BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c30001_g1_i1 len=1102 path=[1:0-1101]

Length=1102
                                                                      Score     E

ref|XP_007047234.1|  Calcium-binding EF-hand family protein, puta...    163   1e-44   
ref|XP_004233438.1|  PREDICTED: calmodulin-like protein 1               155   9e-42   
ref|XP_009615286.1|  PREDICTED: calmodulin-like protein 1               154   2e-41   
ref|XP_004511937.1|  PREDICTED: calmodulin-like protein 1-like          154   3e-41   
ref|XP_009614327.1|  PREDICTED: calmodulin-like protein 1               153   1e-40   
ref|XP_006360218.1|  PREDICTED: calmodulin-like protein 1-like          152   1e-40   
ref|XP_011015067.1|  PREDICTED: calmodulin-like protein 1               153   2e-40   
ref|XP_009630731.1|  PREDICTED: calmodulin-like protein 1               153   2e-40   
ref|NP_001241462.1|  uncharacterized protein LOC100790495               152   2e-40   
gb|KDP31921.1|  hypothetical protein JCGZ_12382                         152   2e-40   
gb|KHN36223.1|  Calmodulin-like protein 1                               151   5e-40   
ref|XP_002310148.2|  hypothetical protein POPTR_0007s11130g             151   6e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003611756.1|  Polcalcin Bra r                                    150   8e-40   
ref|XP_007156808.1|  hypothetical protein PHAVU_002G019300g             150   8e-40   
ref|XP_003611759.1|  Calcium-binding protein CML24                      150   1e-39   
ref|XP_010028260.1|  PREDICTED: calmodulin-like protein 1               149   2e-39   
ref|XP_011078048.1|  PREDICTED: calmodulin-like protein 1               148   4e-39   
ref|XP_003537323.1|  PREDICTED: calmodulin-like protein 1-like          149   4e-39   
emb|CAN70198.1|  hypothetical protein VITISV_021219                     148   4e-39   Vitis vinifera
ref|XP_002285223.1|  PREDICTED: calmodulin-like protein 1               148   5e-39   Vitis vinifera
ref|XP_010667348.1|  PREDICTED: calmodulin-like protein 1               145   6e-38   
ref|XP_010530885.1|  PREDICTED: calmodulin-like protein 1               145   9e-38   
ref|XP_006423165.1|  hypothetical protein CICLE_v10029994mg             144   1e-37   
emb|CBI32420.3|  unnamed protein product                                147   2e-37   
ref|XP_009367023.1|  PREDICTED: calmodulin-like protein 1               143   5e-37   
ref|XP_008236514.1|  PREDICTED: calmodulin-like protein 1               143   5e-37   
emb|CDY37233.1|  BnaA09g08540D                                          143   5e-37   
ref|XP_009123241.1|  PREDICTED: calmodulin-like protein 1               142   1e-36   
ref|XP_007156518.1|  hypothetical protein PHAVU_003G292700g             142   1e-36   
ref|XP_002518773.1|  Polcalcin Jun o, putative                          141   2e-36   Ricinus communis
ref|XP_002313848.1|  calmodulin-related family protein                  141   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008339986.1|  PREDICTED: probable calcium-binding protein ...    141   2e-36   
ref|XP_011000410.1|  PREDICTED: calmodulin-like protein 1               140   5e-36   
ref|XP_008241843.1|  PREDICTED: calmodulin-like protein 1               140   5e-36   
emb|CDY66855.1|  BnaCnng52620D                                          139   1e-35   
ref|XP_007201342.1|  hypothetical protein PRUPE_ppa011990mg             139   2e-35   
ref|XP_006409534.1|  hypothetical protein EUTSA_v10022869mg             139   2e-35   
ref|XP_009375699.1|  PREDICTED: calmodulin-like protein 1               139   3e-35   
ref|NP_001276189.1|  uncharacterized protein LOC100803158               138   4e-35   
ref|XP_010315235.1|  PREDICTED: calmodulin-like protein 1               137   6e-35   
ref|XP_004294813.1|  PREDICTED: uncharacterized protein LOC101296846    142   1e-34   
ref|XP_006299618.1|  hypothetical protein CARUB_v10015796mg             137   1e-34   
ref|XP_010517286.1|  PREDICTED: calmodulin-like protein 1               136   2e-34   
ref|XP_010467315.1|  PREDICTED: calmodulin-like protein 1 isoform X1    136   2e-34   
ref|XP_004288041.1|  PREDICTED: calmodulin-like protein 1-like          135   3e-34   
ref|XP_010467316.1|  PREDICTED: calmodulin-like protein 1 isoform X2    135   3e-34   
ref|XP_008373157.1|  PREDICTED: calmodulin-like protein 1               135   4e-34   
gb|KHN31070.1|  Calmodulin-like protein 1                               137   5e-34   
gb|KDO51418.1|  hypothetical protein CISIN_1g030421mg                   134   5e-34   
ref|XP_010269396.1|  PREDICTED: calmodulin-like protein 1               134   7e-34   
ref|XP_010098458.1|  Calmodulin-like protein 1                          133   1e-33   
ref|NP_179170.1|  calmodulin-like protein 1                             133   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006346428.1|  PREDICTED: calmodulin-like protein 1-like          133   2e-33   
ref|XP_010489170.1|  PREDICTED: calmodulin-like protein 1               133   3e-33   
ref|XP_010666626.1|  PREDICTED: calcium-binding protein CML24-like      133   3e-33   
ref|XP_006487101.1|  PREDICTED: calmodulin-like protein 1-like          132   4e-33   
ref|XP_006423030.1|  hypothetical protein CICLE_v10029360mg             132   6e-33   
ref|XP_007139465.1|  hypothetical protein PHAVU_008G031800g             132   7e-33   
ref|XP_010107948.1|  Calmodulin-like protein 1                          132   8e-33   
ref|XP_010066024.1|  PREDICTED: calmodulin-like protein 1               131   9e-33   
gb|KFK40036.1|  hypothetical protein AALP_AA3G321600                    131   1e-32   
ref|XP_008378808.1|  PREDICTED: calmodulin-like protein 1               131   1e-32   
ref|XP_002523568.1|  Polcalcin Jun o, putative                          129   3e-32   Ricinus communis
ref|XP_008338306.1|  PREDICTED: calmodulin-like protein 1               130   3e-32   
ref|XP_007203186.1|  hypothetical protein PRUPE_ppa025180mg             129   4e-32   
gb|KFK40032.1|  hypothetical protein AALP_AA3G321100                    129   5e-32   
ref|XP_003550069.1|  PREDICTED: calmodulin-like protein 1-like          129   1e-31   
gb|ACU18644.1|  unknown                                                 128   1e-31   Glycine max [soybeans]
ref|XP_004505210.1|  PREDICTED: uncharacterized protein LOC101498518    133   2e-31   
ref|XP_010028261.1|  PREDICTED: calmodulin-like protein 1               127   2e-31   
gb|EPS63822.1|  hypothetical protein M569_10963                         126   3e-31   
ref|NP_001235680.1|  uncharacterized protein LOC100499763               127   3e-31   
ref|XP_011088268.1|  PREDICTED: calmodulin-like protein 1               127   4e-31   
gb|ACJ86047.1|  unknown                                                 127   5e-31   Medicago truncatula
emb|CDO97169.1|  unnamed protein product                                126   6e-31   
ref|XP_008454944.1|  PREDICTED: calmodulin-like protein 1               126   9e-31   
ref|XP_003524630.2|  PREDICTED: calmodulin-like protein 1-like          127   1e-30   
gb|ACU17234.1|  unknown                                                 124   3e-30   Glycine max [soybeans]
gb|KGN43936.1|  hypothetical protein Csa_7G073720                       124   3e-30   
ref|XP_009590682.1|  PREDICTED: calmodulin-like protein 1               124   4e-30   
ref|XP_004137114.1|  PREDICTED: calmodulin-like protein 1-like          124   5e-30   
ref|XP_009362913.1|  PREDICTED: calmodulin-like protein 1               123   9e-30   
ref|XP_003607987.1|  Calmodulin-like protein                            127   1e-29   
ref|XP_009607778.1|  PREDICTED: calmodulin-like protein 1               120   1e-28   
gb|KCW63782.1|  hypothetical protein EUGRSUZ_G01446                     118   2e-28   
emb|CDX99691.1|  BnaC04g34480D                                          119   2e-28   
ref|XP_004166667.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-l...    118   5e-28   
ref|XP_008457835.1|  PREDICTED: probable calcium-binding protein ...    118   8e-28   
ref|XP_009772538.1|  PREDICTED: calmodulin-like protein 1               117   1e-27   
gb|EYU37682.1|  hypothetical protein MIMGU_mgv1a014630mg                117   1e-27   
ref|XP_009790383.1|  PREDICTED: calmodulin-like protein 1               117   1e-27   
ref|XP_004148036.1|  PREDICTED: calmodulin-like protein 1-like          117   2e-27   
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...    117   4e-27   
ref|XP_002525994.1|  Polcalcin Jun o, putative                          115   5e-27   Ricinus communis
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                   115   7e-27   
gb|KHN37504.1|  Calmodulin-like protein 1                               113   1e-26   
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...    114   2e-26   
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...    114   2e-26   
emb|CDY27652.1|  BnaUnng00020D                                          112   3e-26   
ref|XP_009140162.1|  PREDICTED: calcium-binding protein CML24           112   4e-26   
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg             113   4e-26   
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...    112   5e-26   
ref|XP_011021780.1|  PREDICTED: probable calcium-binding protein ...    113   5e-26   
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...    111   8e-26   
ref|XP_006391395.1|  hypothetical protein EUTSA_v10019556mg             114   1e-25   
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...    112   1e-25   
ref|XP_010450535.1|  PREDICTED: calcium-binding protein CML24-like      111   2e-25   
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...    111   2e-25   
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...    111   2e-25   
ref|XP_006405836.1|  hypothetical protein EUTSA_v10027972mg             110   2e-25   
ref|XP_010435616.1|  PREDICTED: calcium-binding protein CML24           110   2e-25   
ref|XP_002870563.1|  hypothetical protein ARALYDRAFT_493755             110   3e-25   
ref|XP_006285942.1|  hypothetical protein CARUB_v10007462mg             110   4e-25   
ref|XP_003552973.1|  PREDICTED: calcium-binding protein CML24-lik...    108   6e-25   
ref|XP_002314786.2|  hypothetical protein POPTR_0010s11740g             110   6e-25   Populus trichocarpa [western balsam poplar]
gb|AFK37714.1|  unknown                                                 108   7e-25   
ref|XP_009105203.1|  PREDICTED: calcium-binding protein CML24           108   8e-25   
gb|KCW52116.1|  hypothetical protein EUGRSUZ_J01551                     109   8e-25   
ref|XP_010440886.1|  PREDICTED: calcium-binding protein CML24-like      108   8e-25   
gb|KDP38112.1|  hypothetical protein JCGZ_04755                         109   9e-25   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...    108   1e-24   
ref|XP_007033045.1|  Calmodulin like 23, putative                       108   1e-24   
ref|XP_007045260.1|  Polcalcin Jun o, putative                          109   1e-24   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...    108   1e-24   
ref|XP_006301789.1|  hypothetical protein CARUB_v10022253mg             108   1e-24   
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...    108   2e-24   
ref|NP_198593.1|  calcium-binding protein CML24                         107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...    108   2e-24   
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...    107   2e-24   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...    107   3e-24   
ref|XP_010032678.1|  PREDICTED: calcium-binding protein CML24           106   4e-24   
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...    108   4e-24   
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...    107   5e-24   
emb|CDY55679.1|  BnaC06g43540D                                          106   5e-24   
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...    106   5e-24   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                    106   7e-24   
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg             105   8e-24   
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...    105   9e-24   
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...    105   1e-23   
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                    106   1e-23   
ref|XP_003568726.2|  PREDICTED: probable calcium-binding protein ...    106   1e-23   
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like      105   1e-23   
ref|NP_564874.1|  calmodulin like 23                                    105   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67124.1|  calmodulin-related protein                              105   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17940.1|  Putative calcium-binding protein CML27                  104   2e-23   
ref|XP_007163392.1|  hypothetical protein PHAVU_001G231000g             104   2e-23   
ref|XP_004517285.1|  PREDICTED: probable calcium-binding protein ...    104   2e-23   
ref|XP_010511464.1|  PREDICTED: probable calcium-binding protein ...    105   2e-23   
ref|XP_008809157.1|  PREDICTED: probable calcium-binding protein ...    105   2e-23   
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...    104   2e-23   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...    105   3e-23   
ref|NP_173866.1|  putative calcium-binding protein CML25                105   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...    105   3e-23   
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836             105   3e-23   
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...    105   3e-23   
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...    105   3e-23   
emb|CDX84967.1|  BnaC05g20880D                                          105   3e-23   
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...    105   3e-23   
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...    105   3e-23   
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg             105   4e-23   
dbj|BAK02108.1|  predicted protein                                      105   4e-23   
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...    104   4e-23   
gb|KFK33273.1|  hypothetical protein AALP_AA6G353700                    103   4e-23   
dbj|BAJ86493.1|  predicted protein                                      105   4e-23   
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...    106   4e-23   
gb|EAZ09381.1|  hypothetical protein OsI_31655                          104   5e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_003637661.1|  Calcium-binding pollen allergen                    105   5e-23   
ref|XP_007160530.1|  hypothetical protein PHAVU_002G329300g             104   6e-23   
ref|XP_010109033.1|  putative calcium-binding protein CML23             103   6e-23   
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...    103   6e-23   
ref|XP_002974189.1|  hypothetical protein SELMODRAFT_100711             104   7e-23   
ref|XP_002888497.1|  hypothetical protein ARALYDRAFT_475742             103   8e-23   
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g             103   9e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006829740.1|  hypothetical protein AMTR_s00126p00123680          102   1e-22   
emb|CDY40786.1|  BnaAnng06490D                                          103   1e-22   
gb|AAZ20284.1|  calcium-binding pollen allergen                         103   1e-22   Arachis hypogaea [goober]
gb|EPS69688.1|  hypothetical protein M569_05080                         102   1e-22   
ref|XP_004236933.1|  PREDICTED: probable calcium-binding protein ...    103   1e-22   
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...    102   1e-22   
emb|CDY24421.1|  BnaCnng04880D                                          105   1e-22   
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg             103   1e-22   
emb|CAC43238.1|  calcium binding protein                                102   1e-22   Sesbania rostrata
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...    103   2e-22   
ref|XP_008805404.1|  PREDICTED: calmodulin-like protein 1               103   2e-22   
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...    102   2e-22   
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...    103   2e-22   
emb|CDM80751.1|  unnamed protein product                                103   2e-22   
ref|XP_002460339.1|  hypothetical protein SORBIDRAFT_02g026670          102   2e-22   Sorghum bicolor [broomcorn]
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770          102   2e-22   Sorghum bicolor [broomcorn]
ref|XP_006660702.1|  PREDICTED: calmodulin-like protein 1-like          102   2e-22   
ref|XP_010528534.1|  PREDICTED: calcium-binding protein CML24-like      102   3e-22   
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like      101   3e-22   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...    102   3e-22   
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like      102   4e-22   
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...    102   5e-22   
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...    101   5e-22   
gb|EMS60246.1|  Calmodulin-like protein 1                               101   5e-22   
ref|XP_010531587.1|  PREDICTED: probable calcium-binding protein ...    102   6e-22   
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...    100   6e-22   
ref|XP_009383649.1|  PREDICTED: probable calcium-binding protein ...    101   6e-22   
ref|NP_001063377.1|  Os09g0458700                                       101   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...    101   7e-22   
ref|NP_001045400.1|  Os01g0949500                                       101   8e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006341535.1|  PREDICTED: calcium-binding allergen Ole e 8-...    100   8e-22   
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like      100   9e-22   
ref|XP_009419453.1|  PREDICTED: calmodulin-like protein 1               101   9e-22   
gb|KCW69357.1|  hypothetical protein EUGRSUZ_F02840                     100   1e-21   
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg                100   1e-21   
ref|XP_010231590.1|  PREDICTED: probable calcium-binding protein ...    100   1e-21   
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g           99.4    1e-21   
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8        100   1e-21   
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...    100   1e-21   
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991            99.4    1e-21   
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...  99.8    1e-21   
ref|XP_010104706.1|  putative calcium-binding protein CML25             100   1e-21   
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...    100   2e-21   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  99.4    2e-21   
gb|EMT22618.1|  Calmodulin-like protein 1                               100   2e-21   
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...    100   2e-21   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g             100   2e-21   
ref|XP_002532464.1|  Calcium-binding allergen Ole e, putative         99.4    2e-21   Ricinus communis
ref|XP_003616365.1|  Polcalcin Nic t                                  98.6    2e-21   
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  99.0    3e-21   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  99.4    3e-21   
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  99.8    3e-21   
ref|XP_010943035.1|  PREDICTED: calmodulin-like protein 1             99.4    3e-21   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...  99.4    3e-21   
gb|EMS61162.1|  putative calcium-binding protein CML16                99.4    4e-21   
ref|XP_002322096.1|  calcium binding family protein                   99.0    4e-21   Populus trichocarpa [western balsam poplar]
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg              99.4    4e-21   
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  99.4    4e-21   
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...  98.2    4e-21   
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...  99.4    5e-21   
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...  99.0    5e-21   
ref|XP_010551871.1|  PREDICTED: calcium-binding protein CML24-like    98.6    5e-21   
ref|XP_010938627.1|  PREDICTED: probable calcium-binding protein ...  99.0    5e-21   
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  98.2    5e-21   
ref|XP_006643684.1|  PREDICTED: probable calcium-binding protein ...  98.6    6e-21   
sp|O64943.2|POLC2_JUNOX  RecName: Full=Polcalcin Jun o 2; AltName...  98.2    6e-21   Juniperus oxycedrus [prickly juniper]
ref|NP_001041950.2|  Os01g0135700                                     98.6    6e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           98.6    6e-21   
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  97.4    8e-21   
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...  98.2    9e-21   
ref|XP_002892987.1|  hypothetical protein ARALYDRAFT_889234           97.8    9e-21   
gb|KDP23917.1|  hypothetical protein JCGZ_27077                       97.4    1e-20   
ref|XP_008787648.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-20   
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...  97.1    1e-20   
