BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30010_g1_i1 len=912 path=[1:0-911]

Length=912
                                                                      Score     E

emb|CDO99127.1|  unnamed protein product                                263   1e-84   
ref|XP_009605099.1|  PREDICTED: major allergen Pru ar 1-like            260   3e-83   
ref|XP_006341397.1|  PREDICTED: major allergen Pru ar 1-like            259   4e-83   
ref|XP_004236449.1|  PREDICTED: major allergen Pru ar 1-like            259   7e-83   
ref|XP_011091080.1|  PREDICTED: major allergen Pru ar 1-like            257   4e-82   
ref|XP_004236450.1|  PREDICTED: major allergen Pru ar 1-like            254   3e-81   
ref|XP_009792840.1|  PREDICTED: major allergen Pru ar 1-like            248   8e-79   
emb|CDP16929.1|  unnamed protein product                                246   5e-78   
ref|XP_009611342.1|  PREDICTED: major allergen Pru ar 1-like            245   1e-77   
ref|XP_009792839.1|  PREDICTED: major allergen Pru ar 1-like            240   1e-75   
ref|XP_010027035.1|  PREDICTED: major allergen Pru ar 1-like            233   7e-73   
ref|XP_010027089.1|  PREDICTED: major allergen Pru ar 1-like            232   1e-72   
ref|XP_011096540.1|  PREDICTED: major allergen Pru av 1-like            231   3e-72   
ref|XP_007035688.1|  Major pollen allergen Car b 1                      230   3e-71   
emb|CDP16928.1|  unnamed protein product                                221   7e-68   
ref|XP_010245454.1|  PREDICTED: pathogenesis-related protein STH-...    217   1e-66   
ref|XP_008223331.1|  PREDICTED: major allergen Pru ar 1-like            211   3e-64   
ref|XP_007224203.1|  hypothetical protein PRUPE_ppa017373mg             211   4e-64   
gb|KHN14638.1|  Major allergen Pru ar 1                                 209   1e-63   
ref|XP_010024735.1|  PREDICTED: major allergen Pru ar 1-like            207   6e-63   
ref|XP_002273815.2|  PREDICTED: pathogenesis-related protein STH-2      205   4e-62   Vitis vinifera
ref|XP_010245452.1|  PREDICTED: pathogenesis-related protein STH-...    205   5e-62   
ref|XP_010245449.1|  PREDICTED: major allergen Pru ar 1-like            205   5e-62   
ref|XP_010245451.1|  PREDICTED: major allergen Pru ar 1-like            205   8e-62   
ref|XP_010024738.1|  PREDICTED: major allergen Pru ar 1-like            204   2e-61   
ref|XP_009618805.1|  PREDICTED: pathogenesis-related protein STH-...    202   1e-60   
ref|XP_009793896.1|  PREDICTED: pathogenesis-related protein STH-...    201   2e-60   
gb|KCW61264.1|  hypothetical protein EUGRSUZ_H04027                     200   4e-60   
ref|XP_007154324.1|  hypothetical protein PHAVU_003G109000g             200   4e-60   
ref|XP_006380227.1|  hypothetical protein POPTR_0008s23130g             200   4e-60   
ref|XP_009369986.1|  PREDICTED: major allergen Pru ar 1-like            200   6e-60   
ref|XP_008360265.1|  PREDICTED: major allergen Pru ar 1-like            199   1e-59   
ref|XP_010259438.1|  PREDICTED: major allergen Pru ar 1-like            199   2e-59   
ref|XP_010023670.1|  PREDICTED: major allergen Pru ar 1-like            198   3e-59   
gb|KCW59979.1|  hypothetical protein EUGRSUZ_H02708                     198   3e-59   
ref|XP_011009733.1|  PREDICTED: pathogenesis-related protein STH-...    198   4e-59   
ref|XP_002516987.1|  Major allergen Pru ar, putative                    197   6e-59   Ricinus communis
ref|XP_010023669.1|  PREDICTED: pathogenesis-related protein STH-...    197   7e-59   
ref|XP_010024741.1|  PREDICTED: major allergen Pru ar 1-like            197   9e-59   
ref|XP_010049778.1|  PREDICTED: pathogenesis-related protein STH-...    196   2e-58   
gb|AFK42887.1|  unknown                                                 196   2e-58   
ref|XP_004508179.1|  PREDICTED: pathogenesis-related protein STH-...    196   2e-58   
ref|XP_008353204.1|  PREDICTED: major allergen Pru ar 1-like            196   2e-58   
gb|KHN02930.1|  Pathogenesis-related protein STH-2                      196   3e-58   
ref|XP_003609710.1|  Pathogenesis-related protein                       195   4e-58   
ref|XP_006419469.1|  hypothetical protein CICLE_v10007165mg             195   5e-58   
ref|XP_007051017.1|  Uncharacterized protein TCM_004731                 194   8e-58   
gb|AFK38659.1|  unknown                                                 194   1e-57   
gb|KHN03329.1|  Pathogenesis-related protein STH-2                      194   1e-57   
ref|XP_010049211.1|  PREDICTED: major allergen Pru ar 1-like            194   1e-57   
ref|XP_010094126.1|  Major allergen Pru av 1                            194   2e-57   
ref|XP_010024746.1|  PREDICTED: pathogenesis-related protein STH-...    194   2e-57   
ref|XP_010024749.1|  PREDICTED: major allergen Pru ar 1-like            193   2e-57   
gb|KCW87753.1|  hypothetical protein EUGRSUZ_A00125                     193   2e-57   
ref|XP_010024742.1|  PREDICTED: major allergen Pru ar 1-like            193   2e-57   
ref|XP_007035695.1|  Major allergen Pru ar 1 isoform 1                  193   2e-57   
ref|XP_011091029.1|  PREDICTED: pathogenesis-related protein STH-...    193   2e-57   
ref|XP_007224360.1|  hypothetical protein PRUPE_ppa020879mg             193   3e-57   
gb|KDO37531.1|  hypothetical protein CISIN_1g044703mg                   194   3e-57   
ref|XP_010024740.1|  PREDICTED: major allergen Pru ar 1-like            193   3e-57   
ref|NP_001235344.1|  uncharacterized protein LOC100500506               193   3e-57   
ref|XP_008340738.1|  PREDICTED: major allergen Pru ar 1-like            193   4e-57   
ref|XP_010027091.1|  PREDICTED: major allergen Pru ar 1-like            192   5e-57   
ref|XP_010028225.1|  PREDICTED: major allergen Pru ar 1-like            192   6e-57   
ref|XP_008235136.1|  PREDICTED: major allergen Pru ar 1-like            192   7e-57   
ref|NP_001237916.1|  uncharacterized protein LOC100527307               192   7e-57   
ref|XP_010028230.1|  PREDICTED: pathogenesis-related protein STH-...    192   1e-56   
ref|XP_010024747.1|  PREDICTED: major allergen Pru ar 1-like            191   1e-56   
ref|XP_010028229.1|  PREDICTED: pathogenesis-related protein STH-...    191   1e-56   
gb|KDP27857.1|  hypothetical protein JCGZ_18937                         191   1e-56   
ref|XP_008345225.1|  PREDICTED: major allergen Pru ar 1-like            191   2e-56   
ref|XP_007035697.1|  Pathogenesis-related protein 10.5                  191   2e-56   
ref|XP_009378740.1|  PREDICTED: major allergen Pru ar 1-like            191   2e-56   
ref|XP_007199050.1|  hypothetical protein PRUPE_ppa018344mg             191   3e-56   
ref|XP_010103411.1|  Major allergen Pru ar 1                            190   4e-56   
ref|XP_007035686.1|  MLP-like protein 423                               190   5e-56   
ref|XP_007035698.1|  Major allergen Pru ar 1                            190   5e-56   
ref|XP_007035703.1|  Pathogenesis-related protein 10.5                  190   5e-56   
ref|XP_010027088.1|  PREDICTED: major allergen Pru ar 1-like            189   6e-56   
ref|XP_010024748.1|  PREDICTED: pathogenesis-related protein STH-...    190   6e-56   
ref|XP_010028231.1|  PREDICTED: pathogenesis-related protein STH-...    189   6e-56   
ref|NP_001238264.1|  uncharacterized protein LOC100306656               189   8e-56   
ref|XP_004290824.1|  PREDICTED: major allergen Pru ar 1-like            189   8e-56   
ref|XP_010028227.1|  PREDICTED: pathogenesis-related protein STH-...    189   9e-56   
gb|KEH37168.1|  pathogenesis-related protein bet V I family protein     189   9e-56   
ref|XP_002273952.1|  PREDICTED: major allergen Pru ar 1                 189   9e-56   Vitis vinifera
ref|XP_010024750.1|  PREDICTED: pathogenesis-related protein STH-...    189   9e-56   
ref|XP_002273790.2|  PREDICTED: major allergen Pru ar 1                 188   2e-55   Vitis vinifera
ref|XP_007035693.1|  Pathogenesis-related protein 10.5                  188   2e-55   
gb|EYU43988.1|  hypothetical protein MIMGU_mgv1a015369mg                188   3e-55   
ref|XP_007138954.1|  hypothetical protein PHAVU_009G252300g             188   3e-55   
gb|KCW61030.1|  hypothetical protein EUGRSUZ_H03792                     189   3e-55   
emb|CAN67367.1|  hypothetical protein VITISV_007417                     187   4e-55   Vitis vinifera
ref|XP_004296883.1|  PREDICTED: major allergen Pru ar 1-like            187   5e-55   
ref|XP_010024739.1|  PREDICTED: major allergen Pru ar 1-like            187   5e-55   
gb|AFF59689.1|  Bet v 1 allergen                                        187   5e-55   
gb|KCW54931.1|  hypothetical protein EUGRSUZ_I00902                     187   6e-55   
ref|XP_010028226.1|  PREDICTED: pathogenesis-related protein STH-...    187   7e-55   
ref|XP_010245453.1|  PREDICTED: major allergen Pru ar 1-like            187   7e-55   
emb|CAN79558.1|  hypothetical protein VITISV_025732                     186   1e-54   Vitis vinifera
ref|XP_010024744.1|  PREDICTED: major allergen Pru ar 1-like            186   1e-54   
ref|XP_007035700.1|  Major allergen Pru ar 1, putative isoform 1        188   1e-54   
ref|XP_002273982.1|  PREDICTED: major allergen Pru ar 1                 186   1e-54   Vitis vinifera
ref|XP_010024743.1|  PREDICTED: pathogenesis-related protein STH-...    185   3e-54   
ref|XP_009347380.1|  PREDICTED: major allergen Pru ar 1-like            184   5e-54   
emb|CAN75490.1|  hypothetical protein VITISV_017149                     184   7e-54   Vitis vinifera
ref|XP_009793804.1|  PREDICTED: pathogenesis-related protein STH-...    184   7e-54   
ref|XP_008223262.1|  PREDICTED: major allergen Pru ar 1-like            186   8e-54   
gb|AFF59687.1|  Bet v 1 allergen                                        184   1e-53   
ref|XP_007035701.1|  Major allergen Pru ar 1, putative isoform 2        185   2e-53   
gb|AFK45365.1|  unknown                                                 183   2e-53   
gb|AIX10939.1|  putative pathogenesis-related protein                   183   2e-53   
gb|AFF59688.1|  Bet v 1 allergen                                        183   2e-53   
gb|ACJ23865.1|  Fag s 1 pollen allergen                                 183   2e-53   Fagus sylvatica
gb|KCW61224.1|  hypothetical protein EUGRSUZ_H03986                     183   2e-53   
ref|XP_007035690.1|  Uncharacterized protein isoform 1                  183   2e-53   
gb|AFF59690.1|  Bet v 1 allergen                                        183   3e-53   
ref|XP_004487809.1|  PREDICTED: pathogenesis-related protein STH-...    182   3e-53   
ref|XP_007223634.1|  hypothetical protein PRUPE_ppa012649mg             182   3e-53   
ref|XP_010027042.1|  PREDICTED: major allergen Pru ar 1-like            183   3e-53   
ref|XP_007099604.1|  Uncharacterized protein TCM_046315                 182   4e-53   
ref|XP_008223267.1|  PREDICTED: major allergen Pru ar 1-like            182   4e-53   
ref|XP_004487814.1|  PREDICTED: pathogenesis-related protein STH-...    182   5e-53   
gb|ACE80949.1|  putative allergen Pru du 1.06B                          181   9e-53   Prunus dulcis x Prunus persica
ref|XP_008223270.1|  PREDICTED: major allergen Pru ar 1-like            181   1e-52   
gb|ACE80953.1|  putative allergen Pru p 1.06C                           181   1e-52   Prunus dulcis x Prunus persica
ref|XP_009591007.1|  PREDICTED: pathogenesis-related protein STH-...    181   1e-52   
ref|XP_002274108.2|  PREDICTED: major allergen Pru ar 1                 181   1e-52   Vitis vinifera
ref|XP_007225603.1|  hypothetical protein PRUPE_ppb010518mg             181   1e-52   
gb|KCW58393.1|  hypothetical protein EUGRSUZ_H01080                     181   1e-52   
ref|XP_010051127.1|  PREDICTED: major allergen Pru av 1-like isof...    181   1e-52   
gb|ACJ23864.1|  Fag s 1 pollen allergen                                 181   2e-52   Fagus sylvatica
gb|ACJ23866.1|  Fag s 1 pollen allergen                                 181   2e-52   Fagus sylvatica
gb|AAS47036.1|  major cherry allergen Pru av 1.0202                     181   2e-52   Prunus avium [gean]
ref|XP_007223627.1|  hypothetical protein PRUPE_ppa012627mg             181   2e-52   
ref|XP_010069887.1|  PREDICTED: major allergen Pru ar 1-like            182   2e-52   
ref|XP_007225972.1|  hypothetical protein PRUPE_ppa012642mg             180   2e-52   
gb|KCW87780.1|  hypothetical protein EUGRSUZ_A00162                     180   2e-52   
ref|XP_007223920.1|  hypothetical protein PRUPE_ppa011018mg             182   3e-52   
gb|ACE80951.1|  putative allergen Pru du 1.06A                          180   3e-52   Prunus dulcis x Prunus persica
ref|XP_007223629.1|  hypothetical protein PRUPE_ppa012632mg             180   3e-52   
ref|XP_007035692.1|  Pathogenesis-related protein 10.5                  180   3e-52   
ref|XP_002269128.1|  PREDICTED: pathogenesis-related protein STH-...    180   4e-52   Vitis vinifera
ref|XP_009794645.1|  PREDICTED: pathogenesis-related protein STH-...    180   4e-52   
ref|XP_008223278.1|  PREDICTED: major allergen Pru ar 1-like            179   5e-52   
ref|XP_009590430.1|  PREDICTED: major allergen Pru ar 1-like            179   6e-52   
gb|AEY11296.1|  pathogenesis-related protein PR10                       179   6e-52   
emb|CDO98809.1|  unnamed protein product                                179   6e-52   
ref|XP_007044241.1|  Uncharacterized protein TCM_009534                 181   7e-52   
gb|EYU43990.1|  hypothetical protein MIMGU_mgv1a015287mg                179   7e-52   
ref|XP_008224643.1|  PREDICTED: major allergen Pru ar 1-like            179   9e-52   
ref|XP_008223269.1|  PREDICTED: major allergen Pru ar 1-like            179   9e-52   
gb|AAS47035.1|  major cherry allergen Pru av 1.0201                     179   9e-52   Prunus avium [gean]
gb|ACE80947.1|  putative allergen Pru du 1.05                           179   9e-52   Prunus dulcis x Prunus persica
gb|AAS47037.1|  major cherry allergen Pru av 1.0203                     179   1e-51   Prunus avium [gean]
ref|XP_002271428.2|  PREDICTED: pathogenesis-related protein STH-2      179   1e-51   Vitis vinifera
emb|CAN79557.1|  hypothetical protein VITISV_025731                     178   2e-51   Vitis vinifera
ref|XP_010027090.1|  PREDICTED: major allergen Pru ar 1-like            178   2e-51   
ref|XP_011100819.1|  PREDICTED: major allergen Mal d 1-like             178   2e-51   
ref|XP_010259439.1|  PREDICTED: major allergen Pru ar 1-like            178   2e-51   
ref|XP_007029487.1|  Uncharacterized protein TCM_025358                 178   2e-51   
ref|XP_008223273.1|  PREDICTED: major allergen Pru ar 1-like            177   3e-51   
gb|AIC34703.1|  pathogenesis-related protein 10                         177   3e-51   
ref|XP_007225973.1|  hypothetical protein PRUPE_ppa012646mg             177   3e-51   
ref|XP_008223271.1|  PREDICTED: major allergen Pru ar 1-like            177   3e-51   
ref|XP_008223333.1|  PREDICTED: major allergen Pru ar 1-like            177   4e-51   
emb|CAC16166.1|  pathogenesis-related protein 10                        177   4e-51   Vitis vinifera
ref|XP_002274309.1|  PREDICTED: major allergen Pru av 1                 177   4e-51   Vitis vinifera
ref|XP_008223279.1|  PREDICTED: major allergen Pru ar 1-like            177   4e-51   
ref|XP_002274706.1|  PREDICTED: major allergen Pru av 1-like            177   5e-51   Vitis vinifera
ref|XP_009621920.1|  PREDICTED: pathogenesis-related protein STH-...    177   5e-51   
gb|AIE17036.1|  pathogenesis-related protein PR-10                      177   5e-51   
emb|CAD33532.1|  pathogenesis-related protein PR10A                     177   5e-51   Datisca glomerata
ref|XP_007029483.1|  Uncharacterized protein TCM_025354                 178   5e-51   
ref|XP_002516990.1|  Major allergen Pru av, putative                    177   6e-51   Ricinus communis
ref|XP_010051417.1|  PREDICTED: major allergen Pru av 1-like            176   7e-51   
ref|XP_006349827.1|  PREDICTED: major allergen Pru ar 1-like            176   7e-51   
emb|CDO98810.1|  unnamed protein product                                177   8e-51   
ref|XP_004298700.1|  PREDICTED: major allergen Pru ar 1-like            176   9e-51   
ref|XP_004239798.1|  PREDICTED: pathogenesis-related protein STH-...    176   1e-50   
ref|XP_002519171.1|  Major allergen Pru ar, putative                    176   1e-50   Ricinus communis
gb|KDP27867.1|  hypothetical protein JCGZ_18947                         176   1e-50   
ref|XP_010050725.1|  PREDICTED: major allergen Pru av 1-like            176   2e-50   
ref|XP_006345977.1|  PREDICTED: pathogenesis-related protein STH-...    176   2e-50   
ref|XP_002274785.1|  PREDICTED: major allergen Pru av 1                 175   2e-50   Vitis vinifera
gb|ACX47057.1|  Fra a 2 allergen                                        174   4e-50   Fragaria x ananassa
ref|XP_002519170.1|  Major allergen Pru ar, putative                    174   4e-50   Ricinus communis
ref|XP_009591008.1|  PREDICTED: pathogenesis-related protein STH-...    174   5e-50   
ref|XP_004296894.1|  PREDICTED: major allergen Pru av 1-like            174   5e-50   
gb|ABZ81047.1|  pollen allergen Que a 1 isoform                         174   7e-50   Quercus alba
emb|CAA54696.1|  1 Sc-3                                                 174   7e-50   Betula pendula [white birch]
ref|XP_007227069.1|  hypothetical protein PRUPE_ppa025302mg             174   7e-50   
ref|XP_004296890.1|  PREDICTED: major allergen Pru ar 1-like            174   8e-50   
ref|XP_004296876.1|  PREDICTED: major allergen Pru ar 1-like            174   8e-50   
gb|ABV25698.1|  Sal m 1 allergen                                        174   8e-50   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009599065.1|  PREDICTED: pathogenesis-related protein STH-...    174   9e-50   
ref|XP_010069885.1|  PREDICTED: major allergen Pru ar 1-like            174   9e-50   
gb|AFF59691.1|  Bet v 1 allergen                                        174   1e-49   
emb|CAA96549.1|  major allergen Cor a 1                                 173   1e-49   Corylus avellana [European hazelnut]
ref|XP_006340889.1|  PREDICTED: pathogenesis-related protein STH-...    173   1e-49   
ref|XP_007035687.1|  Pathogenesis-related protein 10.9                  173   1e-49   
ref|NP_001275580.1|  pathogenesis-related protein STH-2-like            173   1e-49   
ref|XP_009346216.1|  PREDICTED: major allergen Pru ar 1-like            173   1e-49   
gb|AGL07712.1|  pathogenesis related protein PR10                       173   1e-49   
gb|ABZ81046.1|  pollen allergen Que a 1 isoform                         173   2e-49   Quercus alba
ref|XP_004295080.1|  PREDICTED: major allergen Pru av 1-like            172   2e-49   
ref|XP_007035696.1|  Pathogenesis-related protein 10.5 isoform 2        172   2e-49   
ref|XP_010024737.1|  PREDICTED: major allergen Pru ar 1-like            172   3e-49   
ref|XP_008223280.1|  PREDICTED: major allergen Pru av 1-like            172   3e-49   
ref|XP_010064273.1|  PREDICTED: uncharacterized protein LOC104451263    182   3e-49   
ref|XP_004296893.1|  PREDICTED: major allergen Pru av 1-like            172   3e-49   
ref|XP_008340764.1|  PREDICTED: major allergen Pru ar 1-like            172   4e-49   
gb|AAU00066.1|  pathogenesis-related protein 10                         172   4e-49   Solanum virginianum [yellow-fruit nightshade]
gb|AAS00052.1|  Mal d 1-like                                            172   5e-49   Malus domestica [apple tree]
gb|ADG35964.1|  pathogenesis-related protein 10                         172   5e-49   
ref|XP_004295117.1|  PREDICTED: major allergen Pru ar 1-like isof...    172   5e-49   
ref|XP_006340891.1|  PREDICTED: pathogenesis-related protein STH-...    172   6e-49   
emb|CDP10318.1|  unnamed protein product                                171   6e-49   
emb|CAD10374.1|  ypr10                                                  171   9e-49   Castanea sativa
ref|XP_010027083.1|  PREDICTED: major allergen Pru ar 1-like            171   1e-48   
emb|CAA10235.1|  stress and pathogenesis-related protein                171   1e-48   Fagus sylvatica
sp|O50001.1|PRU1_PRUAR  RecName: Full=Major allergen Pru ar 1; Al...    171   1e-48   Prunus armeniaca
ref|XP_010064159.1|  PREDICTED: major allergen Pru av 1-like            170   2e-48   
gb|EYU43989.1|  hypothetical protein MIMGU_mgv1a015365mg                170   2e-48   
ref|XP_010024736.1|  PREDICTED: major allergen Pru ar 1-like            170   3e-48   
gb|ACE80941.1|  putative allergen Pru du 1.02                           170   3e-48   Prunus dulcis x Prunus persica
emb|CAN67708.1|  hypothetical protein VITISV_040371                     169   3e-48   Vitis vinifera
ref|XP_007223635.1|  hypothetical protein PRUPE_ppa012650mg             169   4e-48   
dbj|BAA92224.1|  S1-1                                                   169   5e-48   Vigna unguiculata
ref|XP_010027098.1|  PREDICTED: major allergen Pru ar 1-like            168   5e-48   
ref|XP_002315457.1|  Major allergen Mal d 1 family protein              169   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010051063.1|  PREDICTED: major allergen Pru av 1-like isof...    169   6e-48   
ref|XP_008223264.1|  PREDICTED: major allergen Pru ar 1                 169   6e-48   
ref|XP_004296891.1|  PREDICTED: major allergen Pru ar 1-like            169   8e-48   
gb|KDP27858.1|  hypothetical protein JCGZ_18938                         168   1e-47   
gb|KCW61046.1|  hypothetical protein EUGRSUZ_H03820                     167   1e-47   
emb|CBL94145.1|  putative Mal d 1.12 isoallergen                        167   2e-47   
ref|XP_010326739.1|  PREDICTED: TSI-1 protein isoform X1                168   2e-47   
ref|XP_007223636.1|  hypothetical protein PRUPE_ppa012651mg             168   2e-47   
ref|XP_004295081.1|  PREDICTED: major allergen Pru av 1-like            167   2e-47   
ref|XP_009346214.1|  PREDICTED: major allergen Pru ar 1-like            167   2e-47   
ref|XP_007138955.1|  hypothetical protein PHAVU_009G252400g             169   2e-47   
ref|XP_010027058.1|  PREDICTED: major allergen Pru ar 1-like            167   2e-47   
ref|XP_002314323.1|  Major allergen Mal d 1 family protein              167   2e-47   Populus trichocarpa [western balsam poplar]
gb|KCW61213.1|  hypothetical protein EUGRSUZ_H03974                     167   3e-47   
gb|AAX18292.1|  major allergen Mal d 1.04                               167   3e-47   Malus domestica [apple tree]
ref|XP_004296875.1|  PREDICTED: major allergen Pru ar 1-like            167   4e-47   
gb|ACE80939.1|  putative allergen Pru du 1.01                           167   4e-47   Prunus dulcis x Prunus persica
ref|XP_006489009.1|  PREDICTED: pathogenesis-related protein STH-...    166   5e-47   
emb|CBJ49377.1|  pathogenesis-related protein 10.5                      166   5e-47   Vitis vinifera
ref|XP_004296892.1|  PREDICTED: major allergen Pru ar 1-like            166   5e-47   
ref|XP_011100818.1|  PREDICTED: major allergen Pru av 1-like            166   6e-47   
gb|AEF38450.1|  allergen Mal d 1.04                                     166   7e-47   
ref|NP_001237946.1|  uncharacterized protein LOC100306381               168   9e-47   
ref|XP_010049892.1|  PREDICTED: major allergen Pru av 1-like            166   1e-46   
gb|ACJ23861.1|  Cas s 1 pollen allergen                                 166   1e-46   Castanea sativa
ref|XP_008223266.1|  PREDICTED: major allergen Pru av 1                 166   1e-46   
ref|XP_006587996.1|  PREDICTED: major allergen Pru ar 1-like            164   1e-46   
sp|O24248.1|PRU1_PRUAV  RecName: Full=Major allergen Pru av 1; Al...    166   1e-46   Prunus avium [gean]
ref|XP_007099605.1|  Pathogenesis-related protein 10.5                  165   1e-46   
ref|XP_004247796.1|  PREDICTED: pathogenesis-related protein STH-2      165   2e-46   
gb|ABW99633.1|  pathogenesis related protein PR10                       165   2e-46   Prunus domestica
ref|XP_002271360.1|  PREDICTED: major allergen Pru ar 1                 165   2e-46   Vitis vinifera
ref|XP_008346586.1|  PREDICTED: major allergen Pru ar 1-like            165   2e-46   
gb|ABC86747.1|  pathogenesis-related protein 10                         165   2e-46   Vitis pseudoreticulata
gb|AAX20938.1|  Mal d 1.0406                                            165   2e-46   Malus domestica [apple tree]
gb|ACJ23862.1|  Cas s 1 pollen allergen                                 165   2e-46   Castanea sativa
ref|XP_009346220.1|  PREDICTED: major allergen Pru ar 1-like            165   2e-46   
emb|CAI48023.1|  putative pathogenesis related protein                  165   2e-46   Capsicum chinense [bonnet pepper]
gb|ACJ23863.1|  Cas s 1 pollen allergen                                 165   2e-46   Castanea sativa
gb|ABD78554.1|  pathogenesis-related protein 10.1                       164   3e-46   Vitis pseudoreticulata
ref|XP_006340890.1|  PREDICTED: pathogenesis-related protein STH-...    164   3e-46   
ref|XP_002274535.1|  PREDICTED: major allergen Pru av 1                 164   4e-46   Vitis vinifera
gb|EYU32597.1|  hypothetical protein MIMGU_mgv1a015377mg                164   4e-46   
ref|XP_008223272.1|  PREDICTED: major allergen Pru ar 1-like            164   4e-46   
ref|XP_009347368.1|  PREDICTED: major allergen Pru av 1-like            164   4e-46   
gb|AAO25113.1|  major allergen Mal d 1                                  164   4e-46   Malus domestica [apple tree]
gb|ACF75100.1|  PR-10 protein                                           164   5e-46   Betula nigra [black birch]
ref|XP_008361951.1|  PREDICTED: major allergen Pru ar 1-like            164   6e-46   
ref|XP_002519167.1|  Major allergen Pru ar, putative                    164   6e-46   
ref|XP_002274617.1|  PREDICTED: major allergen Pru av 1                 164   7e-46   
ref|NP_001267956.1|  uncharacterized protein LOC100267074               163   8e-46   
ref|XP_009346213.1|  PREDICTED: major allergen Pru ar 1-like            164   8e-46   
ref|XP_007223628.1|  hypothetical protein PRUPE_ppa012629mg             163   9e-46   
gb|AAX20939.1|  Mal d 1.0407                                            163   9e-46   
gb|AAX20937.1|  Mal d 1.0405                                            163   1e-45   
ref|XP_009369984.1|  PREDICTED: major allergen Pyr c 1                  163   1e-45   
ref|XP_008346874.1|  PREDICTED: major allergen Pru ar 1-like            163   1e-45   
pdb|1E09|A  Chain A, Solution Structure Of The Major Cherry Aller...    163   1e-45   
gb|AFN42528.1|  Betv1-like protein                                      163   1e-45   
gb|ACE80943.1|  putative allergen Pru du 1.03                           163   1e-45   
ref|XP_008390602.1|  PREDICTED: major allergen Mal d 1                  163   1e-45   
ref|XP_009347378.1|  PREDICTED: major allergen Mal d 1                  162   1e-45   
ref|XP_010024733.1|  PREDICTED: major allergen Pru ar 1-like            163   2e-45   
ref|XP_006586622.1|  PREDICTED: uncharacterized protein LOC100306...    167   2e-45   
ref|XP_007208552.1|  hypothetical protein PRUPE_ppa024368mg             162   2e-45   
gb|KHN26515.1|  Major allergen Pru ar 1                                 168   2e-45   
ref|XP_002315459.1|  major pollen allergen Bet v 1k family protein      162   2e-45   
ref|XP_007223639.1|  hypothetical protein PRUPE_ppa012676mg             162   2e-45   
pdb|1H2O|A  Chain A, Solution Structure Of The Major Cherry Aller...    162   2e-45   
emb|CDO98812.1|  unnamed protein product                                162   2e-45   
gb|AAX18297.1|  major allergen Mal d 1.0502                             162   2e-45   
emb|CBL94173.1|  putative Mal d 1.03G isoallergen                       162   2e-45   
ref|XP_008373828.1|  PREDICTED: major allergen Pru ar 1-like            162   3e-45   
ref|XP_007221692.1|  hypothetical protein PRUPE_ppb012927mg             162   3e-45   
ref|XP_009625312.1|  PREDICTED: pathogenesis-related protein STH-...    162   3e-45   
gb|ABD78555.1|  pathogenesis-related protein 10.3                       162   3e-45   
dbj|BAJ25776.1|  putative PR-10 type pathogenesis-related protein       162   3e-45   
ref|XP_008223268.1|  PREDICTED: major allergen Pru av 1-like            162   3e-45   
ref|XP_011100837.1|  PREDICTED: major allergen Pru av 1-like            162   3e-45   
ref|XP_009369979.1|  PREDICTED: major allergen Mal d 1-like             162   3e-45   
gb|AAS00047.1|  Mal d 1-like                                            162   3e-45   
ref|XP_009767628.1|  PREDICTED: major allergen Pru ar 1-like            162   3e-45   
gb|AET44159.1|  pathogenesis related protein 10-4                       162   3e-45   
ref|NP_001234122.1|  Pathogenesis-related protein STH-2-like            162   3e-45   
gb|AAX18324.1|  major allergen Mal d 1.03G                              162   4e-45   
dbj|BAJ25774.1|  putative PR-10 type pathogenesis-related protein       162   4e-45   
dbj|BAJ25772.1|  putative PR-10 type pathogenesis-related protein       162   4e-45   
ref|XP_008223281.1|  PREDICTED: major allergen Pru av 1-like            162   4e-45   
gb|KHN26516.1|  Major allergen Pru ar 1                                 162   4e-45   
gb|AAX20980.1|  Mal d 1.06B05                                           161   4e-45   
ref|XP_009347372.1|  PREDICTED: major allergen Pru av 1-like            161   4e-45   
gb|AAX20949.1|  Mal d 1.0503                                            161   4e-45   
ref|XP_008360264.1|  PREDICTED: major allergen Pru av 1-like            161   5e-45   
dbj|BAJ25779.1|  putative PR-10 type pathogenesis-related protein       161   5e-45   
dbj|BAJ25777.1|  putative PR-10 type pathogenesis-related protein       161   5e-45   
ref|XP_009369985.1|  PREDICTED: major allergen Pru ar 1-like            161   5e-45   
emb|CDP18014.1|  unnamed protein product                                161   5e-45   
gb|ACF75099.1|  PR-10 protein                                           161   5e-45   
ref|XP_004296889.1|  PREDICTED: major allergen Pru av 1-like            161   5e-45   
gb|AAD29671.1|AF126402_1  major allergen Mal d 1                        161   5e-45   
gb|AEE38287.1|  Mal d 1.01                                              161   6e-45   
ref|NP_001275014.1|  pathogenesis-related protein STH-2                 161   6e-45   
gb|AAS00048.1|  Mal d 1-like                                            161   6e-45   
ref|XP_007225979.1|  hypothetical protein PRUPE_ppa012678mg             161   6e-45   
ref|XP_010041509.1|  PREDICTED: pathogenesis-related protein STH-...    164   7e-45   
ref|XP_009347371.1|  PREDICTED: major allergen Mal d 1-like             161   7e-45   
gb|ABC41606.1|  PR-10.0501                                              160   7e-45   
dbj|BAJ25778.1|  putative PR-10 type pathogenesis-related protein       161   7e-45   
gb|EYU32596.1|  hypothetical protein MIMGU_mgv1a015386mg                161   7e-45   
gb|AAX18320.1|  major allergen Mal d 1.03E                              161   7e-45   
emb|CAA96540.1|  major allergen Bet v 1                                 161   8e-45   
gb|AAK13029.1|  ribonuclease-like PR-10c                                161   8e-45   
ref|XP_004296888.1|  PREDICTED: major allergen Pru ar 1-like            160   8e-45   
gb|AAX20978.1|  Mald 1.06B04                                            160   9e-45   
gb|AAD26546.1|AF124823_1  major allergen mal d 1                        160   9e-45   
emb|CAA96535.1|  major allergen Mal d 1                                 160   9e-45   
emb|CAJ85639.1|  Major strawberry allergen Fra a 1-B                    160   9e-45   
ref|XP_009369978.1|  PREDICTED: major allergen Mal d 1-like             160   1e-44   
gb|AAX18314.1|  major allergen Mal d 1.03B                              160   1e-44   
gb|AAX18317.1|  major allergen Mal d 1.03D                              160   1e-44   
ref|XP_010024752.1|  PREDICTED: major allergen Pru ar 1-like isof...    160   1e-44   
ref|XP_008390594.1|  PREDICTED: major allergen Pru av 1-like            160   1e-44   
ref|NP_001284606.1|  major allergen Pru ar 1-like                       160   1e-44   
ref|XP_008223263.1|  PREDICTED: major allergen Pru ar 1-like            160   1e-44   
ref|XP_006419459.1|  hypothetical protein CICLE_v10006107mg             160   1e-44   
emb|CBJ49381.1|  pathogenesis-related protein 10.9                      160   1e-44   
ref|XP_009347375.1|  PREDICTED: major allergen Mal d 1-like             160   1e-44   
ref|XP_008368351.1|  PREDICTED: major allergen Pru av 1-like            160   1e-44   
ref|XP_004298150.1|  PREDICTED: major allergen Pru ar 1-like            160   1e-44   
ref|XP_010024751.1|  PREDICTED: major allergen Pru ar 1-like isof...    160   2e-44   
ref|XP_009346222.1|  PREDICTED: major allergen Pru av 1-like            160   2e-44   
ref|XP_011014083.1|  PREDICTED: major allergen Pru ar 1-like            160   2e-44   
ref|XP_007225980.1|  hypothetical protein PRUPE_ppa012678mg             160   2e-44   
gb|KCW61242.1|  hypothetical protein EUGRSUZ_H04005                     160   2e-44   
ref|XP_008390595.1|  PREDICTED: major allergen Mal d 1-like             160   2e-44   
gb|ABD78556.1|  pathogenesis-related protein 10.2                       160   2e-44   
gb|AAD48405.1|AF136945_1  major allergen Cor a 1.0401                   160   2e-44   
gb|AEF38445.1|  allergen Mal d 1.06C                                    160   2e-44   
sp|O65200.1|PYRC1_PYRCO  RecName: Full=Major allergen Pyr c 1; Al...    160   2e-44   
sp|P43186.2|BEV1M_BETPN  RecName: Full=Major pollen allergen Bet ...    160   2e-44   
gb|AAD26552.1|AF124829_1  major allergen mal d 1                        160   2e-44   
gb|AAK13027.1|  ribonuclease-like PR-10b                                160   2e-44   
gb|KHN14639.1|  Major allergen Pru ar 1                                 165   2e-44   
gb|AAS00046.1|  Mal d 1-like                                            160   2e-44   
ref|XP_004295118.1|  PREDICTED: major allergen Pru ar 1-like isof...    159   2e-44   
gb|AAX18323.1|  major allergen Mal d 1.03F                              160   2e-44   
gb|KDO71811.1|  hypothetical protein CISIN_1g031459mg                   160   2e-44   
gb|ABZ81045.1|  pollen allergen Que a 1 isoform                         160   2e-44   
ref|XP_003546350.1|  PREDICTED: MLP-like protein 34-like                164   2e-44   
ref|XP_004296884.1|  PREDICTED: major allergen Pru ar 1-like            160   2e-44   
emb|CDP20695.1|  unnamed protein product                                159   2e-44   
gb|AAD26554.1|AF124831_1  major allergen mal d 1                        159   2e-44   
ref|XP_009346215.1|  PREDICTED: major allergen Mal d 1                  159   2e-44   
ref|XP_004296887.1|  PREDICTED: major allergen Pru av 1-like            159   2e-44   
gb|AAD26548.1|AF124825_1  major allergen mal d 1                        159   2e-44   
ref|XP_008351173.1|  PREDICTED: major allergen Mal d 1-like             159   3e-44   
gb|ABC41610.1|  PR-10.0502                                              159   3e-44   
sp|P43211.2|MAL11_MALDO  RecName: Full=Major allergen Mal d 1; Al...    159   3e-44   
emb|CAA96543.1|  major allergen Bet v 1                                 159   3e-44   
gb|AAB71865.1|  Mal d1 homolog                                          159   3e-44   
ref|NP_001281292.1|  major allergen Mal d 1                             159   3e-44   
emb|CAA96542.1|  major allergen Bet v 1                                 159   3e-44   
gb|AAX20932.1|  Mal d 1.0209                                            159   3e-44   
ref|XP_004296886.1|  PREDICTED: major allergen Pru av 1-like            159   3e-44   
ref|XP_008390598.1|  PREDICTED: major allergen Mal d 1-like             159   3e-44   
gb|AAS00049.1|  Mal d 1-like                                            159   3e-44   
dbj|BAJ25773.1|  putative PR-10 type pathogenesis-related protein       159   3e-44   
gb|AAD26555.1|AF124832_1  major allergen mal d 1                        159   4e-44   
ref|XP_011073729.1|  PREDICTED: major allergen Pru ar 1-like            159   4e-44   
ref|XP_008340740.1|  PREDICTED: major allergen Mal d 1-like             159   4e-44   
gb|AAG40331.1|AF323975_1  major allergen variant Cor a 1.0404           159   4e-44   
gb|AAX18303.1|  major allergen Mal d 1.06B                              159   4e-44   
gb|AHZ31602.1|  pollen allergen Ziz j 1                                 159   4e-44   
ref|XP_010245448.1|  PREDICTED: pathogenesis-related protein STH-...    159   5e-44   
ref|XP_006488999.1|  PREDICTED: major allergen Pru ar 1-like            159   5e-44   
ref|XP_008390593.1|  PREDICTED: major allergen Pru av 1-like            159   6e-44   
ref|XP_006489005.1|  PREDICTED: major allergen Pru ar 1-like            159   6e-44   
ref|XP_007223619.1|  hypothetical protein PRUPE_ppa012573mg             159   6e-44   
ref|XP_002274242.1|  PREDICTED: major allergen Pru av 1                 158   6e-44   
gb|ACK38253.1|  pathogenesis-related protein                            159   7e-44   
ref|XP_008360260.1|  PREDICTED: major allergen Mal d 1-like             158   8e-44   
emb|CAA96537.1|  major allergen Mal d1                                  158   8e-44   
gb|AAD26547.1|AF124824_1  major allergen mal d 1                        158   9e-44   
ref|XP_009347369.1|  PREDICTED: major allergen Pru av 1-like            158   9e-44   
emb|CAJ85642.1|  Major strawberry allergen Fra a 1-D                    158   9e-44   
gb|AAX18313.1|  major allergen Mal d 1.03A                              158   1e-43   
gb|AAD13683.1|  major allergen Mal d 1                                  158   1e-43   
ref|NP_001274822.1|  pathogenesis-related protein STH-21                158   1e-43   
ref|XP_009346218.1|  PREDICTED: major allergen Mal d 1-like             158   1e-43   
gb|ABW76424.1|  major allergen Cor h 1                                  158   1e-43   
gb|AAX18298.1|  major allergen Mal d 1.06A02                            157   1e-43   
ref|XP_009346219.1|  PREDICTED: major allergen Pru ar 1-like            157   2e-43   
gb|AAK13030.1|  ribonuclease-like PR-10a                                157   2e-43   
emb|CAK93672.1|  PR-10 protein                                          157   2e-43   
gb|AAX20964.1|  Mal d 1.06A03                                           157   2e-43   
gb|AAG40330.1|AF323974_1  major allergen variant Cor a 1.0403           157   2e-43   
gb|AAG40329.1|AF323973_1  major allergen variant Cor a 1.0402           157   2e-43   
ref|XP_009346209.1|  PREDICTED: major allergen Mal d 1-like             157   2e-43   
dbj|BAF95875.1|  pathogenesis-related protein 10                        157   2e-43   
ref|XP_010024753.1|  PREDICTED: major allergen Pru ar 1-like            157   2e-43   
gb|AAX20989.1|  Mal d 1.06C04                                           157   2e-43   
gb|AAL16409.1|  pathogenesis-related protein PR10a                      155   2e-43   
gb|AHF20213.1|  pathogenesis-related protein 10                         157   2e-43   
emb|CAA96536.1|  major allergen Mal d1                                  157   2e-43   
ref|XP_008367134.1|  PREDICTED: LOW QUALITY PROTEIN: major allerg...    157   2e-43   
gb|AAD26558.1|AF124835_1  major allergen mal d 1                        157   2e-43   
gb|AEF38456.1|  allergen Mal d 1.02                                     157   2e-43   
ref|XP_002516989.1|  Major allergen Pru ar, putative                    157   2e-43   
gb|AAX18316.1|  major allergen Mal d 1.03C                              157   2e-43   
emb|CAK93700.1|  PR-10 protein                                          157   2e-43   
gb|AEF38441.1|  allergen Mal d 1.06C                                    157   2e-43   
gb|AAX18304.1|  major allergen Mal d 1.06C                              157   3e-43   
gb|AEF38437.1|  allergen Mal d 1.06A                                    157   3e-43   
ref|XP_008390601.1|  PREDICTED: major allergen Mal d 1-like             157   3e-43   
gb|AEF38446.1|  allergen Mal d 1.06C                                    157   3e-43   
pdb|4C94|A  Chain A, Crystal Structure Of The Strawberry Pathogen...    157   3e-43   
ref|XP_010064237.1|  PREDICTED: major allergen Pru av 1-like            157   4e-43   
ref|XP_006419461.1|  hypothetical protein CICLE_v10006102mg             156   4e-43   
gb|KCW61248.1|  hypothetical protein EUGRSUZ_H04013                     156   4e-43   
emb|CAA04826.1|  pollen allergen, Betv1                                 156   4e-43   
dbj|BAJ25775.1|  putative PR-10 type pathogenesis-related protein       156   4e-43   
ref|XP_009369982.1|  PREDICTED: major allergen Pru av 1-like            156   4e-43   
emb|CAD32318.1|  major allergen d 1                                     156   4e-43   
ref|XP_010024759.1|  PREDICTED: major allergen Pru ar 1-like            156   4e-43   
ref|XP_008351172.1|  PREDICTED: major allergen Mal d 1-like             156   4e-43   
ref|XP_009369974.1|  PREDICTED: major allergen Pru av 1-like            158   4e-43   
ref|XP_010024758.1|  PREDICTED: major allergen Pru ar 1-like            156   5e-43   
ref|XP_009369972.1|  PREDICTED: major allergen Pru av 1-like            156   6e-43   
ref|XP_008340737.1|  PREDICTED: major allergen Mal d 1-like             156   6e-43   
ref|XP_008340765.1|  PREDICTED: major allergen Mal d 1-like             156   6e-43   
gb|AET07376.1|  allergen Mal d 1.06B                                    156   6e-43   
emb|CAJ85645.1|  Major strawberry allergen Fra a 1-E                    156   6e-43   
gb|AAS00044.1|  Mal d 1-like                                            156   7e-43   
emb|CAA88833.1|  major allergen                                         156   7e-43   
gb|AAX18306.1|  major allergen Mal d 1.06C                              156   7e-43   
ref|XP_008390600.1|  PREDICTED: major allergen Pru ar 1-like            155   7e-43   
emb|CAA04828.1|  pollen allergen, Betv1                                 155   7e-43   
gb|AFF59686.1|  Bet v 1 allergen                                        155   7e-43   
emb|CAK93655.1|  PR-10 protein                                          155   8e-43   
gb|AAX20991.1|  Mal d 1.06C06                                           155   8e-43   
emb|CAK93636.1|  PR-10 protein                                          155   9e-43   
gb|AAX20990.1|  Mal d 1.06C05                                           155   9e-43   
ref|XP_010024754.1|  PREDICTED: major allergen Pru ar 1-like            155   1e-42   
pdb|2LPX|A  Chain A, Solution Structure Of Strawberry Allergen Fr...    155   1e-42   
emb|CAA96534.1|  major allergen Mal d 1                                 155   1e-42   
ref|XP_009362317.1|  PREDICTED: major allergen Mal d 1-like             155   1e-42   
gb|AAX21001.1|  Mal d 1.03C03                                           155   1e-42   
emb|CAB94733.1|  Ypr10a protein                                         155   1e-42   
ref|XP_008390599.1|  PREDICTED: major allergen Pru av 1-like            155   1e-42   
ref|XP_009346223.1|  PREDICTED: major allergen Pru av 1-like            155   1e-42   
sp|P43184.2|BEV1K_BETPN  RecName: Full=Major pollen allergen Bet ...    155   1e-42   
gb|EYU32594.1|  hypothetical protein MIMGU_mgv1a015344mg                155   1e-42   
ref|XP_008390596.1|  PREDICTED: major allergen Pru av 1-like            155   1e-42   
ref|XP_006841522.1|  hypothetical protein AMTR_s00003p00148140          155   1e-42   
ref|XP_009346624.1|  PREDICTED: major allergen Pru ar 1-like            155   2e-42   
emb|CAJ85643.1|  Major strawberry allergen Fra a 1-C                    155   2e-42   
ref|XP_009347370.1|  PREDICTED: major allergen Pru av 1-like            155   2e-42   
gb|AAS00051.1|  Mal d 1-like                                            155   2e-42   
sp|P45431.2|BEV1B_BETPN  RecName: Full=Major pollen allergen Bet ...    154   2e-42   
ref|XP_002519169.1|  Major allergen Pru ar, putative                    154   2e-42   
gb|AAX18308.1|  major allergen Mal d 1.07                               154   3e-42   
gb|AEF38444.1|  allergen Mal d 1.06C                                    154   3e-42   
gb|AAX21000.1|  Mal d 1.03C02                                           154   3e-42   
ref|XP_010024760.1|  PREDICTED: major allergen Pru ar 1-like            154   3e-42   
gb|KDO71805.1|  hypothetical protein CISIN_1g036858mg                   154   3e-42   
emb|CAM31908.1|  bet v 1 related allergen                               154   3e-42   
emb|CAA96548.1|  major allergen Cor a 1                                 154   4e-42   
sp|P43176.2|BEV1C_BETPN  RecName: Full=Major pollen allergen Bet ...    154   5e-42   
ref|XP_010024764.1|  PREDICTED: major allergen Pru ar 1-like            154   5e-42   



