   S  V++YF  
Sbjct  115   FFDMPLAGKQRAQRKPGESWGYASSFTGRFSTKLPWKETLSFPFSNEISGSRTVQDYFSG  174

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             TLGQEF   G +YQ YC AM++L+LEI ELLG+ LG+ + HF EF++ENDS++RLN+YPP
Sbjct  175   TLGQEFEQFGRVYQNYCEAMSSLSLEIMELLGLSLGIKKDHFREFFEENDSIMRLNHYPP  234

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQ P+LTLGTGPHCDP+SLTILHQD V+GLQVFV+N+W+++ P P AFVVNIGDTFMALS
Sbjct  235   CQTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVENQWQSILPNPKAFVVNIGDTFMALS  294

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG++KSC+HRAVVN E  R S+AFFLCP +DKVV PP E+++   P+ YPDF WP  LE+
Sbjct  295   NGIFKSCLHRAVVNRESARTSMAFFLCPKRDKVVKPPSEILEKMTPRRYPDFTWPMFLEF  354

Query  295   TQLHYRSDTDTLLNFATWLQQNQ  227
             TQ HYR+D +TL +F  W+  N+
Sbjct  355   TQKHYRADVNTLDSFTNWIITNK  377



>gb|KFK26790.1| gibberellin 20-oxidase [Arabis alpina]
Length=376

 Score =   467 bits (1202),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 279/378 (74%), Gaps = 6/378 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             MAI C   T   +  +Q++EN     ++F+ ++L  +S IP +F+WPD EKP      E 
Sbjct  1     MAIICRTTTSQEHEPKQDLENDETPPLIFNPTLLNLQSQIPNQFIWPDEEKPSTDIP-EL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
              VP ID+++  S       E  +L+ EAC KHGFFLVVNHGV   L+S+  R MDR+F++
Sbjct  60    NVPFIDLSSQDS-----TLEASRLIAEACTKHGFFLVVNHGVSESLVSEAHRFMDRFFDM  114

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             PL+ K++A RK GE CGYASSFTGRF+ KLPWKETLSFRFS E   S  V++YF  T GQ
Sbjct  115   PLAGKQRAQRKPGESCGYASSFTGRFSTKLPWKETLSFRFSNENSGSRTVQDYFSDTSGQ  174

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF   G++YQ YC AM++L+L+I ELLG+ LGV+R +F  F+++NDS++RLN+YPPCQ P
Sbjct  175   EFEQFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEQNDSIMRLNHYPPCQTP  234

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMALSNG++
Sbjct  235   DLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWRSILPNPKAFVVNIGDTFMALSNGIF  294

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN E  RKS+AFFLCP +DKVV PP E++     + YPDF W   LE+TQ H
Sbjct  295   KSCLHRAVVNRESARKSMAFFLCPKRDKVVKPPNEILQKVTTRRYPDFTWSMFLEFTQKH  354

Query  283   YRSDTDTLLNFATWLQQN  230
             YR+D +TL +F+ W+  N
Sbjct  355   YRADVNTLDSFSNWVITN  372



>ref|XP_002865876.1| ATGA20OX2/GA20OX2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42135.1| ATGA20OX2/GA20OX2 [Arabidopsis lyrata subsp. lyrata]
Length=377

 Score =   467 bits (1202),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 282/380 (74%), Gaps = 7/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPN-HERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MAI C   +P    HE ++   K    ++F+ S+L  +S IP +F+WPD EKP      E
Sbjct  1     MAILCTTTSPAEKEHEPKQDLEKDQTPLIFNPSLLNLQSQIPNQFIWPDEEKPS-IDIPE  59

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
               VP ID+++  S       E  +++ EAC KHGFFLVVNHGV   L+SD  R M+R+F+
Sbjct  60    LNVPFIDLSSQDS-----TLEAPRVIAEACTKHGFFLVVNHGVSESLISDAQRLMERFFD  114

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLG  827
             +PL+ K+KA RK GE CGYASSFTGRF+ KLPWKETLSF+FS E   S  V++YF  TLG
Sbjct  115   MPLAGKQKAQRKPGESCGYASSFTGRFSTKLPWKETLSFQFSNENSGSRTVQDYFSDTLG  174

Query  826   QEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQK  647
             QEF  +G++YQ YC AM++L+L+I EL+G+ LGV+R +F  F+QENDS++RLN+YPPCQ 
Sbjct  175   QEFEQVGKVYQDYCEAMSSLSLKIMELMGLSLGVNRDYFRGFFQENDSIMRLNHYPPCQT  234

Query  646   PELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGL  467
             PELTLGTGPHCDP+SLTILHQD V+GLQVFVDN+W+++ P P AFVVNIGDTFMALSNG+
Sbjct  235   PELTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWQSIRPNPKAFVVNIGDTFMALSNGI  294

Query  466   YKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQL  287
             +KSC+HRAVVN E  RKS+AFFLCP KDKVV PP ++++    + YPDF W   LE+TQ 
Sbjct  295   FKSCLHRAVVNRESARKSMAFFLCPKKDKVVKPPSDILEKMTTRKYPDFTWSMFLEFTQK  354

Query  286   HYRSDTDTLLNFATWLQQNQ  227
             HYR+D +TL +F+ W+  N+
Sbjct  355   HYRADVNTLDSFSNWVITNK  374



>ref|XP_010482524.1| PREDICTED: gibberellin 20 oxidase 2-like [Camelina sativa]
Length=381

 Score =   466 bits (1200),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 282/383 (74%), Gaps = 10/383 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTP---NHE-RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAI C   T +P    HE +Q++ N     ++F+ S+L  ++ IP +F+WPD EKP    
Sbjct  1     MAILCTTTTTSPAEKEHEPKQDLGNDQTPPIIFNPSLLNLQNQIPNQFIWPDEEKPS-ID  59

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               E  VP ID++   S       E  +L+ EAC KHGFFLV+NHGV   L+S+  R M+R
Sbjct  60    IPELNVPFIDLSRQDS-----TLEASRLIAEACTKHGFFLVLNHGVSESLISEAQRLMER  114

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F++PL+ K++A RK GE CGYASSFTGRF+ KLPWKETLSFRFS E   S  V+ YF  
Sbjct  115   FFDMPLAGKQRAQRKPGESCGYASSFTGRFSTKLPWKETLSFRFSNENSGSRTVQNYFSD  174

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             TLGQEF   G++YQ YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YPP
Sbjct  175   TLGQEFEHFGKVYQDYCEAMSSLSLKIMELLGLNLGVNRDYFRGFFEENDSIMRLNHYPP  234

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQ P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMALS
Sbjct  235   CQTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVDNQWRSILPNPKAFVVNIGDTFMALS  294

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG++KSC+HRAVVN E  RKS+AFFLCP KDKVV PP E+++    + YPDF W   LE+
Sbjct  295   NGIFKSCLHRAVVNRECARKSMAFFLCPKKDKVVRPPSEILEKMKTRKYPDFTWSMFLEF  354

Query  295   TQLHYRSDTDTLLNFATWLQQNQ  227
             TQ HYR+D +TL +F+ W+  N+
Sbjct  355   TQNHYRADVNTLDSFSNWVISNK  377



>ref|XP_009107150.1| PREDICTED: gibberellin 20 oxidase 2 [Brassica rapa]
 emb|CDY00499.1| BnaA10g07740D [Brassica napus]
Length=380

 Score =   466 bits (1199),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 279/383 (73%), Gaps = 10/383 (3%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQE----IENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYA  1196
             MAI C  PT +P  + QE    +EN     ++F+ S+L  +S IP +F+WPD EKP    
Sbjct  1     MAIICTTPTTSPAEKEQEPKQDLENDQTPPLIFNPSLLNVQSQIPNQFIWPDKEKPS-ID  59

Query  1195  AREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
               E  VP ID++   S D     E  +L+ EAC KHGFFLVVNHGV   L+SD  R M+ 
Sbjct  60    IPELNVPFIDLS---SQD--TTLEASRLIAEACTKHGFFLVVNHGVSESLISDAHRYMES  114

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F++PL+ K++A RK GE  GYASSFTGRF+ KLPWKETLSF FS E   S  V++YF  
Sbjct  115   FFDMPLAGKQRAQRKPGESWGYASSFTGRFSTKLPWKETLSFPFSNEISGSRTVQDYFSG  174

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
             TLGQEF   G +YQ YC AM++L+LEI ELLG+ LG+   HF EF++ENDS++RLN+YPP
Sbjct  175   TLGQEFEQFGRVYQNYCEAMSSLSLEIMELLGLSLGIKTDHFREFFEENDSIMRLNHYPP  234

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQ P+LTLGTGPHCDP+SLTILHQD V+GLQVFV+N+W+++ P P AFVVNIGDTFMALS
Sbjct  235   CQTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVENQWQSILPNPKAFVVNIGDTFMALS  294

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             NG++KSC+HRAVVN E  R S+AFFLCP KDKVV PP ++++   P+ YPDF WP  LE+
Sbjct  295   NGIFKSCLHRAVVNRESARTSMAFFLCPKKDKVVKPPSKILEKMTPRRYPDFTWPMFLEF  354

Query  295   TQLHYRSDTDTLLNFATWLQQNQ  227
             TQ HYR+D +TL +F  W+  N+
Sbjct  355   TQKHYRADVNTLDSFTNWIITNK  377



>emb|CDX99892.1| BnaC09g28130D [Brassica napus]
Length=379

 Score =   466 bits (1198),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 219/382 (57%), Positives = 279/382 (73%), Gaps = 9/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHE---RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAA  1193
             MAI C  PT     E   +Q++EN     ++F+ S+L  +S IP +F+WPD EKP     
Sbjct  1     MAIICTTPTSPAEKEQEPKQDLENDQTPPLIFNPSLLNVQSQIPNQFIWPDKEKPS-IDI  59

Query  1192  REFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRY  1013
              E  VP ID++   S D     E  +L+ EAC KHGFFLVVNHGV   L+SD  R M+ +
Sbjct  60    PELNVPFIDLS---SQD--TTLEASRLIAEACTKHGFFLVVNHGVSESLISDAHRYMESF  114