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  97.4    1e-20   
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...  97.1    1e-20   
emb|CDM86445.1|  unnamed protein product                              98.2    1e-20   
ref|XP_010549761.1|  PREDICTED: probable calcium-binding protein ...  98.6    1e-20   
emb|CDM86427.1|  unnamed protein product                              97.8    1e-20   
emb|CAC34625.1|  putative calmodulin-related protein                  97.1    1e-20   Medicago sativa [alfalfa]
ref|XP_009110358.1|  PREDICTED: probable calcium-binding protein ...  97.4    1e-20   
emb|CDP16307.1|  unnamed protein product                              97.8    1e-20   
gb|AET05414.2|  EF hand calcium-binding family protein                97.8    2e-20   
ref|XP_003630938.1|  Calcium-binding pollen allergen                  97.4    2e-20   
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  98.6    2e-20   
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...  97.1    2e-20   
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...  97.4    2e-20   
ref|NP_001148866.1|  polcalcin Jun o 2                                97.1    2e-20   Zea mays [maize]
ref|XP_004968030.1|  PREDICTED: probable calcium-binding protein ...  97.4    2e-20   
ref|XP_010916442.1|  PREDICTED: probable calcium-binding protein ...  96.7    3e-20   
gb|AIZ06013.1|  Ca2+-binding protein                                  96.7    3e-20   
ref|XP_004288370.1|  PREDICTED: probable calcium-binding protein ...  95.9    3e-20   
ref|XP_003568182.1|  PREDICTED: probable calcium-binding protein ...  96.7    3e-20   
ref|XP_006303188.1|  hypothetical protein CARUB_v10010474mg           96.3    4e-20   
ref|XP_002305867.1|  putative calmodulin-related family protein       95.9    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...  95.5    4e-20   
gb|ABP87672.1|  putative allergen Cup a 4                             96.3    4e-20   
dbj|BAK01430.1|  predicted protein                                    95.9    4e-20   
gb|AFK34900.1|  unknown                                               96.7    4e-20   
ref|XP_002440821.1|  hypothetical protein SORBIDRAFT_09g007360        96.3    4e-20   Sorghum bicolor [broomcorn]
dbj|BAJ88405.1|  predicted protein                                    96.3    5e-20   
ref|XP_008457051.1|  PREDICTED: probable calcium-binding protein ...  95.5    5e-20   
gb|KHM99973.1|  Putative calcium-binding protein CML25                95.5    5e-20   
ref|XP_010271280.1|  PREDICTED: probable calcium-binding protein ...  96.3    6e-20   
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...  95.1    6e-20   Vitis vinifera
ref|NP_173259.1|  putative calcium-binding protein CML27              95.5    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416628.1|  hypothetical protein EUTSA_v10008945mg           95.1    7e-20   
ref|XP_009403977.1|  PREDICTED: probable calcium-binding protein ...  95.5    7e-20   
ref|XP_010459434.1|  PREDICTED: probable calcium-binding protein ...  95.1    7e-20   
gb|KHN40730.1|  Putative calcium-binding protein CML25                94.4    7e-20   
ref|XP_009149267.1|  PREDICTED: probable calcium-binding protein ...  95.1    7e-20   
ref|XP_007036791.1|  Calcium-binding EF-hand family protein           95.1    7e-20   
gb|EMT17394.1|  Putative calcium-binding protein CML18                95.1    9e-20   
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         94.4    1e-19   
ref|XP_010908206.1|  PREDICTED: probable calcium-binding protein ...  95.1    1e-19   
ref|XP_003530955.1|  PREDICTED: calcium-binding allergen Ole e 8      95.1    1e-19   
ref|NP_001152603.1|  polcalcin Jun o 2                                95.1    1e-19   
ref|XP_004957022.1|  PREDICTED: calmodulin-like protein 1-like        95.1    1e-19   
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1          95.1    1e-19   
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...  95.1    1e-19   
ref|XP_007163958.1|  hypothetical protein PHAVU_L002000g              94.7    1e-19   
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...  94.0    1e-19   
ref|XP_003631098.1|  SLR1/LCR-like protein                            94.4    1e-19   
gb|ACG44451.1|  polcalcin Jun o 2                                     95.1    1e-19   
gb|AFG44142.1|  hypothetical protein 0_990_01                         92.8    2e-19   
gb|AFG44138.1|  hypothetical protein 0_990_01                         92.8    2e-19   
gb|KEH26932.1|  EF hand calcium-binding family protein                94.4    2e-19   
gb|AEW07415.1|  hypothetical protein 0_990_01                         92.8    2e-19   
ref|XP_010671432.1|  PREDICTED: calcium-binding allergen Ole e 8-...  94.4    2e-19   
ref|XP_010476999.1|  PREDICTED: probable calcium-binding protein ...  94.4    2e-19   
gb|AFW81600.1|  polcalcin Jun o 2                                     94.7    2e-19   
ref|NP_001152708.1|  LOC100286349                                     94.7    2e-19   
ref|XP_010097572.1|  putative calcium-binding protein CML27           94.0    2e-19   
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  94.7    2e-19   
ref|NP_001150915.1|  calmodulin-related protein 2, touch-induced      94.4    3e-19   
gb|ABK78767.1|  putative allergen Cup a 4                             93.6    3e-19   
emb|CDX96729.1|  BnaA08g22720D                                        93.6    3e-19   
ref|NP_001237156.1|  uncharacterized protein LOC100500636             94.0    3e-19   
emb|CDY70127.1|  BnaA06g38470D                                        93.6    3e-19   
gb|EPS63975.1|  hypothetical protein M569_10810                       93.6    3e-19   
emb|CDY19196.1|  BnaC05g13970D                                        93.6    3e-19   
gb|AAX77686.1|  calcium-binding protein                               93.2    4e-19   
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...  93.6    4e-19   
gb|EMS57491.1|  putative calcium-binding protein CML18                94.7    4e-19   
gb|KHN10547.1|  Putative calcium-binding protein CML27                92.4    4e-19   
emb|CDX83860.1|  BnaC08g17850D                                        93.2    4e-19   
gb|EPS62655.1|  hypothetical protein M569_12136                       93.6    4e-19   
ref|XP_009596756.1|  PREDICTED: calcium-binding allergen Ole e 8-...  92.8    5e-19   
ref|XP_010250152.1|  PREDICTED: probable calcium-binding protein ...  93.6    5e-19   
sp|Q0DJV6.1|CML18_ORYSJ  RecName: Full=Probable calcium-binding p...  92.4    5e-19   
gb|AFW79981.1|  calmodulin protein 2, touch-induced                   93.6    6e-19   
gb|AAV59327.1|  unknown protein                                       92.4    6e-19   
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    92.0    6e-19   
ref|XP_003568563.1|  PREDICTED: probable calcium-binding protein ...  92.8    8e-19   
gb|EAY97018.1|  hypothetical protein OsI_18939                        92.8    8e-19   
ref|XP_011039125.1|  PREDICTED: probable calcium-binding protein ...  92.0    9e-19   
ref|XP_010692608.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-18   
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg              91.3    1e-18   
ref|XP_009797110.1|  PREDICTED: calcium-binding allergen Ole e 8-...  91.7    1e-18   
gb|KEH41241.1|  EF hand calcium-binding family protein                91.3    1e-18   
gb|EEE62792.1|  hypothetical protein OsJ_17595                        92.4    1e-18   
ref|XP_008453475.1|  PREDICTED: probable calcium-binding protein ...  92.0    2e-18   
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...  91.7    2e-18   
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...  91.7    2e-18   
gb|EAY97840.1|  hypothetical protein OsI_19761                        91.7    2e-18   
gb|KEH41232.1|  EF hand calcium-binding family protein                90.5    2e-18   
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...  91.3    2e-18   
ref|XP_003578237.1|  PREDICTED: calmodulin-like protein 1             91.3    3e-18   
gb|KFK43984.1|  hypothetical protein AALP_AA1G199600                  90.5    3e-18   
emb|CDO98355.1|  unnamed protein product                              91.7    3e-18   
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...  90.1    4e-18   
ref|XP_003528969.1|  PREDICTED: calcium-binding allergen Ole e 8-...  90.5    4e-18   
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...  90.5    4e-18   
ref|XP_002317881.2|  calcium binding family protein                   90.1    5e-18   
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...  89.7    5e-18   
gb|ABR17206.1|  unknown                                               91.7    5e-18   
ref|XP_008782318.1|  PREDICTED: probable calcium-binding protein ...  90.1    6e-18   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                       89.4    7e-18   
ref|XP_007052033.1|  EF hand calcium-binding family protein, puta...  90.1    7e-18   
ref|XP_010922191.1|  PREDICTED: probable calcium-binding protein ...  90.1    9e-18   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     89.4    9e-18   
ref|XP_006451632.1|  hypothetical protein CICLE_v10009740mg           89.4    9e-18   
ref|XP_004299534.1|  PREDICTED: probable calcium-binding protein ...  89.4    1e-17   
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           89.0    1e-17   
ref|NP_001055397.1|  Os05g0380900                                     89.7    1e-17   
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...  89.7    1e-17   
ref|XP_006408308.1|  hypothetical protein EUTSA_v10022417mg           88.6    1e-17   
ref|XP_010416174.1|  PREDICTED: probable calcium-binding protein ...  88.6    1e-17   
ref|XP_007219711.1|  hypothetical protein PRUPE_ppa025855mg           89.4    1e-17   
ref|XP_009340773.1|  PREDICTED: probable calcium-binding protein ...  89.4    1e-17   
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...  88.2    2e-17   
ref|XP_004137340.1|  PREDICTED: probable calcium-binding protein ...  89.0    2e-17   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...  89.0    2e-17   
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  88.2    2e-17   
gb|EMT07142.1|  Putative calcium-binding protein CML10                88.2    3e-17   
ref|XP_008356663.1|  PREDICTED: probable calcium-binding protein ...  87.8    3e-17   
ref|NP_001146874.1|  polcalcin Jun o 2                                88.2    4e-17   
ref|XP_011021404.1|  PREDICTED: calcium-binding protein CML24-like    87.4    4e-17   
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  87.4    4e-17   
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...  88.6    4e-17   
ref|XP_002721725.1|  PREDICTED: calmodulin-like protein 3             87.0    4e-17   
ref|XP_006445234.1|  hypothetical protein CICLE_v10022392mg           88.2    4e-17   
ref|XP_011034524.1|  PREDICTED: probable calcium-binding protein ...  88.6    4e-17   
ref|XP_010428289.1|  PREDICTED: probable calcium-binding protein ...  87.4    4e-17   
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg              87.0    5e-17   
ref|XP_006646679.1|  PREDICTED: probable calcium-binding protein ...  86.3    5e-17   
gb|ADC80734.1|  calmodulin 24-like protein                            85.9    5e-17   
ref|XP_008673745.1|  PREDICTED: probable calcium-binding protein ...  87.8    5e-17   
ref|XP_002884376.1|  hypothetical protein ARALYDRAFT_896341           86.7    5e-17   
ref|NP_001147546.1|  calmodulin-related protein 2, touch-induced      87.0    6e-17   
ref|XP_002455240.1|  hypothetical protein SORBIDRAFT_03g006930        87.8    6e-17   
ref|XP_006390534.1|  hypothetical protein EUTSA_v10019258mg           87.0    6e-17   
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...  88.2    6e-17   
ref|XP_002881428.1|  hypothetical protein ARALYDRAFT_902729           86.3    7e-17   
ref|XP_010471425.1|  PREDICTED: probable calcium-binding protein ...  86.7    7e-17   
ref|XP_008374843.1|  PREDICTED: probable calcium-binding protein ...  87.0    7e-17   
ref|XP_010537496.1|  PREDICTED: probable calcium-binding protein ...  86.7    8e-17   
ref|XP_006302928.1|  hypothetical protein CARUB_v10021066mg           86.7    8e-17   
ref|XP_010036949.1|  PREDICTED: probable calcium-binding protein ...  86.3    9e-17   
gb|ABK26031.1|  unknown                                               87.0    1e-16   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  86.3    1e-16   
ref|XP_009356047.1|  PREDICTED: probable calcium-binding protein ...  86.3    1e-16   
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...  87.0    1e-16   
gb|KDO85857.1|  hypothetical protein CISIN_1g047502mg                 85.5    1e-16   
ref|XP_006383316.1|  putative calmodulin-related family protein       85.9    1e-16   
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  85.9    1e-16   
gb|ABK26821.1|  unknown                                               86.7    2e-16   
ref|XP_006295520.1|  hypothetical protein CARUB_v10024624mg           85.5    2e-16   
ref|XP_002320065.2|  hypothetical protein POPTR_0014s06640g           86.7    2e-16   
ref|XP_003565059.1|  PREDICTED: probable calcium-binding protein ...  86.3    2e-16   
ref|XP_004605359.1|  PREDICTED: calmodulin-like protein 3             85.1    2e-16   
gb|KDP28741.1|  hypothetical protein JCGZ_14512                       85.9    2e-16   
ref|XP_008800223.1|  PREDICTED: calmodulin-like                       86.7    2e-16   
gb|ABK24059.1|  unknown                                               87.0    3e-16   
ref|NP_197249.1|  putative calcium-binding protein CML32              84.7    3e-16   
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            84.7    4e-16   
ref|XP_002873831.1|  hypothetical protein ARALYDRAFT_909743           84.3    4e-16   
ref|XP_006851533.1|  hypothetical protein AMTR_s00040p00172050        84.7    7e-16   
gb|KFO18269.1|  Calmodulin                                            84.3    7e-16   
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...  84.7    7e-16   
ref|XP_010197031.1|  PREDICTED: calmodulin, striated muscle-like      83.6    8e-16   
ref|XP_006296176.1|  hypothetical protein CARUB_v10025336mg           84.7    1e-15   
ref|XP_002962635.1|  hypothetical protein SELMODRAFT_69135            83.2    1e-15   
ref|XP_002980456.1|  hypothetical protein SELMODRAFT_59198            83.2    1e-15   
ref|XP_009400616.1|  PREDICTED: probable calcium-binding protein ...  86.7    1e-15   
ref|XP_010453946.1|  PREDICTED: probable calcium-binding protein ...  82.8    1e-15   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            83.2    1e-15   
gb|KFK39945.1|  hypothetical protein AALP_AA3G309900                  82.8    1e-15   
gb|ABN41559.1|  calmodulin                                            82.8    1e-15   
gb|KFK25963.1|  hypothetical protein AALP_AA8G185500                  82.4    2e-15   
ref|XP_006655263.1|  PREDICTED: probable calcium-binding protein ...  83.2    2e-15   
ref|XP_006398844.1|  hypothetical protein EUTSA_v10015440mg           82.4    2e-15   
ref|NP_001241810.1|  polcalcin Jun o 2                                84.0    2e-15   
ref|XP_011090880.1|  PREDICTED: probable calcium-binding protein ...  83.6    2e-15   
ref|NP_001150713.1|  LOC100284346                                     83.6    2e-15   
gb|ADC80752.1|  calmodulin 24-like protein                            81.3    2e-15   
gb|AFW64705.1|  calmodulin protein                                    82.8    2e-15   
ref|NP_001151914.1|  calmodulin-related protein                       82.8    2e-15   
ref|XP_002887495.1|  hypothetical protein ARALYDRAFT_476499           82.4    2e-15   
gb|ESW97557.1|  calmodulin                                            82.0    3e-15   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      82.4    3e-15   
ref|XP_009106021.1|  PREDICTED: probable calcium-binding protein ...  82.0    3e-15   
ref|XP_010508448.1|  PREDICTED: calmodulin-like protein 5             83.2    4e-15   
ref|XP_007432500.1|  PREDICTED: calmodulin isoform X1                 82.4    4e-15   
gb|EPQ02469.1|  Calmodulin                                            82.0    4e-15   
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...  83.2    4e-15   
ref|XP_001768532.1|  predicted protein                                82.0    4e-15   
ref|XP_006418718.1|  hypothetical protein EUTSA_v10003096mg           81.3    4e-15   
gb|ETE70432.1|  Calmodulin                                            81.6    6e-15   
gb|EHB18285.1|  Calmodulin                                            82.0    6e-15   
gb|KFK43584.1|  hypothetical protein AALP_AA1G145300                  80.9    6e-15   
ref|NP_001266452.1|  calmodulin-related protein 2, touch-induced      82.0    6e-15   
gb|KHN22125.1|  Calmodulin-like protein 5                             81.6    6e-15   
ref|XP_010385108.1|  PREDICTED: calmodulin-alpha-like                 80.9    6e-15   
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...  82.0    7e-15   
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...  82.0    8e-15   
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   81.3    8e-15   
ref|NP_001240157.1|  uncharacterized protein LOC100810081             82.0    9e-15   
ref|XP_006397493.1|  hypothetical protein EUTSA_v10001753mg           82.8    9e-15   
ref|XP_008351927.1|  PREDICTED: probable calcium-binding protein ...  80.9    9e-15   
ref|XP_008232680.1|  PREDICTED: calmodulin-like                       81.6    9e-15   
ref|NP_001159038.1|  polcalcin Jun o 2                                79.3    9e-15   
ref|XP_008240158.1|  PREDICTED: probable calcium-binding protein ...  80.9    1e-14   
ref|XP_006291828.1|  hypothetical protein CARUB_v10018003mg           81.6    1e-14   
gb|KFK37167.1|  hypothetical protein AALP_AA4G222400                  80.9    1e-14   
ref|XP_009360087.1|  PREDICTED: probable calcium-binding protein ...  80.5    1e-14   
ref|XP_004308447.1|  PREDICTED: probable calcium-binding protein ...  81.3    1e-14   
ref|XP_007209701.1|  hypothetical protein PRUPE_ppa012426mg           80.9    1e-14   
ref|NP_565996.1|  calmodulin-like protein MSS3                        81.6    1e-14   
ref|XP_006014812.1|  PREDICTED: calmodulin                            81.3    1e-14   
ref|XP_004508466.1|  PREDICTED: calmodulin-like protein 7-like        81.6    1e-14   
ref|XP_010026030.1|  PREDICTED: probable calcium-binding protein ...  82.4    1e-14   
gb|KHN41077.1|  Putative calcium-binding protein CML27                80.5    1e-14   
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...  81.6    1e-14   
ref|XP_005724908.1|  PREDICTED: calmodulin-like isoform X1            80.9    1e-14   
ref|XP_006851809.1|  hypothetical protein AMTR_s00041p00030040        81.3    1e-14   
sp|Q9HFY6.3|CALM_BLAEM  RecName: Full=Calmodulin; Short=CaM           80.1    1e-14   
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3             81.6    1e-14   
gb|EPB83786.1|  calmodulin                                            80.1    2e-14   
emb|CCG82337.1|  Calmodulin                                           80.1    2e-14   
emb|CDS26414.1|  calmodulin                                           80.1    2e-14   
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...  80.9    2e-14   
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     80.5    2e-14   
ref|XP_008491074.1|  PREDICTED: calmodulin                            80.9    2e-14   
ref|XP_010687927.1|  PREDICTED: calmodulin-like protein 7             81.3    2e-14   
emb|CDX98375.1|  BnaC06g17360D                                        80.5    2e-14   
ref|XP_005438974.1|  PREDICTED: calmodulin                            80.5    2e-14   
emb|CEG63331.1|  Putative Calmodulin                                  79.3    2e-14   
ref|XP_009473363.1|  PREDICTED: calmodulin                            80.1    2e-14   
ref|XP_006799422.1|  PREDICTED: calmodulin-like                       80.9    2e-14   
ref|XP_004493396.1|  PREDICTED: calmodulin-like protein 3-like        79.3    3e-14   
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...  80.5    3e-14   
ref|XP_005483194.1|  PREDICTED: calmodulin                            80.1    3e-14   
ref|XP_009647645.1|  PREDICTED: calmodulin                            80.1    3e-14   
ref|XP_009402401.1|  PREDICTED: neo-calmodulin-like isoform X1        80.9    3e-14   
ref|XP_009409671.1|  PREDICTED: probable calcium-binding protein ...  79.7    3e-14   
ref|NP_177504.1|  putative calcium-binding protein CML26              79.7    3e-14   
ref|XP_004559359.1|  PREDICTED: calmodulin-like                       80.5    3e-14   
ref|XP_010517888.1|  PREDICTED: calmodulin-like protein 5             80.5    3e-14   
ref|XP_003758346.1|  PREDICTED: calmodulin-like                       79.3    3e-14   
ref|XP_009929788.1|  PREDICTED: calmodulin-A                          79.7    3e-14   
ref|XP_003549743.1|  PREDICTED: calmodulin-like protein 5-like        80.5    3e-14   
ref|XP_008352239.1|  PREDICTED: calmodulin-like protein 7             80.5    3e-14   
ref|XP_005933937.1|  PREDICTED: calmodulin-like                       80.5    3e-14   
ref|XP_004953833.1|  PREDICTED: probable calcium-binding protein ...  79.7    3e-14   
gb|KCW58109.1|  hypothetical protein EUGRSUZ_H00832                   79.3    3e-14   
ref|XP_010069581.1|  PREDICTED: calmodulin-like protein 3             79.0    4e-14   