>emb|CDO99127.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++YTDE TSPVAPSRIF+ASIVDSH LIPKL+PQ IKS+DI++G GG GSIKQI F 
Sbjct  1    MGVTSYTDEHTSPVAPSRIFRASIVDSHTLIPKLLPQVIKSMDIIEGDGGAGSIKQIAFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS+ KSIKY IDELNE+ LTY YTLVEGDAL+D+LEKITYE+KFEK  +GGSISKVTSK
Sbjct  61   EGSNFKSIKYRIDELNEDALTYSYTLVEGDALIDKLEKITYEIKFEKGPDGGSISKVTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT GDFK+ E+E+KAGKE+V+ MYKAVEAYL+QNP+AYA
Sbjct  121  YYTQGDFKLNEDEVKAGKEKVLGMYKAVEAYLLQNPEAYA  160



>ref|XP_009605099.1| PREDICTED: major allergen Pru ar 1-like, partial [Nicotiana tomentosiformis]
Length=180

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -3

Query  763  KTKMGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQI  584
            K  M ++++TDE T P+ PSRIFKASI+DSHNL+PKLMPQAIKSI+ VQG GG GSIKQI
Sbjct  18   KLIMAITSFTDEYTCPIPPSRIFKASIIDSHNLMPKLMPQAIKSIEFVQGNGGAGSIKQI  77

Query  583  NFPEGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKV  404
            NFPEG + KSIKY IDELNEE   Y YTL+EGDAL+D+LEKITYEVKFE++A+GGSISKV
Sbjct  78   NFPEGGNFKSIKYRIDELNEEKFVYNYTLIEGDALIDKLEKITYEVKFEQSADGGSISKV  137

Query  403  TSKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            TS YYT GDFK+KE+EIKAGKE+V+ MYKAVE YL+QNP AYA
Sbjct  138  TSTYYTEGDFKLKEDEIKAGKEKVLGMYKAVETYLLQNPDAYA  180



>ref|XP_006341397.1| PREDICTED: major allergen Pru ar 1-like [Solanum tuberosum]
Length=159

 Score =   259 bits (662),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T+E TSP+ P RIFKASIVDSHNLIPKLMPQAIKSI+ VQG GG GSIK INFP
Sbjct  1    MAVTTFTEENTSPLPPKRIFKASIVDSHNLIPKLMPQAIKSIE-VQGDGGAGSIKTINFP  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G + KSIKY +DELNEE  TYKYTL+EGD L+D LEKITY+VKFE++A+GGSISKVTS 
Sbjct  60   DGGNFKSIKYRVDELNEEAYTYKYTLIEGDGLVDNLEKITYDVKFEQSADGGSISKVTSS  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVGDFK+KEEEIKAGKE+V+AM+KAVEAYL+QNP+AYA
Sbjct  120  YYTVGDFKLKEEEIKAGKEKVLAMFKAVEAYLLQNPEAYA  159



>ref|XP_004236449.1| PREDICTED: major allergen Pru ar 1-like [Solanum lycopersicum]
Length=159

 Score =   259 bits (661),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T+E TSP+ P RIFKASIVDSHNLIP LMPQAIKSI+ VQG GG GSIK INFP
Sbjct  1    MAVTTFTEENTSPLPPKRIFKASIVDSHNLIPNLMPQAIKSIE-VQGDGGAGSIKTINFP  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G + KSIKY +DELNEET TYKYT++EGD L+D LEKITY+VKFE++A+GGSISKVTS 
Sbjct  60   DGGNFKSIKYRVDELNEETYTYKYTMIEGDGLVDNLEKITYDVKFEQSADGGSISKVTSS  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVGDFK+KEEEIKAGKE+V+AM+KAVEAYL+QNP+AYA
Sbjct  120  YYTVGDFKLKEEEIKAGKEKVLAMFKAVEAYLLQNPEAYA  159



>ref|XP_011091080.1| PREDICTED: major allergen Pru ar 1-like [Sesamum indicum]
Length=160

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M ++T+TD+ +SP+ PSRIFKASI+DSHNLIPKLMPQAIKSIDI+QG GG G+IKQINF 
Sbjct  1    MAITTFTDQHSSPIPPSRIFKASILDSHNLIPKLMPQAIKSIDILQGDGGAGTIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +KY IDELNE+TLTY YTLVEGD+L D+LEKITY V+FE++A+GGSI +VTSK
Sbjct  61   EGSPFKYVKYRIDELNEKTLTYGYTLVEGDSLEDKLEKITYSVQFEQSADGGSICQVTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVG+F +KEEE+KAGKERV+AMYKAVEA+L QNP AYA
Sbjct  121  YYTVGEFTLKEEEVKAGKERVLAMYKAVEAFLAQNPDAYA  160



>ref|XP_004236450.1| PREDICTED: major allergen Pru ar 1-like [Solanum lycopersicum]
Length=159

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T+E TS + P RIFKASIVDSHNLIPKLMPQAIKSI+ VQG GG GSIK INFP
Sbjct  1    MAVTTFTEENTSSLPPKRIFKASIVDSHNLIPKLMPQAIKSIE-VQGDGGAGSIKTINFP  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G + K IKY +DELNEE  TYKYTL+EGD L+D LEKITY+VKFE++A+GGSISKVTS 
Sbjct  60   DGGNFKCIKYRVDELNEEAYTYKYTLIEGDGLVDNLEKITYDVKFEQSADGGSISKVTSS  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVGDFK+KEEEIKAGKE+V+AM+KAVEAYL+QNP+AYA
Sbjct  120  YYTVGDFKLKEEEIKAGKEKVLAMFKAVEAYLLQNPEAYA  159



>ref|XP_009792840.1| PREDICTED: major allergen Pru ar 1-like [Nicotiana sylvestris]
Length=159

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T+E TSP+ P RIFKASIVDSHNLIPKLMPQAI SI+ VQG GG GSIK INFP
Sbjct  1    MAVTTFTEEHTSPLPPKRIFKASIVDSHNLIPKLMPQAISSIE-VQGDGGAGSIKTINFP  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   KSIKY++DELNEET TYKYTLV GD L+D LEKI+Y+VKFE++ +GGSIS VTS 
Sbjct  60   EGGKFKSIKYHVDELNEETYTYKYTLVGGDGLVDNLEKISYDVKFEQSEDGGSISNVTST  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVGDFK+ EEEIKAGKE+V AM+K +EAYL+QNP+AYA
Sbjct  120  YYTVGDFKLNEEEIKAGKEKVSAMFKVIEAYLLQNPEAYA  159



>emb|CDP16929.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+ +E TSP+AP+R+FKASIVDSHNL+PKLMPQA+KSI+I QG GG GSIKQINF 
Sbjct  1    MGVTTFNEEYTSPIAPARLFKASIVDSHNLVPKLMPQALKSIEITQGNGGAGSIKQINFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+KY IDELNE+T TY YTL+EG +L + LEKITYEVKFE T+EGG++SKVTSK
Sbjct  61   EGSHFGSLKYQIDELNEQTYTYNYTLIEGGSLTENLEKITYEVKFEPTSEGGTVSKVTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT GDF +KEE+IKAGKE+V  MYKAVEAYL++NP AY 
Sbjct  121  YYTKGDFSLKEEDIKAGKEKVEGMYKAVEAYLLENPDAYG  160



>ref|XP_009611342.1| PREDICTED: major allergen Pru ar 1-like [Nicotiana tomentosiformis]
Length=159

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T+E TS + P RIFKASI+DSH LIPKLMPQAIKSI+ VQG GG GSIK INFP
Sbjct  1    MAVTTFTEEHTSLLPPKRIFKASIIDSHKLIPKLMPQAIKSIE-VQGDGGAGSIKTINFP  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   KSIKY +DELNEET TYKYTLV GD L+D LEKI+Y+VKFE++A+GGSISKVTS 
Sbjct  60   EGGKFKSIKYRVDELNEETYTYKYTLVGGDGLVDNLEKISYDVKFEQSADGGSISKVTST  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVGDFK+ EEEIKAGKE+V AM+K VEAYL+QNP+AYA
Sbjct  120  YYTVGDFKLNEEEIKAGKEKVSAMFKVVEAYLLQNPEAYA  159



>ref|XP_009792839.1| PREDICTED: major allergen Pru ar 1-like [Nicotiana sylvestris]
Length=157

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T+E TSP+ P RIFKASI+DSH LIPKLMPQAI SI   +G GG GSIK INFP
Sbjct  1    MAVTTFTEEHTSPLPPKRIFKASIIDSHYLIPKLMPQAISSI---EGDGGAGSIKTINFP  57

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   KSIKY +DELNEET TYKYTLV GD L+D LEKI+Y+VKFE++ +GGSISKVTS 
Sbjct  58   EGGKFKSIKYRVDELNEETYTYKYTLVGGDGLVDNLEKISYDVKFEQSEDGGSISKVTST  117

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYTVGDFK+ EEEIKAGKE+V AM+K VEAYL+QNP+AYA
Sbjct  118  YYTVGDFKLNEEEIKAGKEKVSAMFKVVEAYLLQNPEAYA  157



>ref|XP_010027035.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61022.1| hypothetical protein EUGRSUZ_H03778 [Eucalyptus grandis]
Length=160

 Score =   233 bits (595),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T++DE TSP+  SR+FKA IVDS NLIPKLMPQAIKSID+VQG GG GSI+QINF 
Sbjct  1    MGVFTFSDEFTSPIPASRLFKALIVDSQNLIPKLMPQAIKSIDVVQGDGGAGSIRQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS L  +K  +DELNEET TYKY L+EG  L+++ E I YEVKFE T +GGS +K+TS 
Sbjct  61   EGSQLSCMKNRVDELNEETFTYKYALIEGGPLMEKFESIAYEVKFEPTPDGGSKNKMTST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT GDF++KEEE+KAGKER + MYKAVEAYLIQNP AY
Sbjct  121  YYTKGDFELKEEEVKAGKERALGMYKAVEAYLIQNPDAY  159



>ref|XP_010027089.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61214.1| hypothetical protein EUGRSUZ_H03975 [Eucalyptus grandis]
Length=160

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T++DE TSP+  +R+FKA IVDS NLIPKLMPQAIKSID+VQG GG GSI+QINF 
Sbjct  1    MGVFTFSDEFTSPIPAARLFKALIVDSQNLIPKLMPQAIKSIDVVQGDGGAGSIRQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS L  +K  +DELNEET TYKY L+EG  L+++ E I YEVKFE T +GGS +K+TS 
Sbjct  61   EGSQLSCMKNRVDELNEETFTYKYALIEGGPLMEKFESIAYEVKFEPTPDGGSKNKMTST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT GDF++KEEE+KAGKER + MYKAVEAYLIQNP AY
Sbjct  121  YYTKGDFELKEEEVKAGKERALGMYKAVEAYLIQNPDAY  159



>ref|XP_011096540.1| PREDICTED: major allergen Pru av 1-like [Sesamum indicum]
Length=160

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+T+E TS V+PSRIFKASI+D++NLIPKL+PQ IKS++ +QGTG  GSIKQI F 
Sbjct  1    MGVLTFTEEHTSAVSPSRIFKASILDANNLIPKLLPQVIKSMEFIQGTGSPGSIKQICFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS+L S+KY IDELNEET TY YT++EGDAL D+LEKIT+EVK E    GG+ SKVTS 
Sbjct  61   EGSTLSSLKYRIDELNEETYTYNYTVIEGDALTDKLEKITHEVKLEAAPGGGTFSKVTST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT GDF +KEE++KAGKERV+ +YK VEAYL+ NP AYA
Sbjct  121  YYTKGDFALKEEDVKAGKERVLGVYKVVEAYLLNNPDAYA  160



>ref|XP_007035688.1| Major pollen allergen Car b 1 [Theobroma cacao]
 gb|EOY06614.1| Major pollen allergen Car b 1 [Theobroma cacao]
Length=197

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TY+DE TSP+ P+R+FKA IVDSHNLIPKLMP A++SI+I +G GG GSI+QINF 
Sbjct  38   MGVTTYSDEYTSPIPPARLFKALIVDSHNLIPKLMPLAVQSIEITEGDGGAGSIRQINFA  97