Query  1012  FELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKT  833
             F++PL+ K++A RK GE  GYASSFTGRF+ KLPWKETLSF FS E   S  V++YF  T
Sbjct  115   FDMPLAGKQRAQRKPGESWGYASSFTGRFSTKLPWKETLSFPFSNEISGSRTVQDYFSGT  174

Query  832   LGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPC  653
             LGQEF   G +YQ YC AM++L+LEI ELLG+ LG+ + HF EF++ENDS++RLN+YPPC
Sbjct  175   LGQEFEQFGRVYQNYCEAMSSLSLEIMELLGLSLGIKKDHFREFFEENDSIMRLNHYPPC  234

Query  652   QKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSN  473
             Q P+LTLGTGPHCDP+SLTILHQD V+GLQVFV+N+W+++ P P AFVVNIGDTFMALSN
Sbjct  235   QTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVENQWQSILPNPKAFVVNIGDTFMALSN  294

Query  472   GLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYT  293
             G++KSC+HRAVVN E  R S+AFFLCP +DKVV PP E+++   P+ YPDF WP  LE+T
Sbjct  295   GIFKSCLHRAVVNRESARTSMAFFLCPKRDKVVKPPSEILEKMTPRRYPDFTWPMFLEFT  354

Query  292   QLHYRSDTDTLLNFATWLQQNQ  227
             Q HYR+D +TL +F  W+  N+
Sbjct  355   QKHYRADVNTLDSFTNWIITNK  376



>ref|XP_003528896.1| PREDICTED: gibberellin 20 oxidase 2-like [Glycine max]
 gb|KHN04585.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=396

 Score =   466 bits (1198),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 215/347 (62%), Positives = 273/347 (79%), Gaps = 2/347 (1%)
 Frame = -3

Query  1279  FDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEA  1100
             FD S++ ++SNIP++F+WPDHEKP      E Q+P ID+  F S DP A++  C  + EA
Sbjct  30    FDGSLMPNQSNIPSQFIWPDHEKPC-LTPPELQIPPIDLKCFLSADPQALSTVCAELSEA  88

Query  1099  CKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNA  920
             CKKHGFFLVVNHGVD++L++   + +D +F + LS K+KA RK+GEHCGYA+SF GRF++
Sbjct  89    CKKHGFFLVVNHGVDSKLIAQAHKLIDDFFCMQLSQKQKAQRKIGEHCGYANSFIGRFSS  148

Query  919   KLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLG  740
             KLPWKETLSF +SA+K     VE+YF   +G++F   G ++Q+YC AM+ L+L I ELLG
Sbjct  149   KLPWKETLSFHYSADKS-RKTVEDYFLNVMGEDFKQFGSVFQEYCEAMSKLSLGIMELLG  207

Query  739   MGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQV  560
             M LGV R+ F +F++ N+SV+RLNYYPPCQKPEL LGTGPHCDPTSLTILHQD V GLQV
Sbjct  208   MSLGVGRECFRDFFEGNESVMRLNYYPPCQKPELALGTGPHCDPTSLTILHQDQVEGLQV  267

Query  559   FVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDK  380
             FVD  W +V P  +AFVVNIGDTFMALSNG++KSC+HRAVVNN+I RKS+AFFLCP++DK
Sbjct  268   FVDGRWYSVAPKEDAFVVNIGDTFMALSNGMFKSCLHRAVVNNKIVRKSLAFFLCPNRDK  327

Query  379   VVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             VVTPP +L+   + + YPDF WP+LLE+TQ HYRSDT TL  F+ WL
Sbjct  328   VVTPPKDLISYENSRTYPDFTWPSLLEFTQKHYRSDTKTLDAFSRWL  374



>gb|KHN23055.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=327

 Score =   463 bits (1191),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 211/321 (66%), Positives = 256/321 (80%), Gaps = 0/321 (0%)
 Frame = -3

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             E  VP+ID+  F SGDPVA  E  ++V EAC+KHGFFLVVNHG+D  L+S+    MD +F
Sbjct  5     ELGVPLIDLGGFLSGDPVATMEAARIVGEACQKHGFFLVVNHGIDANLISNAHSYMDDFF  64

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             E+PLS K++A RK GEHCGYASSFTGRF++KLPWKETLSF++SAE+  S +V++Y   TL
Sbjct  65    EVPLSQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQYSAEENSSTIVKDYLCNTL  124

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
              +EF   G +YQ YC+AM+ L+L I ELLGM LGV +  F EF++EN+S++RLNYYPPCQ
Sbjct  125   EKEFEQFGRVYQDYCDAMSNLSLGIMELLGMSLGVGKACFREFFEENNSIMRLNYYPPCQ  184

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             KP+LTLGTGPHCDPTSLTILHQD V GLQVFVDNEW +++P  NAFVVNIGDTFMALSNG
Sbjct  185   KPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSISPNFNAFVVNIGDTFMALSNG  244

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
              YKSC+HRAVVN++  RKS+AFFLCP  DKVV+PP ELVD   P++YPDF WP LLE+TQ
Sbjct  245   RYKSCLHRAVVNSKTTRKSLAFFLCPKGDKVVSPPSELVDDLTPRIYPDFTWPMLLEFTQ  304

Query  289   LHYRSDTDTLLNFATWLQQNQ  227
              HYR+D  TL  F  WL Q +
Sbjct  305   KHYRADMKTLEAFTNWLLQRK  325



>emb|CDX92707.1| BnaC07g39650D [Brassica napus]
Length=383

 Score =   464 bits (1195),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 220/379 (58%), Positives = 281/379 (74%), Gaps = 11/379 (3%)
 Frame = -3

Query  1357  IECMIPTP----TPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             + C+  +P    TP  +   I+  P    +F+ S+L  ++ IP +F+WPD EKP    A 
Sbjct  2     VSCVTTSPQEEDTPKLDLGNIQRPP----IFNPSMLNLQATIPNQFIWPDDEKPC-TEAP  56

Query  1189  EFQVPVIDMAAF--RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDR  1016
             E  VP+ID+  F   S  P A  E  +L+ EAC KHGFFLVVNHG+  EL+SD    M R
Sbjct  57    ELDVPLIDLQNFLSASSSPSATLEASRLISEACSKHGFFLVVNHGISEELISDAHECMAR  116

Query  1015  YFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEK  836
             +F++P S K+K  RK GE CGYASSFTGRF+ KLPWKETLSFRF  +K   + V++YF  
Sbjct  117   FFDMPPSEKQKVQRKPGESCGYASSFTGRFSTKLPWKETLSFRFCDDKNSPNTVQDYFCD  176

Query  835   TLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPP  656
              LG E   LG++YQ+YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPP
Sbjct  177   ALGHELEPLGKVYQEYCEAMSSLSLKIMELLGLSLGVSRDYFREFFEENDSIMRLNYYPP  236

Query  655   CQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALS  476
             CQKP+LTLGTGPHCDPTSLTILHQD+V+GLQVFV+N+WR+++P P AFVVNIGDTFMALS
Sbjct  237   CQKPDLTLGTGPHCDPTSLTILHQDNVNGLQVFVENQWRSISPNPKAFVVNIGDTFMALS  296

Query  475   NGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEY  296
             N  Y SC+HRAVVN++  RKS+AFFLCP+KD+VV PP EL+D+  P+ YPDF W  LLE+
Sbjct  297   NNRYMSCLHRAVVNSQSERKSLAFFLCPNKDRVVKPPRELLDSNAPRRYPDFTWSMLLEF  356

Query  295   TQLHYRSDTDTLLNFATWL  239
             TQ HYR+D +TL  F+ WL
Sbjct  357   TQKHYRADMNTLQAFSDWL  375



>ref|XP_009137526.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-like 
[Brassica rapa]
Length=381

 Score =   464 bits (1193),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 217/377 (58%), Positives = 277/377 (73%), Gaps = 3/377 (1%)
 Frame = -3

Query  1357  IECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQV  1178
             + C+  +P   H  +         ++F+ S+L  ++ IP +F+WPD EKP    A E  V
Sbjct  2     VSCITKSPQEEHTPKLDLGNIQTPLIFNPSMLNLQATIPNQFIWPDDEKPC-TEAPELDV  60

Query  1177  PVIDMAAF--RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             P+ID+  F   S  P A  E  +L+ EAC KHGFFLVVNHG+  EL+SD    M R++++
Sbjct  61    PLIDLQNFLSASSSPSATLEASRLISEACSKHGFFLVVNHGISEELISDAHECMARFYDM  120

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
             P S K+K  RK GE CGYASSFTGRF+ KLPWKETLSFRF  +K   + V++YF   LG 
Sbjct  121   PPSEKQKVQRKPGESCGYASSFTGRFSTKLPWKETLSFRFCDDKNSPNTVQDYFCDALGH  180

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             EF  LG++YQ+YC  M++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPCQKP
Sbjct  181   EFLPLGKVYQEYCEEMSSLSLKIMELLGLSLGVSRDYFREFFEENDSIMRLNYYPPCQKP  240

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
              LTLGTGPHCDPTSLTILHQD V+GLQVFVDN+WR+++P P AFVVNIGDTFMALSN +Y
Sbjct  241   NLTLGTGPHCDPTSLTILHQDHVNGLQVFVDNQWRSISPNPKAFVVNIGDTFMALSNNIY  300

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRAVVN++  RKS+AFFLCP K +VV PP EL+D+  P+ YPDF W  LLE+TQ H
Sbjct  301   KSCLHRAVVNSQSERKSLAFFLCPKKYRVVKPPRELLDSNTPRRYPDFTWSMLLEFTQKH  360

Query  283   YRSDTDTLLNFATWLQQ  233
             YR+D +TL  F+ WL +
Sbjct  361   YRADMNTLQAFSDWLTK  377



>ref|XP_009625248.1| PREDICTED: gibberellin 20 oxidase 1-D-like [Nicotiana tomentosiformis]
Length=377

 Score =   463 bits (1192),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/359 (58%), Positives = 272/359 (76%), Gaps = 1/359 (0%)
 Frame = -3

Query  1312  EIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVA  1133
             E +N+   ++VFD+  L++ SNIP +F+WP+ EKP P       VP ID+  + SGDP+A
Sbjct  14    ETQNEETTSLVFDALFLQNNSNIPQQFIWPEGEKPCPEPPLSLHVPPIDLNDYLSGDPLA  73