>ref|XP_007047234.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOX91391.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=188

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 129/176 (73%), Gaps = 5/176 (3%)
 Frame = -2

Query  918  FLNFR-GSFSRK-SSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISM  745
            F+ F+ G   RK S  P   ++ +  +++  S++ +QPN ++M+ VF ++DTN DG+IS 
Sbjct  6    FIEFKYGGLPRKLSRKPTQLSITKERQQSNVSSRTYQPNAEEMKWVFDKFDTNRDGKISK  65

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAV-HNLGGGISKADIKNAFT  574
            EE+K A++V+G G  E   A   +  D DG  +IDF+EFI +  N+G GI+  DI++AF 
Sbjct  66   EEYKSALKVLGKGMAETEVAKAFSAIDTDGDGFIDFKEFIEMMRNMGEGINSNDIQSAFR  125

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            V+DLDGNGKISAEEL++VL++MGERC+L++CRKM++GVD+DGDGLIDI EF  MMT
Sbjct  126  VYDLDGNGKISAEELMEVLKKMGERCSLEACRKMIRGVDADGDGLIDINEFMTMMT  181



>ref|XP_004233438.1| PREDICTED: calmodulin-like protein 1 [Solanum lycopersicum]
Length=193

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 126/176 (72%), Gaps = 7/176 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            + +F+ S S+   S   + VK+ P  + TS   F P +++M++VF ++DTN DG+IS EE
Sbjct  14   YASFKKSMSKSRPSLHLSKVKQTP--STTSLVHFSPKLEEMKRVFDKFDTNKDGKISKEE  71

Query  738  FKLAMQVIggggteaagaf-----eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFT  574
            +K AM+++  GG            +AAD++GDG+I+F EF+ V +L GG++  DIK+AF 
Sbjct  72   YKSAMKMMSSGGGNTKSYEVDDAFQAADTNGDGFINFDEFMRVQSLEGGVNSTDIKSAFK  131

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
             FDLDG+GKISAEELLQV R +GE+C+L+SC+KMV+GVD++GDGLID+ EF  MMT
Sbjct  132  AFDLDGDGKISAEELLQVQRMLGEKCSLESCKKMVRGVDANGDGLIDMDEFVTMMT  187



>ref|XP_009615286.1| PREDICTED: calmodulin-like protein 1 [Nicotiana tomentosiformis]
Length=190

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 120/175 (69%), Gaps = 7/175 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            F +FR S S+   S   + VK+ P   + S   F+P  ++MR+VF ++DTN DG+IS EE
Sbjct  13   FNSFRKSLSKSRPSFNLSNVKKTP---SMSLANFRPKAEEMRRVFDKFDTNKDGKISQEE  69

Query  738  FKLAMQVIggggteaagafeaadsdgdG----YIDFQEFIAVHNLGGGISKADIKNAFTV  571
            +K AM+++G GG         A    D     +I+F+EF+ V NL GG++  DI++AF  
Sbjct  70   YKSAMKMMGSGGNTKTYDVGDAFQAADTDGDGFINFKEFMRVQNLEGGVNPTDIRSAFKA  129

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            FDLDG+GKISAEELLQV R +GE+C+L++C+KMV+GVD++GDGLID+ EF  MMT
Sbjct  130  FDLDGDGKISAEELLQVQRMLGEKCSLENCKKMVRGVDANGDGLIDMNEFVTMMT  184



>ref|XP_004511937.1| PREDICTED: calmodulin-like protein 1-like [Cicer arietinum]
Length=187

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 128/178 (72%), Gaps = 5/178 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKE---RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            F+ F GSFS K++SP     ++   + K+T +S   FQP  ++++ VF ++DTN DG+IS
Sbjct  6    FMKFHGSFSGKATSPTKNVSQKNSFKSKQTTSSEMSFQPQKEEIKWVFEKFDTNKDGKIS  65

Query  747  MEEFKLAMQVIggg--gteaagafeaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFT  574
            +EE+K A + +  G    EA  AF+A DSD DG+IDF+EF+ + N  G I + +IK+AF 
Sbjct  66   LEEYKAAAKALDKGIGDAEAMKAFKAMDSDKDGFIDFKEFMEMFNGEGKIKEDEIKSAFQ  125

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            VFD++G+GKISAEEL Q+L+++GE C+L +C+KMVKGVD DGDG I++ EFT+MM + 
Sbjct  126  VFDINGDGKISAEELSQILKKLGESCSLSACKKMVKGVDGDGDGFINLNEFTRMMMSG  183



>ref|XP_009614327.1| PREDICTED: calmodulin-like protein 1 [Nicotiana tomentosiformis]
Length=201

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 119/175 (68%), Gaps = 7/175 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            F  FR S S+   S   + VK+ P   + S   F+P  ++M++VF ++DTN DG+IS EE
Sbjct  13   FNRFRKSLSKSRPSFNLSKVKKTP---SMSLANFRPKAEEMKRVFDKFDTNKDGKISQEE  69

Query  738  FKLAMQVIggggteaagafeaadsdgdG----YIDFQEFIAVHNLGGGISKADIKNAFTV  571
            +K AM+++G GG         A    D     +I+F+EF+ V NL GG++  DI++AF  
Sbjct  70   YKTAMKMMGSGGNTKTYDVGDAFQAADTDGDGFINFKEFMRVQNLEGGVNPTDIRSAFKA  129

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            FDLDG+GKISAEELLQV R +GE+C+L++C+KMV+GVD++GDGLID+ EF  MMT
Sbjct  130  FDLDGDGKISAEELLQVQRMLGEKCSLENCKKMVRGVDANGDGLIDMNEFVTMMT  184



>ref|XP_006360218.1| PREDICTED: calmodulin-like protein 1-like [Solanum tuberosum]
Length=173

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = -2

Query  894  SRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVI  715
            S+   S   + VK+ P  + TS   F P +++M++VF ++DTN DG+IS EE+KLAM+++
Sbjct  2    SKSKRSLHLSKVKQTP--STTSLVHFSPKLEEMKRVFDKFDTNKDGKISKEEYKLAMKMM  59

Query  714  ggggteaagaf-----eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNG  550
              GG            +AAD++GDG+I+F+EF+ V +L GG++  DIK+AF  FDLDG+G
Sbjct  60   SSGGGNTKSYEVDDAFQAADTNGDGFINFEEFMRVQSLEGGVNSTDIKSAFKAFDLDGDG  119

Query  549  KISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            KISAEELLQV R +GE+C+L+SC+KMV+ VD++GDGLID+ EF  MMT
Sbjct  120  KISAEELLQVQRMLGEKCSLESCKKMVRSVDANGDGLIDMDEFVTMMT  167



>ref|XP_011015067.1| PREDICTED: calmodulin-like protein 1 [Populus euphratica]
 ref|XP_011015069.1| PREDICTED: calmodulin-like protein 1 [Populus euphratica]
Length=204

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 127/194 (65%), Gaps = 24/194 (12%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKER--------------------PKKTATSTQVFQPNMDD  799
            FLNF G   R SSS +    + R                     +++++ ++ FQPN+++
Sbjct  6    FLNFHG-LPRNSSSSSPIPTESRIYRKKRQSCSVSKSMKINVILEQSSSESKSFQPNVEE  64

Query  798  MRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAV  625
            M+ VF ++D N DG+IS +E+K A++ +G G  E+        +D DG  YIDF+EF+ +
Sbjct  65   MKWVFDKFDFNKDGKISRQEYKSALRALGKGLEESEMVKAFQATDIDGDGYIDFKEFMEM  124

Query  624  -HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDG  448
             HN+G G+  +DI++AF VFDLDGNGKISAEEL++VL+R+GER +LD+CRKM++ VD DG
Sbjct  125  MHNMGDGVKSSDIESAFRVFDLDGNGKISAEELMEVLKRLGERSSLDACRKMIRAVDGDG  184

Query  447  DGLIDIKEFTKMMT  406
            DGLIDI EF  MMT
Sbjct  185  DGLIDINEFMGMMT  198



>ref|XP_009630731.1| PREDICTED: calmodulin-like protein 1 [Nicotiana tomentosiformis]
Length=231

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 119/175 (68%), Gaps = 7/175 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            F  FR S S+   S   + VK+ P   + S   F+P  ++M++VF ++DTN DG+IS EE
Sbjct  13   FNRFRKSLSKSRPSFNLSKVKKTP---SMSLANFRPKAEEMKRVFDKFDTNKDGKISQEE  69

Query  738  FKLAMQVIggggteaagafeaadsdgdG----YIDFQEFIAVHNLGGGISKADIKNAFTV  571
            +K AM+++G GG         A    D     +I+F+EF+ V NL GG++  DI++AF  
Sbjct  70   YKTAMKMMGSGGNTKTYDVGDAFQAADTDGDGFINFKEFMRVQNLEGGVNPTDIRSAFKA  129

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            FDLDG+GKISAEELLQV R +GE+C+L++C+KMV+GVD++GDGLID+ EF  MMT
Sbjct  130  FDLDGDGKISAEELLQVQRMLGEKCSLENCKKMVRGVDANGDGLIDMNEFVTMMT  184



>ref|NP_001241462.1| uncharacterized protein LOC100790495 [Glycine max]
 gb|ACU18954.1| unknown [Glycine max]
Length=187

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 116/178 (65%), Gaps = 5/178 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERP---KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FL F  SFS K S+     VK+     ++T+   Q F P  ++M+ VF ++DTN DG++S
Sbjct  6    FLKFNYSFSWKPSASRKNVVKKNSFISRQTSNEGQSFLPKEEEMKWVFQKFDTNKDGKVS  65

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFT  574
            +EE+K A + +     EA         D D   +IDF+EF+ + N  G I + +IKNAF 
Sbjct  66   LEEYKAAARALDRAIGEAEAVKAFRVMDTDEDGFIDFKEFMKMFNEEGRIKETEIKNAFQ  125

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            VFDL+G+GKISAEEL QVL+R+GE C+L +C+KMVKGVD +GDG ID+ EFT+MM + 
Sbjct  126  VFDLNGDGKISAEELSQVLKRLGESCSLSACKKMVKGVDGNGDGFIDLNEFTRMMMSG  183



>gb|KDP31921.1| hypothetical protein JCGZ_12382 [Jatropha curcas]
Length=186

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQV---FQPNMDDMRKVFSRYDTNGDGRIS  748
            FL+F G   + S  PA + + ++    ++       F+PN D+M+ VF+++DTN DG+IS
Sbjct  3    FLSFHGLSRKPSLKPAYSRIYKQSSSVSSPPPEPKSFEPNEDEMKWVFAKFDTNKDGKIS  62

Query  747  MEEFKLAMQV---IggggteaagafeaadsdgdGYIDFQEFIAV-HNLGGGISKADIKNA  580
             +E+K AM+    +G    E A AFEA D DGDG+IDF+EF+ + +N+G G+   DIK+A
Sbjct  63   RQEYKSAMRAMGKVGMNEAEMAKAFEATDIDGDGFIDFKEFMEMMNNVGDGVKSNDIKSA  122

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            F  FDLDGNGKISAEEL +VL+RMGER +LD+CRKM++GVD DGDGLIDI EF  MMT
Sbjct  123  FQAFDLDGNGKISAEELREVLKRMGERSSLDACRKMIQGVDRDGDGLIDINEFMNMMT  180



>gb|KHN36223.1| Calmodulin-like protein 1 [Glycine soja]
Length=187

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 115/178 (65%), Gaps = 5/178 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERP---KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FL F  SFS K SS     VK+     ++T+   Q F P  ++M+ VF ++DTN DG++S
Sbjct  6    FLKFNYSFSWKPSSSRKNVVKKNSFISRQTSNEGQSFLPKEEEMKWVFQKFDTNKDGKVS  65

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFT  574
            +EE+K A +       EA         D D   +IDF+EF+ + N  G I + +IKNAF 
Sbjct  66   LEEYKAAARASDRAIGEAEAVKAFRVMDTDEDGFIDFKEFMKMFNGEGRIKETEIKNAFQ  125

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            VFDL+G+GKISAEEL QVL+R+GE C+L +C+KMVKGVD +GDG ID+ EFT+MM + 
Sbjct  126  VFDLNGDGKISAEELSQVLKRLGESCSLSACKKMVKGVDGNGDGFIDLNEFTRMMMSG  183



>ref|XP_002310148.2| hypothetical protein POPTR_0007s11130g [Populus trichocarpa]
 gb|EEE90598.2| hypothetical protein POPTR_0007s11130g [Populus trichocarpa]
Length=204

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 125/194 (64%), Gaps = 24/194 (12%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKK--------------------TATSTQVFQPNMDD  799
            FLNF G   R SSS +    + R  +                    ++  ++ FQPN+++
Sbjct  6    FLNFHG-LPRNSSSSSLTPTESRIYREKRQSCSVSKSMQQNVILGQSSNESKSFQPNVEE  64

Query  798  MRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAV  625
            M+ VF ++D N DG+IS +E+K A++ +G G  E+        +D DG  YIDF+EF+ +
Sbjct  65   MKWVFDKFDLNKDGKISRQEYKSALRALGKGLEESEMVKAFQATDIDGDGYIDFKEFMEM  124

Query  624  -HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDG  448
             HN+G G+  +DI++AF VFDLDGNGKISAEEL++VL+R+GER +LD+CRKM++ VD DG
Sbjct  125  MHNMGDGVKSSDIESAFRVFDLDGNGKISAEELMEVLKRLGERSSLDACRKMIRAVDGDG  184

Query  447  DGLIDIKEFTKMMT  406
            DGLID+ EF  MMT
Sbjct  185  DGLIDMNEFMGMMT  198



>ref|XP_003611756.1| Polcalcin Bra r [Medicago truncatula]
 ref|XP_003611760.1| Polcalcin Bra r [Medicago truncatula]
 gb|AES94714.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AES94718.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=189

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 123/177 (69%), Gaps = 7/177 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKE---RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FL   GSFS K  SP     ++   + ++T+ +   FQP  D+M+ VF ++D N DG+IS
Sbjct  6    FLKLHGSFSAKPISPRKNIAEQNSFKLRETSNAEMSFQPKKDEMKWVFEKFDKNKDGKIS  65

Query  747  MEEFKLAMQVIgg---ggteaagafeaadsdgdGYIDFQEFIAVHN-LGGGISKADIKNA  580
            +EE+K A + +        +A  AF+A DSD DG+IDF+EF+ + N  G  I + DIK+A
Sbjct  66   LEEYKAAAKALDKGIICDNDAVKAFKAMDSDKDGFIDFKEFMEMFNGEGSKIKEEDIKSA  125

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            F VFD++G+GKISAEEL Q+ +R+GE C+L +C+KMVKGVDSDGDGLID+ EFT+MM
Sbjct  126  FQVFDINGDGKISAEELSQIFKRLGESCSLSACKKMVKGVDSDGDGLIDLNEFTRMM  182



>ref|XP_007156808.1| hypothetical protein PHAVU_002G019300g [Phaseolus vulgaris]
 gb|ESW28802.1| hypothetical protein PHAVU_002G019300g [Phaseolus vulgaris]
Length=188

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 6/179 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERP----KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRI  751
            FL F  SFS K SS      ++      + +    Q FQP  ++M+ VF ++DTN DG+I
Sbjct  6    FLKFNYSFSWKPSSSRKHLAQKNSFISRQTSNNEGQSFQPKEEEMKWVFQKFDTNKDGKI  65

Query  750  SMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAF  577
            S+EE+K A + +  G  EA         D DG  +IDF+EF+ + N  G I +ADIKNAF
Sbjct  66   SLEEYKAAARALDRGIGEAEAVKAFRVMDSDGDGFIDFREFVEMLNGEGRIKEADIKNAF  125

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             VFDL+G+GKISA+EL QVL+R+GE C+L +C+KMVKGVD +GDG ID+ EFT+MM + 
Sbjct  126  QVFDLNGDGKISAQELSQVLKRLGESCSLSACKKMVKGVDGNGDGFIDLNEFTRMMMSG  184



>ref|XP_003611759.1| Calcium-binding protein CML24 [Medicago truncatula]
 gb|AES94717.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=188

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKE---RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FL F GSFS K +SP     ++   + ++T+++   FQP  D+M+ VF ++DTN DG+IS
Sbjct  6    FLKFHGSFSAKPTSPRKNIAQKNSFKLRETSSTEMSFQPKKDEMKWVFEKFDTNKDGKIS  65

Query  747  MEEFKLAMQVIggg--gteaagafeaadsdgdGYIDFQEFIAVHN-LGGGISKADIKNAF  577
            +EE+K A + +  G    +A  AF   DSD DG+IDF+EF+ + N     I + +IK+AF
Sbjct  66   LEEYKAAAKSLDKGIGDPDAVKAFNVMDSDKDGFIDFKEFMEMFNGENNKIKEEEIKSAF  125

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
             VFD++G+GKISAEEL Q+ +R+GE C+L +C+KMVKGVD DGDGLID+ EFT+MM
Sbjct  126  QVFDINGDGKISAEELSQIFKRLGESCSLSACKKMVKGVDGDGDGLIDLNEFTRMM  181



>ref|XP_010028260.1| PREDICTED: calmodulin-like protein 1 [Eucalyptus grandis]
Length=185

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = -2

Query  858  KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAM--QVIggggteaaga  685
            K+  ++ A + ++++PN ++MR+VF ++D NGDG+I+ EE+KLAM  Q  G    EA  A
Sbjct  27   KDTSQRPAAAPRIYRPNTEEMRRVFDKFDANGDGKITKEEYKLAMGAQGQGISDHEATEA  86

Query  684  feaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMG  505
            F   D+D DG++DF+EF+ VH  GGGI   DI+ AF  +DLDG+GKISAEEL +V++ +G
Sbjct  87   FSVMDADKDGFVDFKEFLEVHGSGGGIKSCDIEGAFRAYDLDGDGKISAEELWEVMKSLG  146

Query  504  ERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            E+C+L+ C++MV+GVD+DGDG +++ EF  MMT
Sbjct  147  EKCSLEDCKRMVRGVDADGDGSVNMDEFMNMMT  179



>ref|XP_011078048.1| PREDICTED: calmodulin-like protein 1 [Sesamum indicum]
Length=174

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 10/174 (6%)
 Frame = -2

Query  921  GFLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            GF NF  SF +KS  P    +++ P     S Q      D+ R++F ++DTNGDG+IS+E
Sbjct  2    GFFNFYRSFRKKS--PTRKEIQKPP-----SFQTRSSFQDETRRIFDKFDTNGDGKISLE  54

Query  741  EFKLAMQVIggggteaagafea---adsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTV  571
            E+K A++V+GGG T  A A ++   AD+DGDG+ID +EF  V++  GG    DI+ AF V
Sbjct  55   EYKQALKVLGGGATTTAEAAKSFRVADADGDGFIDLEEFSKVYSSDGGAKSGDIQAAFRV  114

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            FD DG+GKISAEEL++VL+RMGERC+L+ C++M++GVD DGDGLID+ EF  MM
Sbjct  115  FDTDGDGKISAEELMEVLKRMGERCSLEGCKRMIRGVDGDGDGLIDMDEFINMM  168



>ref|XP_003537323.1| PREDICTED: calmodulin-like protein 1-like [Glycine max]
 gb|KHN42075.1| Calmodulin-like protein 1 [Glycine soja]
Length=187