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS +K I+  I+EL+E+  +YKY+L+EGD L+D+LEKITY+VKFE TA+GGS +K+TS 
Sbjct  98   EGSQVKCIRNRIEELDEKNCSYKYSLIEGDGLMDKLEKITYDVKFEPTADGGSKNKMTST  157

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT GDF + EEEIK GKE+ +AMYK VE YLIQNP AYA
Sbjct  158  YYTKGDFVLTEEEIKTGKEKALAMYKVVEGYLIQNPDAYA  197



>emb|CDP16928.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 129/175 (74%), Gaps = 8/175 (5%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+ +E TSP+AP RIFKASIVDSHNLIPKLMPQAIKSI+I QG GG GSIKQINF 
Sbjct  1    MGVTTFNEEYTSPIAPKRIFKASIVDSHNLIPKLMPQAIKSIEITQGNGGAGSIKQINFA  60

Query  574  E--------GSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGG  419
            E         S  KS+ Y IDELN+ET TY YTL+EG AL + LEKITYEVKFE T EGG
Sbjct  61   EEMIFEFTKSSHFKSLTYQIDELNQETYTYNYTLIEGGALTENLEKITYEVKFEPTPEGG  120

Query  418  SISKVTSKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA*DMFLDL  254
            S+SKVTSKYYT GDF +KEE+IK GKE+V+ MYK   +  I  P       F DL
Sbjct  121  SVSKVTSKYYTKGDFSLKEEDIKVGKEKVVGMYKVPISSKILMPMPNHLSRFADL  175



>ref|XP_010245454.1| PREDICTED: pathogenesis-related protein STH-2-like [Nelumbo nucifera]
Length=161

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+++T E   PVAP+R+FKA I+DSHNLIPKLMPQ+IKS++I+QG GG GSI QINFP
Sbjct  1    MGVTSFTQEFACPVAPARMFKALILDSHNLIPKLMPQSIKSVEIIQGDGGAGSINQINFP  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   K +K+ ID L+++ L  KYTLVEGD L D+LE I YEVKFE  A GG + K+TS+
Sbjct  61   EGGHFKYLKHRIDALDKDNLVCKYTLVEGDVLGDKLESIAYEVKFEAAANGGCVCKMTSE  120

Query  394  YYTV-GDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T  GD +++EEEIK GKER + MYK VEAYL++NP  YA
Sbjct  121  YHTTSGDVEVREEEIKTGKERAMGMYKVVEAYLLENPHVYA  161



>ref|XP_008223331.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=161

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP++P+R+FKA ++D+HNL+P LMPQA+KSID +QG G  GSIKQINF 
Sbjct  1    MGVITCTDEYTSPISPARLFKALVLDAHNLVPNLMPQAVKSIDTLQGDGRAGSIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDAL-LDQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS LKS+   +D+++EE   Y YTL+EGDAL +++LE ++YEVKFE   +GGS +K+ S
Sbjct  61   EGSQLKSVTNRVDQVDEENFVYGYTLIEGDALVMEKLEYVSYEVKFEAAEDGGSKNKMVS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            KY+T GDF ++EE+IKAG+E+ + MYK VEAYL+ NP AYA
Sbjct  121  KYHTKGDFVLQEEDIKAGREKALGMYKVVEAYLLLNPDAYA  161



>ref|XP_007224203.1| hypothetical protein PRUPE_ppa017373mg [Prunus persica]
 gb|EMJ25402.1| hypothetical protein PRUPE_ppa017373mg [Prunus persica]
Length=161

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP+ P R+FKA ++D+HNL+P LMPQA+KSID +QG G  GSIKQ NF 
Sbjct  1    MGVITCTDEYTSPIPPDRLFKALVLDAHNLVPNLMPQAVKSIDTLQGDGRAGSIKQFNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDAL-LDQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS LKS+K  +D+++EE   Y YTL+EGDAL +++LE ++YEVKFE   +GGS +K+ S
Sbjct  61   EGSELKSVKNRVDQVDEENFVYGYTLIEGDALIMEKLEYVSYEVKFEAAEDGGSKNKMVS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            KY+T GDF ++EE+IK G+E+ + MYK VEAYL+QNP AYA
Sbjct  121  KYHTKGDFVLQEEDIKTGREKALGMYKVVEAYLLQNPDAYA  161



>gb|KHN14638.1| Major allergen Pru ar 1 [Glycine soja]
Length=161

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV + TDE  SP++PSR+FKA +VD+HNLIPKL+P ++KSI+I+QG GG GSIKQ NF 
Sbjct  1    MGVYSDTDEYPSPISPSRLFKALVVDAHNLIPKLLPNSVKSIEIIQGDGGAGSIKQFNFV  60

Query  574  EGSS-LKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS+ +K+IK  IDE++EETLTY YTL+EG+AL D+   I +E+KFE   +GGSISKVTS
Sbjct  61   EGSNQVKNIKNRIDEIDEETLTYNYTLIEGEALKDKFASIAHEIKFEAAPDGGSISKVTS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            KYY  GD ++ EE+IKA KE V+ +YK VEAYL+QNP  YA
Sbjct  121  KYYLKGDVEINEEDIKASKEIVLGIYKVVEAYLLQNPDVYA  161



>ref|XP_010024735.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61212.1| hypothetical protein EUGRSUZ_H03973 [Eucalyptus grandis]
Length=157

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 126/160 (79%), Gaps = 3/160 (2%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+ +E TSP+  +R+FKA ++DSHNLIPKLMPQAIKSIDI+QG GG G+IKQINF 
Sbjct  1    MGVFTFINEYTSPIPAARLFKALVLDSHNLIPKLMPQAIKSIDIIQGDGGVGTIKQINFI  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS L S+K  +DE+NEET TYKYT+++   L ++ E I YE+KFE T EGGS +K+TS 
Sbjct  61   EGSQLGSMKNRVDEINEETFTYKYTMID---LNEKFESIAYEIKFEPTPEGGSKNKMTST  117

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT G+ ++KEE++K GKER + MYK  EAYL+QNP  YA
Sbjct  118  YYTKGNVELKEEDVKEGKERALGMYKVAEAYLLQNPDTYA  157



>ref|XP_002273815.2| PREDICTED: pathogenesis-related protein STH-2 [Vitis vinifera]
 emb|CAN79554.1| hypothetical protein VITISV_025728 [Vitis vinifera]
 emb|CBI22943.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 128/160 (80%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+++T E T P+APSRIFKA I+DS+NLIPKL+PQ I+SID+VQG GG G+I+Q+NF 
Sbjct  1    MGVTSFTQEFTCPIAPSRIFKALILDSNNLIPKLLPQTIRSIDVVQGDGGAGTIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S+LK +K+ I+EL++E    KY ++EGD L ++LE I +EVKFE  A+GGSI K+ S+
Sbjct  61   EASNLKYVKHQIEELDKENFVCKYRMIEGDVLGEELESIAHEVKFE-AADGGSICKMASE  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T G F++KEEEIKAGK R + +YK VEAYL++NP  YA
Sbjct  120  YHTKGKFEIKEEEIKAGKARAMGIYKVVEAYLLENPHVYA  159



>ref|XP_010245452.1| PREDICTED: pathogenesis-related protein STH-2-like [Nelumbo nucifera]
Length=160

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  Y+ E + P+ P+R+FKA I+DSHNLIPKLMPQ++KSI+IV+G G  GSIK+I+F 
Sbjct  1    MGVIHYSHEISCPIHPARMFKALILDSHNLIPKLMPQSVKSIEIVEGDGEAGSIKKISFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ ID +++E    KYTL+EGD L D+L+ I YEVKFE +A+GG + K+TS+
Sbjct  61   ESSHFKYMKHRIDAVDKENYVCKYTLIEGDVLGDKLQSIAYEVKFEGSADGGCVCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+TVGDF++KEE+IKAGKE+ +AM+K VEA+L++NP  YA
Sbjct  121  YHTVGDFEIKEEDIKAGKEKAMAMHKVVEAHLLENPHLYA  160



>ref|XP_010245449.1| PREDICTED: major allergen Pru ar 1-like [Nelumbo nucifera]
Length=160

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+ +APS++FKA I+DSHNLIPKLMPQ+IKSI+I+QG GG GSIKQ NFP
Sbjct  1    MGVTTYTQEFTTSIAPSKMFKALILDSHNLIPKLMPQSIKSIEIIQGDGGAGSIKQTNFP  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   K +K+ ID L++E    KYTL+EGD L D+L+ I YEVKFE   +GG++ K+ S+
Sbjct  61   EGGHFKFLKHRIDSLDKENYFCKYTLIEGDVLGDKLKWIVYEVKFEACGDGGAVCKMRSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEEEIK GKE+ + MYK VEAYL +NP  YA
Sbjct  121  YHTAEGVELKEEEIKQGKEKAMGMYKVVEAYLTENPHVYA  160



>ref|XP_010245451.1| PREDICTED: major allergen Pru ar 1-like [Nelumbo nucifera]
Length=160

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+ +AP+R+FKA I+DSHNLIPKLMPQ+IKSI+IV+G G  GSIKQ NF 
Sbjct  1    MGVTTYTQEFTTSIAPARMFKALILDSHNLIPKLMPQSIKSIEIVEGDGDIGSIKQTNFH  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ ID L+ E L  KYTL+EGD L D+L+ I YEVK E +  GGS+ K+TS+
Sbjct  61   EGSHFKFLKHRIDGLDMENLVCKYTLIEGDVLGDKLKSIIYEVKLEASGNGGSVCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T     +KEEEIKAGK++ I MYK VEA+L++NP+ YA
Sbjct  121  YHTADGIDLKEEEIKAGKDKAIGMYKVVEAHLLENPELYA  160



>ref|XP_010024738.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61221.1| hypothetical protein EUGRSUZ_H03983 [Eucalyptus grandis]
Length=160

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+P+APSR+FKA IVDSHNLIPK+ PQ IKSI+ V+G GG GSIK  NF 
Sbjct  1    MGVTTYTQEFTTPIAPSRMFKALIVDSHNLIPKIAPQGIKSIEFVEGDGGAGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LKS+K+ ID L+ E L  KYTL+EGD + D++E + YEV+F  + +GG + K+TS+
Sbjct  61   EGGHLKSVKHKIDALDTENLVCKYTLIEGDVIFDKIESVVYEVQFLPSGDGGCVCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEE+IK GKE+ + +YK VE YL+ NP  YA
Sbjct  121  YHTKGDVELKEEDIKQGKEKAMGLYKVVEEYLLANPDVYA  160



>ref|XP_009618805.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
tomentosiformis]
Length=159

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E TSP+AP R+FKA IVDS +LIPKL+PQ ++S+D++QG GG GSI+Q+NF 
Sbjct  1    MGVATFTQELTSPIAPIRLFKALIVDSKSLIPKLLPQFVESVDLLQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +GS  + +K+ IDEL++E +  KYT++EGDAL D+L+ I+YEVKFE++  GG I K+T+K
Sbjct  61   KGSPFEFVKHQIDELDKENMVCKYTMIEGDALGDKLDSISYEVKFEES-NGGCICKMTTK  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y   GDF +KEEEIKAGK+  I +YKAVE++L+QNP  YA
Sbjct  120  YIGFGDFIVKEEEIKAGKDSAIGIYKAVESHLLQNPNLYA  159



>ref|XP_009793896.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
sylvestris]
Length=160

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+ +T E TSP+AP R+FKA IVDS +LIPKL+PQ ++S+D++QG GG GSI+Q+NF 
Sbjct  1    MGVAIFTQEFTSPIAPIRLFKALIVDSKSLIPKLLPQFVESVDLLQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +GS  + +K+ IDEL++E +  KYT++EGDAL D+ + I+YEVKFE++  GG I K+T++
Sbjct  61   KGSPFEFVKHRIDELDKENMVCKYTMIEGDALADKFDSISYEVKFEESNNGGCICKMTTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y  +GDF +KEE+IKAGK+  I +YKAVE++L+QNP  YA
Sbjct  121  YIGIGDFIVKEEDIKAGKDSAIGIYKAVESHLLQNPNLYA  160



>gb|KCW61264.1| hypothetical protein EUGRSUZ_H04027 [Eucalyptus grandis]
Length=157

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 124/159 (78%), Gaps = 3/159 (2%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+T+E  S + P+R+FKA IVDSHNLIPKL PQAIKSIDI++G GG G+IKQINF 
Sbjct  1    MGVFTFTEEYASTIPPARLFKALIVDSHNLIPKLWPQAIKSIDILRGDGGPGTIKQINFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS L S+K  +DELN+ET  YK+T+++   L ++ E I YEVKFE T +GGS +++TS 
Sbjct  61   EGSQLSSMKNSVDELNKETFVYKHTMID---LEERFESIAYEVKFEPTPDGGSKNRMTST  117

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YY  GD ++KEE+I+ GKER + MYK VEA+L+QNP AY
Sbjct  118  YYVKGDIELKEEDIETGKERALGMYKVVEAFLLQNPNAY  156



>ref|XP_007154324.1| hypothetical protein PHAVU_003G109000g [Phaseolus vulgaris]
 gb|ESW26318.1| hypothetical protein PHAVU_003G109000g [Phaseolus vulgaris]
Length=160

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG++TYT E +S VAPSR+FKA IVDS NL+PKL+PQ +K ++++QG G  GSI+Q+NF 
Sbjct  1    MGITTYTQEYSSSVAPSRMFKALIVDSKNLLPKLLPQFVKDVNVIQGDGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ ID L++E L  KYT++EGD L D+LE I+YEVKFE T++G  + K+TS 
Sbjct  61   EASPFKYLKHRIDVLDKENLVCKYTMIEGDPLGDRLESISYEVKFEATSDGACLCKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+F +KEEE+K G+E  IA+YK VE+YL++NPQ YA
Sbjct  121  YNTIGEFDVKEEEVKEGRESTIAIYKVVESYLLENPQVYA  160



>ref|XP_006380227.1| hypothetical protein POPTR_0008s23130g [Populus trichocarpa]
 gb|ERP58024.1| hypothetical protein POPTR_0008s23130g [Populus trichocarpa]
Length=160

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++YT E T P++P+R+FKA I+DS+NLIPKL+PQ +KS+D++ G GG GSI+Q+NF 
Sbjct  1    MGVASYTQEFTCPISPARMFKALILDSNNLIPKLLPQIVKSVDLIHGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+ +K +K+ IDEL+   L  KYT++EGD+L ++LE I YEV+FE  ++GG   K+TS 
Sbjct  61   EGTDIKYVKHRIDELDRVNLVCKYTMIEGDSLGEKLESIAYEVRFEVGSDGGCDCKMTSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y  +GDF +KEEEIKAG+++   +YK VEAYL++NP  YA
Sbjct  121  YLMLGDFTLKEEEIKAGQDKARGIYKVVEAYLLENPHVYA  160



>ref|XP_009369986.1| PREDICTED: major allergen Pru ar 1-like [Pyrus x bretschneideri]
Length=160

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++ T E   P+AP+R+FKA I+DS NLIPKL+PQ I S+D+ QG GG GSI+Q+NF 
Sbjct  1    MGVTSITQEFLCPIAPARMFKALIIDSKNLIPKLLPQFIASVDVTQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  + +K+ IDEL+ E    KYT++EGDAL ++LE I YEVKFE  ++G SI K+TSK
Sbjct  61   EGSHFRYVKHRIDELDVENFVCKYTMIEGDALGEKLESIAYEVKFEAASDGSSICKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+F++KEEEI AGK   I +YK VEAYL++NP  Y+
Sbjct  121  YNTIGEFEVKEEEIIAGKNSAIGIYKVVEAYLLENPNVYS  160



>ref|XP_008360265.1| PREDICTED: major allergen Pru ar 1-like [Malus domestica]
 ref|XP_008367135.1| PREDICTED: major allergen Pru ar 1-like [Malus domestica]
Length=160

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++ T E   P+AP R+FKA I+DS NLIPKL+PQ I S+D+ QG GG GSI+Q+NF 
Sbjct  1    MGVTSITQEFLCPIAPXRMFKALIIDSKNLIPKLLPQFIASVDVTQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  + +K+ IDEL+ E    KYT++EGDAL ++LE I YEVKFE  ++G SI K+TSK
Sbjct  61   EGSHFRYVKHRIDELDVENFVCKYTMIEGDALGEKLESIAYEVKFEAASDGSSICKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+F++KEEEI AGK   I +YK VEAYL++NP  Y+
Sbjct  121  YNTIGEFEVKEEEIIAGKNSAIGIYKVVEAYLLENPNVYS  160



>ref|XP_010259438.1| PREDICTED: major allergen Pru ar 1-like [Nelumbo nucifera]
Length=159

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  YT E T  + P+R+FKA I+DSHNL PKLMPQ+IKSIDI+ G GG G+IKQ NF 
Sbjct  1    MGVVIYTQEFTCAIPPARMFKALILDSHNLCPKLMPQSIKSIDIL-GDGGVGTIKQTNFT  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ ID L++E    K T++EGDAL D+L  + YEVKFE +A+GG I K++S+
Sbjct  60   EASPYKYVKHRIDALDKENFICKNTMIEGDALGDKLTSVVYEVKFEASADGGCICKMSSE  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+TVGD +  EE++KAGKE  + MYKAVEAYL+QNP AYA
Sbjct  120  YHTVGDAQFTEEDVKAGKEGALGMYKAVEAYLLQNPDAYA  159



>ref|XP_010023670.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=160

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E T+P+APSR+FKA IVDSHNLIPK+ PQ IK+I++V+G GG GSIK  NF 
Sbjct  1    MGVTTFTHEFTTPIAPSRMFKALIVDSHNLIPKIAPQGIKNIELVEGDGGVGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ E L  KYTL+EGD + D++E I YEV+F  +++GG + K+TS 
Sbjct  61   EGGHLKFLKHKIDALDTENLVCKYTLIEGDVIFDKIELIVYEVQFLASSDGGCVCKMTSG  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KE++IK GKE+ + +YK VE YL+ NP  Y 
Sbjct  121  YHTTGDVELKEDDIKQGKEKAMGLYKVVEEYLLANPNVYV  160



>gb|KCW59979.1| hypothetical protein EUGRSUZ_H02708, partial [Eucalyptus grandis]
Length=162

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  757  KMGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINF  578
             MGV+T+T E T+P+APSR+FKA IVDSHNLIPK+ PQ IK+I++V+G GG GSIK  NF
Sbjct  2    NMGVTTFTHEFTTPIAPSRMFKALIVDSHNLIPKIAPQGIKNIELVEGDGGVGSIKVTNF  61

Query  577  PEGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTS  398
             EG  LK +K+ ID L+ E L  KYTL+EGD + D++E I YEV+F  +++GG + K+TS
Sbjct  62   AEGGHLKFLKHKIDALDTENLVCKYTLIEGDVIFDKIELIVYEVQFLASSDGGCVCKMTS  121

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
             Y+T GD ++KE++IK GKE+ + +YK VE YL+ NP  Y 
Sbjct  122  GYHTTGDVELKEDDIKQGKEKAMGLYKVVEEYLLANPNVYV  162



>ref|XP_011009733.1| PREDICTED: pathogenesis-related protein STH-2-like [Populus euphratica]
Length=160

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++YT E T P++P+R+FKA I+DS+NLIPKL PQ +KS+D++ G GG GSI+Q+NF 
Sbjct  1    MGVASYTQEFTCPISPARMFKALILDSNNLIPKLFPQIVKSVDLIHGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+ +K +K+ IDEL+   L  +YT++EGD L ++LE I YEV+FE  ++GG   K+TS 
Sbjct  61   EGTDIKYVKHRIDELDRVNLVCRYTMIEGDPLGEKLESIAYEVRFEVGSDGGCDCKMTSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y  +GDF +KEEEIKAG+++   +YK VEAYL++NP  YA
Sbjct  121  YLMLGDFTLKEEEIKAGQDKARGIYKVVEAYLLENPHVYA  160



>ref|XP_002516987.1| Major allergen Pru ar, putative [Ricinus communis]
 gb|EEF45601.1| Major allergen Pru ar, putative [Ricinus communis]
Length=160

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGVST+T E TSPVAPSR+FKA I+DS+ LIPKL+PQ IKS+D++QG  G G+I+Q+NF 
Sbjct  1    MGVSTFTQEFTSPVAPSRMFKALILDSNILIPKLLPQFIKSVDVIQGGDGAGTIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K IK  I+EL+++ L  KYTL+EG  L D+L+ I YEVKFE  ++GG I K+TS 
Sbjct  61   EASDFKYIKNRIEELDKDNLVCKYTLIEGGPLGDKLDSIAYEVKFEAASDGGCICKITSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T+G F +KEE+I+ GK + + +Y+ VEAYL++NPQ YA
Sbjct  121  YFTLGKFTIKEEDIEDGKGKALGIYRVVEAYLLENPQVYA  160



>ref|XP_010023669.1| PREDICTED: pathogenesis-related protein STH-2-like [Eucalyptus 
grandis]
Length=160

 Score =   197 bits (501),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG++T+T E T+P+APSR+FKA I+DSHNLIPK+ PQ IK+ID ++G GG GSIKQ NF 
Sbjct  1    MGITTFTQEFTTPIAPSRMFKALILDSHNLIPKIAPQGIKNIDFIEGDGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G  LK +K+ ID L+ + L  KYTL+EGD + D++E + YEVKFE ++ GG I K++S+
Sbjct  61   DGGHLKYLKHKIDALDSDNLVCKYTLIEGDVIFDRIESVVYEVKFEASSNGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++K+EEIK GKE+ I +YK VE YL  NP  YA
Sbjct  121  YHTKAGVELKQEEIKQGKEKAIGLYKVVEEYLSANPNVYA  160



>ref|XP_010024741.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61226.1| hypothetical protein EUGRSUZ_H03988 [Eucalyptus grandis]
Length=160

 Score =   197 bits (500),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E T+P+APSR+FKA IVDSHNLIPK+ PQ IK+I+ V+G GG GSIK  NF 
Sbjct  1    MGVTTFTQEFTTPIAPSRMFKALIVDSHNLIPKIAPQGIKNIEFVEGNGGVGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ E L  KYTL+EGD + D++E I YEV+F  +++GG + K+TS+
Sbjct  61   EGGHLKFLKHKIDALDTENLVCKYTLIEGDVIFDKIESIVYEVQFLASSDGGCVCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KE++IK GKE+ + +YK VE YL+ NP  Y 
Sbjct  121  YHTKGDVELKEDDIKQGKEKAMGLYKVVEEYLLANPDIYV  160



>ref|XP_010049778.1| PREDICTED: pathogenesis-related protein STH-2-like [Eucalyptus 
grandis]
 gb|KCW87768.1| hypothetical protein EUGRSUZ_A00141 [Eucalyptus grandis]
Length=160

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M  ++ T E T P+AP+R+FKA I++S+ LIPKL+PQ IKS+++VQG GG GSI+Q+NF 
Sbjct  1    MAATSITQELTCPIAPARMFKALIIESNALIPKLLPQFIKSVELVQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +++ I+EL++E    +YT++EGDAL D+LE I YEVKF+  ++GGS+ K+TSK
Sbjct  61   EASHFKYVRHRINELDKENFVCRYTMIEGDALGDKLESIDYEVKFDAASDGGSVCKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T   F+++EEEIKAGKE+ +A++K VE+YL++NPQAYA
Sbjct  121  YNTKEAFQVEEEEIKAGKEKAMAIFKVVESYLLENPQAYA  160



>gb|AFK42887.1| unknown [Medicago truncatula]
 gb|AES91906.2| pathogenesis-related protein bet V I family protein [Medicago 
truncatula]
Length=160

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E +S VAPSR+F A I+DS NLIPKL+PQ +K ++I++G GG GSI+Q+NF 
Sbjct  1    MGVTTFTHEYSSTVAPSRMFTALIIDSRNLIPKLLPQFVKDVNIIEGDGGAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K  ID L++E L  KYT++EGD L D+LE I YEVKFE T +GG + K+ S 
Sbjct  61   EGSPFKYLKQKIDVLDKENLICKYTMIEGDPLGDKLESIAYEVKFEATNDGGCLCKMASS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+GDF +KEE++K G+E  I +Y+ VE+YL++NPQ YA
Sbjct  121  YKTIGDFDVKEEDVKEGRESTIGIYEVVESYLLENPQVYA  160



>ref|XP_004508179.1| PREDICTED: pathogenesis-related protein STH-2-like [Cicer arietinum]
Length=160

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E +S VAPSR+F A I+DS NL+PKL+PQ +K ++I+QG G  GSI+Q+NF 
Sbjct  1    MGVTTFTHEYSSSVAPSRMFTALIIDSKNLLPKLLPQFVKDVNIIQGDGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K  ID L++E L  KYT++EGD L D+LE I YEVKFE T++GG + K++S 
Sbjct  61   EGSPFKYLKQKIDVLDKENLICKYTMIEGDPLGDKLESIAYEVKFEATSDGGCLCKMSSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+GDF +KEE++K G+E  I +YK VE+YL++NPQ YA
Sbjct  121  YKTIGDFDVKEEDVKEGRESTIGIYKVVESYLLENPQVYA  160



>ref|XP_008353204.1| PREDICTED: major allergen Pru ar 1-like [Malus domestica]
Length=168

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP+ P R+FKA ++D+H LIP+LMP+A+KSID ++G G  GSIK+INF 
Sbjct  1    MGVFTRTDEYTSPIPPDRLFKALVLDAHILIPELMPEAVKSIDTLEGDGRAGSIKKINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDAL-LDQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS LKS+   +DE++EE   Y YTLVEG+ L +++LE ITY+ KFE  ++GGS +++ S
Sbjct  61   EGSQLKSVINRVDEVDEENFVYAYTLVEGEPLVVEKLEYITYKAKFEAASDGGSKNRLVS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
             YYT GD  +KEEEIKAG+E+ + MY+ VE YL+QNP AYA
Sbjct  121  NYYTKGDIVLKEEEIKAGREKALGMYRVVETYLLQNPDAYA  161



>gb|KHN02930.1| Pathogenesis-related protein STH-2 [Glycine soja]
Length=160

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG++T+T E +S VAPSR+FKA IVDS NL+PKL+PQ +K ++++QG G  GSI+Q+NF 
Sbjct  1    MGITTFTQEYSSSVAPSRMFKALIVDSRNLLPKLLPQFVKDVNVIQGDGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E +  K +K+ ID L+++ L  KYT++EGD L D+LE I YEVKFE T++GG + K+TS 
Sbjct  61   EDNPFKYLKHRIDVLDKDNLVCKYTMIEGDPLGDKLESIGYEVKFEATSDGGCLCKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+F +KEEE+K G+E  IA+Y+ VE+YL++NPQ YA
Sbjct  121  YNTIGEFDVKEEEVKEGRESGIAVYRVVESYLLENPQVYA  160



>ref|XP_003609710.1| Pathogenesis-related protein [Medicago truncatula]
 gb|AES91907.1| pathogenesis-related protein bet V I family protein [Medicago 
truncatula]
Length=160

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E +S VAPSR+F A I+DS NLIPKL+PQ +K ++I++G GG GSI+Q+NF 
Sbjct  1    MGVTTFTHEYSSTVAPSRMFTALIIDSRNLIPKLLPQFVKDVNIIEGDGGAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +K  ID L++E L  KYT++EGD L D+LE I YEVKFE T +GG + K+ S 
Sbjct  61   EGNPFKYLKQKIDVLDKENLICKYTMIEGDPLGDKLESIAYEVKFEATNDGGCLCKMASS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+GDF +KEE++K G+E  I +Y+ VE+YL++NPQ YA
Sbjct  121  YKTIGDFDVKEEDVKEGRESTIGIYEVVESYLLENPQVYA  160



>ref|XP_006419469.1| hypothetical protein CICLE_v10007165mg [Citrus clementina]
 gb|ESR32709.1| hypothetical protein CICLE_v10007165mg [Citrus clementina]
 gb|KDO71799.1| hypothetical protein CISIN_1g044920mg [Citrus sinensis]
Length=160

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP++P+R+FKA IVDSHNLIPKLMPQA+KSI+I +G GG GSI+QIN  
Sbjct  1    MGVFTVTDEYTSPISPARLFKALIVDSHNLIPKLMPQAVKSIEIFEGDGGAGSIRQINVV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+ +K  K  +D L+ E  +YKY+L+EGD L+D+LEKI+Y+VKFE TA+GGS + +TS 
Sbjct  61   EGNQVKCSKNRVDALDLENFSYKYSLIEGDVLMDKLEKISYDVKFEPTADGGSKNTMTST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT G+F + EEEIK GKE+ +AMYK VE YL+QNP+ YA
Sbjct  121  YYTKGNFVLTEEEIKEGKEKSLAMYKVVENYLMQNPEEYA  160



>ref|XP_007051017.1| Uncharacterized protein TCM_004731 [Theobroma cacao]
 gb|EOX95174.1| Uncharacterized protein TCM_004731 [Theobroma cacao]
Length=159

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T  VAP+R+FKA I+DS NLIPKLMP++IK+++++ G GG GSIKQ NFP
Sbjct  1    MGVTTYTQEFTCSVAPARMFKALILDSDNLIPKLMPKSIKNVELIHGDGGVGSIKQTNFP  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K  ID L+ +    KYT +EGD + D+LE I+YE+KFE +   G + K+TS 
Sbjct  61   EGSHFKYLKNRIDALDVDNCVCKYTTIEGDVIGDKLESISYELKFEASG-AGCVCKMTSH  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GDF +KEEEIKAGK++ + MYK VE YL+ NP  YA
Sbjct  120  YHTKGDFVLKEEEIKAGKDQAVGMYKVVEEYLLANPNVYA  159



>gb|AFK38659.1| unknown [Lotus japonicus]
Length=160

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E +S +APSR+FKA I+DS NLIPKL+PQ +K + ++QG G  GSI+Q+NF 
Sbjct  1    MGVTTFTHEFSSSIAPSRMFKALIIDSKNLIPKLLPQFVKDVQVIQGEGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K  IDE+++E    KYT++EGD L D+LE I YEVKFE T++GG + K+TS 
Sbjct  61   EASPFKYLKQRIDEVDKENFICKYTMIEGDPLGDKLESIAYEVKFEATSDGGCLCKMTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T GDF+++EE++K GKE  I +YK VE+YL++NPQ YA
Sbjct  121  YKTNGDFEVQEEQVKEGKESTIGIYKVVESYLLENPQVYA  160