Query  1132  VAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCG  953
             V+   +LV++AC+KHGFFLVVNHG+D++L+++  + MD +F  PL  KE+A RKLG++CG
Sbjct  74    VSNATRLVNQACRKHGFFLVVNHGIDSKLINEAHKNMDFFFGKPLVEKERAKRKLGDYCG  133

Query  952   YASSFTGRFNAKLPWKETLSFRFSAEKECS-HVVEEYFEKTLGQEFADLGELYQKYCNAM  776
             YASSFT RF+  LPWKETLSFR+SAE   S H+V+ Y    +GQE+   G +YQKYC  M
Sbjct  134   YASSFTSRFSCNLPWKETLSFRYSAEVPSSDHIVQSYILNVMGQEYTHFGNVYQKYCEEM  193

Query  775   NTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLT  596
             + L+L++ ELLG  LGV R +F EF++ NDS++RLNYYPPCQKP+LTLGTGPHCDPTSLT
Sbjct  194   SKLSLKVMELLGESLGVGRAYFREFFEGNDSIMRLNYYPPCQKPDLTLGTGPHCDPTSLT  253

Query  595   ILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRK  416
             ILHQD+V GL+VFVD +W ++ P  NAFVVNIGDTFM +SNG YKSC+HRA+VN   PRK
Sbjct  254   ILHQDNVGGLEVFVDEKWHSIPPNTNAFVVNIGDTFMVMSNGTYKSCLHRAIVNCRKPRK  313

Query  415   SIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             S+AFFLCP KDK+V+PP EL+    P+ +PDF WP  LE+TQ HYR+D  TL  F  WL
Sbjct  314   SLAFFLCPKKDKIVSPPKELITRNLPRKFPDFTWPVFLEFTQKHYRADKKTLDAFVHWL  372



>ref|XP_010442687.1| PREDICTED: gibberellin 20 oxidase 2-like [Camelina sativa]
Length=382

 Score =   462 bits (1190),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 279/384 (73%), Gaps = 11/384 (3%)
 Frame = -3

Query  1363  MAIECMI-----PTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPY  1199
             MAI C       P    +  +Q++ N     ++F+ S+L  ++ IP +F+WPD EKP   
Sbjct  1     MAILCTTTTTTSPAEKEHEPKQDLGNDQTPPLIFNPSLLNLQTQIPNQFIWPDEEKPS-I  59

Query  1198  AAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMD  1019
                E  VP ID++   S       E  +L+ EAC KHGFFLVVNHGV   L+S+  R M+
Sbjct  60    DIPELNVPFIDLSRQDS-----TLEASRLIAEACTKHGFFLVVNHGVSESLISEAQRLME  114

Query  1018  RYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFE  839
             R+F++PL+ K++A RK GE CGYASSFTGRF+ KLPWKETLSFRFS E   S  V+ YF 
Sbjct  115   RFFDMPLAGKQRAQRKPGESCGYASSFTGRFSTKLPWKETLSFRFSNENSGSKTVQNYFS  174

Query  838   KTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYP  659
              TLGQEF   G++YQ YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YP
Sbjct  175   DTLGQEFEHFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYP  234

Query  658   PCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMAL  479
             PCQ P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+WR++ P P AFVVNIGDTFMAL
Sbjct  235   PCQTPDLTLGTGPHCDPSSLTILHQDQVNGLQVFVDNQWRSILPNPKAFVVNIGDTFMAL  294

Query  478   SNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLE  299
             SNG++KSC+HRAVVN E  RKS+AFFLCP KDKVV PP E+++    + YPDF W   LE
Sbjct  295   SNGIFKSCLHRAVVNRECARKSMAFFLCPKKDKVVRPPSEILEKMKTRKYPDFTWSMFLE  354

Query  298   YTQLHYRSDTDTLLNFATWLQQNQ  227
             +TQ HYR+D +TL +F+ W+  N+
Sbjct  355   FTQKHYRADVNTLDSFSNWVISNK  378



>gb|ABV64511.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   461 bits (1187),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 269/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVMRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>ref|NP_199994.1| gibberellin 20 oxidase 2 [Arabidopsis thaliana]
 sp|Q39111.1|GAOX2_ARATH RecName: Full=Gibberellin 20 oxidase 2; AltName: Full=GA 20-oxidase 
2; AltName: Full=Gibberellin C-20 oxidase 2 [Arabidopsis 
thaliana]
 emb|CAA58294.1| gibberellin 20-oxidase [Arabidopsis thaliana]
 dbj|BAB11250.1| gibberellin 20-oxidase [Arabidopsis thaliana]
 gb|AED96129.1| gibberellin 20 oxidase 2 [Arabidopsis thaliana]
Length=378

 Score =   462 bits (1188),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/380 (57%), Positives = 282/380 (74%), Gaps = 8/380 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPN-HE-RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAR  1190
             MAI C   +P    HE +Q++E    + ++F+ S+L  +S IP +F+WPD EKP      
Sbjct  1     MAILCTTTSPAEKEHEPKQDLEKDQTSPLIFNPSLLNLQSQIPNQFIWPDEEKPS-IDIP  59

Query  1189  EFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYF  1010
             E  VP ID+++  S       E  +++ EAC KHGFFLVVNHGV   L++D  R M+ +F
Sbjct  60    ELNVPFIDLSSQDS-----TLEAPRVIAEACTKHGFFLVVNHGVSESLIADAHRLMESFF  114

Query  1009  ELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTL  830
             ++PL+ K+KA RK GE CGYASSFTGRF+ KLPWKETLSF+FS +   S  V++YF  TL
Sbjct  115   DMPLAGKQKAQRKPGESCGYASSFTGRFSTKLPWKETLSFQFSNDNSGSRTVQDYFSDTL  174

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             GQEF   G++YQ YC AM++L+L+I ELLG+ LGV+R +F  F++ENDS++RLN+YPPCQ
Sbjct  175   GQEFEQFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPPCQ  234

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
              P+LTLGTGPHCDP+SLTILHQD V+GLQVFVDN+W+++ P P AFVVNIGDTFMALSNG
Sbjct  235   TPDLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWQSIRPNPKAFVVNIGDTFMALSNG  294

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQ  290
             ++KSC+HRAVVN E  RKS+AFFLCP KDKVV PP ++++    + YPDF W   LE+TQ
Sbjct  295   IFKSCLHRAVVNRESARKSMAFFLCPKKDKVVKPPSDILEKMKTRKYPDFTWSMFLEFTQ  354

Query  289   LHYRSDTDTLLNFATWLQQN  230
              HYR+D +TL +F+ W+  N
Sbjct  355   KHYRADVNTLDSFSNWVITN  374



>gb|ACU40944.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   461 bits (1186),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 269/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACEQHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>ref|XP_004510900.1| PREDICTED: gibberellin 20 oxidase 2-like [Cicer arietinum]
Length=376

 Score =   461 bits (1187),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 212/348 (61%), Positives = 267/348 (77%), Gaps = 2/348 (1%)
 Frame = -3

Query  1276  DSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEAC  1097
             D+S L  +S IP EF+WPDHEKP      +  VP ID+ AF S DP  ++  C  V+EAC
Sbjct  28    DTSFLPCQSKIPLEFIWPDHEKPC-LTPPKLHVPPIDLKAFLSNDPQEISNACSKVNEAC  86

Query  1096  KKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAK  917
             KKHGFFLVVNHGVD +L++   + +D +F + L  K++A RK+GEHCGYA+SF GRF++K
Sbjct  87    KKHGFFLVVNHGVDNKLIAQAHKLIDDFFSMQLLEKQRAQRKIGEHCGYANSFIGRFSSK  146

Query  916   LPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGM  737
             LPWKETLSFR+S +K C  +VEEYF   +G++F   G +YQ YC AMN L+LEI ELLGM
Sbjct  147   LPWKETLSFRYSNDKSC-RIVEEYFVNVMGEDFRQFGSVYQDYCEAMNKLSLEIMELLGM  205

Query  736   GLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVF  557
              LGV   +F EF++ N+SV+RLNYYPPC+ P L LGTGPHCDPTSLTILHQD V GLQV 
Sbjct  206   SLGVGNNYFREFFEGNESVMRLNYYPPCKSPNLALGTGPHCDPTSLTILHQDQVEGLQVL  265

Query  556   VDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKV  377
             VD +W ++ P  +AFVVNIGDTFMALSNG++KSC+HRAVVN++I RKS+AFFLCP +DKV
Sbjct  266   VDEKWHSIVPKDDAFVVNIGDTFMALSNGIFKSCLHRAVVNDKIVRKSLAFFLCPSEDKV  325

Query  376   VTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQ  233
             VTPP EL++  +PK+YP+F WP LLE+TQ HYR+D  TL  F+ WL +
Sbjct  326   VTPPKELINKENPKIYPNFTWPCLLEFTQKHYRADQRTLDAFSRWLHE  373



>gb|ACU40945.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   461 bits (1185),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 268/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP  E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPGGESPTPDAAEELHVPLIDIGGMISGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>ref|XP_010438884.1| PREDICTED: gibberellin 20 oxidase 1 isoform X1 [Camelina sativa]
Length=380

 Score =   461 bits (1187),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 279/383 (73%), Gaps = 16/383 (4%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAA-------VVFDSSVLRHESNIPTEFLWPDHEKPG  1205
             MA+ C+  +        E E+KP          ++F+ S+   ++NIP +F+WPD EKP 
Sbjct  1     MAVSCVTTS-------LEEEDKPKLGFGNIQTPLIFNPSMHNLQTNIPNQFIWPDDEKPS  53

Query  1204  PYAAREFQVPVIDMAAFRSGD-PVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVR  1028
                A +  VP+ID+    S D P +  +   L+ EACKKHGFFLVVNHG+  EL+SD   
Sbjct  54    -IDAPDLDVPLIDLQNLNSSDFPSSSLQASTLISEACKKHGFFLVVNHGISEELISDAHV  112