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 114/178 (64%), Gaps = 5/178 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERP---KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FL F  SFS K SS      K+     ++T+   Q FQP  ++M+ VF ++DTN DG++S
Sbjct  6    FLKFNYSFSWKPSSSRKNVAKKNSFVSRQTSNEGQSFQPTKEEMKWVFQKFDTNRDGKVS  65

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFT  574
            +EE+K A + +     EA         D DG  +ID  EF+ + N  G I + +IKNAF 
Sbjct  66   LEEYKAAARALDRAIGEAEAVKAFRVMDIDGDGFIDLNEFMEMFNGEGRIKETEIKNAFQ  125

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            VFDL+G+GKISAEEL  VL+R+GE C+L +C+KMVKGVD +GDG ID+ EFT+MM + 
Sbjct  126  VFDLNGDGKISAEELSHVLKRLGESCSLSACKKMVKGVDGNGDGFIDLNEFTRMMMSG  183



>emb|CAN70198.1| hypothetical protein VITISV_021219 [Vitis vinifera]
Length=182

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -2

Query  918  FLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL+F+ + S RK     +     R ++ +    +F  NMD+++KVF ++D+N DG+IS E
Sbjct  6    FLDFQYNISKRKYLRKPSRLFSSRDRQNSDLPPIFHLNMDELKKVFDKFDSNRDGKISQE  65

Query  741  EFK--LAMQVIggggteaagafeaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  L   V  G  TE    F+ AD DGDG+IDF+EF+ VH  GGG+   DI++AF  F
Sbjct  66   EYKAVLGALVKEGVRTEVEKIFQVADLDGDGFIDFKEFVEVHKKGGGVKTRDIQSAFRAF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            DL+ +GKI+AEELL+VL R+GERC+L+ CR+MV+GVD+DGDG +DI EFT MMT +
Sbjct  126  DLNRDGKINAEELLEVLGRLGERCSLEECRRMVRGVDTDGDGAVDIDEFTTMMTRS  181



>ref|XP_002285223.1| PREDICTED: calmodulin-like protein 1 [Vitis vinifera]
Length=182

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -2

Query  918  FLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL+F+ + S RK     +     R ++ +    +F  NMD+++KVF ++D+N DG+IS E
Sbjct  6    FLDFQYNISKRKYLRKPSRLFSSRDRQNSDLPPIFHLNMDELKKVFDKFDSNKDGKISEE  65

Query  741  EFK--LAMQVIggggteaagafeaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  L   V  G  TE    F+ AD DGDG+IDF+EF+ VH  GGG+   DI++AF  F
Sbjct  66   EYKAVLGALVKEGVRTEVEKIFQVADLDGDGFIDFKEFVEVHKKGGGVKTRDIQSAFRAF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            DL+ +GKI+AEELL+VL R+GERC+L+ CR+MV+GVD+DGDG +DI EFT MMT +
Sbjct  126  DLNRDGKINAEELLEVLGRLGERCSLEECRRMVRGVDTDGDGAVDIDEFTTMMTRS  181



>ref|XP_010667348.1| PREDICTED: calmodulin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=185

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 109/174 (63%), Gaps = 4/174 (2%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FL+F+ S S+ S++P         K+ ++   +FQPN D+MR+VF R+DTN DG+IS EE
Sbjct  7    FLDFQYSKSKFSTNPKRM-FSFSSKQYSSILPIFQPNEDEMRRVFERFDTNKDGKISQEE  65

Query  738  FKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            +K  ++ +G   +      +           YIDF+EF+A+   GGG+   DI+NAF VF
Sbjct  66   YKAMLRALGKAESMVREVNKIFQVADLNKDGYIDFKEFMALQKDGGGVRAMDIRNAFRVF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            DLD +GKISAEE+ ++L+++GERC L  CR MV   D DGDG I + EF  MMT
Sbjct  126  DLDEDGKISAEEVHEMLKKLGERCTLADCRSMVNAADVDGDGFISMSEFMTMMT  179



>ref|XP_010530885.1| PREDICTED: calmodulin-like protein 1 [Tarenaya hassleriana]
Length=189

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 112/167 (67%), Gaps = 2/167 (1%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEF  736
            L ++ S +R    P+    ++    +A+   V QP++++MR+VF+R+D++ DGRIS  E+
Sbjct  9    LQYKISKNRFLRKPSRMFSRQTSGLSASPASVSQPDINEMRRVFNRFDSDKDGRISQREY  68

Query  735  KLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDL  562
            K  ++ +G               D D   +IDF+EF+ VH  GGG+  +DI+NAF  FDL
Sbjct  69   KAVLRALGQDKAVEEVPKIFKAVDMDRDGFIDFKEFMEVHKAGGGVRTSDIRNAFWTFDL  128

Query  561  DGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEF  421
            +G+GKISAEE++ VLRR+GERC+L+ CR+MV+ VD+DGDGL+++ EF
Sbjct  129  NGDGKISAEEVMSVLRRLGERCSLEDCRRMVRAVDADGDGLVNMDEF  175


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 3/78 (4%)
 Frame = -2

Query  612  GGISKADI---KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDG  442
              +S+ DI   +  F  FD D +G+IS  E   VLR +G+   ++   K+ K VD D DG
Sbjct  38   ASVSQPDINEMRRVFNRFDSDKDGRISQREYKAVLRALGQDKAVEEVPKIFKAVDMDRDG  97

Query  441  LIDIKEFTKMMTAAGTTK  388
             ID KEF ++  A G  +
Sbjct  98   FIDFKEFMEVHKAGGGVR  115



>ref|XP_006423165.1| hypothetical protein CICLE_v10029994mg [Citrus clementina]
 ref|XP_006479349.1| PREDICTED: calmodulin-like protein 1-like [Citrus sinensis]
 gb|ESR36405.1| hypothetical protein CICLE_v10029994mg [Citrus clementina]
Length=187

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 125/178 (70%), Gaps = 9/178 (5%)
 Frame = -2

Query  918  FLNFRGSFSRKSS---SPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FLNF    SRK S   +P  +  KER  +  +  +  + N+ +MR+VF ++DTN DG+IS
Sbjct  6    FLNFYNGLSRKPSVKSTPKESMPKER--QNPSVPRASRSNVQEMRQVFDKFDTNKDGKIS  63

Query  747  MEEFKLAMQVIggggteaagafeaa--dsdgdGYIDFQEFIAV-HNLGGG-ISKADIKNA  580
             +E+  A+ V+G G ++A  A      D+D DGYIDF+EFI + H++G   + K DI+ A
Sbjct  64   QDEYNSALNVLGKGISKAEMAKSFRFIDTDKDGYIDFKEFIEMMHDMGDNRVKKNDIQGA  123

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            F +FDL+G+ KISAEEL++VLR+MGE+ +LDSCRKM++GVD+DGDGLID+ EF  MMT
Sbjct  124  FQLFDLNGDKKISAEELMEVLRKMGEKYSLDSCRKMIRGVDADGDGLIDMDEFMTMMT  181



>emb|CBI32420.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 115/175 (66%), Gaps = 3/175 (2%)
 Frame = -2

Query  921  GFLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISM  745
             FL+F+ + S RK     +     R ++ +    +F  NMD+++KVF ++D+N DG+IS 
Sbjct  5    SFLDFQYNISKRKYLRKPSRLFSSRDRQNSDLPPIFHLNMDELKKVFDKFDSNKDGKISE  64

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTV  571
            EE+K  +  +   G           +D DG  +IDF+EF+ VH  GGG+   DI++AF  
Sbjct  65   EEYKAVLGALVKEGVRTEVEKIFQVADLDGDGFIDFKEFVEVHKKGGGVKTRDIQSAFRA  124

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            FDL+ +GKI+AEELL+VL R+GERC+L+ CR+MV+GVD+DGDG +DI EFT MMT
Sbjct  125  FDLNRDGKINAEELLEVLGRLGERCSLEECRRMVRGVDTDGDGAVDIDEFTTMMT  179



>ref|XP_009367023.1| PREDICTED: calmodulin-like protein 1 [Pyrus x bretschneideri]
Length=190

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAV----KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRI  751
            F  F+    RK  +  A  +    KER K+ + S    QP ++++R VF ++DTN DGRI
Sbjct  6    FFGFQYGTPRKPPNKPAPQMSNISKERSKRYSFSRPSSQPKVEEVRYVFDKFDTNKDGRI  65

Query  750  SMEEFKLAMQVIgg--ggteaagafeaadsdgdGYIDFQEFIAVHNLGGGIS-KADIKNA  580
            S EE+K A++ +       E A  F+A DSDGDG++ F EF+ + N+G   + KADI++A
Sbjct  66   SREEYKSALKTLDKDIAEDEIAKTFKALDSDGDGFVGFTEFVEMFNMGNDEARKADIESA  125

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            F VFDLDGNGKISAEEL  VL+++GE C+L +CR MVKGVDSDGDGLID+ +FTKMM
Sbjct  126  FRVFDLDGNGKISAEELSLVLKKLGENCSLGACRNMVKGVDSDGDGLIDMNDFTKMM  182



>ref|XP_008236514.1| PREDICTED: calmodulin-like protein 1 [Prunus mume]
Length=188

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 121/181 (67%), Gaps = 3/181 (2%)
 Frame = -2

Query  924  SGFLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            + FL+F+ + S RK     +     R ++ +  +  F+PN ++M+ VF ++D+N DG+IS
Sbjct  4    ANFLDFQFNLSKRKFLRKPSHVCSFRDRQNSGLSPSFEPNPNEMKIVFEKFDSNKDGKIS  63

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFT  574
             EE+K  ++ +G G T          +D DG  +I+F+EF+ VH  GGGI   DI+NAF 
Sbjct  64   QEEYKAILRALGKGNTVREVPKIFRIADLDGDGFINFKEFMEVHKKGGGIRTMDIQNAFR  123

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
             FDL+G+GKISAEE+++VLRR+GE C+L+ C++MV+ VD+DGDG++DI EF  MMT +  
Sbjct  124  TFDLNGDGKISAEEVMEVLRRLGESCSLEDCQRMVRAVDTDGDGVVDIDEFMTMMTRSMK  183

Query  393  T  391
            T
Sbjct  184  T  184



>emb|CDY37233.1| BnaA09g08540D [Brassica napus]
Length=189

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  840  TATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaads  667
            +  S  V QP +++MR+VF+R+D++ DG+IS  E+K+ ++ +G            +AAD 
Sbjct  37   SPGSVGVPQPTINEMRRVFNRFDSDKDGKISQTEYKVVLRALGQERAIQDVPKIFKAADL  96

Query  666  dgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLD  487
            DGDG+IDF+EFI  H   GGI   DI+NAF  FDL+G+GKISAEE++ VLR++GERCNL+
Sbjct  97   DGDGFIDFKEFIDAHKRSGGIRSLDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCNLE  156

Query  486  SCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             C++MV+ VD+DGDGL++++EF +MMT +
Sbjct  157  DCKRMVRAVDADGDGLVNMEEFMRMMTQS  185



>ref|XP_009123241.1| PREDICTED: calmodulin-like protein 1 [Brassica rapa]
Length=189

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 108/143 (76%), Gaps = 2/143 (1%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYI  649
            V QP +++MR+VF+R+D++ DG+IS  E+K+ ++ +G            +AAD DGDG+I
Sbjct  43   VPQPTINEMRRVFNRFDSDKDGKISQTEYKVVLRALGQERAIQDVPKIFKAADLDGDGFI  102

Query  648  DFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            DF+EFI  H   GGI   DI+NAF  FDL+G+GKISAEE++ VLR++GERCNL+ C++MV
Sbjct  103  DFKEFIDAHKRSGGIRSLDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCNLEDCKRMV  162

Query  468  KGVDSDGDGLIDIKEFTKMMTAA  400
            + VD+DGDGL++++EF +MMT +
Sbjct  163  RAVDADGDGLVNMEEFMRMMTQS  185



>ref|XP_007156518.1| hypothetical protein PHAVU_003G292700g [Phaseolus vulgaris]
 gb|ESW28512.1| hypothetical protein PHAVU_003G292700g [Phaseolus vulgaris]
Length=185

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  924  SGFLNFRGSFSRKS--SSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRI  751
            + FL+F+ + SRK     P+    ++R + +  ++   QPN D+M++VF ++D+N DG+I
Sbjct  4    TSFLDFQYNLSRKKYLRKPSRLFSRDR-QNSGLNSVCLQPNADEMKRVFDKFDSNKDGKI  62

Query  750  SMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAF  577
            S +E+K+ M+ +G G +        +  D DGDG+I+F+EF+   N GGG+   DI +AF
Sbjct  63   SQQEYKVTMKALGLGDSVHEVPDIFKVVDLDGDGFINFKEFMEAQNKGGGVRAMDINSAF  122

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
              FD +G+GKISAEE+ ++L R+GERC++D CR+MV+ VD+DGDG++D+ EFT MMT
Sbjct  123  RTFDRNGDGKISAEEIREMLARLGERCSIDDCRRMVRAVDTDGDGMVDMDEFTTMMT  179



>ref|XP_002518773.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF43698.1| Polcalcin Jun o, putative [Ricinus communis]
Length=183

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 111/174 (64%), Gaps = 5/174 (3%)
 Frame = -2

Query  918  FLNFRGSFSR-KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL F+   SR K     +     R +K +  T  FQPN+ +MR+VF+++D+N DG+IS +
Sbjct  6    FLEFQYKLSRNKLLRKPSRLFSSRDRKNSLPT--FQPNLSEMRQVFNKFDSNRDGKISQQ  63

Query  741  EFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  ++ +                D DG  +IDF+EF+     GGGI   DI+ AF  F
Sbjct  64   EYKATLRALRQDSMIGDVPKIFQVVDLDGDGFIDFKEFVEAQKKGGGIKTTDIQTAFRAF  123

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            D++G+GKISAEE+++VLRR+GERC L+ CR+MV+ VD+DGDG++++ EF  MMT
Sbjct  124  DVNGDGKISAEEVMEVLRRLGERCGLEDCRRMVRAVDADGDGMVNMDEFMIMMT  177



>ref|XP_002313848.1| calmodulin-related family protein [Populus trichocarpa]
 gb|EEE87803.1| calmodulin-related family protein [Populus trichocarpa]
Length=185

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 116/179 (65%), Gaps = 3/179 (2%)
 Frame = -2

Query  918  FLNFRGSFSR-KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL F+   SR K     +     R ++++     FQPNM +MR+VF ++D+N DG+IS +
Sbjct  6    FLEFQYKLSRNKFLRKPSRLFSSRDRQSSGMLSTFQPNMKEMRQVFDKFDSNKDGKISQQ  65

Query  741  EFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  ++ +G G          +  D DGDG+IDF+EF+     GGGI   DI+ AF  F
Sbjct  66   EYKDTLRALGQGNMLGEVPKIFQVVDLDGDGFIDFKEFVEAQKKGGGIRTTDIQTAFQTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTT  391
            D +G+GKISAEE+++VLRR+GERC+L+ CR+MV  VD DGDG++++ EF  MMT + T+
Sbjct  126  DSNGDGKISAEEVMEVLRRLGERCSLEDCRRMVNAVDIDGDGMVNMDEFMTMMTRSMTS  184



>ref|XP_008339986.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=190

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAV----KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRI  751
            F  F+    RK  +  A  +    KER K+ + S    QP ++++R VF ++DTN DGRI
Sbjct  6    FFGFQYGTPRKPPNKPAPQMSNISKERSKRYSFSRPSSQPKVEEVRYVFDKFDTNKDGRI  65

Query  750  SMEEFKLAMQVIgg--ggteaagafeaadsdgdGYIDFQEFIAVHNLGGGIS-KADIKNA  580
            S EE+K A++ +       E A  F+A DSDGDG++ F EF+ + N+G   + KADI++A
Sbjct  66   SREEYKSALKTLDKDIAEGEIAKTFKALDSDGDGFVGFTEFVEMFNMGNDEARKADIESA  125

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            F VFDLDGNGKIS EEL  VL+++GE C+L +CR MVKGVDSDGDGLID+ EFT MM
Sbjct  126  FRVFDLDGNGKISXEELXLVLKKLGENCSLGACRNMVKGVDSDGDGLIDMNEFTNMM  182



>ref|XP_011000410.1| PREDICTED: calmodulin-like protein 1 [Populus euphratica]
Length=185

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = -2

Query  918  FLNFRGSFSR-KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL F+   SR K     +     R ++++     FQPNM +MR+VF ++D+N DG+IS +
Sbjct  6    FLEFQYKLSRNKFLRKPSRLFSSRDRQSSGILSTFQPNMKEMRQVFDKFDSNKDGKISQQ  65

Query  741  EFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  ++ +G G          +  D DGDGYIDF+EF+     GGGI   DI+ AF  F
Sbjct  66   EYKATLRALGQGSMLGEVPKIFQVVDLDGDGYIDFKEFMEAQKKGGGIRTTDIQTAFQTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTT  391
            D + +GKISAEE+++VLRR+GERC+L+ CR+MV  VD DGDG++++ EF  MMT + T+
Sbjct  126  DSNRDGKISAEEVMEVLRRLGERCSLEDCRRMVNAVDIDGDGMVNMDEFMTMMTQSMTS  184



>ref|XP_008241843.1| PREDICTED: calmodulin-like protein 1 [Prunus mume]
Length=189

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 7/176 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSS---SPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            FL F+    RK     +P  +  KER ++++ S    QP  +++R VF ++DTN DGRIS
Sbjct  7    FLRFQNGSPRKPPNKPAPELSFSKER-QRSSLSRPSSQPKTEEIRYVFDKFDTNKDGRIS  65

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISK-ADIKNAF  577
             EE+K A++ +     EA  A      D DG  +I F+EF+ + N+G   ++ ADI++AF
Sbjct  66   REEYKSALKTLDKEIAEAEIAKTFKALDSDGDGFIGFKEFVEMFNMGADQAREADIESAF  125

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
             +FDLDGNGKISAEEL  VL+++GE C+L +CR MVKGVD++GDGLID+ EF+KMM
Sbjct  126  RLFDLDGNGKISAEELSLVLKKLGENCSLGACRNMVKGVDTNGDGLIDMNEFSKMM  181



>emb|CDY66855.1| BnaCnng52620D [Brassica napus]
Length=189

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYI  649
            V QP +++MR+VF R+D++ DG+IS  E+K+ ++ +G            +AAD DGDG+I
Sbjct  43   VPQPTINEMRRVFDRFDSDKDGKISQTEYKVVLRALGQERAIQDVPKIFKAADLDGDGFI  102

Query  648  DFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            DF+EFI  +   GGI   DI+NAF  FDL+G+GKISAEE++ VLR++GERCNL+ C++MV
Sbjct  103  DFKEFIEANKRSGGIRSLDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCNLEDCKRMV  162

Query  468  KGVDSDGDGLIDIKEFTKMMTAA  400
            + VD+DGDGL++++EF +MMT +
Sbjct  163  RAVDADGDGLVNMEEFMRMMTQS  185



>ref|XP_007201342.1| hypothetical protein PRUPE_ppa011990mg [Prunus persica]
 gb|EMJ02541.1| hypothetical protein PRUPE_ppa011990mg [Prunus persica]
Length=188

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 121/181 (67%), Gaps = 3/181 (2%)
 Frame = -2