>gb|KHN03329.1| Pathogenesis-related protein STH-2 [Glycine soja]
Length=160

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E +S VAPSR+FKA IVDS NL+PKL+PQ +K ++++QG G  GSI+Q+NF 
Sbjct  1    MGVTTFTQEYSSSVAPSRMFKALIVDSRNLLPKLLPQFVKDVNVIQGDGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ ID L+++ L  KYT++EGD L D+L+ I YEVKFE T++GG + K+TS 
Sbjct  61   EASPFKYLKHRIDVLDKDNLVCKYTMIEGDPLGDKLDSIGYEVKFEATSDGGCLCKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+  +KEEE+K G+E  IA+Y+ VE+YL++NPQ YA
Sbjct  121  YNTIGEIDVKEEEVKEGRESGIAVYRVVESYLLENPQVYA  160



>ref|XP_010049211.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW87760.1| hypothetical protein EUGRSUZ_A00133 [Eucalyptus grandis]
Length=160

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG ++ T E T P+A +R+FKA I++++ LIPKL+PQ IKS+++VQG G  GSI+Q+NF 
Sbjct  1    MGATSITQELTCPIAAARMFKALIIEANALIPKLLPQFIKSVELVQGDGAAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +++ IDEL++E    +YT++EGDAL D+LE I YEVKF+  ++GGS+ K+TSK
Sbjct  61   EASHFKYVRHRIDELDKENFVCRYTMIEGDALGDKLESIDYEVKFDAASDGGSVCKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T   F+++EEEIKAGKE+ +A++K VE+YL++NPQAYA
Sbjct  121  YNTKEAFQVEEEEIKAGKEKAMAIFKVVESYLLENPQAYA  160



>ref|XP_010094126.1| Major allergen Pru av 1 [Morus notabilis]
 gb|EXC39745.1| Major allergen Pru av 1 [Morus notabilis]
Length=161

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +  ++ + P+A SRIFKA +VD  NLIPKL+PQ I S+D++QG GG G+I+QINF 
Sbjct  1    MGVLSLAEDFSCPIAASRIFKALMVDQKNLIPKLLPQFIASVDVIQGDGGAGTIEQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFE-KTAEGGSISKVTS  398
            E S  K +K+ IDEL+ E    KY+L+EGD L D+LE I +EVKFE   A+GG + K+TS
Sbjct  61   EASEFKYVKHRIDELDHENFACKYSLIEGDVLGDKLESIDHEVKFEPAAADGGCVCKITS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            KY T GDF + EEEIKAGKE+ +A++K VE+YL +NP AYA
Sbjct  121  KYNTEGDFSVSEEEIKAGKEKAMAIFKVVESYLQENPDAYA  161



>ref|XP_010024746.1| PREDICTED: pathogenesis-related protein STH-2-like [Eucalyptus 
grandis]
 gb|KCW61231.1| hypothetical protein EUGRSUZ_H03993 [Eucalyptus grandis]
Length=160

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG++T+T E T+P+APSR+FKA I+DSHNLIPK+ PQ IKSID ++G GG GSIKQ NF 
Sbjct  1    MGITTFTQEFTTPIAPSRMFKALILDSHNLIPKIAPQGIKSIDFIEGDGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G  L+ +K+ ID L+ + L  KYTL+EGD + D++E + YEVKFE ++ GG I K++S+
Sbjct  61   DGGHLQYLKHKIDALDSDNLVCKYTLIEGDVIFDKIESVVYEVKFEASSNGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++K+EEIK GK++ + +YK VE YL  NP  YA
Sbjct  121  YHTKAGAELKQEEIKQGKDKAMGLYKVVEEYLSANPDVYA  160



>ref|XP_010024749.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61235.1| hypothetical protein EUGRSUZ_H03997 [Eucalyptus grandis]
Length=160

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E T+P+APSR+FKA I+DSHNLIPK+ PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MGVATFTQEFTAPIAPSRMFKALILDSHNLIPKIAPQGIKSIEFIEGDGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ + L  KYTL+EG  + D++E + YEVKFE ++ GG I K++S+
Sbjct  61   EGGHLKCLKHKIDALDLDNLVCKYTLIEGGVIFDKIESVVYEVKFEASSNGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GKE+ + +YK VE YL  NP  YA
Sbjct  121  YHTKTGVELKEEDIKQGKEKAMGLYKVVEEYLSANPDVYA  160



>gb|KCW87753.1| hypothetical protein EUGRSUZ_A00125 [Eucalyptus grandis]
Length=160

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG ++ T E T P+A +R+FKA I++++ LIPKL+PQ IKS+++VQG GG GSI+Q+NF 
Sbjct  1    MGATSITQELTCPIAAARMFKALIIEANALIPKLLPQFIKSVELVQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +++ IDEL+++    +YT++EGDAL D+LE I Y+VKF+  ++GGS+ K+TSK
Sbjct  61   EASHFKYVRHRIDELDKDNFVCRYTMIEGDALGDKLESIDYQVKFDAASDGGSVCKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T   F+++EEEIKAGKE+ +A++K VE+YL++NPQAYA
Sbjct  121  YNTKEAFQVEEEEIKAGKEKAMAIFKVVESYLLENPQAYA  160



>ref|XP_010024742.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61227.1| hypothetical protein EUGRSUZ_H03989 [Eucalyptus grandis]
Length=160

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E T+P+APSR+FKA I+DSHNLIPK+ PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MGVTTFTQEFTAPIAPSRMFKALILDSHNLIPKIAPQGIKSIEFIEGDGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ + L  KYTL+EG  + D++E + YEVKFE ++ GG I K++S+
Sbjct  61   EGGHLKCLKHKIDALDLDNLVCKYTLIEGGVIFDKIESVVYEVKFEASSNGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GKE+ + +YK VE YL  NP  YA
Sbjct  121  YHTKTGVELKEEDIKQGKEKAMGLYKVVEEYLSANPDVYA  160



>ref|XP_007035695.1| Major allergen Pru ar 1 isoform 1 [Theobroma cacao]
 gb|EOY06621.1| Major allergen Pru ar 1 isoform 1 [Theobroma cacao]
Length=160

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++FKA ++DS NLIPK++PQAIKS+  ++G GG G+IKQ+NF 
Sbjct  1    MGVVTYEMEVATTIPPAKMFKAFVLDSDNLIPKILPQAIKSVVTLEGDGGAGTIKQVNFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K  K  ID +++E  T +YT++EGDAL+D LEKI+ E+KFE+ ++GGS+ K +S 
Sbjct  61   EGSQFKYTKQRIDGIDQENFTCRYTVIEGDALMDTLEKISNEIKFEEASDGGSVCKSSSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD  +KEEEIKAGKE+   M+KA+EAYL+ NP AY
Sbjct  121  YYTIGDINIKEEEIKAGKEKASGMFKAIEAYLLANPDAY  159



>ref|XP_011091029.1| PREDICTED: pathogenesis-related protein STH-2-like [Sesamum indicum]
 ref|XP_011091030.1| PREDICTED: pathogenesis-related protein STH-2-like [Sesamum indicum]
 ref|XP_011091031.1| PREDICTED: pathogenesis-related protein STH-2-like [Sesamum indicum]
Length=162

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++ T E +SPVAP R+FKA I+DS+NLIPKL+PQ+IKS+D+++G GG GSI+Q+NF 
Sbjct  1    MGVTSITQEFSSPVAPERLFKALILDSNNLIPKLLPQSIKSVDLLRGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKT--AEGGSISKVT  401
            E S  K +K+ I+EL+++ L  KYT++EGDAL D+LE I YE+KFE +     G + K+T
Sbjct  61   ETSHFKYVKHQINELDKQNLVCKYTMIEGDALGDKLESIVYEIKFEASDINGAGCVCKMT  120

Query  400  SKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            S+Y+T+G +++KEEEIK GKE  + +YK VEA+L++NP  YA
Sbjct  121  SEYHTLGGYEVKEEEIKGGKESAMGIYKVVEAHLLENPHLYA  162



>ref|XP_007224360.1| hypothetical protein PRUPE_ppa020879mg [Prunus persica]
 gb|EMJ25559.1| hypothetical protein PRUPE_ppa020879mg [Prunus persica]
Length=160

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V++ T E   P+AP+R+FKA I+DS NLIP+L+PQ I S+D+ QG GG GSI+Q+NF 
Sbjct  1    MRVTSITQEFLCPIAPARMFKALIIDSKNLIPRLLPQFIASVDVTQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  + +K+ IDEL+++    KYT++EGDAL D+L+ I YEVKFE  ++G SI K+TSK
Sbjct  61   EASHFRYVKHRIDELDQDNFVCKYTMIEGDALGDKLDSIAYEVKFEAASDGSSICKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+F++KEEEI +GK+  + +YK VEAYL++NP  Y+
Sbjct  121  YNTIGEFEVKEEEIISGKKSAMGIYKVVEAYLLENPHVYS  160



>gb|KDO37531.1| hypothetical protein CISIN_1g044703mg [Citrus sinensis]
Length=179

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP++P+R+FKA IVDSHNLIPKLMPQA+KSI+I +G GG GSI+QIN  
Sbjct  1    MGVFTVTDEYTSPISPARLFKALIVDSHNLIPKLMPQAVKSIEIFEGDGGAGSIRQINVV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+ +K  K  +D L+ E  +YKY+L+EGD L+D+LEKI+Y+VKFE TA+GGS + +TS 
Sbjct  61   EGNQVKCSKNRVDALDLENFSYKYSLIEGDVLMDKLEKISYDVKFEPTADGGSKNTMTST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA*DMFLDLVFSQILSNE  227
            YYT G+  + EEEIK GKE+ +AMYK VE YL+QNP+ YA      L FS ++ N+
Sbjct  121  YYTKGNIVLTEEEIKEGKEKSLAMYKVVENYLMQNPEEYA-----SLEFSSLIKNK  171



>ref|XP_010024740.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61225.1| hypothetical protein EUGRSUZ_H03987 [Eucalyptus grandis]
Length=160

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG++T+T E T+P+APSR+FKA I+DSHNLIPK+ PQ IKSID ++G GG GSIKQ NF 
Sbjct  1    MGITTFTQEFTTPIAPSRMFKALILDSHNLIPKIAPQGIKSIDFIEGDGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G  L+ +K+ ID L+ + L  KYTL+EGD + D++E + YEVKFE ++ GG I K++S+
Sbjct  61   DGGHLQYLKHKIDALDSDNLVCKYTLIEGDVIFDKIESVVYEVKFEASSNGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++K++EIK GK++ + +YK VE YL  NP  YA
Sbjct  121  YHTKAGVELKQDEIKQGKDKAMGLYKVVEEYLSANPDVYA  160



>ref|NP_001235344.1| uncharacterized protein LOC100500506 [Glycine max]
 gb|ACU15606.1| unknown [Glycine max]
Length=160

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E +S VAPSR+FKA IVDS NL+PKL+PQ +K +++ QG G  GSI+Q+NF 
Sbjct  1    MGVTTFTQEYSSSVAPSRMFKALIVDSRNLLPKLLPQFVKDVNVTQGDGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ ID L+++ L  KYT++EGD L D+L+ I YEVKFE T++GG + K+TS 
Sbjct  61   EASPFKYLKHRIDVLDKDNLVCKYTMIEGDPLGDKLDSIGYEVKFEATSDGGCLCKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+  +KEEE+K G+E  IA+Y+ VE+YL++NPQ YA
Sbjct  121  YNTIGEIDVKEEEVKEGRESGIAVYRVVESYLLENPQVYA  160



>ref|XP_008340738.1| PREDICTED: major allergen Pru ar 1-like [Malus domestica]
Length=161

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP+ P R+FKA ++D+H LIP+LMP+A+KSID ++G G  GSIK+INF 
Sbjct  1    MGVFTRTDEYTSPIPPDRLFKALVLDAHILIPELMPEAVKSIDTLEGDGRAGSIKKINFH  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDAL-LDQLEKITYEVKFEKTAEGGSISKVTS  398
             GS LKS+   +DE++EE   Y YTLVEG+ L +++LE ITY+ KFE  ++GGS +++ S
Sbjct  61   VGSQLKSVINRVDEVDEENFVYAYTLVEGEPLVVEKLEYITYKAKFEAASDGGSKNRLVS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
             YYT GD  +KEEEIKAG+E+ + MY+ VE YL+QNP AYA
Sbjct  121  NYYTKGDIVLKEEEIKAGREKALGMYRVVETYLLQNPDAYA  161



>ref|XP_010027091.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61217.1| hypothetical protein EUGRSUZ_H03979 [Eucalyptus grandis]
Length=160

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V   +DE +SP+  +R F+A I D HNLIPKLMP+AI SIDIVQG GG G+I QINF 
Sbjct  1    MVVFKLSDEYSSPIPAARFFRALIGDFHNLIPKLMPEAIGSIDIVQGDGGAGTIMQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  L  IK  +D L+EETLT  Y L+EG  L+++ E I YEV FE T +GGS S++ S 
Sbjct  61   EGRELSFIKSRVDMLDEETLTCVYKLIEGSQLMEKFESIAYEVNFEPTPDGGSKSRIAST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT G+F++ EEEIKAG+ER + +Y AVEAYL+QNP AYA
Sbjct  121  YYTKGNFQLNEEEIKAGRERGLGIYIAVEAYLLQNPDAYA  160



>ref|XP_010028225.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW54924.1| hypothetical protein EUGRSUZ_I00894 [Eucalyptus grandis]
Length=160

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG+ T+T E T+ +APSR+FKA I+DSHNLIPK+ PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MGIITFTQEFTTSIAPSRMFKALILDSHNLIPKIAPQGIKSIEFIEGDGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ + L  KYTL+EGD + D++E + YEVKFE ++ GG I K++S+
Sbjct  61   EGGHLKCLKHKIDALDLDNLVCKYTLIEGDVIFDKIESVAYEVKFEASSNGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GKE+ + +YK VE YL  NP  YA
Sbjct  121  YHTKAGVELKEEDIKQGKEKAMGLYKVVEEYLSANPNVYA  160



>ref|XP_008235136.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M   + + E  SPVA +R+FKA I+DSHNLIPKLMPQAIKSI+I+ G GG GSIKQINF 
Sbjct  1    MAAISLSQEFASPVAAARLFKALILDSHNLIPKLMPQAIKSIEIIHGDGGEGSIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +K  ID L+ E L  KYTL+EGD L D+++ ITYEV+FE +  GG   K+ S+
Sbjct  61   EGTRYKYMKNRIDILDVENLVCKYTLIEGDVLEDKIKSITYEVRFEASPNGGCTCKMMSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y   GDF++ EEEI+ GKER + MYK VEAYL ++P AY
Sbjct  121  YQAAGDFEINEEEIRGGKERAMGMYKVVEAYLFESPGAY  159



>ref|NP_001237916.1| uncharacterized protein LOC100527307 [Glycine max]
 gb|ACU16378.1| unknown [Glycine max]
Length=160

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG++T+T E +S VAPS +FKA IVDS NL+PKL+PQ +K ++++QG G  GSI+Q+NF 
Sbjct  1    MGITTFTQEYSSSVAPSPMFKALIVDSRNLLPKLLPQFVKDVNVIQGDGEAGSIEQVNFN  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E +  K +K+ ID L+++ L  KYT++EGD L D+LE I YEVKFE T++GG + K+TS 
Sbjct  61   EDNPFKYLKHRIDVLDKDNLVCKYTMIEGDPLGDKLESIGYEVKFEATSDGGCLCKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+F +KEEE+K G+E  IA+Y+ VE+YL++NPQ YA
Sbjct  121  YNTIGEFDVKEEEVKEGRESGIAVYRVVESYLLENPQVYA  160



>ref|XP_010028230.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW54929.1| hypothetical protein EUGRSUZ_I00900 [Eucalyptus grandis]
Length=160

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+ YT E  +P+APSR+FKA I+DSHNL+PK++PQ IKSI+ ++G GG+GSIKQ NF 
Sbjct  1    MAVTCYTQEFKTPIAPSRMFKALILDSHNLMPKIVPQGIKSIEFIEGDGGSGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+EGD + D++E + YEVKFE +++GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDTIDIENLVCKYTLIEGDVVFDKIESVAYEVKFEASSDGGCMCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GK++ + +YK VE YL+ NP  YA
Sbjct  121  YHTKAGAELKEEDIKQGKDKAMGLYKVVEEYLLANPNVYA  160



>ref|XP_010024747.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61232.1| hypothetical protein EUGRSUZ_H03994 [Eucalyptus grandis]
Length=160

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+  E T+P+APSR+FKA IVDSHNLIPK+ PQ IK I+ V+G GG GSIK  NF 
Sbjct  1    MGVTTFIQEFTTPIAPSRMFKALIVDSHNLIPKIAPQGIKDIEFVEGNGGVGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+  D L+ E L  KYTL+EGD + D++E I YEV+F  ++ GG + K+TS+
Sbjct  61   EGGHLKFLKHKTDALDTENLVCKYTLIEGDVIFDKIESIVYEVQFLASSNGGCLCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KE++IK GKE+ + +YK VE YL+ NP  Y 
Sbjct  121  YHTKGDVELKEDDIKQGKEKAMGLYKVVEEYLLANPDIYV  160



>ref|XP_010028229.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
Length=160

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+ YT E  +P+APSR+FKA I+DSHNL+PK++PQ IKSI+ ++G GG+GSIKQ NF 
Sbjct  1    MAVTCYTQEFKTPIAPSRMFKALILDSHNLMPKIVPQGIKSIEFIEGDGGSGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+EGD + D++E + YEVKFE +++GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDTIDIENLVCKYTLIEGDVVFDKIESVAYEVKFEASSDGGCMCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GK++ + +YK VE YL+ NP  YA
Sbjct  121  YHTKAGAELKEEDIKQGKDKAMGLYKVVEEYLLANPSVYA  160



>gb|KDP27857.1| hypothetical protein JCGZ_18937 [Jatropha curcas]
Length=160

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGVST+T E TSPVAPSR+FKA I+DS+ LIPKL+PQ IKS+DI+QG  G G+I+ + F 
Sbjct  1    MGVSTFTQEYTSPVAPSRMFKALILDSNILIPKLLPQFIKSVDIIQGGQGAGTIELVTFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S LK +K  I+EL+ + L  KYTL+EGD L D+L+ I YEVKFE  ++GGSI K+TS 
Sbjct  61   EASDLKYVKNRIEELDGDNLWCKYTLIEGDPLGDKLDSIAYEVKFEAASDGGSICKITSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+GD+ ++EE IK GKE+   +YK VE+YL++N   YA
Sbjct  121  YITIGDYTIEEEAIKDGKEKAFGIYKVVESYLLENSHVYA  160



>ref|XP_008345225.1| PREDICTED: major allergen Pru ar 1-like [Malus domestica]
Length=160

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M   + + E TSPVA  R+FKA I+DSHNLIPKLMPQAIKSI+I+ G GG GSIKQINF 
Sbjct  1    MSSISLSQEFTSPVAADRLFKALIIDSHNLIPKLMPQAIKSIEIIHGDGGAGSIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +K  ID L+ E L  KYTL+EGD L D+++ I+YEV F+ +  GG   K+ S+
Sbjct  61   EGTRYKYMKNRIDALDVENLVCKYTLIEGDVLADKIKSISYEVSFQASPNGGCTCKMMSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  GD ++ EEEI+ GKER + MYK VEAYL ++P AY
Sbjct  121  YHAAGDLEINEEEIRGGKERAMGMYKVVEAYLFESPGAY  159



>ref|XP_007035697.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
 gb|EOY06623.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
Length=160

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++FKA ++DS NLIPK++PQAIKS ++++G GG GSIK+I F 
Sbjct  1    MGVVTYEMEVATSIPPAKMFKAFVLDSDNLIPKVVPQAIKSSELLEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ ++ +++E  +Y Y+++EGDAL++ LEKI+YE KF    +GGS+ K TSK
Sbjct  61   EGSQFKYVKHKVEGIDKENFSYSYSVIEGDALMNTLEKISYETKFVAGPDGGSVCKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD ++KEE+IKAGKER + MYKAVEAYL+ NP AY
Sbjct  121  YYTIGDIEIKEEQIKAGKERALGMYKAVEAYLLANPDAY  159



>ref|XP_009378740.1| PREDICTED: major allergen Pru ar 1-like [Pyrus x bretschneideri]
Length=160

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M   + + E TSPVA  R+FKA I+DSHNLIPKLMPQAIKSI+I+ G GG GSIKQINF 
Sbjct  1    MSSVSLSQEFTSPVAADRLFKALIIDSHNLIPKLMPQAIKSIEIIHGDGGAGSIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +K  ID L+ + L  KYTL+EGD L D+++ I+YEV F+ +  GG   K+ S+
Sbjct  61   EGTRYKYMKNRIDALDVDNLVCKYTLIEGDVLADKIKSISYEVSFQASPNGGCTCKMMSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  GD ++ EEEI++GKER + MYK VEAYL ++P AY
Sbjct  121  YHAAGDLEINEEEIRSGKERAMGMYKVVEAYLFESPGAY  159



>ref|XP_007199050.1| hypothetical protein PRUPE_ppa018344mg [Prunus persica]
 gb|EMJ00249.1| hypothetical protein PRUPE_ppa018344mg [Prunus persica]
Length=160

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M   + + E  SPVA +R+FKA I+DSHNLIPKLMPQAIKSI+I+ G GG GSIKQINF 
Sbjct  1    MAAISLSQEFASPVAAARLFKALILDSHNLIPKLMPQAIKSIEIIHGDGGEGSIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +K  ID L+ E L  KYTL+EGD L D+++ I YEV+FE +  GG   K+ S+
Sbjct  61   EGTRYKYMKNRIDILDVENLVCKYTLIEGDVLEDKIKSIAYEVRFEASPNGGCTCKMMSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y   GDF++ EEEI+ GKER + MYK VEAYL ++P AY
Sbjct  121  YQAAGDFEINEEEIRGGKERAMGMYKVVEAYLFESPGAY  159



>ref|XP_010103411.1| Major allergen Pru ar 1 [Morus notabilis]
 gb|EXB95730.1| Major allergen Pru ar 1 [Morus notabilis]
Length=171

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+++  E +SPV P  +FKA I+D HNL+ K+MPQAI+SIDIVQG GG G+IKQINF 
Sbjct  1    MGVTSFMQEFSSPVPPHILFKAVILDIHNLVHKVMPQAIESIDIVQGNGGPGTIKQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G+  K +++ ID L+ E    KYTL EGD L +++E I+YEV+FEK +EGG + K+ S+
Sbjct  61   KGTRYKYMRHRIDSLDVENFRCKYTLTEGDVLTEKIEYISYEVEFEKASEGGCVCKMRSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+   DF++ EEEI+ GKER I MY+ VEAYL +NP AY
Sbjct  121  YHIAQDFEIDEEEIRIGKERAIGMYRVVEAYLFENPGAY  159



>ref|XP_007035686.1| MLP-like protein 423 [Theobroma cacao]
 gb|EOY06612.1| MLP-like protein 423 [Theobroma cacao]
Length=160

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+++T E T P+A +R+FKA I++S+ LIPKL+PQ IKS+D++QG GG GSI+Q+NF 
Sbjct  1    MGVTSFTQEFTCPIAAARVFKALIIESNTLIPKLLPQFIKSVDVIQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ IDEL++E L  KYT++EGDAL D+LE I YEVKFE  ++GG I K+TS 
Sbjct  61   EASHFKYVKHRIDELDKENLMCKYTMIEGDALGDKLECIAYEVKFETISDGGCICKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T+G+F++KEEEIKAGK++ + +YK VEAYL++NP  YA
Sbjct  121  YHTLGEFEIKEEEIKAGKDKAMGIYKVVEAYLLENPTVYA  160



>ref|XP_007035698.1| Major allergen Pru ar 1 [Theobroma cacao]
 gb|EOY06624.1| Major allergen Pru ar 1 [Theobroma cacao]
Length=160

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+R+F+A ++DS NLIPK++PQAIKS++ ++G GG G++KQ+NF 
Sbjct  1    MGVFTYEMEVATVIPPARMFQAFVLDSDNLIPKILPQAIKSVETLEGDGGAGTVKQVNFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   K++K  ID +++E  TY YT++EGDAL+  LEKI  E+KF+ + EGGSI K +S 
Sbjct  61   EGYQFKTVKNRIDGIDKEKFTYSYTVIEGDALMSTLEKICNEIKFQASPEGGSICKSSST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD ++K+EEIK+GKE+ + M+KAVEA+L+ NP AY
Sbjct  121  YYTIGDIEIKDEEIKSGKEKALGMFKAVEAHLLANPDAY  159



>ref|XP_007035703.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
 gb|EOY06629.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
Length=160

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++FKA ++D+ NLIPK++PQAIKS ++++G GG GSIK+I F 
Sbjct  1    MGVVTYEMEVATSIPPAKMFKAFVLDADNLIPKVVPQAIKSSELLEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ ++ +++E  +Y Y+++EGDAL++ LEKI+YE KF    +GGS+ K TSK
Sbjct  61   EGSQFKYVKHKVEGIDKENFSYSYSVIEGDALMNTLEKISYETKFVAGPDGGSVCKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD ++KEE+IKAGKER + MYKAVEAYL+ NP AY
Sbjct  121  YYTIGDIEIKEEQIKAGKERALGMYKAVEAYLLANPDAY  159



>ref|XP_010027088.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=156

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  +TD  TS + P R+ KA IVDS NLIPKLMPQAI +IDI+QG GGTGSIKQINF 
Sbjct  1    MGVFIFTDVYTSTIPPKRLSKALIVDSQNLIPKLMPQAINNIDIIQGDGGTGSIKQINFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS L+S+K  +DELNEET TY YT+++   L ++ E I YEVKFE T +G S +K+TS 
Sbjct  61   EGSQLRSMKNRVDELNEETFTYNYTMID---LTEKFESIGYEVKFEPTPDGKSKNKMTST  117

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT G+FK++EE+I   K R + MY+ VEAYL+QNP A A
Sbjct  118  YYTKGNFKLEEEDIGPEK-RTLGMYEVVEAYLLQNPHACA  156



>ref|XP_010024748.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW61233.1| hypothetical protein EUGRSUZ_H03995 [Eucalyptus grandis]
Length=160

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+T+T E T+P+APSR+F A I+DSHNLIPK+ PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MAVTTFTQEFTTPIAPSRMFNALILDSHNLIPKIAPQGIKSIEFIEGNGGVGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+   L  KYTL+EGD + +++E + YEVKFE ++ GG + K++S+
Sbjct  61   EGGHLKYLKHKIDALDSNNLVCKYTLIEGDVIFNKIESVVYEVKFEASSNGGCVCKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+     +++EE+IK GKE+ + +YK VE YL  NP AYA
Sbjct  121  YHLKAGVELREEDIKQGKEKAMGLYKVVEEYLSTNPNAYA  160



>ref|XP_010028231.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 ref|XP_010028232.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW54928.1| hypothetical protein EUGRSUZ_I00898 [Eucalyptus grandis]
Length=160

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+ YT E  +P+APSR+FKA I+DSHNL+PK++PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MAVTCYTQEFKTPIAPSRMFKALILDSHNLMPKIVPQGIKSIEFIEGDGGAGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+EGD + D++E + YEVKFE +++GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDTIDIENLVCKYTLIEGDVVFDKIEFVAYEVKFEASSDGGCMCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GK++ + +YK VE YL+ NP  YA
Sbjct  121  YHTKAGAELKEEDIKQGKDKAMGLYKVVEEYLLANPSVYA  160



>ref|NP_001238264.1| uncharacterized protein LOC100306656 [Glycine max]
 gb|ACU14944.1| unknown [Glycine max]
 gb|KHN14637.1| Pathogenesis-related protein STH-2 [Glycine soja]
Length=160

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG +T+T + +SPVAPSR+FKA I DS  L+PKL+PQ IK ++++QG G  GSI+Q+NF 
Sbjct  1    MGATTFTHDYSSPVAPSRMFKALITDSRTLLPKLLPQIIKEVNLIQGDGEAGSIEQVNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E    K +K+ IDE++++    KYT++EGD L D+LE I YEVKFE T++GG + K+T+K
Sbjct  61   EAFPFKYVKHRIDEVDKDNFVCKYTMIEGDPLEDKLESIAYEVKFEATSDGGCLCKMTTK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y  +G F++KEEEIK G+E  + + K VEAYL++NPQ YA
Sbjct  121  YNVIGGFEVKEEEIKEGRESSLGVCKVVEAYLLENPQVYA  160



>ref|XP_004290824.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V   + E TSPV  +R+FKA I+DSHNLIPKLMPQAIKSI+I++G GG G+IK+INF 
Sbjct  1    MAVINLSQEFTSPVDAARLFKALIIDSHNLIPKLMPQAIKSIEIIEGDGGAGTIKKINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +   ID L+ E L  KYTL+EGD L D++  I YEVKF  +A GG + K+ S+
Sbjct  61   EGTRFKYMINRIDTLDVENLMCKYTLIEGDVLGDKINSIAYEVKFIPSAIGGCVCKMMSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y  VGDF++ EEEI+ GKER + MYK VEAYL ++P AY
Sbjct  121  YQAVGDFEINEEEIRGGKERAMGMYKVVEAYLFESPGAY  159



>ref|XP_010028227.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW54927.1| hypothetical protein EUGRSUZ_I00897 [Eucalyptus grandis]
Length=160

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+ YT E  +P+APSR+FKA I+DSHNL+PK++PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MAVTCYTQEFKTPIAPSRMFKALILDSHNLMPKIVPQGIKSIEFIEGDGGAGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+EGD + D++E + YEVKFE +++GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDTIDIENLVCKYTLIEGDVVFDKIEFVAYEVKFEASSDGGCMCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GK++ + +YK VE YL+ NP  YA
Sbjct  121  YHTKAGAELKEEDIKQGKDKAMRLYKVVEEYLLANPSVYA  160



>gb|KEH37168.1| pathogenesis-related protein bet V I family protein [Medicago 
truncatula]
Length=160

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M VST+T++ +SP+APSR+FKA I DS NL+PKL+PQ IK ++++QG G  G+I+Q+NF 
Sbjct  1    MVVSTFTNDYSSPIAPSRMFKALITDSSNLLPKLLPQFIKDVNLIQGNGEAGTIEQVNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K  ID ++ + L   YT++EGD L D+LE I YEVKFE   +GG + K+TSK
Sbjct  61   EASPFKYLKNRIDMIDNDNLVCNYTMIEGDPLGDKLESIAYEVKFEAIDDGGCLCKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y  +GDF++KEEEIK G+E  I + K VEAYL++NPQ Y
Sbjct  121  YNAIGDFEVKEEEIKEGRENSIGICKVVEAYLLENPQVY  159