Query  1027  EMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEE  848
              M R+F++PLS K++ LRK GE CGYASSFTGRF+ KLPWKETLSFRF   +     V++
Sbjct  113   YMSRFFDMPLSEKQRVLRKPGESCGYASSFTGRFSTKLPWKETLSFRFCDGETHPKTVQD  172

Query  847   YFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLN  668
             YF   LG EF   G++YQ+YC AM++L+L+I ELLG+ LGV+R +F EF++ENDS++RLN
Sbjct  173   YFSDALGHEFQPFGKVYQEYCEAMSSLSLKIMELLGLSLGVNRDYFREFFEENDSIMRLN  232

Query  667   YYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTF  488
             YYPPCQKP+LTLGTGPHCDPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTF
Sbjct  233   YYPPCQKPDLTLGTGPHCDPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTF  292

Query  487   MALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPA  308
             MALSN  YKSC+HRAVVN+E  RKS+AFFLCP KDKVV PP EL+D+   + YPDF W  
Sbjct  293   MALSNDRYKSCLHRAVVNSESERKSLAFFLCPKKDKVVKPPRELLDSITSRKYPDFTWAM  352

Query  307   LLEYTQLHYRSDTDTLLNFATWL  239
              LE+TQ HYR+D +TL  F+ WL
Sbjct  353   FLEFTQKHYRADMNTLQAFSDWL  375



>ref|XP_006413308.1| hypothetical protein EUTSA_v10025434mg [Eutrema salsugineum]
 gb|ESQ54761.1| hypothetical protein EUTSA_v10025434mg [Eutrema salsugineum]
Length=386

 Score =   461 bits (1187),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 219/382 (57%), Positives = 277/382 (73%), Gaps = 8/382 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHE-RQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAARE  1187
             MA+ C+  +P   H  + ++ N     +VF+ S+L  + NIP +F+WP  E+P   A  E
Sbjct  1     MAVSCVTTSPEQEHTPKLDLGNIQTTPIVFNPSMLNLQPNIPNQFIWPHDERPCTEAP-E  59

Query  1186  FQVPVIDMAAF------RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVRE  1025
               VP+ID+  F            +  E  +L+ EAC KHGFFLVVNHG+  EL+SD    
Sbjct  60    LDVPLIDLQNFLSDSDSTPSSSSSTVEASRLISEACNKHGFFLVVNHGISEELISDAHDY  119

Query  1024  MDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEY  845
             M R+F++PLS K++ LRK GE CGYASSFTGRF+ KLPWKETLSFRF  +K  S  V++Y
Sbjct  120   MARFFDMPLSEKQRLLRKSGESCGYASSFTGRFSTKLPWKETLSFRFCDDKSRSKTVQDY  179

Query  844   FEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNY  665
             F   LG  F   G++YQ+YC AM++L+L+I ELLG+ LGV+R +F EF++ENDS++RLNY
Sbjct  180   FCDALGHGFEPFGKVYQEYCEAMSSLSLKIMELLGLSLGVNRNYFREFFEENDSIMRLNY  239

Query  664   YPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFM  485
             YPPCQKP+LTLGTGPHCDPTSLTILHQD V GLQVFV+N+WR++ P P AFVVNIGDTFM
Sbjct  240   YPPCQKPDLTLGTGPHCDPTSLTILHQDHVDGLQVFVENQWRSIRPNPKAFVVNIGDTFM  299

Query  484   ALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             ALSN  YKSC+HRAVVN+E  RKS+AFFLCP  D+VV PP EL+D   P+ YPDF W  L
Sbjct  300   ALSNNRYKSCLHRAVVNSESERKSLAFFLCPKNDRVVKPPRELLDRITPRRYPDFTWSML  359

Query  304   LEYTQLHYRSDTDTLLNFATWL  239
             LE+TQ HYR+D +TL  F+ WL
Sbjct  360   LEFTQKHYRADMNTLQAFSDWL  381



>gb|ACU40942.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   460 bits (1184),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 269/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWWSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>gb|AAC49211.1| gibberellin 20-oxidase [Spinacia oleracea]
 prf||2209435A gibberellin 20-oxidase
Length=374

 Score =   461 bits (1185),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 216/355 (61%), Positives = 265/355 (75%), Gaps = 5/355 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             +FD+S L+HE NIP++F+WPD EKP      E +VP ID+  F SGDPVAV++   L +E
Sbjct  17    LFDTSFLKHEDNIPSQFIWPDDEKPCSETPPELEVPPIDLGGFLSGDPVAVSKATTLANE  76

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             ACK HGFFL+VNH +  ELL      MD +F  P S K+KALRK G+HCGYASSF GRF 
Sbjct  77    ACKWHGFFLIVNHDIYFELLVKAHEAMDYFFSQPFSQKQKALRKQGDHCGYASSFLGRFA  136

Query  922   AKLPWKETLSFRFSAEKECSH--VVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITE  749
              KLPWKETLSFR+  + +     +V+ Y    +G +F + G +YQ+YC AM+ L+L I E
Sbjct  137   TKLPWKETLSFRYYDDDDDKSSKMVQNYISNLMGTDFQEFGRVYQEYCKAMSKLSLGIME  196

Query  748   LLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSG  569
             LLGM LGV R +F EF++ NDS++RLNYYPPCQKPELTLGTGPHCDPTSLTILHQD V G
Sbjct  197   LLGMSLGVGRNYFREFFKGNDSIIRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDHVGG  256

Query  568   LQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPH  389
             L+VFVD +W ++ P   AFVVNIGDTFMALSNG YKSC+HRAVVN++ PRKS+AFFLCP 
Sbjct  257   LEVFVDQKWYSIRPNQKAFVVNIGDTFMALSNGKYKSCLHRAVVNSKTPRKSVAFFLCPR  316

Query  388   KDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQT  224
              +KV+ PP EL    HP++YPDF WP LLE+TQ HYR+DT TL +F  WLQ+  T
Sbjct  317   GNKVIRPPIEL---GHPRVYPDFTWPLLLEFTQKHYRADTKTLDSFTKWLQKRST  368



>gb|ACU40946.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   460 bits (1183),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 214/357 (60%), Positives = 268/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF V NHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVANHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>emb|CDY49714.1| BnaA03g47400D [Brassica napus]
Length=350

 Score =   459 bits (1180),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 266/347 (77%), Gaps = 3/347 (1%)
 Frame = -3

Query  1267  VLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF--RSGDPVAVAETCKLVDEACK  1094
             +L  ++ IP +F+WPD EKP   A  E  VP+ID+  F   S  P A  E  +L+ EAC 
Sbjct  1     MLNLQATIPNQFIWPDDEKPCTEAP-ELDVPLIDLQNFLSASSSPSATLEASRLISEACS  59

Query  1093  KHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKL  914
             KHGFFLVVNHG+  EL+SD    M R++++P S K+K  RK GE CGYASSFTGRF+ KL
Sbjct  60    KHGFFLVVNHGISEELISDAHECMARFYDMPPSEKQKVQRKPGESCGYASSFTGRFSTKL  119

Query  913   PWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMG  734
             PWKETLSFRF  +K   + V++YF   LG EF  LG++YQ+YC  M++L+L+I ELLG+ 
Sbjct  120   PWKETLSFRFCDDKNSPNTVQDYFCDALGHEFLPLGKVYQEYCEEMSSLSLKIMELLGLS  179

Query  733   LGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFV  554
             LGV R +F EF++ENDS++RLNYYPPCQKP LTLGTGPHCDPTSLTILHQD V+GLQVFV
Sbjct  180   LGVSRDYFREFFEENDSIMRLNYYPPCQKPNLTLGTGPHCDPTSLTILHQDHVNGLQVFV  239

Query  553   DNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVV  374
             DN+WR+++P P AFVVNIGDTFMALSN +YKSC+HRAVVN++  RKS+AFFLCP KD+VV
Sbjct  240   DNQWRSISPNPKAFVVNIGDTFMALSNNIYKSCLHRAVVNSQSERKSLAFFLCPKKDRVV  299

Query  373   TPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQ  233
              PP EL+D+  P+ YPDF W  LLE+TQ HYR+D +TL  F+ WL +
Sbjct  300   KPPRELLDSNTPRRYPDFTWSMLLEFTQKHYRADMNTLQAFSDWLTK  346



>gb|ACU40940.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   459 bits (1181),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 214/357 (60%), Positives = 268/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV  
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGG  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>gb|AAB67838.1| gibberellin 20-oxidase [Pisum sativum]
Length=379

 Score =   459 bits (1182),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 282/380 (74%), Gaps = 2/380 (1%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREF  1184
             M + C      P +  +   N+    +   SS+    +NIP+EF+WPDHEKP      + 
Sbjct  1     MKVLCSSMLFAPPNANESFMNEQKQCLDNTSSLPLQITNIPSEFIWPDHEKPC-LTPPKL  59

Query  1183  QVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFEL  1004
             +VP ID+ AF S DP +++  C  V+ ACKKHGFFLVVNHGVD +L++   + +D +F +
Sbjct  60    EVPPIDLKAFLSDDPKSISNACSKVNHACKKHGFFLVVNHGVDNKLIAQAHKLVDEFFCM  119

Query  1003  PLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQ  824
              LS K++A RK+GEHCGYA+SF GRF++KLPWKETLSFR+SA++ C   VE+YF   +G+
Sbjct  120   QLSEKQRAQRKIGEHCGYANSFIGRFSSKLPWKETLSFRYSADESC-RTVEDYFVNIMGE  178

Query  823   EFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKP  644
             +F   G +YQKYC AM+ L+L I ELLGM LGV +++F EF++ N+SV+RLNYYPPC+ P
Sbjct  179   DFRQFGIVYQKYCEAMSNLSLGIMELLGMSLGVGKEYFREFFEGNESVMRLNYYPPCKNP  238

Query  643   ELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLY  464
             +L  GTGPHCDPTSLTILHQD V GLQV VD  W +V P  +AFVVNIGDTFMALSNG++
Sbjct  239   DLAFGTGPHCDPTSLTILHQDQVEGLQVLVDGIWHSVVPKEDAFVVNIGDTFMALSNGMF  298

Query  463   KSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLH  284
             KSC+HRA+VN++I RKS+AFFLCP++DK+VTPP EL+D  +P+ YP+F WP+LLE+TQ H
Sbjct  299   KSCLHRAIVNDKIVRKSLAFFLCPNEDKIVTPPKELIDKENPRKYPNFTWPSLLEFTQKH  358