Query  924  SGFLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            + FL+F+ + S RK     +     R ++ +  +  F+PN ++M++VF ++D+N DG+IS
Sbjct  4    ANFLDFQYNLSKRKFLRKPSHVFSFRDRQNSGVSPSFEPNPNEMKRVFDKFDSNKDGKIS  63

Query  747  MEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFT  574
              E+K  ++ +G G            AD DGDG+I+F+EF+ VH  GGGI   DI+NAF 
Sbjct  64   QPEYKAILRALGKGNMVGEVPKIFRIADLDGDGFINFKEFMEVHKKGGGIRTIDIQNAFR  123

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
             FDL+G+GKISAEE+++VL R+GE C+L+ C++MV+ VD+DGDG++DI EF  MMT +  
Sbjct  124  TFDLNGDGKISAEEVMEVLGRLGESCSLEDCQRMVRAVDTDGDGVVDIDEFMTMMTRSMK  183

Query  393  T  391
            T
Sbjct  184  T  184



>ref|XP_006409534.1| hypothetical protein EUTSA_v10022869mg [Eutrema salsugineum]
 gb|ESQ50987.1| hypothetical protein EUTSA_v10022869mg [Eutrema salsugineum]
Length=189

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 100/139 (72%), Gaps = 2/139 (1%)
 Frame = -2

Query  816  QPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDF  643
            QP + +MR+VF+R+D + DG+IS  E+K+ ++ +G               D DG  +IDF
Sbjct  45   QPTISEMRRVFNRFDWDKDGKISQTEYKVVLRALGQEKAIEDVPKIFKAVDLDGDGFIDF  104

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            +EFI  H   GG+  +DI+NAF  FDL+G+GKISAEE++ VLR++GERC+L+ C++MV+ 
Sbjct  105  REFIEAHKRSGGVRSSDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCSLEDCKRMVRA  164

Query  462  VDSDGDGLIDIKEFTKMMT  406
            VD+DGDGL++++EF +MMT
Sbjct  165  VDADGDGLVNMEEFMRMMT  183


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            ++++  F  FD D +GKIS  E   VLR +G+   ++   K+ K VD DGDG ID +EF 
Sbjct  49   SEMRRVFNRFDWDKDGKISQTEYKVVLRALGQEKAIEDVPKIFKAVDLDGDGFIDFREFI  108

Query  417  KMMTAAGTTK  388
            +    +G  +
Sbjct  109  EAHKRSGGVR  118



>ref|XP_009375699.1| PREDICTED: calmodulin-like protein 1 [Pyrus x bretschneideri]
Length=199

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = -2

Query  858  KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafe  679
            KER K++  S    QP ++++R VF ++DTN DGRIS EE+K A++ +     E   A  
Sbjct  39   KERSKRSRFSRPSSQPKVEEVRYVFDKFDTNKDGRISREEYKSALKTLDKDIAEGEIAKT  98

Query  678  aadsdgdG--YIDFQEFIAVHNLGGGIS-KADIKNAFTVFDLDGNGKISAEELLQVLRRM  508
                D DG  ++ F EF+   N+G   + KADI++AF VFD+DGNGKISAEEL  VL+++
Sbjct  99   FKALDSDGDGFVGFTEFVETFNMGNDEARKADIESAFRVFDVDGNGKISAEELSLVLKKL  158

Query  507  GERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            GE C+L +CR MVK VDS+GDGLID+ EFTKMM
Sbjct  159  GENCSLGACRNMVKAVDSNGDGLIDMNEFTKMM  191



>ref|NP_001276189.1| uncharacterized protein LOC100803158 [Glycine max]
 gb|ACU18976.1| unknown [Glycine max]
Length=185

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 119/178 (67%), Gaps = 3/178 (2%)
 Frame = -2

Query  924  SGFLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVF-QPNMDDMRKVFSRYDTNGDGRIS  748
            + FL+F+ + SR+      + +  R ++ +    VF QPN D+M++VF ++D+N DG+IS
Sbjct  4    TSFLDFQYNLSRRKYLRKPSRLFSRDRQNSGLKGVFLQPNADEMKQVFDKFDSNKDGKIS  63

Query  747  MEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFT  574
             +E+K  M+ +G G +           D DGDG+I+F+EF+   N GGG+   DI +AF 
Sbjct  64   QQEYKATMKALGMGDSVHEVPNIFRVVDLDGDGFINFKEFMEAQNKGGGVRTMDIHSAFR  123

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             FD +G+G+ISAEE+ + L R+GERC+++ CR+MV+ VD+DGDG++D+ EFT MMT +
Sbjct  124  TFDRNGDGRISAEEVKETLGRLGERCSIEDCRRMVRAVDTDGDGMVDMDEFTTMMTQS  181



>ref|XP_010315235.1| PREDICTED: calmodulin-like protein 1 [Solanum lycopersicum]
Length=185

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 112/178 (63%), Gaps = 3/178 (2%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FL+F+ + S++S       +  R ++ + S  V+QP++D+++KVF R+D+N DG+IS EE
Sbjct  6    FLDFQYNLSKRSFLRKPTRMFTRERQNSRSLPVYQPSVDELKKVFDRFDSNKDGKISPEE  65

Query  738  FKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            +K  ++ +G          +  D        +IDF EF+AV    GG+   D+++AF  F
Sbjct  66   YKAILKAMGKKNLLTREVQKIFDVADADGDGFIDFNEFVAVQKKEGGVKTTDLQSAFHTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            D DG+G+IS +E+ ++ + +G+RC+L  CRKMVK VD++GDG+ID+ EF  MMT   T
Sbjct  126  DKDGDGRISVQEVYELQKGLGQRCSLQDCRKMVKAVDANGDGVIDLDEFVTMMTRTMT  183



>ref|XP_004294813.1| PREDICTED: uncharacterized protein LOC101296846 [Fragaria vesca 
subsp. vesca]
Length=380

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 124/183 (68%), Gaps = 5/183 (3%)
 Frame = -2

Query  939  LDIIMS--GFLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDT  769
            LD  MS   FL+F+ + S RK           R ++ +  T  F+PN+++M++VF ++DT
Sbjct  192  LDSDMSNMSFLDFQYNLSKRKFLRTPTRLFSSRDRQNSGLTPGFEPNLNEMKRVFEKFDT  251

Query  768  NGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKA  595
            N DG+IS ++++  ++ +G G          +  D DGDG+I+F+EF+ VH   GG+   
Sbjct  252  NKDGKISQQDYRAILRALGKGSMVGEVPKIFKLVDLDGDGFINFKEFMEVHKKSGGVKTI  311

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            DI+NAF  FDL+G+GKISAEE+++VL+R+GERC+L+ C++MV+ VD+DGDG++D+ EF  
Sbjct  312  DIQNAFQTFDLNGDGKISAEEVMEVLKRLGERCSLEECQRMVRAVDTDGDGMVDLDEFMT  371

Query  414  MMT  406
            MMT
Sbjct  372  MMT  374



>ref|XP_006299618.1| hypothetical protein CARUB_v10015796mg, partial [Capsella rubella]
 gb|EOA32516.1| hypothetical protein CARUB_v10015796mg, partial [Capsella rubella]
Length=211

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  816  QPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDF  643
            QP++++MR+VF+R+D++ DG+IS  E+K+ ++ +G               D DG  +IDF
Sbjct  69   QPSVNEMRRVFNRFDSDSDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLDGDGFIDF  128

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            +EFI  +   GGI  +DI+NAF  FDL+G+GKISAEE++ VLR++GERC+L+ C++MV+ 
Sbjct  129  REFIDAYKRSGGIRSSDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCSLEDCKRMVRA  188

Query  462  VDSDGDGLIDIKEFTKMMTA  403
            VD+DGDGL++++EF +MM++
Sbjct  189  VDADGDGLVNMEEFMRMMSS  208


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 3/78 (4%)
 Frame = -2

Query  612  GGISKA---DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDG  442
            GG S+    +++  F  FD D +GKIS  E   VLR +G+   ++   K+ K VD DGDG
Sbjct  65   GGFSQPSVNEMRRVFNRFDSDSDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLDGDG  124

Query  441  LIDIKEFTKMMTAAGTTK  388
             ID +EF      +G  +
Sbjct  125  FIDFREFIDAYKRSGGIR  142



>ref|XP_010517286.1| PREDICTED: calmodulin-like protein 1 [Camelina sativa]
Length=187

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = -2

Query  819  FQPNMDDMRKVFSRYDTNGDGRISMEEFKLAM--QVIggggteaagafeaadsdgdGYID  646
            FQP++++MR+VF R+DT+ DG+IS  E+K+ +  Q       +    F+A D DGDG+ID
Sbjct  44   FQPSVNEMRRVFKRFDTDSDGKISQTEYKVVLRAQGQERVIEDVPKIFKAVDLDGDGFID  103

Query  645  FQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            F+EF   +   GGI  +DI+NAF  FDL+G+GKISAEE++ VLR++GERC+L+ C++MV+
Sbjct  104  FREFTDAYKRSGGIRSSDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCSLEDCKRMVR  163

Query  465  GVDSDGDGLIDIKEFTKMMT  406
             VD+DGDGL++++EF +MM+
Sbjct  164  AVDADGDGLVNMEEFMRMMS  183


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD D +GKIS  E   VLR  G+   ++   K+ K VD DGDG ID +EFT 
Sbjct  50   EMRRVFKRFDTDSDGKISQTEYKVVLRAQGQERVIEDVPKIFKAVDLDGDGFIDFREFTD  109

Query  414  MMTAAGTTK  388
                +G  +
Sbjct  110  AYKRSGGIR  118



>ref|XP_010467315.1| PREDICTED: calmodulin-like protein 1 isoform X1 [Camelina sativa]
Length=187

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = -2

Query  819  FQPNMDDMRKVFSRYDTNGDGRISMEEFKLAM--QVIggggteaagafeaadsdgdGYID  646
            FQP++++MR+VF R+DT+ DG+IS  E+K+ +  Q       +    F+A D DGDG+ID
Sbjct  44   FQPSVNEMRRVFKRFDTDSDGKISQTEYKVVLRAQGQERVIEDVPKIFKAVDLDGDGFID  103

Query  645  FQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            F+EF   +   GGI  +DI+NAF  FDL+G+GKISAEE++ VLR++GERC+L+ C++MV+
Sbjct  104  FREFTDAYKRSGGIRSSDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCSLEDCKRMVR  163

Query  465  GVDSDGDGLIDIKEFTKMMT  406
             VD+DGDGL++++EF +MM+
Sbjct  164  AVDADGDGLVNMEEFMRMMS  183


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD D +GKIS  E   VLR  G+   ++   K+ K VD DGDG ID +EFT 
Sbjct  50   EMRRVFKRFDTDSDGKISQTEYKVVLRAQGQERVIEDVPKIFKAVDLDGDGFIDFREFTD  109

Query  414  MMTAAGTTK  388
                +G  +
Sbjct  110  AYKRSGGIR  118



>ref|XP_004288041.1| PREDICTED: calmodulin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=191

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = -2

Query  918  FLNFR-GSFSRKSSSPAAAAV----KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGR  754
            FL F  GS  RKS +  A  +    KER + + +S    QP M+++R VF ++DTN DG+
Sbjct  6    FLGFHYGSSMRKSRNKPAPQLSNVSKERQRSSVSSRSSSQPKMEEIRWVFDKFDTNKDGK  65

Query  753  ISMEEFKLAMQVIggggteaagafeaadsdgd--GYIDFQEFIAVHNLGGG-ISKADIKN  583
            IS EE+K  ++ +    TEA  A      D D    I + EF+ + N+G   + KADI+ 
Sbjct  66   ISREEYKSVLKTLDKEMTEAEIAKTFKALDSDGDDSIGWTEFVEMFNMGADEVKKADIEG  125

Query  582  AFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            AF VFDLDGNGKISAEEL  +L+++GE C+L +C+KMVKGVD DGDGLID+ EFTKMM
Sbjct  126  AFRVFDLDGNGKISAEELSLILKKLGENCSLGACKKMVKGVDIDGDGLIDLNEFTKMM  183



>ref|XP_010467316.1| PREDICTED: calmodulin-like protein 1 isoform X2 [Camelina sativa]
Length=187

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -2

Query  816  QPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDF  643
            QP++++MR+VF+R+DT+ DG+IS  E+K+ ++ +G            +A D DGDG+IDF
Sbjct  45   QPSVNEMRRVFNRFDTDSDGKISQTEYKVVLRALGQERVIDDVPKIFKAVDLDGDGFIDF  104

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            +EF   +   GGI  +DI+NAF  FDL+G+GKISAEE++ VLR++GERC+L+ C++MV+ 
Sbjct  105  REFTDAYKRSGGIRSSDIRNAFWTFDLNGDGKISAEEVMSVLRKLGERCSLEDCKRMVRA  164

Query  462  VDSDGDGLIDIKEFTKMMT  406
            VD+DGDGL++++EF +MM+
Sbjct  165  VDADGDGLVNMEEFMRMMS  183


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = -2

Query  612  GGISKA---DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDG  442
            GG S+    +++  F  FD D +GKIS  E   VLR +G+   +D   K+ K VD DGDG
Sbjct  41   GGFSQPSVNEMRRVFNRFDTDSDGKISQTEYKVVLRALGQERVIDDVPKIFKAVDLDGDG  100

Query  441  LIDIKEFTKMMTAAGTTK  388
             ID +EFT     +G  +
Sbjct  101  FIDFREFTDAYKRSGGIR  118



>ref|XP_008373157.1| PREDICTED: calmodulin-like protein 1 [Malus domestica]
Length=184

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 114/176 (65%), Gaps = 4/176 (2%)
 Frame = -2

Query  924  SGFLNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            + FL+F+ + S RK     +     R ++ +     F+PN ++M+KVF ++D+N DG+IS
Sbjct  4    ANFLDFQYNLSKRKFLRKPSQMFSFRDRQYSGIAPTFEPNPNEMKKVFEKFDSNKDGKIS  63

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFT  574
              E+K  ++ +G G             D D   +I+F+EF+ VH   GGI   DI+NAF 
Sbjct  64   QAEYKAILRALGKGNMIGEVPKIFKFVDLDEDGFINFKEFMEVHK-KGGIRTMDIQNAFR  122

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            +FDL+G+GKISAEE+++VLR + ERCNL+ CR+MV+ VD+DGDG++D+ EF  MMT
Sbjct  123  MFDLNGDGKISAEEVMEVLRGLEERCNLEDCRRMVRAVDTDGDGMVDLDEFMTMMT  178



>gb|KHN31070.1| Calmodulin-like protein 1 [Glycine soja]
Length=277

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 119/178 (67%), Gaps = 3/178 (2%)
 Frame = -2

Query  924  SGFLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVF-QPNMDDMRKVFSRYDTNGDGRIS  748
            + FL+F+ + SR+      + +  R ++ +    VF QPN D+M++VF ++D+N DG+IS
Sbjct  96   TSFLDFQYNLSRRKYLRKPSRLFSRDRQNSGLKGVFLQPNADEMKQVFDKFDSNKDGKIS  155

Query  747  MEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFT  574
             +E+K  M+ +G G +           D DGDG+I+F+EF+   N GGG+   DI +AF 
Sbjct  156  QQEYKATMKALGMGDSVHEVPNIFRVVDLDGDGFINFKEFMEAQNKGGGVRTMDIHSAFR  215

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             FD +G+G+ISAEE+ + L R+GERC+++ CR+MV+ VD+DGDG++D+ EFT MMT +
Sbjct  216  TFDRNGDGRISAEEVKETLGRLGERCSIEDCRRMVRAVDTDGDGMVDMDEFTTMMTQS  273



>gb|KDO51418.1| hypothetical protein CISIN_1g030421mg [Citrus sinensis]
Length=177

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 117/164 (71%), Gaps = 6/164 (4%)
 Frame = -2

Query  885  SSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggg  706
            +  P  +  KER  +  +  +  + N+ +MR+VF ++DTN DG+IS +E+  A+ V+G G
Sbjct  10   NQPPKESMPKER--QNPSVPRASRSNVQEMRQVFDKFDTNKDGKISQDEYNSALSVLGKG  67

Query  705  gteaagafeaa--dsdgdGYIDFQEFIAV-HNLGGG-ISKADIKNAFTVFDLDGNGKISA  538
             ++A  A      D+D DGYIDF+EFI + H++G   + K DI+ AF +FDL+G+ KISA
Sbjct  68   ISKAEMAKSFRFIDTDKDGYIDFKEFIEMMHDMGDNRVKKNDIQGAFQLFDLNGDKKISA  127

Query  537  EELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            EEL++VLR+MGE+ +LDSCRKM++GVD+DGDGLID+ EF  MMT
Sbjct  128  EELMEVLRKMGEKYSLDSCRKMIRGVDADGDGLIDMDEFMTMMT  171



>ref|XP_010269396.1| PREDICTED: calmodulin-like protein 1 [Nelumbo nucifera]
Length=189

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FLNF     ++           + ++ +  +Q FQPN+D+MR+VF  +D + DG+IS ++
Sbjct  8    FLNFLFRLPQRFLPKPTQQFSFKDRQYSGLSQAFQPNVDEMRRVFDEFDADKDGKISKKD  67

Query  738  FKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            +   ++ +     E                 +IDF EF+  H  GGG+   DI+ AF  F
Sbjct  68   YSALLRKLRQQDVECDEVHRIFHVIDLDRDGFIDFDEFMDAHKKGGGVKVIDIRKAFWFF  127

Query  567  DLDGNGKISAEELLQVLRRMGERCNLD--SCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            DLDG+GKIS EE+L+VL R+GE C+LD   C++MV+GVD+DGDG +D++EF  MMT +
Sbjct  128  DLDGDGKISPEEVLEVLNRLGESCSLDLEDCKRMVRGVDTDGDGFVDMEEFMNMMTLS  185



>ref|XP_010098458.1| Calmodulin-like protein 1 [Morus notabilis]
 gb|EXB75076.1| Calmodulin-like protein 1 [Morus notabilis]
Length=145

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            M+++R  F ++DTN DG+IS EE+K A++V+    T+   A      D DG  ++DF+EF
Sbjct  1    MEELRWAFEKFDTNRDGKISREEYKSALRVLDREITDGEIAKAFNALDTDGDGFVDFKEF  60

Query  633  IAVHNLG-GGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
            + + ++G GG+  +DI++AF +FDLDG+GKISAEEL QVL+++GE C++ +CR MVKGVD
Sbjct  61   VEMFDMGSGGVKASDIESAFRLFDLDGDGKISAEELSQVLKQLGESCSIRACRNMVKGVD  120

Query  456  SDGDGLIDIKEFTKMMTAAGTTKR  385
            +DGDG I+I+EFT+MM+   TTK+
Sbjct  121  NDGDGFINIEEFTRMMS---TTKK  141



>ref|NP_179170.1| calmodulin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZQE6.1|CML1_ARATH RecName: Full=Calmodulin-like protein 1 [Arabidopsis thaliana]
 gb|AAD17412.1| putative calmodulin-like protein [Arabidopsis thaliana]
 gb|AAM91578.1| putative calmodulin-like protein [Arabidopsis thaliana]
 gb|AAP21379.1| At2g15680 [Arabidopsis thaliana]
 gb|AEC06429.1| calmodulin-like protein 1 [Arabidopsis thaliana]
Length=187

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = -2

Query  816  QPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDF  643
            QP++++MR+VFSR+D + DG+IS  E+K+ ++ +G            +A D DGDG+IDF
Sbjct  45   QPSVNEMRRVFSRFDLDKDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLDGDGFIDF  104