>ref|XP_002273952.1| PREDICTED: major allergen Pru ar 1 [Vitis vinifera]
 emb|CBI22940.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG  TY  E TS + P+++FKA ++D  NLIPK++PQAIK ++I++G GG G+IK+INF 
Sbjct  1    MGAITYEMEVTSSIPPAKMFKAFVLDVDNLIPKVLPQAIKCVEIIEGDGGPGTIKKINFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K++ID L++E  TY YT++EGDAL+D LE I YEVK   + +GGSI K  SK
Sbjct  61   EGSQFNYVKHWIDSLDKENFTYCYTIIEGDALMDNLESIYYEVKLVASPDGGSICKNISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ E++IKAGKE+ + M+KA+EAYL+ NP AY
Sbjct  121  YHTKGDIQITEDQIKAGKEKAMGMFKAIEAYLLANPDAY  159



>ref|XP_010024750.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW61236.1| hypothetical protein EUGRSUZ_H03998 [Eucalyptus grandis]
Length=160

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V++YT E T+P+APSR+FKA I+DSHNL+PK++PQ IKSI+ +QG GG GSIKQ NF 
Sbjct  1    MAVTSYTQEFTTPIAPSRMFKALILDSHNLMPKIVPQGIKSIEFLQGNGGAGSIKQTNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+E D + D++E + YEVKFE T  GG + K+TS+
Sbjct  61   EGGHLKFLKHRIDAIDAENLVCKYTLIESDVIFDKIEFVVYEVKFEATDNGGCVCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GK++ + +YK VE YL  NP  Y 
Sbjct  121  YHTRAGVELKEEDIKQGKDKAMGLYKVVEEYLSVNPGVYC  160



>ref|XP_002273790.2| PREDICTED: major allergen Pru ar 1 [Vitis vinifera]
 emb|CBI22941.3| unnamed protein product [Vitis vinifera]
Length=158

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TYTDE TSPV   R+FKA I+++ +L+PK++PQAIKSI+ V+G GG G+IKQ+NF 
Sbjct  1    MGVVTYTDELTSPVPAPRLFKALILEADSLLPKIVPQAIKSIETVEGNGGPGTIKQLNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ IDEL++E + YKYTL+EGDAL+D++E I+YE+ FE + +GG  SK  S 
Sbjct  61   EGSQFKYVKHRIDELDKEKMIYKYTLIEGDALMDKIEYISYEISFEASPDGGCKSKNVSV  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            Y++    ++KEEEIK GKE+  A++KAVEAYL+ NP A
Sbjct  121  YHSKPGVEIKEEEIKDGKEKAAAVFKAVEAYLLANPDA  158



>ref|XP_007035693.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
 gb|EOY06619.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
Length=160

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++FKA ++D+ NLIPK++PQAIKS ++++G GG GSIK+I F 
Sbjct  1    MGVVTYEMEVATSIPPAKMFKAFVLDADNLIPKVVPQAIKSSELLEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ ++ +++E  +Y Y+++EGDAL++ LEKI+YE KF    +GGS+ K T K
Sbjct  61   EGSQFKYVKHKVEGIDKENFSYSYSVIEGDALMNTLEKISYETKFAAGPDGGSVCKSTGK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD ++KEE+IKAGKER + MYKAVEAYL+ NP AY
Sbjct  121  YYTIGDTEIKEEQIKAGKERALGMYKAVEAYLLANPDAY  159



>gb|EYU43988.1| hypothetical protein MIMGU_mgv1a015369mg [Erythranthe guttata]
Length=160

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+    E TSPV+P R+FKA I++S NLIPKL+PQ IKSID ++G+GG+GSI+Q+NF 
Sbjct  1    MGVTKINQEFTSPVSPGRLFKALILESSNLIPKLLPQFIKSIDTLEGSGGSGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K  I+EL++E    KYT++EGDAL D+L+ I YE+KFE +   GSI K+TS+
Sbjct  61   ESSHFKYVKNRINELDKENYVCKYTMIEGDALGDKLKYIEYEIKFELSDNRGSICKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+TVG +++ EEEIK GKE  + +YK VEAYL++NP  YA
Sbjct  121  YHTVGSYEIDEEEIKGGKESAMGIYKVVEAYLLENPHIYA  160



>ref|XP_007138954.1| hypothetical protein PHAVU_009G252300g [Phaseolus vulgaris]
 gb|ESW10948.1| hypothetical protein PHAVU_009G252300g [Phaseolus vulgaris]
Length=160

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG +T+T + +SPVAPSR+FKA I DS  L+PKL+PQ IK ++++QG G  G+I+Q+NF 
Sbjct  1    MGGTTFTYDYSSPVAPSRMFKALITDSKTLLPKLLPQFIKEVNLIQGDGEAGTIEQVNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ IDE+++E L  KYT++EG  L ++LE I YEV FE T++GG + K+TSK
Sbjct  61   EASPFKYVKHRIDEVDKEKLVCKYTMIEGGPLGEKLESIAYEVNFEATSDGGCLCKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y  +GDF++KEEEIK G+E  + + K VEAYL+QNPQ YA
Sbjct  121  YNVIGDFEVKEEEIKEGRESSLGVCKVVEAYLLQNPQVYA  160



>gb|KCW61030.1| hypothetical protein EUGRSUZ_H03792 [Eucalyptus grandis]
Length=181

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -3

Query  718  PVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLKSIKYYI  539
            P+  +R F+A I D HNLIPKLMP+AI+SIDIVQG GG G+I QINF EG  L  IK  +
Sbjct  34   PIPAARFFRALIGDFHNLIPKLMPEAIESIDIVQGDGGAGTIMQINFTEGGELSFIKSRV  93

Query  538  DELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGDFKMKEE  359
            D L+EETLT  Y L+EG  L+++ E I YEV FE T +GGS S++ S YYT GDF++ EE
Sbjct  94   DVLDEETLTCVYRLIEGSQLMEKFESIAYEVNFEPTPDGGSKSRIASTYYTKGDFQLNEE  153

Query  358  EIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            EIKAG+ER + +Y AVEAYL+QNP AYA
Sbjct  154  EIKAGRERGLGIYIAVEAYLLQNPDAYA  181



>emb|CAN67367.1| hypothetical protein VITISV_007417 [Vitis vinifera]
Length=159

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E  S + P++IFKA I+DS NLIPK++PQAIK ++I++G GG GSIK+I F 
Sbjct  1    MGVISYEHEIISSIPPAKIFKAFILDSDNLIPKVLPQAIKCVEIIEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D +++E  TY Y+L+EGDAL+  LE I+YEVK   +  GGSI K TSK
Sbjct  61   EGSQFNYVKHRVDGIDKENFTYSYSLIEGDALMGTLESISYEVKLVASPNGGSICKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GDF++ E++IKAGKE+ + ++KAVEAYL+ NP AY
Sbjct  121  YHTKGDFEITEDQIKAGKEKAMGLFKAVEAYLLANPDAY  159



>ref|XP_004296883.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++ + E   P+APSR+FKA I+DS NLIPKL+PQ I S+++ QG GG GSI+Q+NF 
Sbjct  1    MGVTSISQEFLCPIAPSRMFKALIIDSKNLIPKLLPQFIASVEVTQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ IDEL+++    KYT++EGDAL D+LE I YEVKFE  ++G SI K+TS 
Sbjct  61   EGSHFKYVKHRIDELDQDNFVCKYTMIEGDALGDKLESIGYEVKFEAASDGSSICKMTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y  +G+ ++KEEEI AGK   + +Y+ VE +L++NP  Y+
Sbjct  121  YNPIGEAEVKEEEIIAGKNSAMGIYEVVETFLVENPNVYS  160



>ref|XP_010024739.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=160

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E  + +APSR+FKA IVDSHNLIPK+ PQ IKSI  V+G GG GSIK  NF 
Sbjct  1    MGVTTFTQEFPTLIAPSRMFKALIVDSHNLIPKIAPQGIKSIKFVEGDGGAGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ E L  KYTL+EGD + D++EK+ YEV+F   + GG + K+ S+
Sbjct  61   EGGHLKILKHKIDFLDTENLVCKYTLIEGDVIFDKIEKVVYEVQFLALSNGGCVCKMISE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+  GD ++ EE+IK GKE+ + +YK VE +L+ NP AYA
Sbjct  121  YHAKGDVEINEEDIKQGKEKAMGLYKVVEEFLLANPDAYA  160



>gb|AFF59689.1| Bet v 1 allergen [Quercus suber]
Length=160

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+R+FKA +VD+ NLIPK+ PQAIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTYESENTSAIPPARLFKAFVVDADNLIPKVAPQAIKSTEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ +DE+N E  T+ Y+++EGDAL D LEKI+YE K   + +GGSI K TSK
Sbjct  61   EGSQFKYVKHRVDEVNHEHFTFAYSVIEGDALSDMLEKISYETKIVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++KAVE YL+ +P  Y
Sbjct  121  YHTKGDHEIKEEQVKAGKEKASGLFKAVEGYLLAHPDLY  159



>gb|KCW54931.1| hypothetical protein EUGRSUZ_I00902, partial [Eucalyptus grandis]
Length=156

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V+ YT E  +P+APSR+FKA I+DSHNL+PK++PQ IKSI+ ++G GG+GSIKQ NF 
Sbjct  1    MAVTCYTQEFKTPIAPSRMFKALILDSHNLMPKIVPQGIKSIEFIEGDGGSGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+EGD + D++E + YEVKFE +++GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDTIDIENLVCKYTLIEGDVVFDKIESVAYEVKFEASSDGGCMCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNP  287
            Y+T    ++KEE+IK GK++ + +YK VE YL+ NP
Sbjct  121  YHTKAGAELKEEDIKQGKDKAMGLYKVVEEYLLANP  156



>ref|XP_010028226.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW54926.1| hypothetical protein EUGRSUZ_I00896 [Eucalyptus grandis]
Length=160

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V++YT E  +P+APSR+FKA I+DSHNL+PK++PQ IKSI+ ++G GG GSIKQ NF 
Sbjct  1    MAVTSYTQEFITPIAPSRMFKALIIDSHNLMPKIVPQGIKSIEFIEGDGGAGSIKQTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL++GD + D++E + YEVKFE +++GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDAIDIENLVCKYTLIDGDVVFDKIEYVAYEVKFEDSSDGGCMCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++ EE+IK GK++ + +YK VE YL+ NP  YA
Sbjct  121  YHTKAGAELIEEDIKQGKDKAMGLYKVVEEYLLANPDVYA  160



>ref|XP_010245453.1| PREDICTED: major allergen Pru ar 1-like [Nelumbo nucifera]
Length=160

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV        + V+PSR+FKA I+DSHNL PKLM  +I++I+ ++G G  GSIKQINF 
Sbjct  1    MGVIRINQTFATRVSPSRLFKALILDSHNLCPKLMFASIRNIEFLEGDGDVGSIKQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  + +K+ IDEL++E  T KYTL+EGDAL ++LE ITYEVKFE  A GG I K++S+
Sbjct  61   EASPYRYVKHRIDELDKENFTCKYTLIEGDALAEKLESITYEVKFEANAWGGCICKMSSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y T+GD ++KEEEI+ GK+R I MY+ VEAYL+ +P AY
Sbjct  121  YRTIGDVEVKEEEIEDGKDRAIGMYEVVEAYLLAHPNAY  159



>emb|CAN79558.1| hypothetical protein VITISV_025732 [Vitis vinifera]
Length=159

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+++FKA I+DS  LIPK++PQAIKS +I++G GG GSIK+I F 
Sbjct  1    MGVITYEHEXTSSIPPAKMFKAFILDSDKLIPKILPQAIKSTEIIEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D +++E  TY Y+++EGDAL+  LE I+YEVK   +  GGSI K TSK
Sbjct  61   EGSQFNYVKHRVDGIDKENFTYSYSVIEGDALMGTLESISYEVKLVASPSGGSICKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GDF++ E++IKAGKE+ + ++KAVEAYL+ NP AY
Sbjct  121  YHTKGDFEITEDQIKAGKEKALGLFKAVEAYLLANPDAY  159



>ref|XP_010024744.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61230.1| hypothetical protein EUGRSUZ_H03992 [Eucalyptus grandis]
Length=160

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E  + +APSR+FKA IVDSHNLIPK+ PQ IKSI+ V+G GG GSIK  NF 
Sbjct  1    MGVTTFTQEFPTLIAPSRMFKALIVDSHNLIPKIAPQDIKSIEFVEGDGGAGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ E L  KYTL+EGD + +++EK+ YEV+F  ++ GG I K+ S+
Sbjct  61   EGGHLKFLKHKIDFLDTENLVCKYTLIEGDVIFNKIEKVIYEVQFLASSNGGCICKMISE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+  GD ++ EE+IK GKE+   +YK VE +L+ NP AYA
Sbjct  121  YHAKGDVELNEEDIKRGKEKATGLYKVVEEFLLANPDAYA  160



>ref|XP_007035700.1| Major allergen Pru ar 1, putative isoform 1 [Theobroma cacao]
 gb|EOY06626.1| Major allergen Pru ar 1, putative isoform 1 [Theobroma cacao]
Length=209

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  +  + + P+R+F+A ++DS NLIPK++PQAIKS++ ++G GG G+ KQ+NF 
Sbjct  50   MGVFTYEMKVATVIPPARMFQAFVLDSDNLIPKILPQAIKSVETLEGDGGAGTAKQVNFG  109

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K++K  ID +++E  TY YT++EGDAL++ LEKI  E+KF+ + EGGSI K +S 
Sbjct  110  EGSQFKTVKNRIDGIDKEKFTYSYTVIEGDALMNTLEKICNEIKFQASPEGGSICKSSST  169

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD ++K+EEIK+GKE+   M+KAVEA+L+ NP  Y
Sbjct  170  YYTIGDIEIKDEEIKSGKEKASGMFKAVEAHLLANPDTY  208



>ref|XP_002273982.1| PREDICTED: major allergen Pru ar 1 [Vitis vinifera]
 emb|CBI22939.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E  S + P++IFKA I+DS NLIPK++PQAIK ++I++G GG GSIK+I F 
Sbjct  1    MGVISYEHEIISSIPPAKIFKAFILDSDNLIPKVLPQAIKCVEIIEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D +++E  TY Y+++EGDAL+  LE I+YEVK   +  GGSI K TSK
Sbjct  61   EGSQFNYVKHRVDGIDKENFTYSYSVIEGDALMGTLESISYEVKLVASPSGGSICKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GDF++ E++IKAGKE+ + ++KAVEAYL+ NP AY
Sbjct  121  YHTKGDFEITEDQIKAGKEKALGLFKAVEAYLLANPDAY  159



>ref|XP_010024743.1| PREDICTED: pathogenesis-related protein STH-21-like [Eucalyptus 
grandis]
 gb|KCW61228.1| hypothetical protein EUGRSUZ_H03990 [Eucalyptus grandis]
Length=160

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V++YT E T+ +APSR+FKA I+DSHNL+PK++PQ IKSI+ +QG GG GSIKQ NF 
Sbjct  1    MAVTSYTQEFTTLIAPSRMFKALILDSHNLMPKIVPQGIKSIEFLQGNGGAGSIKQTNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID ++ E L  KYTL+E D +LD++E + YEV FE T  GG + K+TS+
Sbjct  61   EGGHLKYLKHRIDAIDAENLVCKYTLIESDVILDKIEFVAYEVNFEATDNGGCVCKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T    ++KEE+IK GK++ + +YK VE YL  NP  Y 
Sbjct  121  YHTRAGVELKEEDIKQGKDKAMGLYKVVEEYLSVNPGVYC  160



>ref|XP_009347380.1| PREDICTED: major allergen Pru ar 1-like [Pyrus x bretschneideri]
Length=160

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV++ T E   P+AP+R+FKA I+DS NLIPKL+PQ I S+D+ QG GG GSI+Q+NF 
Sbjct  1    MGVTSITQEFLCPIAPARMFKALIIDSKNLIPKLLPQFIASVDVTQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  + +K+ IDEL+ E    KYT++EGDAL ++LE I YEVKFE  ++G SI K+TSK
Sbjct  61   EGSHFRYVKHRIDELDVENFVCKYTMIEGDALGEKLESIAYEVKFEAASDGSSICKMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G+ ++KEEEI AGK   I +YK VEAYL++NP  Y+
Sbjct  121  YNTIGEVEVKEEEIIAGKNSAIGIYKVVEAYLLENPNVYS  160



>emb|CAN75490.1| hypothetical protein VITISV_017149 [Vitis vinifera]
Length=159

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY +E TS + P+++FKA+I+DS NLIPK  PQAIKS++I+QG GG G+IK+I+F 
Sbjct  1    MGVFTYENEVTSSIPPAKMFKAAILDSDNLIPKARPQAIKSVEIIQGEGGPGTIKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  TY Y+++EGDAL+  LE I+YEVK   + +GGSI K  SK
Sbjct  61   EGSQFKSVTHRVDGIDKENFTYSYSIIEGDALMGILESISYEVKLVASPDGGSICKNISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T  D  + EE+IKAGKE+   M+KA+EAYL+ NP AY
Sbjct  121  YHTKDDAVIDEEQIKAGKEKASGMFKAIEAYLLANPDAY  159



>ref|XP_009793804.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
sylvestris]
Length=160

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E ++ VAP+R+FKA ++D+ NLIPKLMPQ +K+I+ V+G GG GSIK++NF 
Sbjct  1    MGVTTYTHEASTTVAPTRLFKALVLDADNLIPKLMPQVVKNIETVEGDGGVGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ +  ++++ L  KY+L+EGD L D+LE ITY+VKFE +A GG I K +++
Sbjct  61   EGGPIKYLKHKLHVIDDKNLVTKYSLIEGDVLGDKLESITYDVKFETSANGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GK++ + ++KAVE YLI NP  YA
Sbjct  121  YHTKGDYVFKEEEHNEGKDKALELFKAVEDYLIANPTVYA  160



>ref|XP_008223262.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=217

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V++ T E   P+AP+R+FKA I+DS NLIP+L+PQ I S+D+ QG GG GSI+Q+NF 
Sbjct  35   MDVTSITQEFLCPIAPARMFKALIIDSKNLIPRLLPQFIASVDVTQGDGGAGSIEQVNFT  94

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  + +K+ IDEL+++    KYT++EGDAL D+L+ I YEVKFE  ++G SI K+TSK
Sbjct  95   EASHFRYVKHRIDELDQDNFVCKYTMIEGDALGDKLDSIAYEVKFEAASDGSSICKMTSK  154

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA*DMFLDLVFSQ  242
            Y T+G+F++KEEEI +GK   + +YK VEAYL+     Y+ +  L  +  Q
Sbjct  155  YNTIGEFEVKEEEIISGKNSAMGIYKVVEAYLLSAMGIYSYNCLLLYIHKQ  205



>gb|AFF59687.1| Bet v 1 allergen [Quercus suber]
Length=160

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+R+FKA +VD+ NLIPK+ PQAIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTYETENTSAIPPARLFKAFVVDADNLIPKVAPQAIKSTEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ +DE+N E  T+ Y+++EGDAL D LEKI+YE K   + +GGSI K TSK
Sbjct  61   EGSQFKYVKHRVDEVNHEHFTFAYSVIEGDALSDMLEKISYETKIVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++KAVE YL+ +   Y
Sbjct  121  YHTKGDHEIKEEQVKAGKEKASGLFKAVEGYLLAHSDVY  159



>ref|XP_007035701.1| Major allergen Pru ar 1, putative isoform 2 [Theobroma cacao]
 gb|EOY06627.1| Major allergen Pru ar 1, putative isoform 2 [Theobroma cacao]
Length=209

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  +  + + P+R+F+A ++DS NLIPK++PQAIKS++ ++G GG G+ KQ+NF 
Sbjct  50   MGVFTYEMKVATVIPPARMFQAFVLDSDNLIPKILPQAIKSVETLEGDGGAGTAKQVNFG  109

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG   K++K  ID +++E  TY YT++EGDAL++ LEKI  E+KF+ + EGGSI K +S 
Sbjct  110  EGYQFKTVKNRIDGIDKEKFTYSYTVIEGDALMNTLEKICNEIKFQASPEGGSICKSSST  169

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GD ++K+EEIK+GKE+   M+KAVEA+L+ NP  Y
Sbjct  170  YYTIGDIEIKDEEIKSGKEKASGMFKAVEAHLLANPDTY  208



>gb|AFK45365.1| unknown [Lotus japonicus]
Length=160

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T + ++PVAPSR+FKA I DS  L+PKL+PQ IK + ++QG G  GSI+QINF 
Sbjct  1    MGVTTFTHDFSTPVAPSRMFKALITDSRALLPKLLPQFIKDVTLIQGNGEAGSIEQINFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ I+ ++   L   YT++EGD L D+LE I YEVKFE T++GGS  ++TSK
Sbjct  61   EGSPFKYLKHRIEMVDNNNLLCNYTMIEGDPLGDKLESIAYEVKFEATSDGGSHCEMTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T+G ++++EEEIK G E  I + K VE YL++NPQ YA
Sbjct  121  YNTIGGYEVREEEIKEGNESSIGICKVVEKYLLENPQVYA  160



>gb|AIX10939.1| putative pathogenesis-related protein [Gardenia jasminoides]
Length=161

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TSPV P+++FKA I+D  NL+PK+MP+AIKS++I+ G GG G+IK  +F 
Sbjct  1    MGVITYDYELTSPVPPAKLFKACILDFDNLLPKIMPEAIKSVEILHGDGGAGTIKVTHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTL--VEGDALLDQLEKITYEVKFEKTAEGGSISKVT  401
            EGS  KS+K+ +DEL++E   YKYT+  VEGD L D +EK++YE +FE +A+GGSI+K  
Sbjct  61   EGSQFKSMKHCVDELDKEKFVYKYTVSEVEGDTLKDVIEKVSYETRFEASADGGSITKNK  120

Query  400  SKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            S Y+  GD K+ E+EIK+GKE+ + ++KAVEA+L+ +P AY
Sbjct  121  STYHLKGDAKITEKEIKSGKEKAVGVFKAVEAHLLAHPDAY  161



>gb|AFF59688.1| Bet v 1 allergen [Quercus suber]
Length=160

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+  E TS + P+R+FKA +VD+ NLIPK+ PQAIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTHESENTSAIPPARLFKAFVVDADNLIPKVAPQAIKSTEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ +DE+N E  T+ Y+++E DAL D LEKI+YE K   + +GGSI K TSK
Sbjct  61   EGSQFKYVKHRVDEVNHEHFTFAYSVIEDDALSDMLEKISYETKIVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++KAVE YL+ +P  Y
Sbjct  121  YHTKGDHEIKEEQVKAGKEKASGLFKAVEGYLLAHPDLY  159



>gb|ACJ23865.1| Fag s 1 pollen allergen [Fagus sylvatica]
Length=160

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E T+ + P+R+FKA ++D+ NLIPK+ PQAIKS +I++G+GG G+IK+I F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ IDE++    TY YTL+EGDA+ + LEKI YE+K   + +GGSI K TSK
Sbjct  61   EGSQFNYMKHRIDEIDNANFTYAYTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KE++IKAGKE    ++KAVEAYL+ NP AY
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY  159



>gb|KCW61224.1| hypothetical protein EUGRSUZ_H03986 [Eucalyptus grandis]
Length=158

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E  + +APSR+FKA IVDSHNLIPK+ PQ IKSI  V+G GG GSIK  NF 
Sbjct  1    MGVTTFTQEFPTLIAPSRMFKALIVDSHNLIPKIAPQGIKSIKFVEGDGGAGSIKVTNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  LK +K+ ID L+ E L  KYTL+EGD + D++EK+ YEV+F   + GG + K+ S+
Sbjct  61   EGGHLKILKHKIDFLDTENLVCKYTLIEGDVIFDKIEKVVYEVQFLALSNGGCVCKMISE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+  GD  + EE+IK GKE+ + +YK VE +L+ NP AYA
Sbjct  121  YHAKGD--INEEDIKQGKEKAMGLYKVVEEFLLANPDAYA  158



>ref|XP_007035690.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007035691.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY06616.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY06617.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=158

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++F+A ++D   LIPK++P+AIKS++I++G GG GSIK++ F 
Sbjct  1    MGVFTYESEIVTAIPPAKMFQALVLDGDKLIPKIVPKAIKSVEIIEGDGGPGSIKKLTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +GS  K +K+ ++ ++++  TY YT++EGDAL++  EKI+YE K E + +GGSI K TSK
Sbjct  61   DGSQFKYVKHKVESVDKDNFTYCYTVIEGDALMNAFEKISYETKLEPSPDGGSICKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            YYT+GDF++KEEEIK+GKE+ + ++KA+EAYL+ NP A
Sbjct  121  YYTIGDFEIKEEEIKSGKEKALGLFKAIEAYLLANPDA  158



>gb|AFF59690.1| Bet v 1 allergen [Quercus suber]
Length=160

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+R+FKA +VD+ NLIPK+ PQAIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTYETENTSAIPPARLFKAFVVDADNLIPKVAPQAIKSTEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +++ +DE+N E  T+ Y+++EGDAL D LEKI+YE K   + +GGSI K TSK
Sbjct  61   EGSQFKYVRHRVDEVNHEHFTFAYSVIEGDALSDMLEKISYETKIVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++KAVE YL+ +   Y
Sbjct  121  YHTKGDHEIKEEQVKAGKEKASGLFKAVEGYLLAHSDPY  159



>ref|XP_004487809.1| PREDICTED: pathogenesis-related protein STH-2-like [Cicer arietinum]
Length=160

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T + +SP+APSR+FKA I DS NL+PKL+PQ IK ++++QG G  G+I+Q+NF 
Sbjct  1    MGVTTFTHDYSSPIAPSRMFKALITDSSNLLPKLLPQFIKDVNLIQGNGEPGTIEQVNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            + S  K +K  ID ++ + L   YT++EGD L D+ E I YEVKFE  ++GG + K+ SK
Sbjct  61   KASPFKYLKNRIDMIDNDNLVCNYTMIEGDPLGDKFESIAYEVKFEAISDGGCLCKMISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y  +G+F++KEEEIK G+E  I + K VEAYL++NPQ Y
Sbjct  121  YNAIGEFEVKEEEIKEGRESSIGICKVVEAYLMENPQVY  159



>ref|XP_007223634.1| hypothetical protein PRUPE_ppa012649mg [Prunus persica]
 gb|ACE80950.1| putative allergen Pru p 1.06B [Prunus dulcis x Prunus persica]
 gb|EMJ24833.1| hypothetical protein PRUPE_ppa012649mg [Prunus persica]
Length=160

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y YTLVEGDAL D++EKITYE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYNYTLVEGDALSDKVEKITYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_010027042.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=181

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  700  IFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLKSIKYYIDELNEE  521
            +F+A I D HNLIPKLMP+AI+SIDIVQG GG G+I QINF EG  L  IK  +D L+EE
Sbjct  40   VFRALIGDFHNLIPKLMPEAIESIDIVQGDGGAGTIMQINFTEGGELSFIKSRVDVLDEE  99

Query  520  TLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGDFKMKEEEIKAGK  341
            TLT  Y L+EG  L+++ E I YEV FE T +GGS S++ S YYT GDF++ EEEIKAG+
Sbjct  100  TLTCVYRLIEGSQLMEKFESIAYEVNFEPTPDGGSKSRIASTYYTKGDFQLNEEEIKAGR  159

Query  340  ERVIAMYKAVEAYLIQNPQAYA  275
            ER + +Y AVEAYL+QNP AYA
Sbjct  160  ERGLGIYIAVEAYLLQNPDAYA  181



>ref|XP_007099604.1| Uncharacterized protein TCM_046315 [Theobroma cacao]
 gb|EOY20426.1| Uncharacterized protein TCM_046315 [Theobroma cacao]
Length=159

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+R+FKA I+D   LIPK++PQA KS++ ++G G  GSIK++ F 
Sbjct  1    MGVFTYESEVVTTIPPARMFKACILDGDKLIPKIVPQAFKSVEYIEGNGEPGSIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K  ++ L++E   Y Y+++EGDAL++ LEKITYE K E +  GGS+ K TSK
Sbjct  61   EGSQFNYMKQKVEALDKENFVYSYSVIEGDALMNMLEKITYETKLEPSPAGGSLCKTTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT GDF++KEE +KAGKE+ + M+KAVEAYL+ NP AY
Sbjct  121  YYTKGDFELKEEGVKAGKEKALGMFKAVEAYLLANPGAY  159



>ref|XP_008223267.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS +AP R+FKA ++D+ NL+PK+ PQA+KS +IV+G GG G+IK+ +F 
Sbjct  1    MGVFTYETEFTSVIAPPRLFKALVLDADNLVPKIAPQAVKSAEIVEGDGGVGTIKKTSFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D L+++   Y Y+L+EGDAL D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSEYSYVKHQVDALDKDNFVYSYSLIEGDALSDKIEKISYEIKLVASADGGSIIKNTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKER  A++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEHVKAGKERAHALFKVIETYLVANPDAY  159



>ref|XP_004487814.1| PREDICTED: pathogenesis-related protein STH-2-like [Cicer arietinum]
Length=160

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T + +SP+APSR+FKA I DS NL+PKL+PQ IK ++++QG G  G+I Q+NF 
Sbjct  1    MGVTTFTHDYSSPIAPSRMFKALITDSSNLLPKLLPQFIKDVNLIQGNGEPGTIDQVNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            + S  K +K  ID ++ + L   YT++EGD L D+ E I YEVKFE  ++GG + K+ SK
Sbjct  61   KASPFKYLKNRIDMIDNDNLVCNYTMIEGDPLGDKFESIAYEVKFEAISDGGCLCKMISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y  +G+F++KEEEIK G+E  I + K VEAYL++NPQ Y
Sbjct  121  YNAIGEFEVKEEEIKEGRESSIGICKVVEAYLMENPQVY  159



>gb|ACE80949.1| putative allergen Pru du 1.06B [Prunus dulcis x Prunus persica]
Length=160