Query  283   YRSDTDTLLNFATWLQQNQT  224
             YR+D  TL  F+ WLQ+  T
Sbjct  359   YRADERTLDAFSMWLQEKTT  378



>sp|O04705.1|GAO1D_WHEAT RecName: Full=Gibberellin 20 oxidase 1-D; AltName: Full=GA 20-oxidase 
1-D; AltName: Full=Gibberellin C-20 oxidase 1-D; AltName: 
Full=Protein Wga20; AltName: Full=TaGA20ox1-D; Short=Ta20ox1D 
[Triticum aestivum]
 emb|CAA74330.1| gibberellin 20-oxidase [Triticum aestivum]
 dbj|BAA21480.1| wga20 [Triticum aestivum]
Length=361

 Score =   458 bits (1179),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 268/352 (76%), Gaps = 2/352 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD++VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDAAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPAAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR  GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDNFFTMPLPEKQRALRHPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD+V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPLETLGTGPHCDPTSLTILHQDNVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  +  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWIVQQQ  354



>gb|KEH19017.1| gibberellin 20-oxidase [Medicago truncatula]
Length=372

 Score =   458 bits (1179),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 269/342 (79%), Gaps = 2/342 (1%)
 Frame = -3

Query  1252  SNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLV  1073
             +NIP+EF+WP+HEKP      + QVP ID+ AF SGDP A++  C  V++ACKKHGFFLV
Sbjct  31    TNIPSEFIWPEHEKPC-LTPPKLQVPPIDLKAFLSGDPKAISNACSQVNDACKKHGFFLV  89

Query  1072  VNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLS  893
             VNHGVD +LL+   + +D +F + L  K+KA RK+GEHCGYA+SF GRF++KLPWKETLS
Sbjct  90    VNHGVDKKLLAQAHKLVDDFFCMQLCEKQKAQRKVGEHCGYANSFIGRFSSKLPWKETLS  149

Query  892   FRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKH  713
             FR+S +K C   VE+YF   +G++F   G +YQ YC AM+ L+L I ELLGM LGVD+++
Sbjct  150   FRYSDDKSC-RTVEDYFVNVMGEDFRQFGSVYQDYCEAMSNLSLGIMELLGMSLGVDKEY  208

Query  712   FSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAV  533
             F  F++ NDSV+RLNYYPPC+ P+L LGTGPHCDPTSLTILHQD V GLQV VD  W ++
Sbjct  209   FRHFFEANDSVMRLNYYPPCKNPDLALGTGPHCDPTSLTILHQDQVEGLQVLVDGIWHSI  268

Query  532   NPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELV  353
              P  +AFVVNIGDTFMALSNG++KSC+HRAVVN+ I RKS+AFFLCP+++K+VTPP EL+
Sbjct  269   VPKEDAFVVNIGDTFMALSNGIFKSCLHRAVVNDTIVRKSLAFFLCPNEEKIVTPPKELI  328

Query  352   DATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQ  227
             +  +P +YP+F WP+LLE+TQ HYR+D  TL  F+ WLQ+ Q
Sbjct  329   NKENPMIYPNFTWPSLLEFTQKHYRADERTLDAFSRWLQEKQ  370



>gb|ACU40939.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   457 bits (1177),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 268/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++ +WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQLIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSQLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  +  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGALVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>gb|AGW24332.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   458 bits (1178),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 273/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF+W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFRWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>gb|AGW24319.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   457 bits (1177),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 273/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E +VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELEVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>gb|ACU40943.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   457 bits (1175),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/357 (60%), Positives = 266/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +  +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFLTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS+ RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSITRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL+ TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDSTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>gb|AAT49058.1| GA 20-oxidase 1 [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   456 bits (1173),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 211/356 (59%), Positives = 268/356 (75%), Gaps = 2/356 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD++VL   ++IP++F+WP+ E P P A  E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDAAVLSGRTDIPSQFIWPEGESPTPDATEEMHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D +LL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAQLLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ N+S++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNESIMRLNYYPPCQRPLETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHA  215
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q   A
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQPASA  358



>gb|EYU35054.1| hypothetical protein MIMGU_mgv1a024312mg [Erythranthe guttata]
Length=344

 Score =   455 bits (1171),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 212/360 (59%), Positives = 270/360 (75%), Gaps = 20/360 (6%)
 Frame = -3

Query  1309  IENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAV  1130
             IEN+      F    L+HES+IP +F+WPDHEKP P        P +D  +         
Sbjct  4     IENR-----SFSFGSLQHESHIPPQFIWPDHEKPSPDPP-----PQLDGGS---------  44

Query  1129  AETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGY  950
              E  +LVD AC+ HGFFLVVNHG+D +L+ +  + +D +F+LPL  KEKALRK G+HCGY
Sbjct  45    -EAARLVDRACRGHGFFLVVNHGIDMKLIEEVHKGVDLFFKLPLDAKEKALRKKGDHCGY  103

Query  949   ASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNT  770
             ASSFT RF++ LPWKETLSFR+SAE+  S+VVE YF   +G++F   G + Q+YC AMN+
Sbjct  104   ASSFTNRFSSNLPWKETLSFRYSAERHLSNVVESYFLDVMGEDFDAFGSVCQRYCEAMNS  163

Query  769   LALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTIL  590
             L+L++ E+LGM LGV   +F +F++ NDS++RLNYYPPCQKP+L LGTGPHCDPTSLTIL
Sbjct  164   LSLKVMEILGMSLGVGENYFRDFFEGNDSIMRLNYYPPCQKPDLVLGTGPHCDPTSLTIL  223

Query  589   HQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSI  410
             HQDSV GL+VFVD +W ++ P P+AF+VNIGDTFMAL+NG+YK C+HRAVVN+  PRKS+
Sbjct  224   HQDSVGGLEVFVDEKWHSIAPNPHAFLVNIGDTFMALTNGIYKGCLHRAVVNSTSPRKSL  283

Query  409   AFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQN  230
             AFFLCP  DK+V PP ELV   +P++YPDF WPALLE+TQ HYRSD  TL  F +WL+QN
Sbjct  284   AFFLCPKTDKIVRPPKELVSEENPRMYPDFTWPALLEFTQKHYRSDMKTLEAFVSWLRQN  343



>ref|NP_194272.1| gibberellin 20 oxidase 1 [Arabidopsis thaliana]
 sp|Q39110.2|GAOX1_ARATH RecName: Full=Gibberellin 20 oxidase 1; AltName: Full=GA 20-oxidase 
1; Short=AtGA20ox1; AltName: Full=Gibberellin C-20 oxidase 
1 [Arabidopsis thaliana]
 emb|CAB45519.1| gibberellin 20-oxidase-Arabidopsis thaliana
 emb|CAB81353.1| gibberellin 20-oxidase-Arabidopsis thaliana
 gb|AEE85055.1| gibberellin 20 oxidase 1 [Arabidopsis thaliana]
 gb|AGW24306.1| GA20ox1 [Arabidopsis thaliana]
 gb|AGW24309.1| GA20ox1 [Arabidopsis thaliana]
 gb|AGW24311.1| GA20ox1 [Arabidopsis thaliana]
 gb|AGW24315.1| GA20ox1 [Arabidopsis thaliana]
 gb|AGW24316.1| GA20ox1 [Arabidopsis thaliana]
 gb|AGW24325.1| GA20ox1 [Arabidopsis thaliana]
 gb|AGW24329.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   456 bits (1174),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 272/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>gb|AGW24323.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   456 bits (1173),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 272/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  +++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSIQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>emb|CDP15474.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   456 bits (1174),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 214/368 (58%), Positives = 278/368 (76%), Gaps = 6/368 (2%)
 Frame = -3

Query  1339  TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMA  1160
             +PT N  + E       ++VFD+  L+++S+IP EF+WPD EKP         VP ID+ 
Sbjct  11    SPTTNETKGE-----QKSLVFDAPFLQNQSDIPHEFIWPDEEKPCLEPPPMLHVPCIDLN  65

Query  1159  AFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKA  980
              F SGDPV V+ T KLV +AC +HGFFLVVNHG+D +LL    + +D +F+ PL  K++ 
Sbjct  66    GFLSGDPVTVSTTTKLVKQACLEHGFFLVVNHGMDLQLLKAAHKCLDFFFDRPLQEKQRV  125

Query  979   LRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAE-KECSHVVEEYFEKTLGQEFADLGE  803
              RKLG+HCGYASSFT RF++KLPWKETLSFR+ A+ ++  ++VE YF   +G++F++ G+
Sbjct  126   QRKLGDHCGYASSFTNRFSSKLPWKETLSFRYCADGQQALNIVESYFLNGMGEDFSESGK  185

Query  802   LYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTG  623
             ++QKY  AM++L+L+I ELLG  LGV  KHF EF+  NDS++RLNYYP CQKP+LTLGTG
Sbjct  186   VFQKYSEAMSSLSLKIMELLGTSLGVTAKHFREFFAGNDSIMRLNYYPACQKPDLTLGTG  245

Query  622   PHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRA  443
             PH DPTSLTILHQD V GL+V+V+ +W +V P P AFVVNIGDTFMALSNG+YKSC+HRA
Sbjct  246   PHTDPTSLTILHQDHVGGLEVYVNGKWHSVPPDPEAFVVNIGDTFMALSNGIYKSCLHRA  305

Query  442   VVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDT  263
             +VN+  PRKSIAFFLCP  DKVV+PP ELV + +P+++PDF W  LLE+TQ HYR+D  T
Sbjct  306   IVNSRTPRKSIAFFLCPKMDKVVSPPEELVSSDNPRMFPDFTWSELLEFTQKHYRADMKT  365

Query  262   LLNFATWL  239
             L  FA WL
Sbjct  366   LDAFAKWL  373



>gb|AAC39313.2| gibberellin 20-oxidase [Arabidopsis thaliana]
Length=377

 Score =   456 bits (1173),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 272/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCMKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             ++  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SKSERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>sp|O04706.1|GAO1B_WHEAT RecName: Full=Gibberellin 20 oxidase 1-B; AltName: Full=GA 20-oxidase 
1-B; AltName: Full=Gibberellin C-20 oxidase 1-B; AltName: 
Full=TaGA20ox1-B; Short=Ta20ox1B [Triticum aestivum]
 emb|CAA74331.1| gibberellin 20-oxidase [Triticum aestivum]
Length=365