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            +EFI  +   GGI  +DI+N+F  FDL+G+GKISAEE++ VL ++GERC+L+ C +MV+ 
Sbjct  105  REFIDAYKRSGGIRSSDIRNSFWTFDLNGDGKISAEEVMSVLWKLGERCSLEDCNRMVRA  164

Query  462  VDSDGDGLIDIKEFTKMMTA  403
            VD+DGDGL++++EF KMM++
Sbjct  165  VDADGDGLVNMEEFIKMMSS  184


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 3/78 (4%)
 Frame = -2

Query  612  GGISKA---DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDG  442
            GG S+    +++  F+ FDLD +GKIS  E   VLR +G+   ++   K+ K VD DGDG
Sbjct  41   GGFSQPSVNEMRRVFSRFDLDKDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLDGDG  100

Query  441  LIDIKEFTKMMTAAGTTK  388
             ID +EF      +G  +
Sbjct  101  FIDFREFIDAYKRSGGIR  118



>ref|XP_006346428.1| PREDICTED: calmodulin-like protein 1-like [Solanum tuberosum]
Length=185

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 108/178 (61%), Gaps = 3/178 (2%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FL+F+ + S++S       +  R ++ + S  V+Q ++DD++KVF R+D+N DG IS EE
Sbjct  6    FLDFQYNLSKRSFLRKPTRMFTRERQNSCSLPVYQTSVDDLKKVFDRFDSNKDGNISPEE  65

Query  738  FKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            +K  ++ +G          +  D        +IDF EF+ V    GG+   D++ AF  F
Sbjct  66   YKAILKAMGKKNLLTREVQKIFDVADADGDGFIDFNEFVEVQKKEGGVKTTDLQRAFHTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            D DG+GKIS +E+ ++ + +G+RC+L  CRKMVK VD++GDG+ID+ EF  MMT   T
Sbjct  126  DKDGDGKISVQEVYELQKGLGQRCSLQDCRKMVKAVDANGDGVIDLDEFVTMMTRTMT  183



>ref|XP_010489170.1| PREDICTED: calmodulin-like protein 1 [Camelina sativa]
Length=187

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = -2

Query  816  QPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDF  643
            QP++++MR+VF+R+DT+ DG+IS  E+K+ ++ +G            +A D DGDG+IDF
Sbjct  45   QPSVNEMRRVFNRFDTDSDGKISQTEYKVVLRALGQERVIEDVPKIFKAVDLDGDGFIDF  104

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            +EF   +   GGI  +DI+NAF  FDL+G+ KISAEE++ VLR++GERC+L+ C++MV+ 
Sbjct  105  REFTDAYKRSGGIRSSDIRNAFWTFDLNGDEKISAEEVMSVLRKLGERCSLEDCKRMVRA  164

Query  462  VDSDGDGLIDIKEFTKMMT  406
            VD+DGDGL++++EF +MM+
Sbjct  165  VDADGDGLVNMEEFMRMMS  183


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = -2

Query  612  GGISKA---DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDG  442
            GG S+    +++  F  FD D +GKIS  E   VLR +G+   ++   K+ K VD DGDG
Sbjct  41   GGFSQPSVNEMRRVFNRFDTDSDGKISQTEYKVVLRALGQERVIEDVPKIFKAVDLDGDG  100

Query  441  LIDIKEFTKMMTAAG  397
             ID +EFT     +G
Sbjct  101  FIDFREFTDAYKRSG  115



>ref|XP_010666626.1| PREDICTED: calcium-binding protein CML24-like [Beta vulgaris 
subsp. vulgaris]
Length=195

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 14/185 (8%)
 Frame = -2

Query  918  FLNFRG-SFSRKSSSPAAAAVKE-----RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDG  757
            FLN  G + SRKSS   A+         R      + Q FQ NM +M++VF  YD N DG
Sbjct  6    FLNSYGFNLSRKSSLINASQTSSFKFAARQDSKTKNPQTFQSNMQEMKQVFDTYDKNKDG  65

Query  756  RISMEEFKLAMQVIggggteaagafeaadsdgdG------YIDFQEFIAVHNLGGGISKA  595
            ++S EE+K  ++ I G G       EA+ +          +IDF EF+ +HN    +   
Sbjct  66   KVSKEEYKAMVRAISGKGISVISDTEASKAFQVADKDGDGFIDFNEFMLLHN--NKVKSK  123

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            DI++AF +FD DG+GKI A+EL++VLRRMG+  +L+SC+KM+K VD+DGDGLI++ EF+ 
Sbjct  124  DIESAFKIFDCDGDGKICAKELMEVLRRMGQMYSLESCKKMIKEVDNDGDGLINLAEFST  183

Query  414  MMTAA  400
            MMT+ 
Sbjct  184  MMTST  188



>ref|XP_006487101.1| PREDICTED: calmodulin-like protein 1-like [Citrus sinensis]
Length=185

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = -2

Query  918  FLNFRGSFSR-KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL+F+   S+ K     +     R ++ ++    FQ + ++M++VF R+D+N DG+IS  
Sbjct  6    FLDFQYKISKNKFLRKPSRLFSSRDRQNSSVLPTFQADRNEMKRVFDRFDSNKDGKISQM  65

Query  741  EFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  ++ IG     +         D DG  +IDF+EF+  H  GGGI   DI++AF  F
Sbjct  66   EYKAVLRAIGQASMISEVPKIFQVVDLDGDGFIDFKEFMEAHKKGGGIRTMDIQSAFRTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            D +G+GKISAEE+L++LRR+ E C+L+ CRKMV+ VD+DGDG++++ EF  MMT +
Sbjct  126  DKNGDGKISAEEILEMLRRLEESCSLEDCRKMVRAVDTDGDGMVNMDEFMAMMTRS  181



>ref|XP_006423030.1| hypothetical protein CICLE_v10029360mg [Citrus clementina]
 gb|ESR36270.1| hypothetical protein CICLE_v10029360mg [Citrus clementina]
 gb|KDO59695.1| hypothetical protein CISIN_1g041237mg [Citrus sinensis]
Length=185

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = -2

Query  918  FLNFRGSFSR-KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISME  742
            FL+F+   S+ K     +     R ++ ++    FQ + ++M++VF R+D+N DG+IS  
Sbjct  6    FLDFQYKISKNKFLRKPSRLFSSRDRQNSSLLPTFQADRNEMKRVFDRFDSNKDGKISQM  65

Query  741  EFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            E+K  ++ IG     +         D DG  +IDF+EF+  H  GGGI   DI++AF  F
Sbjct  66   EYKAILRAIGQASMISEVPKIFQVVDLDGDGFIDFKEFMEAHKKGGGIRTMDIQSAFRTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            D + +GKISAEE+L++LRR+GE C+L+ CRKMV+ VD+DGDG++++ EF  MMT +
Sbjct  126  DKNDDGKISAEEILEMLRRLGESCSLEDCRKMVRAVDTDGDGMVNMDEFMTMMTRS  181



>ref|XP_007139465.1| hypothetical protein PHAVU_008G031800g [Phaseolus vulgaris]
 gb|ESW11459.1| hypothetical protein PHAVU_008G031800g [Phaseolus vulgaris]
Length=185

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 113/179 (63%), Gaps = 6/179 (3%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKE----RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRI  751
            FL  + S S   SS   +AV      +  +T+     FQP  ++M+ VF R+DTN DG+I
Sbjct  3    FLKIQNSSSLGHSSQPKSAVPNSNNFKSNQTSNMGCNFQPRSEEMKWVFDRFDTNKDGKI  62

Query  750  SMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAF  577
            S+EE+K A++ +G G   +         D DG   IDF+EF+ + N+   + + +IK+AF
Sbjct  63   SLEEYKAAVRTMGWGIGGSEAVESFQVMDSDGDGSIDFKEFMEMFNVEERVKETEIKSAF  122

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             VFDL+G+GKISAEEL  VL+ +GE C+L++C+KMV GVD +GDG ID+ EF +MM + 
Sbjct  123  QVFDLNGDGKISAEELSHVLKSLGESCSLNACKKMVMGVDGNGDGFIDLNEFMRMMMSG  181



>ref|XP_010107948.1| Calmodulin-like protein 1 [Morus notabilis]
 gb|EXC17348.1| Calmodulin-like protein 1 [Morus notabilis]
Length=186

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 113/175 (65%), Gaps = 2/175 (1%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FL+F+ +  ++      + +  R ++++     F PN D+M+ VF ++DTN DG+IS ++
Sbjct  6    FLDFQYNIIKRKLLQKPSRLFSRDRQSSGLKPSFMPNQDEMKLVFDKFDTNKDGKISQQD  65

Query  738  FKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFD  565
            +K  ++ +G        A      D DG  +I F+EF+  H  GGGI   DI++AF ++D
Sbjct  66   YKAILRSLGKETIPGEVAKIFQIVDLDGDGFISFKEFMDAHKKGGGIKTMDIQSAFRMYD  125

Query  564  LDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            L+ +GKIS  E+++VL+R+GE+C+LD CR+MV+ VD+DGDGL+D+ EF  MMT +
Sbjct  126  LNNDGKISPVEVMEVLKRLGEQCSLDDCRRMVRAVDTDGDGLVDMDEFMTMMTRS  180



>ref|XP_010066024.1| PREDICTED: calmodulin-like protein 1 [Eucalyptus grandis]
Length=185

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -2

Query  852  RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--e  679
            R ++ +     +QPN D+M++VF ++D+N DG+IS +E+K  ++ I              
Sbjct  29   RSRQNSGLLPTYQPNADEMKRVFDKFDSNKDGKISQQEYKAVLRAISKENLIEEVPQIFR  88

Query  678  aadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGER  499
             AD DGDG+IDF+EF+      GGI   DI++AF  FDL+G+GKI+A+E+L+VL  +GER
Sbjct  89   VADLDGDGFIDFKEFMEAQKKEGGIKTKDIQSAFYTFDLNGDGKITADEVLKVLGSLGER  148

Query  498  CNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            C+++ CRKMV+ VD DGDG++D+ EF  MMT
Sbjct  149  CSIEDCRKMVRAVDRDGDGVVDMDEFMTMMT  179



>gb|KFK40036.1| hypothetical protein AALP_AA3G321600 [Arabis alpina]
Length=190

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = -2

Query  846  KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaa  673
            + +  S  V QP +++M++VF+R+D++ DG+IS  E+K+ ++ +G            +A 
Sbjct  35   QSSPRSGGVPQPTINEMKRVFNRFDSDKDGKISQTEYKVVLRALGQEKAIEDVPKIFKAV  94

Query  672  dsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
            D DGDG+IDF+EF+  +   GGI  +DI NAF  FDL+G+GKISAEE++ VLR++GERC+
Sbjct  95   DLDGDGFIDFREFMEAYKRRGGIKSSDICNAFWTFDLNGDGKISAEEVMSVLRKLGERCD  154

Query  492  LDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            L+ C++MVK VD DGDGL++++EF +MM
Sbjct  155  LEDCKRMVKAVDVDGDGLVNMEEFMRMM  182


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 41/78 (53%), Gaps = 3/78 (4%)
 Frame = -2

Query  612  GGISKADI---KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDG  442
            GG+ +  I   K  F  FD D +GKIS  E   VLR +G+   ++   K+ K VD DGDG
Sbjct  41   GGVPQPTINEMKRVFNRFDSDKDGKISQTEYKVVLRALGQEKAIEDVPKIFKAVDLDGDG  100

Query  441  LIDIKEFTKMMTAAGTTK  388
             ID +EF +     G  K
Sbjct  101  FIDFREFMEAYKRRGGIK  118



>ref|XP_008378808.1| PREDICTED: calmodulin-like protein 1 [Malus domestica]
Length=185

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 113/175 (65%), Gaps = 5/175 (3%)
 Frame = -2

Query  915  LNFRGSFS-RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            L+F+ S S RK     +     + +K +     F+PN ++M+KVF ++D+N DG+IS  E
Sbjct  9    LDFQYSLSKRKFLCKPSRIFSFQDRKNSGLALTFEPNHNEMKKVFDKFDSNKDGKISPAE  68

Query  738  FKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFD  565
            +K  ++ +G G             D D   +I+F+EF+ VHN  GGI   DI+NAF +FD
Sbjct  69   YKAILRALGKGSKVGEVQKIFKIVDLDRDGFINFKEFLDVHN--GGIRTIDIQNAFQMFD  126

Query  564  LDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            L+G+GKISAEE+++VL  + E CNLD CR++V+ VD+DGDG++D+ +F  MMT++
Sbjct  127  LNGDGKISAEEVMEVLTGLEESCNLDDCRRIVRAVDTDGDGMVDLNDFMTMMTSS  181



>ref|XP_002523568.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF38763.1| Polcalcin Jun o, putative [Ricinus communis]
Length=140

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = -2

Query  798  MRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI-A  628
            M+ VFS+YD+N DGRIS +E+K A++ +G G  +A  A     +D +G  +IDF+EF   
Sbjct  1    MKWVFSKYDSNRDGRISRQEYKSALKALGKGADDAEMAKAFEATDTNGDGFIDFKEFRDM  60

Query  627  VHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDG  448
            ++NL  G+   DI++AF  F  D +GKISAEEL++VL+ MGERC+L+SCRKM++GVDSDG
Sbjct  61   MNNLEEGVKSNDIRSAFRAFHRDSSGKISAEELMEVLKMMGERCSLESCRKMIRGVDSDG  120

Query  447  DGLIDIKEFTKMMT  406
            DGLIDI EF  MMT
Sbjct  121  DGLIDINEFMNMMT  134



>ref|XP_008338306.1| PREDICTED: calmodulin-like protein 1 [Malus domestica]
Length=199

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 3/139 (2%)
 Frame = -2

Query  816  QPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDF  643
            QP + ++R  F ++D N DGRIS EE+K A++ +     E   A      D DG  +I F
Sbjct  53   QPKVXEVRYXFDKFDMNKDGRISREEYKSALKTLDKDIAEGEIAKTFKALDSDGDGFIGF  112

Query  642  QEFIAVHNLGGGIS-KADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
             EF+   N+G   + KADI++AF VFDLDGNGKISAEEL  VL+++GE C+L +CR MVK
Sbjct  113  TEFVETXNMGNDEARKADIESAFRVFDLDGNGKISAEELSLVLKKLGENCSLGACRNMVK  172

Query  465  GVDSDGDGLIDIKEFTKMM  409
             VDSDGDGLID+ EFTKMM
Sbjct  173  AVDSDGDGLIDMNEFTKMM  191



>ref|XP_007203186.1| hypothetical protein PRUPE_ppa025180mg [Prunus persica]
 gb|EMJ04385.1| hypothetical protein PRUPE_ppa025180mg [Prunus persica]
Length=150

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = -2

Query  813  PNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQ  640
            P  +++R VF ++DTN DGRIS EE+K A++ +     EA  A      D DG  +I F+
Sbjct  5    PKAEEIRYVFDKFDTNKDGRISREEYKSALKTLDKEIAEAEIAKTFKALDSDGDGFIGFK  64

Query  639  EFIAVHNLGGGISK-ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            EF  + N+G   ++ ADI++AF +FDLDGNGKISAEEL  VL+++GE C+L +CR MVKG
Sbjct  65   EFAEMFNMGADQAREADIESAFRLFDLDGNGKISAEELSLVLKKLGENCSLGACRNMVKG  124

Query  462  VDSDGDGLIDIKEFTKMM  409
            VD++GDGLID+ EF+KMM
Sbjct  125  VDTNGDGLIDMNEFSKMM  142



>gb|KFK40032.1| hypothetical protein AALP_AA3G321100 [Arabis alpina]
Length=173

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YI  649
            V QP +++M++VF+R+D++ DG+IS  E+K+ ++ +G               D DG  +I
Sbjct  26   VPQPTINEMKRVFNRFDSDKDGKISQTEYKVVLRALGQEKAIEDVPKIFKAVDLDGDGFI  85

Query  648  DFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            DF EF+  +   GG+  +DI++AF  FDL+G+GKISAEE++ VLR++GERC+L+ C++MV
Sbjct  86   DFMEFMEAYKRSGGLKTSDIRSAFRTFDLNGDGKISAEEVMLVLRKLGERCDLEDCKRMV  145

Query  468  KGVDSDGDGLIDIKEFTKMM  409
            K +D+DGDGL++++EF +MM
Sbjct  146  KAIDADGDGLVNMEEFMRMM  165


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++K  F  FD D +GKIS  E   VLR +G+   ++   K+ K VD DGDG ID  EF +
Sbjct  33   EMKRVFNRFDSDKDGKISQTEYKVVLRALGQEKAIEDVPKIFKAVDLDGDGFIDFMEFME  92

Query  414  MMTAAGTTK  388
                +G  K
Sbjct  93   AYKRSGGLK  101



>ref|XP_003550069.1| PREDICTED: calmodulin-like protein 1-like [Glycine max]
 gb|KHN26468.1| Calmodulin-like protein 1 [Glycine soja]
Length=190

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 107/165 (65%), Gaps = 3/165 (2%)
 Frame = -2

Query  888  KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgg  709
            KS +P +   K   K T+      QP  ++M+ VF ++DTN DG+I++EE+K AM+ +G 
Sbjct  23   KSPTPNSNNFK-SSKHTSNVGCNIQPKSEEMKLVFDKFDTNKDGKITLEEYKAAMRTMGW  81

Query  708  ggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAE  535
            G             D DG  +IDF+EF+ + N+   + + +IK+AF VFDL+G+GKISAE
Sbjct  82   GIEGTEADESFQVMDSDGDGFIDFKEFMDMFNVEETVKETEIKSAFQVFDLNGDGKISAE  141

Query  534  ELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            EL QVL+ +GE C+L +C+KMV GVD +GDG ID+ EF +M+ + 
Sbjct  142  ELSQVLKSLGESCSLSACKKMVMGVDGNGDGFIDLNEFMRMLMSG  186



>gb|ACU18644.1| unknown [Glycine max]
Length=190

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = -2

Query  888  KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgg  709
            KS +P +   K   K T+      QP  ++M+ VF ++DTN DG+I++EE+K AM+ +G 
Sbjct  23   KSPTPNSNNFK-SSKHTSNVGCNIQPKSEEMKLVFDKFDTNKDGKITLEEYKAAMRTMGW  81

Query  708  ggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAE  535
            G             D DG  +IDF+EF+ + N+   + + +IK+AF VFDL+G+GKISAE
Sbjct  82   GIEGTEADESFQVMDSDGDGFIDFKEFMDMFNVEETVKETEIKSAFQVFDLNGDGKISAE  141

Query  534  ELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            EL QVL+ +GE C+L +C+KMV GVD +GDG ID+ EF +M+
Sbjct  142  ELSQVLKSLGESCSLSACKKMVMGVDGNGDGFIDLNEFMRML  183



>ref|XP_004505210.1| PREDICTED: uncharacterized protein LOC101498518 [Cicer arietinum]
Length=407

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 116/177 (66%), Gaps = 2/177 (1%)
 Frame = -2

Query  924  SGFLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISM  745
            + FL+F+ + S++      + +  R ++ +    +FQP++D+M+ VF ++D+N DG+IS 
Sbjct  227  TSFLDFKYNLSKRKYLRKPSRMLSRERQNSGLKNIFQPSVDEMKMVFDKFDSNKDGKISQ  286

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTV  571
            +E+K  ++ +G G +           D DG  +I+F+EF+     GGGI   DI++AF  
Sbjct  287  QEYKATLKSLGMGKSVHEVPDIFRVVDLDGDGFINFEEFMEAQRKGGGIRSLDIQSAFRT  346