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKITYE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYNYSLVEGDALSDKVEKITYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_008223270.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY DE TS + P R+FKA ++++  LIPK+ P A+KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYADESTSVIPPPRLFKALVLEADTLIPKIAPHAVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +AEGGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASAEGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>gb|ACE80953.1| putative allergen Pru p 1.06C [Prunus dulcis x Prunus persica]
Length=160

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y YTLVEGDAL D++EKI+YE+K   +A+GGSI K +S 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYTLVEGDALSDKVEKISYEIKLVASADGGSIIKSSSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTAGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_009591007.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E ++ VAP+R+FKA ++D+ NLIPKLMPQ +K+I+IV+G GG GSIK++NF 
Sbjct  1    MGVTTYTHEASTTVAPTRLFKALVLDADNLIPKLMPQVVKNIEIVEGDGGVGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ +  ++++ L  KY+L+EGD L D+LE ITY+VKFE +A GG I K +++
Sbjct  61   EGGPIKYLKHKLHVIDDKNLVTKYSLIEGDVLGDKLESITYDVKFETSANGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GKE+ + ++K VE YL+ N   YA
Sbjct  121  YHTKGDYVFKEEEHNEGKEKAMELFKVVEDYLLANSTVYA  160



>ref|XP_002274108.2| PREDICTED: major allergen Pru ar 1 [Vitis vinifera]
Length=159

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+++FKAS++D+ NLIPK++PQAIK+++I+QG GG G+IK+I F 
Sbjct  1    MGVITYEMEVTSSIPPAKMFKASVLDADNLIPKILPQAIKNVEIIQGDGGPGTIKKIYFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  TY Y+++EGDAL+  LE I+YEVK   + +GGSI K  SK
Sbjct  61   EGSQFKSVTHRVDGIDKENFTYSYSIIEGDALMGILESISYEVKLVASPDGGSICKNISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T  D  + EE+IKAGKE+   M+KA+EAYL+ NP AY
Sbjct  121  YHTKDDAVIDEEQIKAGKEKASGMFKAIEAYLLANPDAY  159



>ref|XP_007225603.1| hypothetical protein PRUPE_ppb010518mg [Prunus persica]
 gb|EMJ26802.1| hypothetical protein PRUPE_ppb010518mg [Prunus persica]
Length=160

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TYTDE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGSI K +S 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSIIKSSSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>gb|KCW58393.1| hypothetical protein EUGRSUZ_H01080 [Eucalyptus grandis]
Length=160

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+  E  SPVAP R+FKA ++DSH L PKLMPQ I+SID+VQG GG GS++Q NF 
Sbjct  1    MGVVTFAQELESPVAPDRLFKALMLDSHVLFPKLMPQYIRSIDLVQGDGGVGSVRQANFS  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +GS L+  K+ IDE + +    K+TL+EGD L D L+ + YE++F     GGSI +++S 
Sbjct  61   QGSLLRYAKHRIDEQDADNFRCKFTLIEGDILGDDLKSVVYEIEFVDDGNGGSICRMSSD  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y +  D K ++E+I+AGK++ + +Y+AVEAYL+ NP AY
Sbjct  121  YCSDRDIKFRDEDIEAGKDKAMELYRAVEAYLLANPTAY  159



>ref|XP_010051127.1| PREDICTED: major allergen Pru av 1-like isoform X2 [Eucalyptus 
grandis]
Length=159

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+P+ P+++FKA+++D+ NLI K++PQAIKS+++++G GG G++K I F 
Sbjct  1    MGVVSYDCEITTPIPPAKMFKAAVLDADNLILKVLPQAIKSVEVLEGDGGPGTVKLITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K++K+ ++ L++E  TY Y+++EGDAL    EKI+Y VK   +AEGGS+ K TSK
Sbjct  61   EGSQYKTMKHKVEALDKENFTYSYSIIEGDALGTTFEKISYGVKITTSAEGGSVCKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T+G+  + EE+IKAGKE+  AM+KA+EAYL+ NP AY
Sbjct  121  YFTIGEADITEEKIKAGKEKASAMFKAIEAYLLANPDAY  159



>gb|ACJ23864.1| Fag s 1 pollen allergen [Fagus sylvatica]
Length=160

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E T+ + P+R+FKA ++D+ NLIPK+ PQAIKS +I++G+GG G+IK+I F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ IDE++    TY  TL+EGDA+ + LEKI YE+K   + +GGSI K TSK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KE++IKAGKE    ++KAVEAYL+ NP AY
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY  159



>gb|ACJ23866.1| Fag s 1 pollen allergen [Fagus sylvatica]
Length=160

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E T+ + P+R+FKA ++D+ NLIPK+ PQAIKS +I++G+GG G+IK+I F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ IDE++    TY  TL+EGDA+ + LEKI YE+K   + +GGSI K TSK
Sbjct  61   EGSQFNYVKHRIDEIDNTNFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KE++IKAGKE    ++KAVEAYL+ NP AY
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY  159



>gb|AAS47036.1| major cherry allergen Pru av 1.0202 [Prunus avium]
Length=160

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYADESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_007223627.1| hypothetical protein PRUPE_ppa012627mg [Prunus persica]
 gb|ACE80952.1| putative allergen Pru p 1.06A [Prunus dulcis x Prunus persica]
 gb|EMJ24826.1| hypothetical protein PRUPE_ppa012627mg [Prunus persica]
Length=160

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y YTLVEGDAL D++EKI+YE+K   +A+GGS+ K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYTLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_010069887.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=203

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -3

Query  757  KMGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINF  578
            KMGV T+  E  SPVAP R+FKA ++DSH L PKLMPQ I+SID+VQG GG GS++Q NF
Sbjct  43   KMGVVTFAQELESPVAPDRLFKALMLDSHVLFPKLMPQYIRSIDLVQGDGGVGSVRQANF  102

Query  577  PEGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTS  398
             +GS L+  K+ IDE + +    K+TL+EGD L D L+ + YE++F     GGSI +++S
Sbjct  103  SQGSLLRYAKHRIDEQDADNFRCKFTLIEGDILGDDLKSVVYEIEFVDDGNGGSICRMSS  162

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
             Y +  D K ++E+I+AGK++ + +Y+AVEAYL+ NP AY
Sbjct  163  DYCSDRDIKFRDEDIEAGKDKAMELYRAVEAYLLANPTAY  202



>ref|XP_007225972.1| hypothetical protein PRUPE_ppa012642mg [Prunus persica]
 gb|EMJ27171.1| hypothetical protein PRUPE_ppa012642mg [Prunus persica]
Length=160

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TYTDE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGSI K +S 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSIIKSSSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATDLFKLIENYLVANPDAY  159



>gb|KCW87780.1| hypothetical protein EUGRSUZ_A00162 [Eucalyptus grandis]
Length=160

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+P+ P+++FKA+++D+ NLIPK++PQAIKS+++++G GG G+IK I F 
Sbjct  1    MGVVSYDSEVTTPIPPAKMFKAAVLDADNLIPKVLPQAIKSVEVLEGNGGPGTIKLITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  +++K+ ++ L++E  TY Y+++EGD L    EKI+YEVK   + EGGS+ K TSK
Sbjct  61   EGSQYQTMKHKVEALDKENFTYSYSIIEGDVLGTTFEKISYEVKITASPEGGSVCKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNP  287
            Y+T+G+  + EE+IKAGKE+  AM+KA+EAYL+ NP
Sbjct  121  YFTIGEVDITEEKIKAGKEKASAMFKAIEAYLLANP  156



>ref|XP_007223920.1| hypothetical protein PRUPE_ppa011018mg [Prunus persica]
 gb|EMJ25119.1| hypothetical protein PRUPE_ppa011018mg [Prunus persica]
Length=226

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -3

Query  778  YRKEKKTKMGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTG  599
            +   K   MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G
Sbjct  59   FLSSKIITMGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVG  118

Query  598  SIKQINFPEGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGG  419
            +IK+I+F EGS    +K+ ID L+++   Y YTLVEGDAL D++EKI+YE+K   +A+GG
Sbjct  119  TIKKISFGEGSHYSYVKHRIDGLDKDNFVYSYTLVEGDALSDKVEKISYEIKLVASADGG  178

Query  418  SISKVTSKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            SI K +S Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  179  SIIKSSSNYHTAGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  225



>gb|ACE80951.1| putative allergen Pru du 1.06A [Prunus dulcis x Prunus persica]
Length=160

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG+ TYTDE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGS+ K TS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_007223629.1| hypothetical protein PRUPE_ppa012632mg [Prunus persica]
 gb|ACE80948.1| putative allergen Pru p 1.05 [Prunus dulcis x Prunus persica]
 gb|EMJ24828.1| hypothetical protein PRUPE_ppa012632mg [Prunus persica]
Length=160

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS V P+R+FKA ++D+ NL+PK+ PQAIKS +IV+G GG G+IK+ +F 
Sbjct  1    MGVFTYATEFTSVVPPARLFKALVLDADNLVPKIAPQAIKSAEIVEGDGGVGTIKKTSFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D L+++   Y Y+L+EGDAL D++EKI+YE+K   +A+GGS+ K TS 
Sbjct  61   EGSEYSYVKHQVDALDKDNFVYNYSLIEGDALSDKIEKISYEIKLVASADGGSVIKNTSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKE+  A++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAHALFKIIETYLVANPDAY  159



>ref|XP_007035692.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
 gb|EOY06618.1| Pathogenesis-related protein 10.5 [Theobroma cacao]
Length=159

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++FKA I+D  NLIPK++PQA KS++ ++G+G  GSIK+I F 
Sbjct  1    MGVFTYESEVATAIPPAKMFKACILDGDNLIPKIVPQAFKSVEYIEGSGEPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K  ++ L+++   Y Y+++EGDAL++ LEKITYE K E++  GGSI K TSK
Sbjct  61   EGSQFNYMKEKVEALDKDNFVYIYSVIEGDALMNTLEKITYETKLEQSPAGGSICKTTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GDF++ EE IKAGKE+ + ++K VEAYL+ NP AY
Sbjct  121  YYTIGDFEITEEGIKAGKEKALGIFKVVEAYLLANPDAY  159



>ref|XP_002269128.1| PREDICTED: pathogenesis-related protein STH-21-like [Vitis vinifera]
Length=157

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV ++  E  SPVAP R+FKA I+DSHNL PKLMPQ+IKSIDI+QG GG G+IKQ NF 
Sbjct  1    MGVVSFAQESESPVAPGRLFKALILDSHNLCPKLMPQSIKSIDIIQGDGGVGTIKQTNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
             G     IK+ IDE++ E    K+TL+EGD + ++L    YE++F    EGGSI ++ S+
Sbjct  61   RGIH---IKHRIDEVDNEKCRCKFTLIEGDVMGEKLRSAGYEIEFMDDGEGGSICRMLSE  117

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y TVGD   ++E+I+ GKE+   ++K VEA+L+ NP AYA
Sbjct  118  YETVGDVVFRDEDIEEGKEKATELFKPVEAFLLANPDAYA  157



>ref|XP_009794645.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
sylvestris]
Length=160

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+ VAP+R+FKA ++DS NL+PKLMP+ +K+I+I++G GG GSIK++NF 
Sbjct  1    MGVTTYTHEVTTSVAPTRLFKAIVLDSENLVPKLMPKVVKNIEIIEGDGGAGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS +K +K+ I  ++++ L  KY+L+EGD L D+LE +TYE+KFE +  GG I K +++
Sbjct  61   EGSPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLEFVTYEIKFEASGNGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GK + + ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDYVFKEEEHNEGKNQAMELFKTVEDYLLANPSVYV  160



>ref|XP_008223278.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYADESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_009590430.1| PREDICTED: major allergen Pru ar 1-like [Nicotiana tomentosiformis]
Length=160

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG+ T TDE TSP++  R+FKASIVD  NL+PK+ PQ  K+I+ +QG GG G+IKQ+NF 
Sbjct  1    MGIVTITDEFTSPISAPRMFKASIVDGDNLLPKIAPQVFKNIETIQGDGGPGTIKQMNFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS +K +K+ +D +++E +TY YTL+EGD L+D+++ I+YE+  E   +GG   K TSK
Sbjct  61   EGSEIKFVKHRVDAIDKEKMTYAYTLIEGDTLMDKIDSISYEINLESMPDGGCKGKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y T    ++KEEEIKAGKE    + KAVEAYL+ NP  Y
Sbjct  121  YNTKPGVEIKEEEIKAGKEMAAGIVKAVEAYLLANPNEY  159



>gb|AEY11296.1| pathogenesis-related protein PR10 [Nicotiana tabacum]
Length=160

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E ++ VAP+R+FKA ++D+ NLIPKLMPQ +K+I+ V+G GG GSIK++NF 
Sbjct  1    MGVTTYTHEASTTVAPTRLFKALVLDADNLIPKLMPQVVKNIETVEGDGGVGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ +  ++++ L  KY+L+EGD L D+LE ITY+VKFE +A+GG I K +++
Sbjct  61   EGGPIKYLKHKLHVIDDKNLVTKYSLIEGDVLGDKLESITYDVKFETSAKGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GKE+ + ++K VE YL+ N   YA
Sbjct  121  YHTKGDYVFKEEEHNEGKEKAMELFKVVEDYLLANSTVYA  160



>emb|CDO98809.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS V P+++FKA I+D  NLIPK++PQAIKS++ +QG GG G++K  +F 
Sbjct  1    MGVITYDHEVTSSVPPAKLFKAFILDFDNLIPKILPQAIKSVETLQGDGGAGTVKLTHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+K+ +DEL++E   +KYT+ EGD L D +EKI+YEVK E +A+GGSI+K  S 
Sbjct  61   EGSQYKSMKHRVDELDKENFAFKYTVFEGDVLGDVIEKISYEVKIEASADGGSITKSKST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT  D K+ EE IK+GK++   ++KA+EA+L  NP AY
Sbjct  121  YYTKDDAKITEEHIKSGKDKSAGVFKAIEAHLAANPDAY  159



>ref|XP_007044241.1| Uncharacterized protein TCM_009534 [Theobroma cacao]
 gb|EOY00073.1| Uncharacterized protein TCM_009534 [Theobroma cacao]
Length=198

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + + P+++FKA I+D   LIPK++P A KS++ ++G G  GSIK++ F 
Sbjct  40   MGVFTYESEVVTTIPPAKMFKACILDGDKLIPKIVPHAFKSVEYIEGNGEPGSIKKVTFG  99

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K  ++ L++E   Y Y++ EGDAL++ LEK+TYE K E +  GGS+ K TSK
Sbjct  100  EGSQFNYMKQKVEALDKENFVYSYSVNEGDALMNMLEKVTYETKLEPSPAGGSVCKTTSK  159

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GDF++KEE IKAGKE+ + M+KAVEAYL+ NP AY
Sbjct  160  YYTIGDFELKEEGIKAGKEKALGMFKAVEAYLLANPDAY  198



>gb|EYU43990.1| hypothetical protein MIMGU_mgv1a015287mg [Erythranthe guttata]
Length=162

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -3

Query  742  TYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSS  563
            T TDE TS V+  R+FKA I+DS NLIP++ PQAIK+++I+QG G  G+IKQINF  GS 
Sbjct  7    TVTDEFTSAVSAPRLFKALILDSDNLIPQIAPQAIKNVEILQGDGVPGTIKQINFAPGSE  66

Query  562  LKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTV  383
             K +K+ ID L+EE ++Y YTL+EGD L+D+LEKI+YE+KFE   +GGS  K  S YYT 
Sbjct  67   FKYMKHRIDALDEENMSYNYTLIEGDPLMDKLEKISYEMKFENGDDGGSKGKSGSTYYTK  126

Query  382  GDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
               ++KEEEIKAGKE+    +KAVEAYL+  P AY
Sbjct  127  EGVEIKEEEIKAGKEKAAGFFKAVEAYLLAKPDAY  161



>ref|XP_008224643.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYADESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGS+ K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_008223269.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E +S V P+R+FKA ++D+ NL+PK+ PQAIKS +IV+G GG G+IK+ +F 
Sbjct  1    MGVFTYETEFSSVVPPARLFKALVLDADNLVPKIAPQAIKSAEIVEGDGGVGTIKKTSFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D L+++   Y Y+L+EGDAL D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSEYSYVKHQVDALDKDNFVYNYSLIEGDALSDKIEKISYEIKLMASADGGSIIKNTSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKE+  A++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAHALFKIIETYLVANPDAY  159



>gb|AAS47035.1| major cherry allergen Pru av 1.0201 [Prunus avium]
Length=160

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++K+ +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKTAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y YTLVEGDAL D++EKITYE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYNYTLVEGDALSDKIEKITYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            Y+T GD ++KEE++KAGKE+   ++K +E YL  NP A
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATGLFKLIENYLAANPDA  158



>gb|ACE80947.1| putative allergen Pru du 1.05 [Prunus dulcis x Prunus persica]
Length=160

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS V P+R+FKA ++D+ NL+PK+ PQAIKS +IV+G GG G+IK+ +F 
Sbjct  1    MGVFTYETEFTSVVPPARLFKALVLDADNLVPKIAPQAIKSAEIVEGDGGVGTIKKTSFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D L+++   Y Y+L+EGDAL D++EKI+YE+K   +A+GGS+ K TS 
Sbjct  61   EGSEYGYVKHQVDALDKDNFVYNYSLIEGDALSDKIEKISYEIKLVASADGGSVIKNTSS  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKE+  A++K +E YL+ NP AY
Sbjct  121  YHTKGDVEIKEENVKAGKEKAHALFKIIETYLVANPDAY  159



>gb|AAS47037.1| major cherry allergen Pru av 1.0203 [Prunus avium]
Length=160

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY DE TS + P R+FKA ++++  LIPK+ PQ++K  +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYADESTSVITPPRLFKALVLEADTLIPKIAPQSVKGAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE+++AGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTTGDVEIKEEDVRAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_002271428.2| PREDICTED: pathogenesis-related protein STH-2 [Vitis vinifera]
 emb|CBI22930.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E  +PV+P+R+FKA +VDSH L+P+L+P+++KSI+ V+G GG GSI Q NF 
Sbjct  1    MGVTTFTQEFVTPVSPARMFKALVVDSHILVPRLVPESVKSIEFVEGDGGAGSITQTNFS  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
              S  + +KY I+ +++E L  +YTL+EG  L DQLE I YE+KFE++ +GG I K  S+
Sbjct  61   GDSDCEYLKYKINAVDKEKLECRYTLIEGGVLGDQLESIVYEMKFEESGDGGCICKTRSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNP  287
            Y+T G+F++KEE I+ GKE+ + +YK VEAYL+ NP
Sbjct  121  YHTKGEFEIKEESIREGKEKAMGVYKLVEAYLLANP  156



>emb|CAN79557.1| hypothetical protein VITISV_025731 [Vitis vinifera]
Length=159

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG  TY  E TS + P+++FKA ++D  +LIPK++PQ IK ++I++G GG G IK+I F 
Sbjct  1    MGAITYEMEVTSSIPPAKMFKAFVLDVDSLIPKVLPQPIKCVEIIEGDGGPGMIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L++E  TY YT++EGDAL+D LE I YEVK   + +GGSI K  SK
Sbjct  61   EGSQFNYVKHRIDSLDKENFTYCYTIIEGDALMDTLESIYYEVKLVASPDGGSICKNISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ E++IKAGKE+ + M+KA+EAYL+ NP AY
Sbjct  121  YHTKGDIQITEDQIKAGKEKAMGMFKAIEAYLLANPDAY  159



>ref|XP_010027090.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61215.1| hypothetical protein EUGRSUZ_H03977 [Eucalyptus grandis]
Length=160

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -3

Query  736  TDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLK  557
            +D+ +SP+  +R F+A I D HNLIPKLMP+AI SIDIVQG GG G+I QINF EG  L 
Sbjct  7    SDQYSSPIPAARFFRALIGDFHNLIPKLMPEAIGSIDIVQGDGGAGTIMQINFTEGRELS  66

Query  556  SIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGD  377
             IK  +D L+EET+T  Y L+EG   L++ E + YE+ F  T +GGS + + S YY  G+
Sbjct  67   FIKSRVDVLDEETMTCVYKLIEGGQWLEKFESVAYEIMFGPTPDGGSKTILASTYYPKGN  126

Query  376  FKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            F+  +EEIKAG+ER + +YKAVEAYL+QNP AYA
Sbjct  127  FQFDDEEIKAGRERGLGIYKAVEAYLLQNPDAYA  160



>ref|XP_011100819.1| PREDICTED: major allergen Mal d 1-like [Sesamum indicum]
Length=160

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV   +    + V PSR+FKA I+DSHNL P+LM  +IKSID +QG G  G+IKQ+NF 
Sbjct  1    MGVIKVSQSFRTKVTPSRMFKALILDSHNLCPQLMFSSIKSIDFLQGKGEPGTIKQMNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            + S    +K+ IDE++EE    KYT +EGDAL+D+L+ ITYEVKFE    GG I ++TS+
Sbjct  61   DASPFNYVKHRIDEMDEEKFMCKYTFIEGDALMDKLDHITYEVKFEPYGFGGCICRITSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT  + ++KEE+I+ GK+R I MY+ VEAYL+ +P AY
Sbjct  121  YYTKENVEIKEEDIELGKDRAIGMYEVVEAYLLAHPHAY  159



>ref|XP_010259439.1| PREDICTED: major allergen Pru ar 1-like [Nelumbo nucifera]
Length=160

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E  SPVAP+R+FKA I+DS NLIPKLMPQAIKS+D++QG G  GSI+Q+NF 
Sbjct  1    MGVTTFTQEFASPVAPARMFKALILDSRNLIPKLMPQAIKSVDLIQGDGEVGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E    K +K  ++EL++E    KY+L+EGD L D+L+ I YEVKF  +++GG + K+ S+
Sbjct  61   EAIPFKYVKNRVNELDKENFVCKYSLIEGDPLKDKLDHIDYEVKFMSSSDGGCMCKMISQ  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEEEIK GK++   MYK VE YL+ NP  YA
Sbjct  121  YHTKGDVEIKEEEIKEGKDQAKGMYKLVENYLLANPDVYA  160



>ref|XP_007029487.1| Uncharacterized protein TCM_025358 [Theobroma cacao]
 gb|EOY09989.1| Uncharacterized protein TCM_025358 [Theobroma cacao]
Length=159

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG+ TY  E  + + P+++FKA I+D  NLIPK++PQA K+++ ++G G  GSIK++ F 
Sbjct  1    MGIFTYESEVVAAIPPAKMFKACILDGDNLIPKIVPQAFKNVEYIEGNGEPGSIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +   ++ L+++   Y Y+++EGDAL++ LEKITYE K E +  GGSI K TSK
Sbjct  61   EGSQFNYMIEKVEVLDKDNFVYSYSVIEGDALMNTLEKITYETKLEPSPAGGSICKTTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+GDF++KEE IKAGKE+ + ++KAVEAYL+ NP AY
Sbjct  121  YYTIGDFEIKEEGIKAGKEKALGIFKAVEAYLLANPDAY  159



>ref|XP_008223273.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
 ref|XP_008223275.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
 ref|XP_008223276.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=159

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQA+KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQAVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y YTLVEGDAL D++EKITYE+K    ++GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYTLVEGDALSDKVEKITYEIKL-VASDGGSIIKSTSN  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  120  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  158



>gb|AIC34703.1| pathogenesis-related protein 10 [Juglans sigillata]
Length=160

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+R+FKA ++D+ NLIPK++PQA+KS +I++G GG G+IK+INF 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+  D ++E   TY Y+++EGDAL D++EKI+YE K   + EGGSI K  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y++ GD ++KEE++K GKE+   ++KAVE YL+ +P AY
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY  159



>ref|XP_007225973.1| hypothetical protein PRUPE_ppa012646mg [Prunus persica]
 gb|EMJ27172.1| hypothetical protein PRUPE_ppa012646mg [Prunus persica]
Length=160

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY+DE TS + P R+FKA ++++  LIPK+ PQ++KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYSDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGS+ K TS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP A
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDA  158



>ref|XP_008223271.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA ++D+ NL+PK+  QA+KS +IV+G GG G+IK+I F 
Sbjct  1    MGVFTYETELTSVIPPPRLFKALVLDADNLVPKIASQAVKSAEIVEGDGGVGTIKKIRFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +KY ID L+++   Y Y+L+EGD++ D+++KI YE+K   +A+GGSI K TS 
Sbjct  61   EGSEYSYVKYRIDRLDKDNFVYSYSLIEGDSITDKIQKICYEIKLVASADGGSIIKNTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+++GD ++KEE++KAGKER   ++K VE YL+ NP AY
Sbjct  121  YHSIGDVEIKEEDVKAGKERASGLFKVVEKYLLGNPDAY  159



>ref|XP_008223333.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=172

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY DE TS + P R+FKA ++++  LIPK+ PQA+KS +IV+G GG G+IK+I+F 
Sbjct  1    MGVFTYADESTSVIPPPRLFKALVLEADTLIPKIAPQAVKSAEIVEGDGGVGTIKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP  
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDG  158



>emb|CAC16166.1| pathogenesis-related protein 10 [Vitis vinifera]
Length=159

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS V P+++FKA+I+DS NLIPK+ PQAIKS++I+QG GG G+IK+I+F 
Sbjct  1    MGVFTYESEVTSSVPPAKMFKAAILDSDNLIPKVRPQAIKSVEIIQGEGGPGTIKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  T+ YT+V+GD L   +E I++E+K   + +GGSI K TSK
Sbjct  61   EGSKFKSMTHRVDAIDKENFTFSYTVVDGDVLTGGIESISHELKVVASPDGGSIYKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ EE +K GKE  +A++KA+EAY++ +P AY
Sbjct  121  YHTKGDVEICEEHVKGGKEEALALFKAIEAYVLAHPDAY  159



>ref|XP_002274309.1| PREDICTED: major allergen Pru av 1 [Vitis vinifera]
 emb|CAN75908.1| hypothetical protein VITISV_005514 [Vitis vinifera]
 emb|CBI22935.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+++FKA+I+DS NLIPK+ PQAIKS++I+QG GG G+IK+I+F 
Sbjct  1    MGVFTYESEVTSSIPPAKMFKAAILDSDNLIPKVRPQAIKSVEIIQGEGGPGTIKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  T+ YT+V+GD L   +E I++E+K   + +GGSI K TSK
Sbjct  61   EGSKFKSMTHRVDAIDKENFTFSYTVVDGDVLTGGIESISHELKVVASPDGGSIYKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ EE IK GKE  +A++KA+EAY++ +P AY
Sbjct  121  YHTKGDVEISEEHIKGGKEEALALFKAIEAYVLAHPDAY  159



>ref|XP_008223279.1| PREDICTED: major allergen Pru ar 1-like [Prunus mume]
Length=160

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TYT+E TS + P R+FKA ++++  LIPK+ PQ+++S +IV+G GG G++K+I+F 
Sbjct  1    MGVFTYTNESTSVIPPPRLFKALVLEADTLIPKIAPQSVRSAEIVEGDGGVGTVKKISFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+LVEGDAL D++EKI+YE+K   +A+GGS  K TS 
Sbjct  61   EGSHYSYVKHRIDGLDKDNFVYSYSLVEGDALSDKVEKISYEIKLVASADGGSTIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K +E YL+ NP AY
Sbjct  121  YHTTGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY  159



>ref|XP_002274706.1| PREDICTED: major allergen Pru av 1-like [Vitis vinifera]
Length=159

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY +E TS + P+++FKA+I+DS NLIPK+ PQAIK+++I+QG GG G+IK+I+F 
Sbjct  1    MGVITYENEVTSSIPPAKMFKAAILDSDNLIPKVRPQAIKNVEIIQGEGGPGTIKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  T+ YT+V+GD L   +E I++E+K   + +GGSI K TSK
Sbjct  61   EGSKFKSMTHRVDAIDKENFTFSYTVVDGDVLTGGIESISHELKVVASPDGGSIYKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ EE IK GKE  +A++KA+EAY++ +P AY
Sbjct  121  YHTKGDVEISEEHIKGGKEEALALFKAIEAYVLAHPDAY  159



>ref|XP_009621920.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E ++ VAP+R+FKA ++D+ NLIPKLMPQ +K+I+ V+G GG GSIK++NF 
Sbjct  1    MGVTTYTHEASTTVAPTRLFKALVLDADNLIPKLMPQVVKNIETVEGDGGVGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E   +K +K+ +  ++++ L  KY+L+EGD L D+LE  TY+VKFE +A GG I K +++
Sbjct  61   EDGPIKYLKHKLHVIDDKHLVTKYSLIEGDVLGDKLESTTYDVKFETSANGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GK++ +  +KAVE YL+ NP  YA
Sbjct  121  YHTKGDYVFKEEEHNEGKDKAMEFFKAVEDYLLANPTVYA  160



>gb|AIE17036.1| pathogenesis-related protein PR-10 [Nicotiana benthamiana]
Length=160

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+  +P+R+FKA ++DS NL+PKLMP+ +K+I+IV+G GG GSIK++NF 
Sbjct  1    MGVTTYTHEVTTSASPTRLFKAIVLDSENLVPKLMPKVVKNIEIVEGDGGAGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS +K +K+ I  ++++ L  KY+L+EGD L D+LE +TY++KFE +  GG I K +++
Sbjct  61   EGSPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLEFVTYDIKFEASGNGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GK++ + ++K VE YLI NP  Y 
Sbjct  121  YHTKGDYVFKEEEHSEGKDQAMELFKTVEDYLIANPSLYV  160



>emb|CAD33532.1| pathogenesis-related protein PR10A [Datisca glomerata]
Length=159

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  + TS + P ++FKA ++D+  LIPK++PQAIK   I++G GG GSIK+I F 
Sbjct  1    MGVFTYVTDATSVIPPPKVFKAFVLDADQLIPKIVPQAIKGTGIIEGDGGPGSIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ ID L++E   Y YT++EGDA+ D++EK+  EVK E +  GGSI K TSK
Sbjct  61   EGSEYKYMKHRIDVLDKENFIYSYTIIEGDAIGDKIEKVENEVKIEASPTGGSILKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT  D+++KE+EIKAGKE+ + ++KA+E+YL+ NP AY
Sbjct  121  YYTKDDYELKEDEIKAGKEKALGLFKAIESYLLANPNAY  159



>ref|XP_007029483.1| Uncharacterized protein TCM_025354 [Theobroma cacao]
 gb|EOY09985.1| Uncharacterized protein TCM_025354 [Theobroma cacao]
Length=205