 Score =   455 bits (1171),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 210/348 (60%), Positives = 268/348 (77%), Gaps = 2/348 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD++VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDAAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRATAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD+V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPMETLGTGPHCDPTSLTILHQDNVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  +  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+++PRKS+AFFLCP  D
Sbjct  243   VHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSKVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWI  350



>prf||2116434A gibberellin 20-oxidase
Length=377

 Score =   456 bits (1172),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 272/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SERMRKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>dbj|BAD94705.1| gibberellin 20-oxidase - Arabidopsis thaliana
Length=377

 Score =   455 bits (1171),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 271/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF+ ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFGENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>emb|CDX98998.1| BnaC09g48370D [Brassica napus]
Length=379

 Score =   455 bits (1170),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 281/384 (73%), Gaps = 8/384 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESN-IPTEFLWPDHEKPGPYAARE  1187
             MA+EC+   P   ++ +  E+      +FD+++L   SN IP +F+WPDHEKP     + 
Sbjct  1     MAMECIATLPERFNDNKTKED----PSIFDANLLNQLSNHIPQQFVWPDHEKPST-DVQP  55

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              Q P+ID+A F SGD   V+E  +LV EA KKHGFFLV NHGVD  LLS     MD +F+
Sbjct  56    LQAPLIDLAGFLSGDSFLVSEATRLVSEASKKHGFFLVTNHGVDETLLSRAYLFMDSFFK  115

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKEC-SHVVEEYFEKTL  830
              P   K+KA R  GE  GYASSF GRF++KLPWKETLSF+FS E++C S  V+++  K +
Sbjct  116   APACEKQKAQRTWGESSGYASSFVGRFSSKLPWKETLSFKFSPEEKCQSQAVKDFVSKKM  175

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G E+ + G++YQ+Y +AMN L+L+I ELLGM LG++R+HF  F+++N+S+LRLNYYP C 
Sbjct  176   GDEYENFGKVYQEYADAMNILSLKIMELLGMSLGIERRHFRNFFEDNESILRLNYYPQCN  235

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             +PELTLGTGPHCDPTSLTILHQD V+GLQV+VDN+W+++ P P AFVVNIGDTFMAL+NG
Sbjct  236   QPELTLGTGPHCDPTSLTILHQDQVAGLQVYVDNKWQSIPPDPQAFVVNIGDTFMALTNG  295

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATH-PKLYPDFKWPALLEYT  293
             +YKSC+HRAVVN+E  RK+ AFFLCP  DK+V PP ELV  T   + YPDF W   LE+T
Sbjct  296   IYKSCLHRAVVNSERERKTFAFFLCPKGDKMVKPPKELVGVTSGERKYPDFTWSTFLEFT  355

Query  292   QLHYRSDTDTLLNFATWLQQNQTL  221
             Q HYRSD +TL  F+ WL+  ++ 
Sbjct  356   QKHYRSDMNTLEEFSNWLKNRKSF  379



>emb|CAA58293.1| gibberellin 20-oxidase [Arabidopsis thaliana]
 gb|AGW24305.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   455 bits (1170),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 272/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             ++  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SKSERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>gb|AGW24320.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   455 bits (1170),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/367 (59%), Positives = 271/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP  F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNPFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTLGTGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>ref|XP_010423241.1| PREDICTED: gibberellin 20 oxidase 3 [Camelina sativa]
Length=380

 Score =   455 bits (1170),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 277/385 (72%), Gaps = 9/385 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESN-IPTEFLWPDHEKPGPYAARE  1187
             MA+EC+   P    +R  +      + +FD+ +L   SN IP +F+WPDHEKP     + 
Sbjct  1     MAMECIATVP----QRFSVNKAKEDSSIFDAKLLNQHSNHIPQQFVWPDHEKPST-DVQP  55

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              QVP+ID+A F SGD + V+E  +LV EA  +HGFFLV NHGVD  LLS     MD +F+
Sbjct  56    LQVPLIDLAGFLSGDSLLVSEATRLVSEAATQHGFFLVTNHGVDESLLSRAYLNMDSFFK  115

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFS-AEKECSHVVEEYFEKTL  830
              P   K+KA RK GE  GYASSF GRF++KLPWKETLSF+FS  EK  S  V+++  K +
Sbjct  116   APACEKQKAQRKWGESSGYASSFVGRFSSKLPWKETLSFKFSPEEKTHSQTVKDFVSKKM  175

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G  + D G++YQ+Y  AMNTL+L+I ELLGM LGV+R+HF EF+++N+S+ RLNYYP C+
Sbjct  176   GDGYEDFGKVYQEYAEAMNTLSLKIMELLGMSLGVERRHFREFFEDNESIFRLNYYPQCK  235

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             +PEL LGTGPHCDPTSLTILHQD V GLQVFVDN+W+++ P P+AFVVNIGDTFMAL+NG
Sbjct  236   QPELALGTGPHCDPTSLTILHQDQVGGLQVFVDNKWKSIPPNPHAFVVNIGDTFMALTNG  295

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA--THPKLYPDFKWPALLEY  296
              YKSC+HRA+VN+E  RK+ AFFLCP  DKVV PP ELV +  +  + YPDF W   LE+
Sbjct  296   RYKSCLHRALVNSERERKTFAFFLCPKGDKVVKPPEELVGSLMSREREYPDFTWSMFLEF  355

Query  295   TQLHYRSDTDTLLNFATWLQQNQTL  221
             TQ HYR+D +TL  F+ WL+  +  
Sbjct  356   TQKHYRADMNTLEAFSIWLKSRRNF  380



>ref|XP_006828892.1| hypothetical protein AMTR_s00001p00187150 [Amborella trichopoda]
 gb|ERM96308.1| hypothetical protein AMTR_s00001p00187150 [Amborella trichopoda]
Length=356

 Score =   454 bits (1167),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 260/350 (74%), Gaps = 4/350 (1%)
 Frame = -3

Query  1285  VVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVD  1106
             +VFD++ LR  + IP  F+WP+HE+P      E  VP+ID++  R GD     E  KLV 
Sbjct  9     LVFDAARLRQANTIPERFVWPEHERPN--NPSELDVPLIDLSGLRLGDAHTTFEAVKLVR  66

Query  1105  EACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRF  926
             EAC +HGFF VVNH V++ LL +    MDR+F + L  K++A RK GE CGYASSFTGRF
Sbjct  67    EACSRHGFFQVVNHWVESSLLKEAHEHMDRFFAMGLGEKQRAQRKPGESCGYASSFTGRF  126

Query  925   NAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITEL  746
              +KLPWKETLSF FS      HVV +YF   LG  F   GE+YQKYC++M+ +++ I EL
Sbjct  127   ASKLPWKETLSFHFSPA--MPHVVTDYFRSVLGDGFGSSGEVYQKYCDSMSEVSMNIMEL  184

Query  745   LGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGL  566
             LG+ LGVDR HF +F+ ENDS++RLNYYPPCQ+P L LGTGPHCDPTSLTILHQD VSGL
Sbjct  185   LGLSLGVDRAHFRDFFMENDSIMRLNYYPPCQQPGLVLGTGPHCDPTSLTILHQDDVSGL  244

Query  565   QVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHK  386
             QVFVD++W ++ P P+AFV+NIGDTFMALSNG YKSC+HRAVVN+  PRK++AFFL P  
Sbjct  245   QVFVDDQWHSIKPNPHAFVINIGDTFMALSNGRYKSCLHRAVVNSREPRKTLAFFLSPKM  304

Query  385   DKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQ  236
             ++VV PP +LVD  HP+LYPDF W  LLE+TQ HYR+D  TL +F  WLQ
Sbjct  305   ERVVRPPQDLVDQEHPRLYPDFTWATLLEFTQKHYRADMKTLDSFTRWLQ  354



>gb|ACU40941.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   454 bits (1167),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 267/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFDS+VL   ++IP++F+WP+ E P P AA E  VP+ID+    SGDP A AE  +LV E
Sbjct  5     VFDSAVLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDPRAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLP KETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPRKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTDGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++T  HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTLKHYRADMKTLEVFSSWVVQQQQAAMT  359



>emb|CDP15473.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   454 bits (1169),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 215/368 (58%), Positives = 276/368 (75%), Gaps = 6/368 (2%)
 Frame = -3

Query  1339  TPTPNHERQEIENKPAAAVVFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMA  1160
             +PT N  + E       ++VFD+  L+++S+IP EF+WPD EKP         VP ID+ 
Sbjct  11    SPTTNETKGE-----QKSLVFDAPFLQNQSDIPHEFIWPDEEKPCLEPPPMLHVPCIDLN  65

Query  1159  AFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKA  980
              F SGDPV V+ T KLV +AC +HGFFLVVNHG+D +LL    + +D +F+ PL  K++ 
Sbjct  66    GFLSGDPVTVSTTTKLVKQACLEHGFFLVVNHGMDLQLLKAAHKCLDFFFDRPLHEKQRV  125

Query  979   LRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECS-HVVEEYFEKTLGQEFADLGE  803
              RKLG+HCGYASSFT RF++KLPWKETLSFR+ A+ + S ++VE YF   +G+ F + G+
Sbjct  126   QRKLGDHCGYASSFTNRFSSKLPWKETLSFRYCADGQQSLNIVESYFLNGMGEGFRESGK  185

Query  802   LYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTG  623
             ++QKY  AM++L+L+I ELLG  LGV  KHF EF+  NDS++RLNYYP CQKP+LTLGTG
Sbjct  186   VFQKYSEAMSSLSLKIMELLGTSLGVKAKHFREFFAGNDSIMRLNYYPACQKPDLTLGTG  245

Query  622   PHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRA  443
             PH DPTSLTILHQD V GL+V+V+ +W +V P P AFVVNIGDTFMALSNG+YKSC+HRA
Sbjct  246   PHTDPTSLTILHQDHVGGLEVYVNGKWHSVPPDPEAFVVNIGDTFMALSNGIYKSCLHRA  305