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            FD +G+GKISAEE+ ++L ++ ERC+LD CR+MV+ VD++GDG++D+ EF  MMT +
Sbjct  347  FDKNGDGKISAEEVKEMLWKLEERCSLDECRRMVRAVDTNGDGMVDMNEFVAMMTQS  403



>ref|XP_010028261.1| PREDICTED: calmodulin-like protein 1 [Eucalyptus grandis]
 gb|KCW54966.1| hypothetical protein EUGRSUZ_I00935 [Eucalyptus grandis]
Length=182

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 120/180 (67%), Gaps = 10/180 (6%)
 Frame = -2

Query  927  MSGF-LNFRGSFSRKSSSPAA--AAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDG  757
            MS F LN + S S+  S      +  K+  ++ A + ++++P  +++R+VF +YD NGDG
Sbjct  1    MSRFRLNLQYSLSKIPSFKLGKRSLSKDTSQRPAAAPRIYRPTTEEIRRVFDKYDANGDG  60

Query  756  RISMEEFKLAMQVIgg--ggteaagafeaadsdgdGYIDFQEFIAVHN-LGGGISKADIK  586
            +I+ EE+KLA+  +G      EA  AF   D+D DG++DF+EF+ VH+  GGGI   DI+
Sbjct  61   KITKEEYKLAIGALGQGISDHEATEAFSVMDADKDGFVDFKEFLEVHHGPGGGIKSCDIE  120

Query  585  NAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
              F +FDLDG+G+ISAEEL +V+  +G    L+ CR+MV+ VD+DGDG +++ EFT MMT
Sbjct  121  GTFRLFDLDGDGQISAEELWEVMTSVG----LEDCRRMVRAVDTDGDGSVNMDEFTNMMT  176



>gb|EPS63822.1| hypothetical protein M569_10963, partial [Genlisea aurea]
Length=143

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdGYIDF  643
            V+ PN+D++++VF ++D+N DG+IS +E+   ++ +G   TE    FE AD DGDG+IDF
Sbjct  2    VYLPNVDELKQVFDKFDSNKDGKISPDEYTAMLRAMGKRSTEVEKIFEVADVDGDGFIDF  61

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            +EF  V  +GGG+   D++ AF  FD + +GKI+ EE+ Q+LR++GERC+L  C KMV+ 
Sbjct  62   KEFTEVQMMGGGVKSMDLQGAFQAFDANNDGKITVEEIYQLLRKLGERCSLQDCNKMVRA  121

Query  462  VDSDGDGLIDIKEFTKMMT  406
            VD++GDG+ID  EF KMMT
Sbjct  122  VDANGDGVIDSDEFFKMMT  140


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++K  F  FD + +GKIS +E   +LR MG+R       K+ +  D DGDG ID KEFT+
Sbjct  9    ELKQVFDKFDSNKDGKISPDEYTAMLRAMGKRST--EVEKIFEVADVDGDGFIDFKEFTE  66

Query  414  MMTAAGTTK  388
            +    G  K
Sbjct  67   VQMMGGGVK  75



>ref|NP_001235680.1| uncharacterized protein LOC100499763 [Glycine max]
 gb|ACU13543.1| unknown [Glycine max]
Length=185

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 117/178 (66%), Gaps = 3/178 (2%)
 Frame = -2

Query  924  SGFLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVF-QPNMDDMRKVFSRYDTNGDGRIS  748
            +  L+F+ S SRK      + +    ++ +    VF QP  D+M++VF ++D+N DG+IS
Sbjct  4    TSLLDFQYSLSRKKYLRKPSRLFSWDRQNSGPKNVFPQPKADEMKQVFDKFDSNKDGKIS  63

Query  747  MEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFT  574
             +E+K  M+ +G G +           D +GDG+I+F+EF+   + GGG+   DI++AF 
Sbjct  64   QQEYKATMKALGMGDSVHEVPNIFRVVDLNGDGFINFKEFMEAQSKGGGVRMMDIQSAFR  123

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             FD +G+G+ISAEE+ ++L ++GERC+++  R+MV+ VD+DGDG++D+ EFT MMT +
Sbjct  124  TFDKNGDGRISAEEVKEMLGKLGERCSIEDSRRMVRAVDTDGDGMVDMDEFTTMMTQS  181



>ref|XP_011088268.1| PREDICTED: calmodulin-like protein 1 [Sesamum indicum]
Length=186

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 107/174 (61%), Gaps = 3/174 (2%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FL+ + + S++      + +  R K+ +    ++ PNM+++++VF+++D N DG+IS EE
Sbjct  7    FLDIQYNLSKRKFLRKPSRMFSRDKQNSGVFPIYWPNMEELKQVFNKFDANKDGKISPEE  66

Query  738  FKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            +K  ++ +G G        +  +        +IDF EF+     GGG+   D++ AF  F
Sbjct  67   YKAILKALGKGNLLTKEVQKIFEVADLDGDGFIDFNEFVEAQKKGGGVKTVDLQRAFQAF  126

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            D D +GKI+ EE+ ++L+++GERC++  CRKMV+ VD++GDG+ID  EF  MMT
Sbjct  127  DKDNDGKITVEEVYELLQKLGERCSIQDCRKMVQAVDTNGDGVIDSDEFIAMMT  180



>gb|ACJ86047.1| unknown [Medicago truncatula]
 gb|AFK48608.1| unknown [Medicago truncatula]
 gb|AES90184.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=196

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYI  649
            +FQP++D+M+ VF ++D+N DG+IS +E+K  ++ +G   +           D DGDG+I
Sbjct  50   IFQPSLDEMKMVFDKFDSNKDGKISQQEYKATLKSLGMEKSVNEVPNIFRVVDLDGDGFI  109

Query  648  DFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            +F+EF+     GGGI   DI+ AF  FD +G+GKISAEE+ ++L ++ ERC+L+ CR+MV
Sbjct  110  NFEEFMEAQKKGGGIRSLDIQTAFRTFDKNGDGKISAEEIKEMLWKLEERCSLEDCRRMV  169

Query  468  KGVDSDGDGLIDIKEFTKMMTAA  400
            + VD+DGDG++D+ EF  MMT +
Sbjct  170  RAVDTDGDGMVDMNEFVAMMTQS  192



>emb|CDO97169.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 108/174 (62%), Gaps = 3/174 (2%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            FL F+    +++     + +  +    ++    +Q ++++ ++VF +YD N DG+IS EE
Sbjct  6    FLGFQYGLPKRNFLRKPSRLFSKDGHNSSKLPAYQQSLEETKQVFDKYDANKDGKISPEE  65

Query  738  FKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFTVF  568
            +K  ++ +G G        +  +        +IDF+EF+ V    GG+  AD++NAF  F
Sbjct  66   YKAILKALGKGNPLTVEVKKIFEVADLDGDGFIDFKEFVEVQKKEGGLKTADLQNAFRTF  125

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            D+DG+GKI+ EE+ ++L+++GERC++  CR+MV+ VD++GDG+ID+ EF  MMT
Sbjct  126  DMDGDGKITVEEVFELLQKLGERCSMKDCRRMVRAVDANGDGVIDMDEFMTMMT  179



>ref|XP_008454944.1| PREDICTED: calmodulin-like protein 1 [Cucumis melo]
Length=184

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -2

Query  846  KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaa  673
            ++++   +  QP++++++++F+++DTN DGRIS  E++  ++ +G G +         A 
Sbjct  32   RQSSGLRRALQPSLEEIKQIFNKFDTNKDGRISKHEYRGILKALGRGSSMEEVQKIFRAV  91

Query  672  dsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
            DSDGDGYI+  EF+ VH  GGG+   +++ AF  FDL+G+ KISAEE+++VL+ +GE+C+
Sbjct  92   DSDGDGYINLNEFMEVHRSGGGVQAKEVEFAFKTFDLNGDRKISAEEVMRVLKGLGEKCS  151

Query  492  LDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
            ++ CR+MV+ VDSDGDG++DI EF  MMT + 
Sbjct  152  IEDCRRMVRAVDSDGDGMVDINEFMTMMTRSA  183



>ref|XP_003524630.2| PREDICTED: calmodulin-like protein 1-like [Glycine max]
 gb|KHN25017.1| Calmodulin-like protein 1 [Glycine soja]
Length=216

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 111/180 (62%), Gaps = 7/180 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSS-----PAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGR  754
            FL F  S S   SS     P      +  K+T+      QP  ++M+ VF ++DTN DG+
Sbjct  33   FLQFHSSNSLGHSSFQPNSPNPNNNIKSSKQTSNVGCNIQPKSEEMKWVFDKFDTNKDGK  92

Query  753  ISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNA  580
            I++EE+K A++ +G G             D DG  +IDF+EF+ + N+   + + +IK+A
Sbjct  93   ITLEEYKAAVRTMGWGIEGTETDESFQVMDSDGDGFIDFKEFMDMFNVEERVKETEIKSA  152

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            F VFDL+G+GKISAEEL QVL+ +GE C+L +C+KMV GVD +GDG ID+ EF +MM + 
Sbjct  153  FQVFDLNGDGKISAEELSQVLKSLGESCSLSACKKMVMGVDRNGDGFIDLNEFMRMMMSC  212



>gb|ACU17234.1| unknown [Glycine max]
Length=189

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 7/180 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKSSSPAAAAVK-----ERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGR  754
            FL F  S S   SS    +       +  K+T+      QP  ++M+ VF ++DTN DG+
Sbjct  6    FLQFHSSNSLGHSSFQPNSPNPNNNIKSSKQTSNVGCNIQPKSEEMKWVFDKFDTNKDGK  65

Query  753  ISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNA  580
            I++EE+K A++ +G G             D DG  +IDF+EF+ + N+   + + +IK+A
Sbjct  66   ITLEEYKAAVRTMGWGIEGTETDESFQVMDSDGDGFIDFKEFMDMFNVEERVKETEIKSA  125

Query  579  FTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            F VFDL+G+GKISAEEL QVL+ +GE C+L +C+KMV GVD +GDG ID+ EF +M  + 
Sbjct  126  FQVFDLNGDGKISAEELSQVLKSLGESCSLSACKKMVMGVDRNGDGFIDLNEFMRMTMSC  185



>gb|KGN43936.1| hypothetical protein Csa_7G073720 [Cucumis sativus]
Length=184

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -2

Query  846  KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaa  673
            ++++   +  QP+ ++++++F+++DTN DGRIS  E++  ++ +G G +         A 
Sbjct  32   RQSSGLRRALQPSSEEIKQIFNKFDTNKDGRISKHEYRGILKALGRGNSMEEVQKIFRAV  91

Query  672  dsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
            DSDGDGYI+  EF+ VH  GGG+   +++ AF  FDL+G+ KISAEE+++VL+ +GE+C+
Sbjct  92   DSDGDGYINLNEFMEVHRSGGGVQAKEVEFAFKTFDLNGDRKISAEEVMRVLKGLGEKCS  151

Query  492  LDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
            ++ CR+MV+ VDSDGDG++DI EF  MMT + 
Sbjct  152  IEDCRRMVRAVDSDGDGMVDINEFMTMMTRSA  183



>ref|XP_009590682.1| PREDICTED: calmodulin-like protein 1 [Nicotiana tomentosiformis]
Length=183

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---Y  652
            V+QP++D++++VF ++DTN DG+IS  E+K  ++ +G          +  D        +
Sbjct  36   VYQPSLDELKRVFDKFDTNKDGKISPGEYKGILRAMGKKNLLTKEVDKIFDVADADGDGF  95

Query  651  IDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            IDF+EF+ V   GGG+   D+++AF  FD DG+GKIS +E+ ++ +R+GE+C+L  CR M
Sbjct  96   IDFKEFVEVQKKGGGVKTIDLQSAFHTFDKDGDGKISVQEVYELQQRLGEQCSLHDCRNM  155

Query  471  VKGVDSDGDGLIDIKEFTKMMTAAGT  394
            V+ VD++GDG+ID++EF  MMT   T
Sbjct  156  VRAVDANGDGVIDLEEFITMMTRTMT  181



>ref|XP_004137114.1| PREDICTED: calmodulin-like protein 1-like [Cucumis sativus]
Length=199

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = -2

Query  852  RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaa  673
            + ++++   +  QP+ ++++++F+++DTN DGRIS  E++  ++ +G G +         
Sbjct  30   KDRQSSGLRRALQPSSEEIKQIFNKFDTNKDGRISKHEYRGILKALGRGNSMEEVQKIFR  89

Query  672  dsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGER  499
              D DG  YI+  EF+ VH  GGG+   +++ AF  FDL+G+ KISAEE+++VL+ +GE+
Sbjct  90   AVDSDGDGYINLNEFMEVHRSGGGVQAKEVEFAFKTFDLNGDRKISAEEVMRVLKGLGEK  149

Query  498  CNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
            C+++ CR+MV+ VDSDGDG++DI EF  MMT + 
Sbjct  150  CSIEDCRRMVRAVDSDGDGMVDINEFMTMMTRSA  183



>ref|XP_009362913.1| PREDICTED: calmodulin-like protein 1 [Pyrus x bretschneideri]
Length=185

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 97/143 (68%), Gaps = 4/143 (3%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YI  649
             F+PN ++M+KVF ++D+N DG+IS  E+K  ++ +G G             D D   +I
Sbjct  41   TFEPNHNEMKKVFDKFDSNKDGKISSAEYKAILRALGKGSKVGQVQKILKIVDLDRDGFI  100

Query  648  DFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            +F++F+ VHN  GGI   DI+NAF  FDL+G+GKIS EE+++VL  + E CN+D CR++V
Sbjct  101  NFKDFMDVHN--GGIRTIDIQNAFQTFDLNGDGKISTEEVMEVLTGLVESCNIDDCRRIV  158

Query  468  KGVDSDGDGLIDIKEFTKMMTAA  400
            + VD+DGDG++D+ +F  MMT +
Sbjct  159  RAVDTDGDGMVDLNDFMTMMTRS  181



>ref|XP_003607987.1| Calmodulin-like protein [Medicago truncatula]
Length=388

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYI  649
            +FQP++D+M+ VF ++D+N DG+IS +E+K  ++ +G   +           D DGDG+I
Sbjct  242  IFQPSLDEMKMVFDKFDSNKDGKISQQEYKATLKSLGMEKSVNEVPNIFRVVDLDGDGFI  301

Query  648  DFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            +F+EF+     GGGI   DI+ AF  FD +G+GKISAEE+ ++L ++ ERC+L+ CR+MV
Sbjct  302  NFEEFMEAQKKGGGIRSLDIQTAFRTFDKNGDGKISAEEIKEMLWKLEERCSLEDCRRMV  361

Query  468  KGVDSDGDGLIDIKEFTKMMTAA  400
            + VD+DGDG++D+ EF  MMT +
Sbjct  362  RAVDTDGDGMVDMNEFVAMMTQS  384



>ref|XP_009607778.1| PREDICTED: calmodulin-like protein 1 [Nicotiana tomentosiformis]
Length=185

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 106/171 (62%), Gaps = 7/171 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKS--SSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISM  745
            FL+F+ + S++S    P     KER  + +    ++Q ++D+++KVF ++D+N DG+IS 
Sbjct  6    FLDFQYNLSKRSFLRKPTRMFTKER--QNSGLLPIYQLSVDELKKVFDKFDSNKDGKISP  63

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFT  574
            EE+K  ++ +G          +  D        +IDF+EF+      GG+   D+K+AF 
Sbjct  64   EEYKAILKSMGKKNLLTREVQKIFDVADANGDGFIDFKEFVEAQKKEGGVKTMDLKSAFH  123

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEF  421
             FD DG+GKIS +E+ ++ + +G+RC+L  CRKMVK VD++GDG+ID+ EF
Sbjct  124  TFDKDGDGKISVQEVYELQKGLGQRCSLQDCRKMVKAVDANGDGVIDLDEF  174



>gb|KCW63782.1| hypothetical protein EUGRSUZ_G01446 [Eucalyptus grandis]
Length=139

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = -2

Query  798  MRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAV  625
            M++VF ++D+N DG+IS +E+K  ++ I               AD DGDG+IDF+EF+  
Sbjct  1    MKRVFDKFDSNKDGKISQQEYKAVLRAISKENLIEEVPQIFRVADLDGDGFIDFKEFMEA  60

Query  624  HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGD  445
                GGI   DI++AF  FDL+G+GKI+A+E+L+VL  +GERC+++ CRKMV+ VD DGD
Sbjct  61   QKKEGGIKTKDIQSAFYTFDLNGDGKITADEVLKVLGSLGERCSIEDCRKMVRAVDRDGD  120

Query  444  GLIDIKEFTKMMT  406
            G++D+ EF  MMT
Sbjct  121  GVVDMDEFMTMMT  133



>emb|CDX99691.1| BnaC04g34480D [Brassica napus]
Length=158

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            MDD+R+VF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  EF
Sbjct  14   MDDIRRVFQRFDKNGDGKISVDELKEVIRALSPNASPEETVKMMKQFDLDGNGFIDMDEF  73

Query  633  -----IAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
                 I V+  GGG SK D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  CRKM+
Sbjct  74   VSLFQIGVNQGGGGNSKNDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCRKMI  133

Query  468  KGVDSDGDGLIDIKEFTKMMTAAGT  394
              VD+DGDG ++ +EF  MM   G 
Sbjct  134  SKVDTDGDGCVNFEEFKLMMNNGGA  158



>ref|XP_004166667.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-like protein 1-like 
[Cucumis sativus]
Length=183

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 107/152 (70%), Gaps = 3/152 (2%)
 Frame = -2

Query  846  KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaa  673
            ++++   +  QP+ ++++++F+++DTN DGRIS  E++  ++ +G G +         A 
Sbjct  32   RQSSGLRRALQPSSEEIKQIFNKFDTNKDGRISKHEYRGILKALGRGNSMEEVQKIFRAV  91

Query  672  dsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
            DSDGDGYI+  EF+ VH   GG+   +++ AF  FDL+G+ KISAEE+++VL+ +GE+C+
Sbjct  92   DSDGDGYINLNEFMEVHR-SGGVQAKEVEFAFKTFDLNGDRKISAEEVMRVLKGLGEKCS  150

Query  492  LDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
            ++ CR+MV+ VDSDGDG++DI EF  MMT + 
Sbjct  151  IEDCRRMVRAVDSDGDGMVDINEFMTMMTRSA  182



>ref|XP_008457835.1| PREDICTED: probable calcium-binding protein CML32 [Cucumis melo]
Length=190

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 106/156 (68%), Gaps = 5/156 (3%)
 Frame = -2

Query  861  VKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf  682
            +KER   ++TS++ F+PN+++++  F ++D+N DG+IS EE+K A + + G         
Sbjct  26   IKERSNSSSTSSKHFRPNLEEIKWAFEKFDSNKDGKISFEEYKEAHRGLAGSKEITDAEA  85

Query  681  eaadsdgdG----YIDFQEFIAVHNLGGG-ISKADIKNAFTVFDLDGNGKISAEELLQVL  517
            E +    D     ++D +EF+ ++ +  G +   DI++AF V+D +G+GKISAEE++ ++
Sbjct  86   EKSFKLVDADGDGFVDLKEFVELYTMSSGEVKVGDIESAFKVYDSNGDGKISAEEVMGIM  145

Query  516  RRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            + +GE   L++C++MVKGVD DGDG IDI+EF+K+M
Sbjct  146  KILGENTTLNACKQMVKGVDMDGDGFIDIQEFSKLM  181



>ref|XP_009772538.1| PREDICTED: calmodulin-like protein 1 [Nicotiana sylvestris]
Length=185