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 126/195 (65%), Gaps = 12/195 (6%)
 Frame = -3

Query  862  FHFSAPNNFSHRSSPILESISALIFTFLYRKEKKTKMGVSTYTDEQTSPVAPSRIFKASI  683
             H + P N  +     LE  SA+I            MGV TY  E  + + P+++FKA I
Sbjct  23   LHGAYPKNKQNSKQGKLEERSAVI------------MGVFTYESEVVTAIPPAKMFKACI  70

Query  682  VDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLKSIKYYIDELNEETLTYKY  503
            +D   LIPK++PQA K+++ ++G G  GSIK++ F EGS    +   ++ L+++   Y Y
Sbjct  71   LDGDKLIPKIVPQAFKNVEYIEGNGEPGSIKKVTFGEGSQFNYMIEKVEALDKDNFVYSY  130

Query  502  TLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGDFKMKEEEIKAGKERVIAM  323
            +++EGDAL+  LEKITYE K E +  GGSI K TSKYYT+GDF++KEE IKAGKE+ + +
Sbjct  131  SVIEGDALMKTLEKITYETKLEPSPAGGSICKTTSKYYTIGDFEIKEEGIKAGKEKALGI  190

Query  322  YKAVEAYLIQNPQAY  278
            +KAVEAYL+ NP AY
Sbjct  191  FKAVEAYLLANPDAY  205



>ref|XP_002516990.1| Major allergen Pru av, putative [Ricinus communis]
 gb|EEF45604.1| Major allergen Pru av, putative [Ricinus communis]
Length=158

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 114/158 (72%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY +E TS ++  R+FKA   ++  ++PK+ P AIKS ++V+G GG GSIK+I F 
Sbjct  1    MGVFTYEEEVTSTLSAHRLFKAIAFETDVIVPKIAPHAIKSYELVEGDGGQGSIKKITFA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +GS  K +K+ ID L++E+ TY YT++EGDAL+D LEKI+YE KF     GG I K TSK
Sbjct  61   QGSQFKYVKHKIDVLDKESFTYGYTIIEGDALMDTLEKISYETKFVPAPNGGCICKGTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            YYT GD ++KEEEI AGKE+   M+K +EAYL+ NP A
Sbjct  121  YYTKGDIELKEEEINAGKEKARGMFKGIEAYLLANPDA  158



>ref|XP_010051417.1| PREDICTED: major allergen Pru av 1-like [Eucalyptus grandis]
 gb|KCW87791.1| hypothetical protein EUGRSUZ_A00188 [Eucalyptus grandis]
Length=159

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+P+ P+++FKA+++D+ NLIPK++PQAIKS+++++G GG G++K I F 
Sbjct  1    MGVVSYDSEITTPIPPAKMFKAAVLDADNLIPKVLPQAIKSVEVLEGDGGPGTVKLITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K++K  ++ L++E LTY Y+++EGD L    EKI+ EVK   + EGGS+ K TSK
Sbjct  61   EGSHYKTMKQKVESLDKENLTYCYSIIEGDMLGTTFEKISNEVKIIASPEGGSVCKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T+G+ ++ EE+IKAGKE+   M+KA+EA+L+ NP AY
Sbjct  121  YFTIGEVEITEEKIKAGKEKASEMFKAIEAHLLANPDAY  159



>ref|XP_006349827.1| PREDICTED: major allergen Pru ar 1-like [Solanum tuberosum]
Length=159

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T      S + P+++FKAS++D+  LIPK++PQAIK+++I+ G GG G+IK I F 
Sbjct  1    MGVITCETNTISSIPPAKLFKASVLDADILIPKILPQAIKNVEILHGDGGVGTIKLITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +GS  K++K  +D +++E  TY YT++EGDAL+D LE I+Y +K E    GGSI K TS 
Sbjct  61   DGSQFKNMKQRVDGVDKENYTYNYTIIEGDALMDVLESISYNIKIEPYENGGSICKNTST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE+IKAGKE+ + ++KA+EAYL+ NP AY
Sbjct  121  YHTKGDVQIKEEDIKAGKEKAVGLFKAIEAYLLANPDAY  159



>emb|CDO98810.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 123/165 (75%), Gaps = 5/165 (3%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG  T+T+E TS +  SR+FKA I+DS NLIPK+ PQA+K++++++G GG GSIK++NF 
Sbjct  1    MGAVTFTEEFTSTIPASRLFKALILDSDNLIPKIAPQAVKNVELIEGDGGPGSIKKMNFG  60

Query  574  EGSSLKS-----IKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSIS  410
            EG ++ S     +K+ ID +++E LTY YTL++GDAL+D+L+ I+YE+KFE + +GG   
Sbjct  61   EGKTINSTLDMYVKHRIDAVDKENLTYAYTLIDGDALMDKLDSISYEMKFEPSPDGGCKG  120

Query  409  KVTSKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            K  S Y+T    ++KEEEIK GKE+   ++K VEAYL+ NP+AYA
Sbjct  121  KNVSTYHTKPGVEIKEEEIKDGKEKAAGVFKLVEAYLLANPEAYA  165



>ref|XP_004298700.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+R+FKA ++D+ NLIPK+ PQA+K  +I+QG GG G+IK+IN  
Sbjct  1    MGVFTYESEFTSVIPPARLFKAFVLDADNLIPKIAPQAVKGTEILQGDGGVGTIKKINLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID ++++   YKY+++EGDA+ D++EK++YE K   +++GGS+ K TS 
Sbjct  61   EGSEYSYVKHQIDGIDKDNFVYKYSMIEGDAISDKIEKVSYETKLVASSDGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKER   ++K +E++L+ NP+AY
Sbjct  121  YHTKGDVEIKEEHVKAGKERAAGLFKIIESHLLANPEAY  159



>ref|XP_004239798.1| PREDICTED: pathogenesis-related protein STH-2-like [Solanum lycopersicum]
Length=162

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T+E  SP+ P R+FKA I+DS +LIPKL+PQ ++++ ++QG GG GSI+Q+NF 
Sbjct  1    MGVTTFTEEINSPITPIRLFKALIMDSKSLIPKLLPQFVENVVLLQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFE--KTAEGGSISKVT  401
            +G+  + +K+ IDEL++E +  KYT++EGD L   L+ I+YE+K E  K   GG I K+T
Sbjct  61   KGNPFEFVKHRIDELDKENMVCKYTMIEGDPLGQNLDFISYEIKIEESKINIGGCICKMT  120

Query  400  SKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            + Y+ +GDF  KEE+IK GK+  + +YK VE YLIQNP  YA
Sbjct  121  TNYHGIGDFFAKEEDIKDGKDSAMGIYKTVETYLIQNPNLYA  162



>ref|XP_002519171.1| Major allergen Pru ar, putative [Ricinus communis]
 gb|EEF43035.1| Major allergen Pru ar, putative [Ricinus communis]
Length=158

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  + +  +++FKA +++ + LI +++PQAIKSIDI++G GG G+IKQINF 
Sbjct  1    MGVVTYEMEVATTIPAAKMFKAFVLEGNTLIARILPQAIKSIDILEGDGGAGTIKQINFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            + S  K  K   D +++E LTY YT++EGD L+ +LEKI+ E+KFE T +GG + K  SK
Sbjct  61   DASQFKYAKERTDAVDKENLTYAYTMIEGDVLIGKLEKISNEIKFEATPDGGCLIKSLSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            YYT+GDF++K+E+IKAGKE+ + ++KAVE YL+ NP A
Sbjct  121  YYTIGDFELKQEDIKAGKEKSMGLFKAVEGYLLANPDA  158



>gb|KDP27867.1| hypothetical protein JCGZ_18947 [Jatropha curcas]
Length=169

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E  SP+ P+++FKA ++D+ N+I K++PQAI +++I+QG GG G++++I F 
Sbjct  1    MGVVSYNMEVASPIPPAKLFKAFVLDNDNIIQKVVPQAINNVEILQGDGGPGTVRKITFG  60

Query  574  EG---------SSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEG  422
            EG         S  K +K+ I+E+++E   Y+Y+ +EGD L+D LEKI  E+KFE + +G
Sbjct  61   EGMPKLLLYAGSQFKYVKHRIEEIDKENFVYRYSAIEGDVLVDVLEKIDNEIKFEASGDG  120

Query  421  GSISKVTSKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            GSI K  S YYT+GD ++K+EEIKAGKE+ + ++KAVEAYL+ NP AY+
Sbjct  121  GSICKNRSTYYTIGDHELKQEEIKAGKEKSLQIFKAVEAYLLANPHAYS  169



>ref|XP_010050725.1| PREDICTED: major allergen Pru av 1-like [Eucalyptus grandis]
 gb|KCW87779.1| hypothetical protein EUGRSUZ_A00159 [Eucalyptus grandis]
Length=159

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+P+ P+++FKA+++D+ NLIPK++PQAIKS+++++G GG G++K I F 
Sbjct  1    MGVVSYDSEITTPIPPAKMFKAAVLDADNLIPKVLPQAIKSVEVLEGDGGPGTVKLITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K++K  ++ L++E  TY Y+++EGD L    EKI+ EVK   + EGGS+ K TSK
Sbjct  61   EGSQYKTMKQKVEALDKENFTYCYSIIEGDMLGTTFEKISNEVKITTSPEGGSVCKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T+G+ ++ EE+IKAGKE+   M+KA+EA+L+ NP AY
Sbjct  121  YFTIGEVEITEEKIKAGKEKASEMFKAIEAHLLANPDAY  159



>ref|XP_006345977.1| PREDICTED: pathogenesis-related protein STH-2-like [Solanum tuberosum]
Length=162

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T+E TSP+ P R+FKA IVDS +LIPKL+PQ ++++ ++QG GG GSI+Q+NF 
Sbjct  1    MGVTTFTEEITSPITPIRLFKALIVDSKSLIPKLLPQFVENVVLLQGDGGAGSIEQVNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFE--KTAEGGSISKVT  401
            +G+  + +K+ IDEL++E +  KYT++EGD L   L+ I++E+K E  K   GG I K+T
Sbjct  61   KGNPFEFVKHRIDELDKENMVCKYTMIEGDPLGQNLDFISHEIKIEESKINIGGCICKMT  120

Query  400  SKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            + Y+ +GDF  KEE+IK GK+  + +YK VE YLIQNP  Y 
Sbjct  121  TNYHGIGDFFAKEEDIKDGKDSAMGIYKTVETYLIQNPNLYT  162



>ref|XP_002274785.1| PREDICTED: major allergen Pru av 1 [Vitis vinifera]
 emb|CBI22931.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS V P+++FKA+I+DS NLIPK+ PQAIKS++ +QG GG G+IK+I+F 
Sbjct  1    MGVFTYESEVTSSVPPAKMFKAAILDSDNLIPKVRPQAIKSVETIQGEGGPGTIKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  T+ YT+V+GD L   +E I++E+K   + +GGSI K TSK
Sbjct  61   EGSKFKSMTHRVDAIDKENFTFSYTVVDGDVLTGGIESISHELKVVASPDGGSIYKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ EE +K GKE  +A++KA+EAY++ +P AY
Sbjct  121  YHTKGDVEICEEHVKGGKEEALALFKAIEAYVLAHPDAY  159



>gb|ACX47057.1| Fra a 2 allergen [Fragaria x ananassa]
Length=160

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA I+D+ NLIPK+ PQA+K  +I++G GG G+IK+I F 
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+ + ID +++E   Y Y+L+EGDAL D++EKI+YE K   +++GGSI K TS 
Sbjct  61   EGSQFGSVTHKIDGIDKENFVYSYSLIEGDALSDKIEKISYETKLVSSSDGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEE +KAGKE+   ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC  160



>ref|XP_002519170.1| Major allergen Pru ar, putative [Ricinus communis]
 gb|EEF43034.1| Major allergen Pru ar, putative [Ricinus communis]
Length=158

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V TY  E  + +  +++FKA +++ + LI K++PQAIKSIDI++G GG G+IKQINF 
Sbjct  1    MAVVTYEMEVATTIPAAKMFKAFVLEGNTLIAKILPQAIKSIDILEGDGGAGTIKQINFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            + S  K  K   D +++E LTY YT++EGD L+ +LEKI+ E+KFE T +GG + K  SK
Sbjct  61   DASQFKYAKERTDSVDKENLTYAYTMIEGDVLIGKLEKISNEIKFEATPDGGCLVKSLSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            YYT+GDF++K+E+IKAGKE+ + ++KAVE YL+ NP A
Sbjct  121  YYTIGDFELKQEDIKAGKEKSMGLFKAVEGYLLANPDA  158



>ref|XP_009591008.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TY  E T+ VAP+R+FKA ++DS NL+PKLMPQ +K+I+IV G G  GSIK++NF 
Sbjct  1    MGVTTYNQEVTTLVAPTRLFKALVLDSENLVPKLMPQVVKNIEIVVGDGDAGSIKKMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS +K +K+ I  ++++ L  KY+L+EGD L D+LE +TY++KFE +  GG I K +++
Sbjct  61   EGSPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLEFVTYDIKFEASGNGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GK++ + ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDYVFKEEEHNEGKKQAMELFKTVEDYLLANPSVYV  160



>ref|XP_004296894.1| PREDICTED: major allergen Pru av 1-like [Fragaria vesca subsp. 
vesca]
 gb|AHZ10957.1| Fra a 1.06 allergen [Fragaria x ananassa subsp. ananassa]
Length=160

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA I+D+ NLIPK+ PQA+K  +IV+G GG G+IK+I F 
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIVEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+ + ID +++E   Y Y+LVEGDAL D++EKI+YE K   +++GGS+ K TS 
Sbjct  61   EGSQFGSVTHKIDGIDKENFVYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEE +KAGKE+   ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC  160



>gb|ABZ81047.1| pollen allergen Que a 1 isoform [Quercus alba]
Length=160

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+  ++TS +AP+R+FKA  +DS NLI K++PQAIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS LK  K+ ID ++ E  TY ++++EGDAL D+LE ++ E K   + +GGSI+K TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y T GDF++ +E I+ GKE+   ++KAVEAYL+ +P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY  159



>emb|CAA54696.1| 1 Sc-3 [Betula pendula]
 emb|CAB94732.1| Ypr10b protein [Betula pendula]
 prf||2122374C allergen Bet v 1-Sc3
Length=160

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  Y DE TS +AP+R+FK+ ++D+ NLIPK+ P+ + S + ++G GG G+IK+I FP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ +DE++     Y Y+++EG  L D LEKI+YE+K      GGSI K+TSK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD  + EEEIKAGKE+   ++KAVE YL+ +P AY
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY  159



>ref|XP_007227069.1| hypothetical protein PRUPE_ppa025302mg [Prunus persica]
 gb|EMJ28268.1| hypothetical protein PRUPE_ppa025302mg [Prunus persica]
Length=160

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA ++D+ NLIPK+ PQAIKS +IVQG GG G+IK+I   
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFVLDADNLIPKIAPQAIKSSEIVQGDGGVGTIKKITLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID +++E   Y Y+L+EGDA+ + +EK+ YE+K  ++A+GGSI K TS 
Sbjct  61   EGSQYSYVKHQIDSIDKENFVYGYSLIEGDAISETIEKVCYEIKLVESADGGSIIKNTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKER   ++K +E +L+ NP AY
Sbjct  121  YHTKGDVEIKEEQVKAGKERASGLFKLIENHLVANPDAY  159



>ref|XP_004296890.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA ++D+ NLIPK+ PQA+KS +IVQG GG G+IK+I+  
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFVLDADNLIPKIAPQAVKSAEIVQGDGGVGTIKKIHLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+++EGDA+ D++EKI+YE+K   +A+GGSI K TS 
Sbjct  61   EGSEYSYVKHQIDGLDKDNFVYNYSMIEGDAIGDKVEKISYEIKLVASADGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  G+ ++KEE +KAGKER   ++K +E YL+ NP AY
Sbjct  121  YHCKGEVEIKEEHVKAGKERAAGLFKIIEIYLLGNPDAY  159



>ref|XP_004296876.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
 gb|AHZ10956.1| Fra a 1.05 allergen [Fragaria x ananassa subsp. ananassa]
Length=160

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA I+D+ NLIPK+ PQA+K  +I++G GG G+IK+I F 
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+ + ID ++++   Y Y+LVEGDAL D++EKI+YE K   +++GGSI K TS 
Sbjct  61   EGSQFGSVTHKIDGIDKDNFVYSYSLVEGDALSDKIEKISYETKLVASSDGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEE +KAGKE+   ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC  160



>gb|ABV25698.1| Sal m 1 allergen [Salvia miltiorrhiza]
Length=160

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV   +    + V P+R+FKA I+DSHNL P+LM  +IK+++ +QGTGG G+IKQINF 
Sbjct  1    MGVIKVSQTFRTKVTPNRMFKALIMDSHNLAPQLMFSSIKNVEFLQGTGGPGTIKQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S L  +K+ IDEL+EE    KYT +E D L+D+L++IT+EVKFE    GG   K+TS+
Sbjct  61   EASPLNYVKHRIDELDEENYMCKYTFIEVDGLMDKLDRITHEVKFEAYGFGGCRCKITSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT  + ++KEE+I+ GK+R + MY+ VEAYL+ +P AY
Sbjct  121  YYTKENMEIKEEDIEQGKDRAVGMYEVVEAYLLAHPHAY  159



>ref|XP_009599065.1| PREDICTED: pathogenesis-related protein STH-2-like [Nicotiana 
tomentosiformis]
Length=160

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E ++ VAP+R+FKA ++D  NLIP L+PQ + +I+ V+G GG GSIK++NF 
Sbjct  1    MGVTTYTHEASTTVAPTRLFKALVLDVDNLIPTLLPQIVNNIETVEGDGGVGSIKRMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E   +K +K+ +  ++++ L  KY+L+EGD L D+LE ITY+VKFE +A GG I K +++
Sbjct  61   EDGPIKYLKHKLHVIDDKNLVTKYSLIEGDVLGDKLESITYDVKFETSANGGCICKTSTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+  KEEE   GK++ + ++KAVE YL+ NP  YA
Sbjct  121  YHTKGDYVFKEEEHNEGKDKAMELFKAVEDYLLANPAVYA  160



>ref|XP_010069885.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 ref|XP_010041742.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW44105.1| hypothetical protein EUGRSUZ_L02480 [Eucalyptus grandis]
 gb|KCW58395.1| hypothetical protein EUGRSUZ_H01082 [Eucalyptus grandis]
Length=160

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+  E  SPVAP R+F+A ++DSH L PKLMPQ IK ID++QG GG GS+KQ +F 
Sbjct  1    MGVVTFAQELESPVAPDRLFEALMLDSHVLFPKLMPQYIKRIDLIQGDGGVGSVKQTDFS  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            + S L+  K+ IDEL+ +    KYTL+EGD L D L+ + YE++F     GGSI +++S 
Sbjct  61   QESLLRYAKHRIDELDADNFRCKYTLIEGDILSDDLKSVVYEMEFVDDGNGGSICRMSSY  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y +  D + ++E+I+AGKE  + +Y+AVEAYL+ NP AY
Sbjct  121  YCSDRDIEFRDEDIEAGKETAMELYRAVEAYLLANPTAY  159



>gb|AFF59691.1| Bet v 1 allergen [Quercus suber]
Length=160

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+++FKA ++D+ NLIPK+ P AIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTYESETTSAIPPAKLFKAFVLDADNLIPKVAPHAIKSAEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ IDE++    TY Y+++EGDAL + LEKI+YE+K   + +GGS+ K TSK
Sbjct  61   EGSQFKYVKHRIDEVDHANFTYGYSVIEGDALSEVLEKISYEIKIVASHDGGSVLKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T G  ++KEE+IKAGKE+   ++KA+EAYL+ +   Y
Sbjct  121  YHTKGAHEIKEEQIKAGKEKAAGLFKAIEAYLLAHSDLY  159



>emb|CAA96549.1| major allergen Cor a 1 [Corylus avellana]
Length=160

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  Y  E TS + P+R+FK  ++DS NLIPK+ P+AIKSI+I++G GG G+IK+I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    IK  ++E+++   +Y+Y+++EGDAL D+LEKI YE+K   +  GGSI K  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T+GD ++K+E+IKAGKE+   ++KAVE YL+ +  AY
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY  159



>ref|XP_006340889.1| PREDICTED: pathogenesis-related protein STH-2-like [Solanum tuberosum]
Length=160

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E T+ +AP+R+FK  ++D  +L+PKL+   +KSI++V+G GG GSIKQ+NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEVVEGDGGAGSIKQMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ I  ++++ L  KY+L+EGD L D+LE I Y+VKFE   +GG + K T+ 
Sbjct  61   EGGPIKYLKHKIHAIDDKNLETKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTT  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+ + EEE   GK + I ++KA+EAYL+ NP  YA
Sbjct  121  YHTKGDYVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA  160



>ref|XP_007035687.1| Pathogenesis-related protein 10.9 [Theobroma cacao]
 gb|EOY06613.1| Pathogenesis-related protein 10.9 [Theobroma cacao]
Length=160

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+  T    S V P+R+FKA I+DSHNL PKLM  +IKSI+ ++G G  GSIKQINF 
Sbjct  1    MGVTKITQTFRSQVTPARMFKALILDSHNLGPKLMFSSIKSIEFIEGEGDAGSIKQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K +K+ IDEL++E    KYTL+EGDAL D+LE I+YEVKFE    GG I K+TS+
Sbjct  61   EASPFKYVKHRIDELDKEKFMCKYTLIEGDALTDKLESISYEVKFEAYGYGGCICKMTSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y      ++KE++I+ GK+R I MY+ +EAYL+ +P AY
Sbjct  121  YKAKEGIEIKEQDIEFGKDRAIGMYEVIEAYLMAHPHAY  159



>ref|NP_001275580.1| pathogenesis-related protein STH-2-like [Solanum lycopersicum]
 gb|AHC08074.1| PR10 protein [Solanum lycopersicum]
Length=160

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+T+T E T+ +AP+R+FK  ++D  +L+PKL+   +KSI+IV+G GG GSIKQ+NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ I  ++++ L  KY+L+EGD L D+LE I Y+VKFE   +GG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD  + EEE   GK + I ++KA+EAYL+ NP  YA
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA  160



>ref|XP_009346216.1| PREDICTED: major allergen Pru ar 1-like [Pyrus x bretschneideri]
Length=161

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA I+D+ NLIPKL PQA+K I+I++G GG G+IK+I F 
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKLAPQAVKGIEILEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALL-DQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS L  +K+ ID ++++   Y YTL+EGD LL D++EK+ YE K   + +GGSI K TS
Sbjct  61   EGSQLGFVKHIIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
             Y+  GD ++KEE++KAGKE    ++K VE YL+ NP AY
Sbjct  121  HYHAKGDVEIKEEQVKAGKEMASGLFKLVEGYLLANPDAY  160



>gb|AGL07712.1| pathogenesis related protein PR10 [Ziziphus jujuba]
Length=160

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS VAP+R+FKA +VD   LIP++ PQA+K I+I++G GG G++K+I+F 
Sbjct  1    MGVLTYESEITSTVAPARLFKAFVVDGDKLIPQIAPQAVKQIEILEGDGGAGTVKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+  K +K+ +++++ ++LTY Y ++EGD L D++EKI YE KF   A+GG+I K  SK
Sbjct  61   EGAQFKYVKHKVNKVDIDSLTYSYAVIEGDVLSDKVEKIEYENKFVAAADGGTIIKNISK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T+G+ ++ EE+IKAGK+R   ++K +E YL QNP AY
Sbjct  121  YHTIGEVEITEEQIKAGKDRAGGLFKVLEGYLHQNPDAY  159



>gb|ABZ81046.1| pollen allergen Que a 1 isoform [Quercus alba]
Length=160

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  S + P+R+FKA ++DS NLIPK++PQA+KS +I++G GG G+IK+I F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS LK  K+ ID ++ E  TY ++++EGDAL D+LE ++ E K   + +GGSI K TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y T GDF++ +E I+ GKE+   ++KAVEAYL+ +P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY  159



>ref|XP_004295080.1| PREDICTED: major allergen Pru av 1-like [Fragaria vesca subsp. 
vesca]
 gb|AHZ10955.1| Fra a 1.04 allergen [Fragaria x ananassa subsp. ananassa]
Length=160

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA I+D+ NLIPK+ PQA+K  +I++G GG G+IK+I F 
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+ + ID ++++   Y Y+LVEGDAL D++EKI+YE K   +++GGS+ K TS 
Sbjct  61   EGSQFGSVTHKIDGIDKDNFAYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEE +KAGKE+   ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC  160



>ref|XP_007035696.1| Pathogenesis-related protein 10.5 isoform 2, partial [Theobroma 
cacao]
 gb|EOY06622.1| Pathogenesis-related protein 10.5 isoform 2, partial [Theobroma 
cacao]
Length=139

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  691  ASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLKSIKYYIDELNEETLT  512
            A ++DS NLIPK++PQAIKS+  ++G GG G+IKQ+NF EG   K  K  ID +++E  T
Sbjct  1    AFVLDSDNLIPKILPQAIKSVVTLEGDGGAGTIKQVNFGEGYQFKYTKQRIDGIDQENFT  60

Query  511  YKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGDFKMKEEEIKAGKERV  332
             +YT++EGDAL+D LEKI+ E+KFE+ ++GGS+ K +S YYT+GD  +KEEEIKAGKE+ 
Sbjct  61   CRYTVIEGDALMDTLEKISNEIKFEEASDGGSVCKSSSSYYTIGDINIKEEEIKAGKEKA  120

Query  331  IAMYKAVEAYLIQNPQAY  278
              M+KA+EAYL+ NP AY
Sbjct  121  SGMFKAIEAYLLANPDAY  138



>ref|XP_010024737.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61220.1| hypothetical protein EUGRSUZ_H03982 [Eucalyptus grandis]
Length=159

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 116/158 (73%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG+ TY  E T+P+ P+++FKA +VD   + PK++PQ  +S++IV+G GG G+IK+I F 
Sbjct  1    MGLITYDMEITTPIPPAKMFKAFVVDGDEIFPKILPQIFQSMEIVEGDGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S  K  K+ +D L++E LTY Y+ +EGDAL++  EKI+Y++K E+  +GGSI K TSK
Sbjct  61   EASQFKYAKHMVDALDKEKLTYSYSWIEGDALMNIFEKISYDIKIEEGPDGGSICKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            YY +GD +  E++IK GKE+V+ ++KA+E YL+ NP A
Sbjct  121  YYAIGDIQFSEDQIKDGKEKVLGLFKALEGYLLANPNA  158



>ref|XP_008223280.1| PREDICTED: major allergen Pru av 1-like [Prunus mume]
Length=160

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA ++D+ NLIPK+ PQAIK+ +IVQG GG G+IK+I   
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFVLDADNLIPKIAPQAIKNSEIVQGDGGVGTIKKITLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID +++E   Y Y+L+EGDA+ + +EK+ YE+K   +A+GGSI K TS 
Sbjct  61   EGSQYSYVKHQIDSIDKENFVYSYSLIEGDAISETIEKVCYEIKLVASADGGSIIKNTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKER   ++K +E +L+ NP AY
Sbjct  121  YHTKGDVEIKEEHVKAGKERASGLFKLIENHLVANPDAY  159



>ref|XP_010064273.1| PREDICTED: uncharacterized protein LOC104451263 [Eucalyptus grandis]
Length=520

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+P+ P+++FKA+++D+ NLIPK++PQAIKS+++++G GG G+IK I F 
Sbjct  361  MGVVSYDSEVTTPIPPAKMFKAAVLDADNLIPKVLPQAIKSVEVLEGNGGPGTIKLITFG  420

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  +++K+ ++ L++E  TY Y+++EGD L    EKI+YEVK   + EGGS+ K TSK
Sbjct  421  EGSQYQTMKHKVEALDKENFTYSYSIIEGDVLGTTFEKISYEVKITASPEGGSVCKNTSK  480

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNP  287
            Y+T+G+  + EE+IKAGKE+  AM+KA+EAYL+ NP
Sbjct  481  YFTIGEVDITEEKIKAGKEKASAMFKAIEAYLLANP  516


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  730  EQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINF  578
            E    + P+++FKA+++D+ NLIP+++ QAIKS+++++G  G G+   I F
Sbjct  290  ETCESIPPAKMFKATVLDADNLIPRVLLQAIKSVEVLEGDEGPGTTNLITF  340



>ref|XP_004296893.1| PREDICTED: major allergen Pru av 1-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA I+D+ NLIPK+ PQA+K  +I++G GG G+IK+I F 
Sbjct  1    MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+ + ID +++E   Y Y+LVEGDAL D++EKI+Y  K   +++GGSI K TS 
Sbjct  61   EGSQFGSVTHKIDGIDKENFVYSYSLVEGDALSDKIEKISYVTKLVASSDGGSIIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD ++KEE +KAGKE+   ++K VE YL+ NP  Y 
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC  160



>ref|XP_008340764.1| PREDICTED: major allergen Pru ar 1-like [Malus domestica]
Length=161

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  S + P R+FKA I+D+ NLIPKL PQA+K I+I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFISVIXPPRLFKAFILDADNLIPKLAPQAVKGIEILEGNGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALL-DQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS L  +K+ ID ++++   Y YTL+EGD LL D++EK+ YE K   + +GGSI K TS
Sbjct  61   EGSQLGFVKHRIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
             Y+  GD ++KEE++KAGKE+   ++K VE+YL+ NP AY
Sbjct  121  HYHAKGDVEIKEEQVKAGKEQASGLFKLVESYLLANPDAY  160



>gb|AAU00066.1| pathogenesis-related protein 10 [Solanum virginianum]
Length=160

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+ ++PSR+FKA ++   NL+P+++P  +K+I+ ++G GG GSIKQ+NF 
Sbjct  1    MGVNTYTHESTTSISPSRLFKALVLHFDNLVPQVVPHEVKNIETIEGDGGAGSIKQMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ I  ++++ L  KY+L+EGD L D+LE I Y++KFE + +GG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDVLGDKLESINYDIKFEASGDGGCVCKTTTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD  + EEE   GK++ I ++KAVEA+L+ NP  YA
Sbjct  121  YHTKGDHVITEEEDNVGKDKAINLFKAVEAHLLANPSVYA  160



>gb|AAS00052.1| Mal d 1-like [Malus domestica]
 emb|CBL94138.1| putative Mal d 1.10 isoallergen [Malus domestica]
Length=161