Query  442   VVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDT  263
             +VN+  PRKSIAFFLCP  DKVV+PP ELV + +P+++PDF W  LLE+TQ HYR+D  T
Sbjct  306   IVNSRTPRKSIAFFLCPKMDKVVSPPEELVSSDNPRMFPDFTWSELLEFTQKHYRADMKT  365

Query  262   LLNFATWL  239
             L  FA WL
Sbjct  366   LDAFAKWL  373



>gb|AAG43043.1| gibberellin 20-oxidase [Lolium perenne]
Length=363

 Score =   453 bits (1166),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 212/357 (59%), Positives = 264/357 (74%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD+++L  +S+IP++F+WP  E P P A  E  VP+ID+    SGD VA AE  +LV +
Sbjct  5     VFDAALLSGQSDIPSQFIWPADESPSPDATEELHVPLIDIGGLLSGDRVAAAEVTRLVGD  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F + L  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMSLQGKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   E   VVE Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSEPDLVVE-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ N+S++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNESIMRLNYYPPCQRPNETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  D  W ++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHADGRWLSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVD  +P+ YPDF W ALL++TQ HYR+D  TL  F+ W+QQ     AT
Sbjct  303   KVVAPPGTLVDEANPRAYPDFTWRALLDFTQKHYRADMKTLEVFSDWIQQGHQPAAT  359



>emb|CAX46399.1| putative GA20OX protein [Rosa lucieae]
Length=324

 Score =   452 bits (1162),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 206/325 (63%), Positives = 260/325 (80%), Gaps = 1/325 (0%)
 Frame = -3

Query  1273  SSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACK  1094
             +++LR++++IP +F+WPD EKP P A +   VP+ID+  F SGDP A  +  +LV EAC+
Sbjct  1     AALLRYQTDIPKQFIWPDDEKPCPNAPK-LHVPLIDLGDFLSGDPEAAMKASRLVGEACE  59

Query  1093  KHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKL  914
             KHGFFLVVNHGV   L++D  + MD +F LPLS K++A RK GEHCGYASSFTGRF++KL
Sbjct  60    KHGFFLVVNHGVKDSLIADAHQYMDNFFGLPLSEKQRAQRKAGEHCGYASSFTGRFSSKL  119

Query  913   PWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMG  734
             PWKETLSFR++A++  S+VV+ Y    +G++F + G +YQ Y  AM+TL++ I ELLGM 
Sbjct  120   PWKETLSFRYTADQSESNVVKNYLCNAMGEDFEEFGRVYQDYSEAMSTLSIGIMELLGMS  179

Query  733   LGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFV  554
             LGVDR HF EF+ +NDS++RLNYYPPCQKP+ TLGTGPHCDPTSLTILHQD V GLQVFV
Sbjct  180   LGVDRTHFKEFFGDNDSIMRLNYYPPCQKPDQTLGTGPHCDPTSLTILHQDQVGGLQVFV  239

Query  553   DNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVV  374
             D EWR+++P  NAFVVNIGDTFMALSNG YKSC+HRAVVN++ PRKS+AFFLCP  DKVV
Sbjct  240   DEEWRSISPNLNAFVVNIGDTFMALSNGRYKSCLHRAVVNSKTPRKSLAFFLCPRDDKVV  299

Query  373   TPPPELVDATHPKLYPDFKWPALLE  299
              PP  LVD ++P++YPDF    +LE
Sbjct  300   KPPSGLVDTSYPRIYPDFTMADVLE  324



>ref|XP_010491324.1| PREDICTED: gibberellin 20 oxidase 3-like [Camelina sativa]
Length=380

 Score =   454 bits (1167),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 214/385 (56%), Positives = 278/385 (72%), Gaps = 9/385 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESN-IPTEFLWPDHEKPGPYAARE  1187
             MA+EC+   P    +R  +      + +FD+ +L   SN IP +F+WPDHEKP     + 
Sbjct  1     MAMECIATVP----QRFSVNKAKEDSSIFDAKLLNQHSNHIPQQFVWPDHEKPST-DVQP  55

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              QVP+ID+A F SGD + V++  +LV EA  +HGFFLV NHGVD  LLS     MD +F+
Sbjct  56    LQVPLIDLAGFLSGDSLLVSKATRLVSEAATQHGFFLVTNHGVDESLLSRAYLNMDSFFK  115

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKEC-SHVVEEYFEKTL  830
              P S K+KA RK GE  GYASSF GRF++KLPWKETLSF+FS E+   S  V+++  + +
Sbjct  116   APASEKQKAQRKWGESSGYASSFVGRFSSKLPWKETLSFKFSPEERTHSQTVKDFVSEKM  175

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G  + D G++YQ+Y  AMNTL+L+I ELLGM LGV+R+HF EF+++N+S+ RLNYYP C+
Sbjct  176   GDGYEDFGKVYQEYAEAMNTLSLKIMELLGMSLGVERRHFREFFEDNESIFRLNYYPQCK  235

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             +PEL LGTGPHCDPTSLTILHQD V GLQVFVDN+W+++ P P+AFVVNIGDTFMAL+NG
Sbjct  236   QPELALGTGPHCDPTSLTILHQDQVGGLQVFVDNKWKSIPPNPHAFVVNIGDTFMALTNG  295

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA--THPKLYPDFKWPALLEY  296
              YKSC+HRA+VN+E  RK+ AFFLCP  DKVV PP ELV +  +  + YPDF W   LE+
Sbjct  296   RYKSCLHRALVNSERERKTFAFFLCPKGDKVVKPPEELVGSLMSREREYPDFTWSMFLEF  355

Query  295   TQLHYRSDTDTLLNFATWLQQNQTL  221
             TQ HYR+D +TL  F+ WL+  +  
Sbjct  356   TQKHYRADMNTLEAFSIWLKSRRNF  380



>sp|O04707.1|GAO1A_WHEAT RecName: Full=Gibberellin 20 oxidase 1-A; AltName: Full=GA 20-oxidase 
1-A; AltName: Full=Gibberellin C-20 oxidase 1-B; AltName: 
Full=TaGA20ox1-A; Short=Ta20ox1A [Triticum aestivum]
 emb|CAA74332.1| gibberellin 20-oxidase [Triticum aestivum]
Length=365

 Score =   453 bits (1165),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 267/348 (77%), Gaps = 2/348 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD++VL   S+IP++F+WP+ E P P AA E  VP+I++    SGD  A AE  +LV E
Sbjct  5     VFDAAVLSGRSDIPSQFIWPEGESPTPDAAEELHVPLINIGGMLSGDAAAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDNFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD+V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPLETLGTGPHCDPTSLTILHQDNVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  +  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             KVV PP  LVDA++P+ YPDF W +LL++TQ HYR+D  TL  F++W+
Sbjct  303   KVVAPPGTLVDASNPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWI  350



>gb|AGW24312.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   454 bits (1167),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 277/384 (72%), Gaps = 16/384 (4%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPG  1205
             MA+  +  +P       E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP 
Sbjct  1     MAVSFVTTSP-------EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS  53

Query  1204  PYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVRE  1025
                  E  VP+ID+    S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD    
Sbjct  54    -INVLELDVPLIDLQNLLS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEY  111

Query  1024  MDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEY  845
               R+F++PLS K++ LRK GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++Y
Sbjct  112   TSRFFDMPLSEKQRVLRKSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDY  171

Query  844   FEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNY  665
             F   LG  F   G++YQ+YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNY
Sbjct  172   FCDALGHGFQPFGKVYQEYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNY  231

Query  664   YPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFM  485
             YPPC KP+LTLGTGPHCDPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFM
Sbjct  232   YPPCIKPDLTLGTGPHCDPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFM  291

Query  484   ALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             ALSN  YKSC+HRAVVN+E  RKS+AFFLCP KD+VVT P EL+D+   + YPDF W   
Sbjct  292   ALSNDRYKSCLHRAVVNSESERKSLAFFLCPKKDRVVTQPRELLDSITSRRYPDFTWSMF  351

Query  304   LEYTQLHYRSDTDTLLNFATWLQQ  233
             LE+TQ HYR+D +TL  F+ WL +
Sbjct  352   LEFTQKHYRADMNTLQAFSDWLTK  375



>gb|AGW24331.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   454 bits (1167),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 271/367 (74%), Gaps = 9/367 (2%)
 Frame = -3

Query  1312  EIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAF  1154
             E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP      E  VP+ID+   
Sbjct  11    EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS-INVLELDVPLIDLQNL  69

Query  1153  RSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALR  974
              S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD      R+F++PLS K++ LR
Sbjct  70    LS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLR  128

Query  973   KLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQ  794
             K GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++YF   LG  F   G++YQ
Sbjct  129   KSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQ  188

Query  793   KYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHC  614
             +YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNYYPPC KP+LTL TGPHC
Sbjct  189   EYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLETGPHC  248

Query  613   DPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVN  434
             DPTSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFMALSN  YKSC+HRAVVN
Sbjct  249   DPTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFMALSNDRYKSCLHRAVVN  308

Query  433   NEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLN  254
             +E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   LE+TQ HYR+D +TL  
Sbjct  309   SESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMFLEFTQKHYRADMNTLQA  368

Query  253   FATWLQQ  233
             F+ WL +
Sbjct  369   FSDWLTK  375



>gb|KFK25093.1| gibberellin 20-oxidase [Arabis alpina]
Length=381

 Score =   454 bits (1167),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 279/385 (72%), Gaps = 8/385 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESN-IPTEFLWPDHEKPGPYAARE  1187
             MA++C+   P   ++ +     P+   +FD+ V+  + N IP +F+WPDHEKP     + 
Sbjct  1     MAMKCIATLPQSFNDHKTKLEDPS---IFDAKVINQQPNHIPQQFVWPDHEKPST-NVQP  56

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              QVP+ID+A F SGD   V+E  +LV EA ++HGFFLV NHGVD  LLS     MD +F+
Sbjct  57    LQVPLIDLAGFLSGDSFLVSEATRLVSEAAQQHGFFLVTNHGVDETLLSRAYMFMDSFFK  116

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKEC-SHVVEEYFEKTL  830
              P   K KA R  GE  GYASSF GRF++KLPWKETLSF+FS E++C S  V+++  K +
Sbjct  117   SPACEKHKAQRTWGESSGYASSFVGRFSSKLPWKETLSFKFSPEEKCQSQTVKDFVTKKM  176

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G  + DLG++YQ+Y  AMNTL+L+I ELLGM LG++RKHF EF+++N+S+LRLNYYP C+
Sbjct  177   GDGYEDLGKVYQEYAEAMNTLSLKIMELLGMSLGIERKHFREFFEDNESILRLNYYPQCK  236

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             +PEL LGTGPHCDPTSLTILHQD V GLQVFVDN+W+++ P P AFVVNIGDTFMAL+NG
Sbjct  237   QPELALGTGPHCDPTSLTILHQDQVGGLQVFVDNQWQSIPPNPQAFVVNIGDTFMALTNG  296

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA--THPKLYPDFKWPALLEY  296
              YKSC+HRAVVN+E  RK+ AFFLCP  DK+V PP ELV    +  + YPDF W   LE+
Sbjct  297   RYKSCLHRAVVNSERERKTFAFFLCPKGDKMVKPPKELVGGVMSGEREYPDFTWSTFLEF  356

Query  295   TQLHYRSDTDTLLNFATWLQQNQTL  221
             TQ HYRSD +TL  F+ WL+  ++ 
Sbjct  357   TQKHYRSDMNTLEEFSNWLKNGRSF  381



>gb|AGW24324.1| GA20ox1 [Arabidopsis thaliana]
Length=377

 Score =   453 bits (1166),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 277/384 (72%), Gaps = 16/384 (4%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAV-------VFDSSVLRHESNIPTEFLWPDHEKPG  1205
             MA+  +  +P       E E+KP   +       +F+ S+L  ++NIP +F+WPD EKP 
Sbjct  1     MAVSFVTTSP-------EEEDKPKLGLGNIQTPLIFNPSMLNLQANIPNQFIWPDDEKPS  53

Query  1204  PYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVRE  1025
                  E  VP+ID+    S DP +  +  +L+ EACKKHGFFLVVNHG+  EL+SD    
Sbjct  54    -INVLELDVPLIDLQNLLS-DPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEY  111

Query  1024  MDRYFELPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKECSHVVEEY  845
               R+F++PLS K++ LRK GE  GYASSFTGRF+ KLPWKETLSFRF  +   S  V++Y
Sbjct  112   TSRFFDMPLSEKQRVLRKSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDY  171

Query  844   FEKTLGQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNY  665
             F   LG  F   G++YQ+YC AM++L+L+I ELLG+ LGV R +F EF++ENDS++RLNY
Sbjct  172   FCDALGHGFQPFGKVYQEYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNY  231

Query  664   YPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFM  485
             YPPC KP+LTLGTGPHCD TSLTILHQD V+GLQVFV+N+WR++ P P AFVVNIGDTFM
Sbjct  232   YPPCIKPDLTLGTGPHCDRTSLTILHQDHVNGLQVFVENQWRSIRPNPKAFVVNIGDTFM  291

Query  484   ALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDATHPKLYPDFKWPAL  305
             ALSN  YKSC+HRAVVN+E  RKS+AFFLCP KD+VVTPP EL+D+   + YPDF W   
Sbjct  292   ALSNDRYKSCLHRAVVNSESERKSLAFFLCPKKDRVVTPPRELLDSITSRRYPDFTWSMF  351

Query  304   LEYTQLHYRSDTDTLLNFATWLQQ  233
             LE+TQ HYR+D +TL  F+ WL +
Sbjct  352   LEFTQKHYRADMNTLQAFSDWLTK  375



>gb|EMS45754.1| Gibberellin 20 oxidase 1-A [Triticum urartu]
Length=365

 Score =   452 bits (1164),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 266/348 (76%), Gaps = 2/348 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD++VL   S+IP++F+WP+ E P P AA E  VP+I++    SGD  A AE  +LV E
Sbjct  5     VFDAAVLSGRSDIPSQFIWPEGESPTPDAAEELHVPLINIGGMLSGDAAAAAEVTRLVGE  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDNFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG++   LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD+V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPLETLGTGPHCDPTSLTILHQDNVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  +  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWL  239
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWI  350



>gb|ACU40931.1| gibberellin 20 oxidase [Dasypyrum villosum]
 gb|ACU40932.1| gibberellin 20 oxidase [Dasypyrum villosum]
Length=359

 Score =   452 bits (1163),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 210/357 (59%), Positives = 267/357 (75%), Gaps = 2/357 (1%)
 Frame = -3

Query  1282  VFDSSVLRHESNIPTEFLWPDHEKPGPYAAREFQVPVIDMAAFRSGDPVAVAETCKLVDE  1103
             VFD+++L   ++IP++F+WP+ E P P AA E  VP+ID+    SGD  A AE  +LV +
Sbjct  5     VFDAALLSGRADIPSQFIWPEGESPTPDAAEELHVPLIDIGGMLSGDADAAAEVTRLVGQ  64

Query  1102  ACKKHGFFLVVNHGVDTELLSDGVREMDRYFELPLSFKEKALRKLGEHCGYASSFTGRFN  923
             AC++HGFF VVNHG+D ELL+D  R +D +F +PL  K++ALR+ GE CGYASSFTGRF 
Sbjct  65    ACERHGFFQVVNHGIDAELLADAHRCVDAFFTMPLPEKQRALRRPGESCGYASSFTGRFA  124

Query  922   AKLPWKETLSFRFSAEKECSHVVEEYFEKTLGQEFADLGELYQKYCNAMNTLALEITELL  743
             +KLPWKETLSFR S   + + VV+ Y   TLG+    LGE+Y +YC+ M+ L+LEI E+L
Sbjct  125   SKLPWKETLSFR-SCPSDPALVVD-YIVATLGEGHRRLGEVYARYCSEMSRLSLEIMEVL  182

Query  742   GMGLGVDRKHFSEFYQENDSVLRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDSVSGLQ  563
             G  LGV R H+  F++ NDS++RLNYYPPCQ+P  TLGTGPHCDPTSLTILHQD V GLQ
Sbjct  183   GESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPYETLGTGPHCDPTSLTILHQDDVGGLQ  242

Query  562   VFVDNEWRAVNPTPNAFVVNIGDTFMALSNGLYKSCMHRAVVNNEIPRKSIAFFLCPHKD  383
             V  +  WR++ P  +AFVVNIGDTFMALSNG YKSC+HRAVVN+ +PRKS+AFFLCP  D
Sbjct  243   VHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNSRVPRKSLAFFLCPEMD  302

Query  382   KVVTPPPELVDATHPKLYPDFKWPALLEYTQLHYRSDTDTLLNFATWLQQNQTLHAT  212
             KVV PP  LVDA +P+ YPDF W +LL++TQ HYR+D  TL  F++W+ Q Q    T
Sbjct  303   KVVAPPGTLVDAANPRAYPDFTWRSLLDFTQKHYRADMKTLEVFSSWVVQQQQAAMT  359



>emb|CDX70015.1| BnaA10g23640D [Brassica napus]
Length=379

 Score =   453 bits (1165),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 215/384 (56%), Positives = 278/384 (72%), Gaps = 8/384 (2%)
 Frame = -3

Query  1363  MAIECMIPTPTPNHERQEIENKPAAAVVFDSSVLRHESN-IPTEFLWPDHEKPGPYAARE  1187
             MA+EC+   P    +R           +FD+++L   SN IP +F+WPDHEKP     + 
Sbjct  1     MAMECIATLP----QRFNDNKTKGDPSIFDANLLNQLSNHIPQQFVWPDHEKPST-DVQP  55

Query  1186  FQVPVIDMAAFRSGDPVAVAETCKLVDEACKKHGFFLVVNHGVDTELLSDGVREMDRYFE  1007
              Q P+ID+A F SGD   V+E  +LV EA KKHGFFLV NHGVD  LLS     MD +F+
Sbjct  56    LQAPLIDLAGFLSGDSFLVSEATRLVSEASKKHGFFLVTNHGVDETLLSRAYLFMDSFFK  115

Query  1006  LPLSFKEKALRKLGEHCGYASSFTGRFNAKLPWKETLSFRFSAEKEC-SHVVEEYFEKTL  830
              P   K+KA R  GE  GYASSF GRF++KLPWKETLSF+FS E++C S  V+++  K +
Sbjct  116   APACEKQKAQRTWGESSGYASSFVGRFSSKLPWKETLSFKFSPEEKCQSQAVKDFVSKKM  175

Query  829   GQEFADLGELYQKYCNAMNTLALEITELLGMGLGVDRKHFSEFYQENDSVLRLNYYPPCQ  650
             G E+ + G++YQ+Y  AMN L+L+I ELLGM LG++R+HF +F+++N+S+LRLNYYP C 
Sbjct  176   GDEYDNFGKVYQEYAEAMNILSLKIMELLGMSLGIERRHFRDFFEDNESILRLNYYPQCN  235

Query  649   KPELTLGTGPHCDPTSLTILHQDSVSGLQVFVDNEWRAVNPTPNAFVVNIGDTFMALSNG  470
             +PELTLGTGPHCDPTSLTILHQD V+GLQV+VDN+W+++ P P AFVVNIGDTFMAL+NG
Sbjct  236   QPELTLGTGPHCDPTSLTILHQDQVAGLQVYVDNKWQSIPPNPQAFVVNIGDTFMALTNG  295

Query  469   LYKSCMHRAVVNNEIPRKSIAFFLCPHKDKVVTPPPELVDA-THPKLYPDFKWPALLEYT  293
             +YKSC+HRAVVN+E  RK+ AFFLCP  DK+V PP ELV   +  + YPDF W   LE+T
Sbjct  296   IYKSCLHRAVVNSERERKTFAFFLCPKGDKMVKPPKELVGVMSGEREYPDFTWSTFLEFT  355

Query  292   QLHYRSDTDTLLNFATWLQQNQTL  221
             Q HYRSD +TL  F+ WL+  ++ 
Sbjct  356   QKHYRSDMNTLEEFSNWLKNRKSF  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4161480999858