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  S + P R+FKA I+D+ NLIPKL PQA+K I+I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFISVIPPPRLFKAFILDADNLIPKLAPQAVKGIEILEGNGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALL-DQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS L  +K+ ID ++++   Y YTL+EGD LL D++EK+ YE K   + +GGSI K TS
Sbjct  61   EGSQLGFVKHRIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTS  120

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
             Y+  GD ++KEE++KAGKE+   ++K VE+YL+ NP AY
Sbjct  121  HYHAKGDVEIKEEQVKAGKEQASGLFKLVESYLLANPDAY  160



>gb|ADG35964.1| pathogenesis-related protein 10 [Vitis hybrid cultivar]
Length=162

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 120/162 (74%), Gaps = 3/162 (2%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS V P+++FKA+I+DS NLIPK+ PQAIKS++I+QG GG G+IK+I+F 
Sbjct  1    MGVFTYESEVTSSVPPAKMFKAAILDSDNLIPKVRPQAIKSVEIIQGEGGPGTIKKIHFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  KS+ + +D +++E  T+ YT+V+GD L   +E I++E+K   + +GGSI K TSK
Sbjct  61   EGSKFKSMTHRVDAIDKENFTFSYTVVDGDVLTGGIESISHELKVVASPDGGSIYKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKE---RVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++ EE +K GKE     +A++KA+EAY++ +P AY
Sbjct  121  YHTKGDVEICEEHVKGGKEEALEALALFKAIEAYVLAHPDAY  162



>ref|XP_004295117.1| PREDICTED: major allergen Pru ar 1-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=160

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E  S + P+R+FKA I+D+ NLIPKL PQA+K  + ++G GG G+IK+I F 
Sbjct  1    MGVFTYETEFISVIPPARLFKAFILDADNLIPKLAPQAVKGAETIEGDGGVGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS   S+ + ID +++E   Y Y+L+EGDA+ D++EKI+YE K   +++GGS+ K TS 
Sbjct  61   EGSQYSSVTHRIDGIDKENFVYNYSLIEGDAISDKIEKISYETKLVASSDGGSVIKSTSN  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT GD ++KEE +KAGKE+   ++K VE YL+ NP  Y 
Sbjct  121  YYTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC  160



>ref|XP_006340891.1| PREDICTED: pathogenesis-related protein STH-2-like [Solanum tuberosum]
Length=160

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+ ++P+R+FKA ++D  NL+PKL+ Q +K+ + ++G GG GSIKQ+NF 
Sbjct  1    MGVNTYTCESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ I  ++++ L  KY+L+EGD L D+LE ITY++KFE    GG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDVLGDKLESITYDIKFEAYDNGGCVYKTTTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD+ + EEE   GKER++ + KAVEAYL+ NP  YA
Sbjct  121  YHTKGDYVVTEEEHNVGKERIMNISKAVEAYLLANPSVYA  160



>emb|CDP10318.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M   TY+ E TSP+ P+R+FKA+I+D   L+PK++PQAIKS++I++G GG G+IK   F 
Sbjct  1    MAPITYSSEMTSPIPPARLFKAAILD-DTLLPKILPQAIKSVEILEGDGGAGTIKLSKFG  59

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E +  KS K+ +DEL++E   Y Y+++E DAL + +EK T E+KFE +  GGSI K  S 
Sbjct  60   EANKFKSAKHRVDELDKENFVYSYSVIESDALKEGIEKFTNEIKFEASPNGGSICKTNSS  119

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
             YT GD ++ EEEIK   ER + M+KAVEAYL+ NP AY
Sbjct  120  IYTKGDVQITEEEIKGATERALGMFKAVEAYLLANPDAY  158



>emb|CAD10374.1| ypr10 [Castanea sativa]
Length=160

 Score =   171 bits (433),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+ +E TS + P R+FKA ++D+ NLIPKL P AIKS +I++G GG G+IK+I F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ IDE+++   TY Y+++EGD + + LEKI+YE+K   + +GGSI K TSK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T G+ ++KEE++ AGKE+   ++KAVEAYL+ +  AY
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY  159



>ref|XP_010027083.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=156

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 4/160 (3%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV ++T+E  S V  +R+FKA I+DSHNLIPKLMPQAIKSIDI+QG GG G+IKQIN  
Sbjct  1    MGVFSFTNEYVSTVPSARLFKALILDSHNLIPKLMPQAIKSIDIIQGNGGAGTIKQINII  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
             GS L SIK  +DELNEET TYK ++++     ++ E I + VK E T EGGS + + + 
Sbjct  61   SGSRLISIKDRVDELNEETFTYKCSMMDRK---EKFESIVHVVKLEPTPEGGSKNMIMTT  117

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y T GD + KE++ KA  + V+ MYK  EAYL+QNP AYA
Sbjct  118  YNTKGDAEFKEQD-KASNKSVLEMYKLTEAYLLQNPDAYA  156



>emb|CAA10235.1| stress and pathogenesis-related protein [Fagus sylvatica]
Length=160

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P+R+FKA ++D+ NLIPK+ PQ+IKS + ++G GG G+IK+I F 
Sbjct  1    MGVFTYESENTSVIPPARLFKAFVLDADNLIPKVAPQSIKSTETLEGDGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K +K+ IDE+++   +Y Y+++EGD +   +EKI+YE+K   + +GGS+ K TSK
Sbjct  61   EGSQFKYVKHRIDEVDQANFSYGYSVIEGDVVSGIIEKISYEIKIVASPDGGSLLKSTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  G+ ++KEEE+KAGKE+   ++KAVEAYL+ +P AY
Sbjct  121  YHIKGNHEIKEEEVKAGKEKAAGLFKAVEAYLLAHPDAY  159



>sp|O50001.1|PRU1_PRUAR RecName: Full=Major allergen Pru ar 1; AltName: Allergen=Pru 
ar 1 [Prunus armeniaca]
 gb|AAB97141.1| major allergen protein homolog [Prunus armeniaca]
Length=160

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P ++FKA I+D+ NLIPK+ P A+K  +I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D ++++ L+Y YTL+EGDAL D +E I Y++K   + +GGSI K TS 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K VEAYL+ NP AY
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY  159



>ref|XP_010064159.1| PREDICTED: major allergen Pru av 1-like [Eucalyptus grandis]
 gb|KCW87755.1| hypothetical protein EUGRSUZ_A00128 [Eucalyptus grandis]
Length=159

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+PV  +++FKA ++D+ NLIPK++PQAIKS+++ +G GG  +IK I F 
Sbjct  1    MGVVSYDFEITTPVPLAKMFKAVVLDNDNLIPKVLPQAIKSVEVFKGNGGPRTIKLITFS  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K++K+ ++ L++E  TY Y++++GD L    EKI+YE K   + EGGS+ K TSK
Sbjct  61   EGSQYKTMKHKVEALDKENFTYSYSIIKGDVLGTTFEKISYEAKITASPEGGSVCKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T+G+    EE+IKAGKE+  AM+KA+EAYL  NP AY
Sbjct  121  YFTIGEVDTTEEKIKAGKEKASAMFKAIEAYLFANPDAY  159



>gb|EYU43989.1| hypothetical protein MIMGU_mgv1a015365mg [Erythranthe guttata]
Length=160

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV   +    + V P+R+FKA I+DSHNL P+L+  +IKSID +QG G  G+IKQ+NF 
Sbjct  1    MGVVKVSQSFRTKVTPNRMFKALILDSHNLAPQLLFSSIKSIDFLQGEGEPGTIKQMNFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            E S    +K+ ID ++EE    KYTL+EGDAL+ +L+ I YEVKFE    GG + K+TS+
Sbjct  61   EASPYNYVKHRIDAVDEENYYCKYTLIEGDALMGKLDHIVYEVKFEAYGYGGCLCKITSE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YYT+ + ++KEE+I+ GK+R I MY+ VEAYL+ +P AY
Sbjct  121  YYTIENVEIKEEDIEQGKDRAIGMYEVVEAYLLAHPHAY  159



>ref|XP_010024736.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61219.1| hypothetical protein EUGRSUZ_H03981 [Eucalyptus grandis]
Length=161

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = -3

Query  742  TYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSS  563
            T+T+E +S V   R+FKA I+D  NL+PK+MPQAIKS++++ G GG GSIKQ+NF +GS 
Sbjct  6    TFTEEFSSSVPAPRLFKALIIDGDNLMPKIMPQAIKSVELIHGDGGPGSIKQMNFADGSP  65

Query  562  LKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTV  383
            LK +K+ ID L++E +TY Y++VEG  L +++E I+YE+K E T +GG      SKY   
Sbjct  66   LKFVKHRIDALDKEKMTYSYSMVEGGELGNKIESISYEIKMEATPDGGCKGANVSKYLPK  125

Query  382  GDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
                + EEEIKAGKE+  A++KAVEAYL+ NP+ YA
Sbjct  126  PGIVINEEEIKAGKEKATAVFKAVEAYLLANPETYA  161



>gb|ACE80941.1| putative allergen Pru du 1.02 [Prunus dulcis x Prunus persica]
Length=160

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P ++FKA I+D+ NLIPK+ P A+K  +I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKIAPTAVKGTEILEGDGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID ++++ LTY YTL+EGD L D +EKI Y++K   +  GGSI K TS 
Sbjct  61   EGSQYGYVKHRIDGIDKDNLTYSYTLIEGDVLSDVIEKIAYDIKLLASPNGGSIVKTTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K VE YL+ NP AY
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEGYLLANPDAY  159



>emb|CAN67708.1| hypothetical protein VITISV_040371 [Vitis vinifera]
Length=141

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  700  IFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLKSIKYYIDELNEE  521
            +FKA I+DS NLIPK++PQAIK I+I++G GG GSIK+I F EGS    +K+ +D +++E
Sbjct  1    MFKAFILDSDNLIPKILPQAIKCIEIIEGDGGPGSIKKITFGEGSQFNYVKHRVDGIDKE  60

Query  520  TLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGDFKMKEEEIKAGK  341
              TY Y+++EGDAL+  LE I+YEVK   +  GG++ K TSKY+T GDF++ E +IKAGK
Sbjct  61   NFTYSYSVIEGDALMGTLESISYEVKLVASPNGGTMCKSTSKYHTKGDFEITENQIKAGK  120

Query  340  ERVIAMYKAVEAYLIQNPQAY  278
            E+ + ++KAVEAYL+ NP AY
Sbjct  121  EKAMGLFKAVEAYLLANPDAY  141



>ref|XP_007223635.1| hypothetical protein PRUPE_ppa012650mg [Prunus persica]
 gb|ACE80942.1| putative allergen Pru p 1.02 [Prunus dulcis x Prunus persica]
 gb|EMJ24834.1| hypothetical protein PRUPE_ppa012650mg [Prunus persica]
Length=160

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P ++FKA I+D+ NLIPK+ P A+K  +I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKIAPTAVKDTEILEGDGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID ++++ LTY YTL+EGDAL D +EKI Y++K   +  GGSI K  S 
Sbjct  61   EGSQYGYVKHRIDGIDKDNLTYSYTLIEGDALSDVIEKIVYDIKLVASPNGGSIVKTISH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K VE YL+ NP AY
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEGYLLANPDAY  159



>dbj|BAA92224.1| S1-1 [Vigna unguiculata]
Length=160

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MG  T+TDE TS V P R+FKA I+D+ NLIPKLMP+AIK++ +V+G GG GSI++I   
Sbjct  1    MGALTFTDEFTSTVQPGRLFKALILDAPNLIPKLMPEAIKNVQLVEGNGGPGSIQEITIA  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ ID ++ E LTY Y ++EGD  L++++ I++E+KFE T EGG  +K  S 
Sbjct  61   EGDKIKHLKHRIDAIDPEKLTYSYAVIEGDGALEKVDSISHEIKFEATEEGGCKTKNVST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+     ++KEE+ KA K+  +A+ KAV+AYL+ NP AY
Sbjct  121  YHPKAGVEVKEEDFKAAKDEGLALLKAVDAYLLANPDAY  159



>ref|XP_010027098.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
Length=142

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 18/159 (11%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T+T+E  S + P+R+FKA IVDSHNLIPKL PQAIKSIDI++G             
Sbjct  1    MGVFTFTEEYASTIPPARLFKALIVDSHNLIPKLWPQAIKSIDILRG-------------  47

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
              S L S+K  +DELN+ET  YK+T+++   L ++ E I YEVKFE T +GGS +++TS 
Sbjct  48   --SQLSSMKNSVDELNKETFVYKHTMID---LEERFESIAYEVKFEPTPDGGSKNRMTST  102

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            YY  GD ++KEE+I+ GKER + MYK VEA+L+QNP AY
Sbjct  103  YYVKGDIELKEEDIETGKERALGMYKVVEAFLLQNPNAY  141



>ref|XP_002315457.1| Major allergen Mal d 1 family protein [Populus trichocarpa]
 gb|EEF01628.1| Major allergen Mal d 1 family protein [Populus trichocarpa]
Length=160

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  ++DE TSPV P+R+FKA I+DS NL+PKL+PQ IKS++  QG G  GSI+QI+F 
Sbjct  1    MGVFAFSDEFTSPVPPARLFKALILDSGNLLPKLLPQLIKSVEFTQGNGEAGSIRQISFQ  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G  L S+K  ++ ++ E  +Y Y+L+EG+ LLD++E I YEV+F    +GGSI+K+ S 
Sbjct  61   DGIGLTSVKNRVEAVDPENFSYSYSLIEGEGLLDKMETIVYEVQFVPGPDGGSINKMKST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD  + EEE+K GKE+ + MYKAVEAYL+QNP+AY
Sbjct  121  YHTKGDIVLTEEEVKEGKEKALGMYKAVEAYLLQNPEAY  159



>ref|XP_010051063.1| PREDICTED: major allergen Pru av 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW87784.1| hypothetical protein EUGRSUZ_A00172 [Eucalyptus grandis]
Length=159

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV +Y  E T+P+ P+++FKA+++D+ NLI K++PQAIKS+++++G GG G++K I F 
Sbjct  1    MGVVSYDCEITTPIPPAKMFKAAVLDADNLILKVLPQAIKSVEVLEGDGGPGTVKLITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS  K++K  ++ L++E  TY Y+++EGD L    EKI+ EVK   + EGGS+ K TSK
Sbjct  61   EGSQYKTMKQKVEALDKENFTYCYSIIEGDMLGTSFEKISNEVKITASPEGGSVCKNTSK  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQA  281
            Y+T+G+ ++ EE+IKAGKE+   M+KA+EA+L+ NP A
Sbjct  121  YFTIGEVEITEEKIKAGKEKASEMFKAIEAHLLANPDA  158



>ref|XP_008223264.1| PREDICTED: major allergen Pru ar 1 [Prunus mume]
Length=160

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P ++FKA I+D+ NLIPK+ P A+K  +I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ +D ++++ L+Y YTL+EGDAL D +EKI Y++K   +  GGSI K  S 
Sbjct  61   EGSQYGYVKHKVDGIDKDNLSYSYTLIEGDALSDVIEKIAYDIKLVASPNGGSIVKTISH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE++KAGKE+   ++K VEAYL+ NP AY
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY  159



>ref|XP_004296891.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R++KA ++D+ NLIPK+ PQA+KS +IVQG GG G+IK+I+  
Sbjct  1    MGVFTYETEFTSVIPPPRLYKAFVLDADNLIPKIAPQAVKSAEIVQGDGGVGTIKKIHLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+++EGDA+ D++EKI+YE+K   +  GGSI K TS 
Sbjct  61   EGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  G+ ++KEE +KAGKER   ++K +E +L+ NP+AY
Sbjct  121  YHCKGEVEIKEEHVKAGKERAAGLFKIIENHLLANPEAY  159



>gb|KDP27858.1| hypothetical protein JCGZ_18938 [Jatropha curcas]
Length=160

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -3

Query  754  MG-VSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINF  578
            MG V T+ D+ TSPV   ++FKA I+D+ NL+PKL+PQ + SI+I++G GG GSI ++ +
Sbjct  1    MGSVITFADDFTSPVPAKKLFKALILDAPNLLPKLLPQVV-SIEIIEGDGGPGSITKMTY  59

Query  577  PEGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTS  398
             EG  LK +K+ ID L+ E LT+ YTL+EGDAL D+ E I +E+KFE T +GG      S
Sbjct  60   NEGGELKHVKHRIDGLDTEKLTHSYTLIEGDALDDKNESIAFEIKFEATVDGGCKGTSVS  119

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            K++    F++KE+E+K GKE+  A++KAVEAYLI NP+AYA
Sbjct  120  KFHPKPGFEIKEDEVKKGKEKAAALFKAVEAYLIANPEAYA  160



>gb|KCW61046.1| hypothetical protein EUGRSUZ_H03820 [Eucalyptus grandis]
Length=142

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V   +DE  SP+  +R F+A I D HNLIPKLMP+AI+SIDIVQG GG G+I QINF 
Sbjct  1    MVVFKLSDEYNSPIPAARFFRALIGDFHNLIPKLMPEAIESIDIVQGDGGAGTIMQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  L  IK  +D L+EETLT  Y L+EG  L+++ E I YEV FE T +GGS S++ S 
Sbjct  61   EGGELSFIKSRVDVLDEETLTCVYRLIEGSQLMEKFESIAYEVNFEPTPDGGSKSRIAST  120

Query  394  YYTVGDFKMKEEEIKAGKER  335
            YYT GDF++ EEEIKAG+ER
Sbjct  121  YYTKGDFQLNEEEIKAGRER  140



>emb|CBL94145.1| putative Mal d 1.12 isoallergen [Malus domestica]
Length=146

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 113/161 (70%), Gaps = 16/161 (10%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP+ P R+FKA ++D+H LIP+LMP+A+KSID +               
Sbjct  1    MGVFTRTDEYTSPIPPDRLFKALVLDAHILIPELMPEAVKSIDTL---------------  45

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALL-DQLEKITYEVKFEKTAEGGSISKVTS  398
            EGS LKS+   +DE++EE   Y YTLVEG+ L+ ++LE ITY+ KFE  ++GGS +++ S
Sbjct  46   EGSQLKSVINRVDEVDEENFVYAYTLVEGEPLVVEKLEYITYKAKFEAASDGGSKNRLVS  105

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
             YYT GD  +KEEEIKAG+E+ + MY+ VE YL+QNP AYA
Sbjct  106  NYYTKGDIVLKEEEIKAGREKALGMYRVVETYLLQNPDAYA  146



>ref|XP_010326739.1| PREDICTED: TSI-1 protein isoform X1 [Solanum lycopersicum]
 gb|AHC08073.1| PR10 protein [Solanum lycopersicum]
Length=160

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV+TYT E T+ ++P+R+FKA ++D  NL+PKL+ Q +K+ + ++G GG GSIKQ+NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  +K +K+ I  ++++ L  KY+L+EGD L ++LE ITY++KFE    GG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD  + EEE   G+ER++ + KAVEAYL+ NP  YA
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA  160



>ref|XP_007223636.1| hypothetical protein PRUPE_ppa012651mg [Prunus persica]
 gb|ABB78006.1| major allergen Pru p 1 [Prunus persica]
 emb|CAM35495.1| pru p 1 [Prunus persica]
 gb|ABW99628.1| pathogenesis related protein PR10 [Prunus persica]
 gb|ACE80940.1| putative allergen Pru p 1.01 [Prunus dulcis x Prunus persica]
 gb|EMJ24835.1| hypothetical protein PRUPE_ppa012651mg [Prunus persica]
Length=160

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA ++D+ NL+PK+ PQAIK  +I++G GG G+IK+I F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID +++E  +Y YTL+EGDAL D LEKI+YE K   +  GGSI K TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKE+   ++K +E YL  +P AY
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY  159



>ref|XP_004295081.1| PREDICTED: major allergen Pru av 1-like [Fragaria vesca subsp. 
vesca]
 gb|AHZ10958.1| Fra a 1.07 allergen [Fragaria x ananassa subsp. ananassa]
Length=160

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R++KA ++D+ NLIPK+ PQA+KS ++VQG GG G+IK+I+  
Sbjct  1    MGVFTYETEFTSVIPPPRLYKAFVLDTDNLIPKIAPQAVKSTELVQGDGGVGTIKKIHLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+++EGDA+ D++EKI+YE+K   +  GGSI K TS 
Sbjct  61   EGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  G+ ++KEE +KAGKER   ++K +E YL+ NP AY
Sbjct  121  YHCKGEVEIKEEHVKAGKERAAGLFKIIENYLLGNPDAY  159



>ref|XP_009346214.1| PREDICTED: major allergen Pru ar 1-like [Pyrus x bretschneideri]
Length=146

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 113/161 (70%), Gaps = 16/161 (10%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP+ P R+FKA ++D+H LIP+LMP+A+KSID ++G             
Sbjct  1    MGVFTRTDEYTSPIPPDRLFKALVLDAHILIPELMPEAVKSIDNLKG-------------  47

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALL-DQLEKITYEVKFEKTAEGGSISKVTS  398
              S LKS+   +D+++EE   Y YTLVEG+ L+ ++LE ITY+ KFE   +GGS +++ S
Sbjct  48   --SQLKSVINRVDDVDEENFVYAYTLVEGEPLVAEKLEYITYKAKFEAAPDGGSKNRLVS  105

Query  397  KYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
             YYT GD  +KEEEIKAG+ER + MY+ VEAYL+QNP AYA
Sbjct  106  NYYTKGDVVLKEEEIKAGRERALGMYRVVEAYLLQNPDAYA  146



>ref|XP_007138955.1| hypothetical protein PHAVU_009G252400g, partial [Phaseolus vulgaris]
 gb|ESW10949.1| hypothetical protein PHAVU_009G252400g, partial [Phaseolus vulgaris]
Length=191

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 114/162 (70%), Gaps = 0/162 (0%)
 Frame = -3

Query  760  TKMGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQIN  581
            + MG  T+T+E TS V P R+FKA I+D+ NLIPKLMP AIK++ +V+G GG GSI++I 
Sbjct  30   SSMGALTFTEEFTSSVQPGRLFKALILDAPNLIPKLMPDAIKNVQLVEGNGGPGSIQEIT  89

Query  580  FPEGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVT  401
              EG  +K +K+ ID ++ E LTY Y ++EGD  L++++ I++E+KFE T EGG  +K  
Sbjct  90   IAEGDKIKHLKHRIDAIDPEKLTYSYAVIEGDGALEKVDSISHEIKFEATEEGGCKTKNV  149

Query  400  SKYYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            S Y+      +KEE+ KA KE  +A+ K V+AYL+ NP+AYA
Sbjct  150  STYHPKAGVDVKEEDFKAAKEEGLALLKVVDAYLVANPEAYA  191



>ref|XP_010027058.1| PREDICTED: major allergen Pru ar 1-like [Eucalyptus grandis]
 gb|KCW61060.1| hypothetical protein EUGRSUZ_H03836 [Eucalyptus grandis]
Length=142

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            M V   +DE  SP+  +R F+A I D HNLIPKLMP+AI+SIDIVQG GG G+I QINF 
Sbjct  1    MVVFKLSDEYNSPIPTARFFRALIGDFHNLIPKLMPEAIESIDIVQGDGGAGTIMQINFT  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG  L  IK  +D L+EETLT  Y L+EG  L+++ E I YEV FE T +GGS S++ S 
Sbjct  61   EGGELSFIKSRVDVLDEETLTCVYRLIEGSQLMEKFESIAYEVNFEPTPDGGSKSRIAST  120

Query  394  YYTVGDFKMKEEEIKAGKER  335
            YYT GDF++ EEEIKAG+ER
Sbjct  121  YYTKGDFQLNEEEIKAGRER  140



>ref|XP_002314323.1| Major allergen Mal d 1 family protein [Populus trichocarpa]
 gb|EEF00494.1| Major allergen Mal d 1 family protein [Populus trichocarpa]
Length=160

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  ++DE TSPV P+R+FKA I+D  NL+PKL+PQ IKS++  QG G  GSI+QI+F 
Sbjct  1    MGVFAFSDEFTSPVPPARLFKALILDFGNLLPKLLPQLIKSVEFTQGNGEAGSIRQISFQ  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            +G  L+S+   ++ ++ E  +Y Y+L+EG+ LLD++E + YEV+F    +GGSI+K+ S 
Sbjct  61   DGIGLRSVTNRVEAVDPENFSYSYSLIEGEGLLDKMETVVYEVQFVPGPDGGSINKMKST  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            Y+T GD  + EEE+K GKE+ + MYKAVEAYL+QNP+AYA
Sbjct  121  YHTKGDIVLTEEEVKEGKEKALGMYKAVEAYLLQNPEAYA  160



>gb|KCW61213.1| hypothetical protein EUGRSUZ_H03974 [Eucalyptus grandis]
Length=147

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV  +TD  TS + P R+ KA IVDS NLIPKLMPQAI +IDI+QG GGTGS       
Sbjct  1    MGVFIFTDVYTSTIPPKRLSKALIVDSQNLIPKLMPQAINNIDIIQGDGGTGS-------  53

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
              S L+S+K  +DELNEET TY YT+++   L ++ E I YEVKFE T +G S +K+TS 
Sbjct  54   --SQLRSMKNRVDELNEETFTYNYTMID---LTEKFESIGYEVKFEPTPDGKSKNKMTST  108

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT G+FK++EE+I   K R + MY+ VEAYL+QNP A A
Sbjct  109  YYTKGNFKLEEEDIGPEK-RTLGMYEVVEAYLLQNPHACA  147



>gb|AAX18292.1| major allergen Mal d 1.04 [Malus domestica]
 gb|AAX18293.1| major allergen Mal d 1.04 [Malus domestica]
 gb|AAX18294.1| major allergen Mal d 1.04 [Malus domestica]
 gb|AAX20933.1| Mal d 1.0404 [Malus domestica]
 gb|AAX20934.1| Mal d 1.0404 [Malus domestica]
 gb|AAX20935.1| Mal d 1.0404 [Malus domestica]
 gb|AAX20936.1| Mal d 1.0404 [Malus domestica]
 gb|AEF38451.1| allergen Mal d 1.04 [Malus domestica]
 gb|AFC65124.1| allergen Mal d 1.04 [Malus domestica]
 gb|AFC65126.1| allergen Mal d 1.04 [Malus domestica]
 gb|AFC65127.1| allergen Mal d 1.04 [Malus domestica]
Length=160

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS +   R+FKA I+D  NLIPK+ PQAIKS +I++G GG G+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K  ++ ++++  TY Y+++EGD L D+LEKITYE K   + +GGSI K TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  GD ++KEE +KAGKE+   ++K +EAYL+ NP AY
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLVANPDAY  159



>ref|XP_004296875.1| PREDICTED: major allergen Pru ar 1-like [Fragaria vesca subsp. 
vesca]
 gb|AHZ10959.1| Fra a 1.08 allergen [Fragaria x ananassa subsp. ananassa]
Length=160

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R++KA ++D+ NLIPK+ PQA+KS +IVQG GG G+IK+I+  
Sbjct  1    MGVFTYETEFTSVIPPPRLYKAFVLDADNLIPKIAPQAVKSAEIVQGDGGVGTIKKIHLG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID L+++   Y Y+++EGDA+ D++EKI+YE+K   +  GGSI K TS 
Sbjct  61   EGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+  G+ ++KEE +KAGKE+   ++K +E +L+ NP+AY
Sbjct  121  YHCKGEVEIKEEHVKAGKEKAAGLFKIIENHLLANPEAY  159



>gb|ACE80939.1| putative allergen Pru du 1.01 [Prunus dulcis x Prunus persica]
Length=160

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV TY  E TS + P R+FKA ++D+ NL+PK+ PQAIK  +I++G GG G+IK+I F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG  60

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EGS    +K+ ID +++E  +Y YTL EGDAL D LEKI+YE K   +  GGSI K TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLTEGDALGDNLEKISYETKLVASPSGGSIIKSTSH  120

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAY  278
            Y+T GD ++KEE +KAGKE+   ++K +E YL  +P AY
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY  159



>ref|XP_006489009.1| PREDICTED: pathogenesis-related protein STH-2-like [Citrus sinensis]
Length=145

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 118/160 (74%), Gaps = 15/160 (9%)
 Frame = -3

Query  754  MGVSTYTDEQTSPVAPSRIFKASIVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFP  575
            MGV T TDE TSP++P+R+FKA IVDSHNLIPKLMPQA+KSI+I                
Sbjct  1    MGVFTVTDEYTSPISPARLFKALIVDSHNLIPKLMPQAVKSIEIF---------------  45

Query  574  EGSSLKSIKYYIDELNEETLTYKYTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSK  395
            EG+ +K  K  +D L+ E  +YKY+L+EGD L+D+LEKI+Y+VKFE TA+GGS + +TS 
Sbjct  46   EGNQVKCSKNRVDALDLENFSYKYSLIEGDVLMDKLEKISYDVKFEPTADGGSKNTMTST  105

Query  394  YYTVGDFKMKEEEIKAGKERVIAMYKAVEAYLIQNPQAYA  275
            YYT G+F + EEEIK GKE+ +AMYK VE YL+QNP+ YA
Sbjct  106  YYTKGNFVLTEEEIKEGKEKSLAMYKVVENYLMQNPEEYA  145



>emb|CBJ49377.1| pathogenesis-related protein 10.5 [Vitis vinifera]
Length=136

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  685  IVDSHNLIPKLMPQAIKSIDIVQGTGGTGSIKQINFPEGSSLKSIKYYIDELNEETLTYK  506
            I+DS NLIPK++PQAIK ++I++G GG GSIK+I F EGS    +K+ +D +++E  TY 
Sbjct  1    ILDSDNLIPKVLPQAIKCVEIIEGDGGPGSIKKITFGEGSQFNYVKHRVDGIDKENFTYS  60

Query  505  YTLVEGDALLDQLEKITYEVKFEKTAEGGSISKVTSKYYTVGDFKMKEEEIKAGKERVIA  326
            Y+++EGDAL+  LE I+YEVK   +  GGSI K TSKY+T GDF++ E++IKAGKE+ + 
Sbjct  61   YSVIEGDALMGTLESISYEVKLVASPSGGSICKSTSKYHTKGDFEITEDQIKAGKEKALG  120

Query  325  MYKAVEAYLIQNPQAY  278
            ++KAVEAYL+ NP AY
Sbjct  121  LFKAVEAYLLANPDAY  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1899776125104