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 105/171 (61%), Gaps = 7/171 (4%)
 Frame = -2

Query  918  FLNFRGSFSRKS--SSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISM  745
            FL+ + + S++S    P     KER  + +    ++Q ++D+++KVF ++D+N DG+IS 
Sbjct  6    FLDIKYNLSKRSFLRKPTRMFTKER--QNSGLLPIYQLSVDELKKVFDKFDSNKDGKISP  63

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAFT  574
            EE+K  ++ +G          +  D        +IDF+EF+      GG+   D+K+AF 
Sbjct  64   EEYKAILKSMGKKNLLTREVQKIFDVADANGDGFIDFKEFVEAQKKEGGVKTMDLKSAFH  123

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEF  421
             FD DG+GKIS +E+ ++ + +G+RC+L  CRKMVK VD++GDG+ID+ EF
Sbjct  124  TFDKDGDGKISVQEVYELQKGLGQRCSLQDCRKMVKAVDANGDGVIDLDEF  174



>gb|EYU37682.1| hypothetical protein MIMGU_mgv1a014630mg [Erythranthe guttata]
Length=183

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 95/144 (66%), Gaps = 3/144 (2%)
 Frame = -2

Query  843  KTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsd  664
            + + +  ++ PN++++++VF+++D+N DG+IS EE+K  ++ +G G           +  
Sbjct  29   QNSGTLPMYLPNIEELKQVFNKFDSNKDGKISPEEYKAVLKALGKGNLLTKEVQNIFEVA  88

Query  663  gdG---YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
                  +IDF EF+ V   GGG+  AD++ AF  FD D +GKI+ EE+ ++L+++GERC+
Sbjct  89   DLDGDGFIDFNEFVEVQRKGGGVKAADLQRAFQAFDKDNDGKITVEEVHELLKKLGERCS  148

Query  492  LDSCRKMVKGVDSDGDGLIDIKEF  421
            L  C+KMV+ VD++GDG+ID  EF
Sbjct  149  LRDCQKMVRAVDANGDGVIDSDEF  172



>ref|XP_009790383.1| PREDICTED: calmodulin-like protein 1 [Nicotiana sylvestris]
Length=183

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---Y  652
            V+QP++D++++VF ++DTN DG+IS  E+K  ++ +G          +  D        +
Sbjct  36   VYQPSLDELKRVFDKFDTNKDGKISPGEYKGILRAMGKKNLLTKEVDKIFDVADADGDGF  95

Query  651  IDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            IDF+EF+ V   GGG+   D+++AF  FD DG+GKIS +E+ ++ +R+GE+C+L  CR M
Sbjct  96   IDFKEFVEVQKKGGGVKTIDLQSAFRTFDKDGDGKISVQEVYELQQRLGEQCSLHDCRNM  155

Query  471  VKGVDSDGDGLIDIKEF  421
            V+ VD++GDG+ID +EF
Sbjct  156  VRAVDANGDGVIDFEEF  172



>ref|XP_004148036.1| PREDICTED: calmodulin-like protein 1-like [Cucumis sativus]
 ref|XP_004161723.1| PREDICTED: calmodulin-like protein 1-like [Cucumis sativus]
 gb|KGN62012.1| hypothetical protein Csa_2G286450 [Cucumis sativus]
Length=190

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 112/181 (62%), Gaps = 8/181 (4%)
 Frame = -2

Query  927  MSGFLNFRGSFSRKSSSPAAA---AVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDG  757
            MS  L    S S K  S   +    +KER   ++ S++ F+PN+++++  F ++D+N DG
Sbjct  1    MSSLLKLFRSCSGKRPSKNTSFSIPIKERSNSSSPSSKHFRPNLEEIKWAFEKFDSNKDG  60

Query  756  RISMEEFKLAMQVIggggteaagafeaadsdgdG----YIDFQEFIAVHNLGGG-ISKAD  592
            +IS EE+K A + + G         E +    D     ++D +EF+ ++ +  G +   D
Sbjct  61   KISFEEYKEAHRGLAGSKEITDAEAEKSFKLVDVDGDGFVDLKEFVELYTMSSGEVKVGD  120

Query  591  IKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKM  412
            I++AF V+D +G+GKISAEE++ +++ +GE   L +C++MVKGVD DGDG ID++EF+K+
Sbjct  121  IESAFKVYDSNGDGKISAEEVMGIMKILGENTTLKACKQMVKGVDMDGDGFIDVQEFSKL  180

Query  411  M  409
            M
Sbjct  181  M  181



>ref|XP_006469245.1| PREDICTED: probable calcium-binding protein CML25-like [Citrus 
sinensis]
Length=212

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 108/195 (55%), Gaps = 19/195 (10%)
 Frame = -2

Query  927  MSGFLNFRGSFSRKSSSPAAAAVKERPKKTATST---------------QVFQPNMDDMR  793
            +    + +   S  S SP  +     P  TATS                 V  P++ ++R
Sbjct  3    LGSIFHLKKKSSFPSMSPNGSQHSPHPLITATSAACNSNRSNSSSNNNNNVIIPDVHELR  62

Query  792  KVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHN  619
            +VF+++D NGDG+IS  E    +  +G   TE        + D DG  ++DF EF+ ++ 
Sbjct  63   QVFNKFDANGDGKISASELGSILTSLGHAATEEELQKMVKEIDADGDGFVDFDEFVELNT  122

Query  618  LGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGD  445
             G   ++   ++K+AF+V+D+DGNG I+AEEL QVLR +G+ C L  CR+M++GVD DGD
Sbjct  123  KGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGD  182

Query  444  GLIDIKEFTKMMTAA  400
            G ID +EF  MMTA 
Sbjct  183  GTIDFEEFKVMMTAG  197



>ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis]
Length=190

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 108/183 (59%), Gaps = 16/183 (9%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQV---------FQPNMDDMRKVFSRYDTNG  763
            + F+  F RK S     +    P    T+ QV          +P+++++ +VF ++D NG
Sbjct  1    MGFKAIFHRKKSKKTDDSDSNSP---TTANQVTGSRSQSLKLKPHIEELEQVFKKFDVNG  57

Query  762  DGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIAVHNLGGGISKA--  595
            DG+IS  E    M  +G    E        +  +DGDG+IDF+EF+ ++  G G  +   
Sbjct  58   DGKISSLELGSIMSSLGHEANEEEVMKMIKEFDADGDGFIDFKEFVELNTQGVGSDEVME  117

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++K+AF V+D+DGNG ISAEEL +V+  +GE C++  CRKM+ GVDSDGDG+ID +EF  
Sbjct  118  NLKDAFDVYDIDGNGSISAEELHKVMGSIGESCSIAECRKMISGVDSDGDGMIDFEEFKV  177

Query  414  MMT  406
            MMT
Sbjct  178  MMT  180



>gb|KDO60746.1| hypothetical protein CISIN_1g029304mg [Citrus sinensis]
Length=195

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 19/178 (11%)
 Frame = -2

Query  879  SPAAAAVKERPKKTATST---------------QVFQPNMDDMRKVFSRYDTNGDGRISM  745
            SP  +     P  TATS                 V  P++ ++R+VF+++D NGDG+IS 
Sbjct  2    SPNGSQHSPHPLITATSAACNSNRSNSSSNNNNNVIIPDVHELRQVFNKFDANGDGKISA  61

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAF  577
             E    +  +G   TE        + D DG  ++DF EF+ ++  G   ++   ++K+AF
Sbjct  62   SELGSILTSLGHAATEEELQKMVREIDADGDGFVDFDEFVELNTKGVDSAEVMENLKDAF  121

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTA  403
            +V+D+DGNG I+AEEL QVLR +G+ C L  CR+M++GVD DGDG ID +EF  MMTA
Sbjct  122  SVYDIDGNGSITAEELHQVLRSLGDDCTLAECRRMIRGVDCDGDGTIDFEEFKVMMTA  179



>gb|KHN37504.1| Calmodulin-like protein 1 [Glycine soja]
Length=139

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  MRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFIAV  625
            M++VF ++D+N DG+IS +E+K  M+ +G G +           D +GDG+I+F+EF+  
Sbjct  1    MKQVFDKFDSNKDGKISQQEYKATMKALGMGDSVHEVPNIFRVVDLNGDGFINFKEFMEA  60

Query  624  HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGD  445
             + GGG+   DI++AF  FD +G+G+ISAEE+ ++L ++GERC+++  R+MV+ VD+DGD
Sbjct  61   QSKGGGVRMMDIQSAFRTFDKNGDGRISAEEVKEMLGKLGERCSIEDSRRMVRAVDTDGD  120

Query  444  GLIDIKEFTKMMTAA  400
            G++D+ EFT MMT +
Sbjct  121  GMVDMDEFTTMMTQS  135



>ref|XP_010925995.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = -2

Query  849  PKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad  670
            P+++  S+++   N  D+++VF+RYDTNGDG+IS  E    M+ +G   ++       A+
Sbjct  4    PQESEKSSELVSVN--DIKRVFTRYDTNGDGKISPSELADVMRALGSEVSDEELKAMMAE  61

Query  669  sdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERC  496
             D DG  ++D +EF+A H  G G  + ++++AF ++DLD +G+ISA+EL  VL+++GE+C
Sbjct  62   LDSDGDGFVDLKEFVAFHR-GLGEKEEELRDAFAMYDLDRDGQISAKELHLVLKQLGEKC  120

Query  495  NLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTK  388
            ++  C +M++ VDSDGDG ++ +EF  MMT  G  K
Sbjct  121  SVHDCSRMIRSVDSDGDGSVNFEEFKMMMTNGGERK  156



>ref|XP_010925997.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 103/156 (66%), Gaps = 5/156 (3%)
 Frame = -2

Query  849  PKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad  670
            P+++  ++++   N  D+ +VF+RYDTNGDG+IS  E    M+ +G   ++       A+
Sbjct  4    PQESEKTSELVSVN--DVERVFTRYDTNGDGKISPSELADVMRALGSEVSDEELKAMMAE  61

Query  669  sdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERC  496
             D DG  ++D +EF+A H  G G  + ++++AF ++DLD +G+ISA+EL  VL+R+GE+C
Sbjct  62   LDSDGDGFVDLKEFVAFHR-GLGEKEGELRDAFAMYDLDRDGQISAKELHLVLKRLGEKC  120

Query  495  NLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTK  388
            ++  C +M++ VDSDGDG ++ +EF  MMT  G  K
Sbjct  121  SVHDCSRMIRSVDSDGDGSVNFEEFKMMMTNGGERK  156



>emb|CDY27652.1| BnaUnng00020D [Brassica napus]
Length=159

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 94/146 (64%), Gaps = 8/146 (5%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            MDD+R+VF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  EF
Sbjct  14   MDDIRRVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVKMMKQFDLDGNGFIDMDEF  73

Query  633  IAVHNLG------GGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            +++  +G      GG SK D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  CRKM
Sbjct  74   VSLFQIGVNQGGGGGNSKNDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCRKM  133

Query  471  VKGVDSDGDGLIDIKEFTKMMTAAGT  394
            +  VD+DGDG ++ +EF  MM   G 
Sbjct  134  ISKVDTDGDGCVNFEEFKLMMNNGGA  159



>ref|XP_009140162.1| PREDICTED: calcium-binding protein CML24 [Brassica rapa]
Length=160

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            MDD+R+VF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  EF
Sbjct  14   MDDIRRVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVKMMKQFDLDGNGFIDMDEF  73

Query  633  IAVHNLG-------GGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRK  475
            +++  +G       GG SK D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  CRK
Sbjct  74   VSLFQIGVNQGGGGGGNSKNDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCRK  133

Query  474  MVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            M+  VD+DGDG ++ +EF  MM   G 
Sbjct  134  MISKVDTDGDGCVNFEEFKLMMNNGGA  160



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = -2

Query  915  LNFRGSFSRKSSS-PAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            + F+  FSRK  S P+A A+      + + +   +  + ++ +VF ++D NGDG+IS  E
Sbjct  1    MGFKSLFSRKKKSIPSATALPLTTTPSRSPSFSSRAQIAELDQVFKKFDVNGDGKISSSE  60

Query  738  FKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAFTV  571
                M  +G    E   +    + D DG  +IDF+EF+ ++  G   ++A  ++K+AF+V
Sbjct  61   LGAIMSSLGQPANEEELSHMILEVDSDGDGFIDFKEFVELNTNGVDQAEALENLKDAFSV  120

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            +D+DGNG ISAEEL +VLR +G+ C++  C+KM+  VDSDGDG+I+ +EF  MM
Sbjct  121  YDIDGNGSISAEELYKVLRSLGDECSIAECKKMISAVDSDGDGMINFEEFKVMM  174


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A++   F  FD++G+GKIS+ EL  ++  +G+  N +    M+  VDSDGDG ID KEF 
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLGQPANEEELSHMILEVDSDGDGFIDFKEFV  98

Query  417  KMMT  406
            ++ T
Sbjct  99   ELNT  102



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 90/139 (65%), Gaps = 2/139 (1%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIgggg--teaagafeaadsdgdGYIDFQEFI  631
            +++ KVFS++DTNGDGRIS+ E    +  +G      E A      D+DGDG+ID  EF 
Sbjct  14   EEVEKVFSKFDTNGDGRISLTELGAILNGLGSATPGDEVARIMSELDTDGDGFIDLNEFK  73

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
            A H  GG  S  ++K AF ++D D NGKISA EL  VLR +GE+C+L  CR+M+  VD D
Sbjct  74   AFHCGGGEDSNKELKEAFDLYDKDKNGKISASELHSVLRSLGEKCSLKDCRRMISSVDVD  133

Query  450  GDGLIDIKEFTKMMTAAGT  394
            GDG ++ +EF KMMT A +
Sbjct  134  GDGCVNFEEFKKMMTRASS  152



>ref|XP_011021780.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=197

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 109/180 (61%), Gaps = 11/180 (6%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQ-------VFQPNMDDMRKVFSRYDTNGDG  757
            + F+  F+RK  S  + +  + P    TST          +P + ++ +VF ++D NGDG
Sbjct  1    MGFKALFNRKKKSKKSDSSVDSPSAIVTSTNGSKSPSIRLRPQVQELEQVFKKFDVNGDG  60

Query  756  RISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIAVHNLGGGISKA--DI  589
            +IS  E    M  +G   TE        +  +DGDG+ID QEF+A++  G   ++   ++
Sbjct  61   KISSAELGSIMASLGHEATEDELKTMITEFDADGDGFIDLQEFVALNTQGVDTNEVMENL  120

Query  588  KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            K+AF+V+D+DGNG ISAEEL +V+  +GE C++  CRK++ GVDSDGDG+ID +EF  MM
Sbjct  121  KDAFSVYDVDGNGSISAEELHKVMASLGEPCSMAECRKIISGVDSDGDGMIDFEEFKVMM  180


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD++G+GKIS+ EL  ++  +G     D  + M+   D+DGDG ID++EF  
Sbjct  46   ELEQVFKKFDVNGDGKISSAELGSIMASLGHEATEDELKTMITEFDADGDGFIDLQEFVA  105

Query  414  MMT  406
            + T
Sbjct  106  LNT  108



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 87/142 (61%), Gaps = 2/142 (1%)
 Frame = -2

Query  819  FQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YID  646
              P M ++ KVF +YDTNGDG+IS+ E    +  +G   T         + D DG  +ID
Sbjct  4    LTPRMKEVEKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMMLEVDTDGDGFID  63

Query  645  FQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
             +EF A H    G +  D+++AF ++D D NGKISA EL  V++ +GE+C+L  CR+M+ 
Sbjct  64   LEEFAAFHCPVEGSNSKDLRDAFDLYDKDKNGKISASELHSVMKGIGEKCSLKDCRRMIS  123

Query  465  GVDSDGDGLIDIKEFTKMMTAA  400
             VD DGDG ++ +EF KMMT A
Sbjct  124  SVDDDGDGSVNFEEFKKMMTRA  145



>ref|XP_006391395.1| hypothetical protein EUTSA_v10019556mg, partial [Eutrema salsugineum]
 gb|ESQ28681.1| hypothetical protein EUTSA_v10019556mg, partial [Eutrema salsugineum]
Length=258

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 91/141 (65%), Gaps = 6/141 (4%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdg--dGYIDFQE  637
            +M+D+RKVF R+D NGDG+IS++E K  ++ +    +         + D   +G+ID  E
Sbjct  12   SMEDIRKVFQRFDKNGDGKISIDELKDVIRALSPTASPEETKSMMKELDLDGNGFIDMDE  71

Query  636  FIAVHNLGGGISKA----DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            F+A+  +G G S      D+K AF ++DLDGNG ISA+EL  V+  +GE+C++  C+KM+
Sbjct  72   FVALFQIGDGNSNGNDAQDLKAAFDLYDLDGNGWISAKELQSVMNNLGEKCSIQDCKKMI  131

Query  468  KGVDSDGDGLIDIKEFTKMMT  406
              VD DGDG ++ +EF KMM+
Sbjct  132  SSVDVDGDGCVNFEEFKKMMS  152



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = -2

Query  915  LNFRGSFSRKSSS-PAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            + F+  FSRK  S P+A A+      + + +   +  + ++ +VF ++D NGDG+IS  E
Sbjct  1    MGFKSLFSRKKKSIPSATALPLTTTPSRSPSFNSRAQIAELDQVFKKFDVNGDGKISSSE  60

Query  738  FKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAFTV  571
                M  +G    E   +    + D DG  +IDF+EF+ ++  G   ++A  ++K+AF+V
Sbjct  61   LGAIMSSLGQPANEEELSHMILEVDSDGDGFIDFKEFVELNTNGVDQAEALENLKDAFSV  120

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            +D+DGNG ISAEEL +VLR +G+ C++  C+KM+  VDSDGDG+I+ +EF  MM
Sbjct  121  YDIDGNGLISAEELYKVLRSLGDECSIAECKKMISAVDSDGDGMINFEEFKVMM  174


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A++   F  FD++G+GKIS+ EL  ++  +G+  N +    M+  VDSDGDG ID KEF 
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLGQPANEEELSHMILEVDSDGDGFIDFKEFV  98

Query  417  KMMT  406
            ++ T
Sbjct  99   ELNT  102



>ref|XP_010450535.1| PREDICTED: calcium-binding protein CML24-like [Camelina sativa]
Length=163

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 94/150 (63%), Gaps = 11/150 (7%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +MDD+RKVF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  14   SMDDIRKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDE  73

Query  636  FIAVHNLGGGISK---------ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDS  484
            F+A+  +G G            +D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  
Sbjct  74   FVALFQIGIGAGGGGNNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQD  133

Query  483  CRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            C+KM+  VD+DGDG ++  EF KMM+  G 
Sbjct  134  CKKMISKVDTDGDGCVNFDEFKKMMSHGGA  163



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (61%), Gaps = 12/176 (7%)
 Frame = -2

Query  915  LNFRGSFSRK---SSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISM  745
            + F+  FSRK   + S AAA +  R    AT  Q+ +     + +VF+++D NGDG+IS 
Sbjct  1    MGFKSLFSRKKKSTPSSAAAPLVMRSPSFATRAQIAE-----LEQVFNKFDVNGDGKISS  55

Query  744  EEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAF  577
             E    M  +G   TE        + D DG  +ID  EF+ ++  G   ++A  ++++AF
Sbjct  56   SELGAIMGSLGHPATEDELRSMILEVDADGDGFIDINEFVELNTKGIDSAEALQNLRDAF  115

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            +V+D DGNG ISAEEL +VL+ +G+ C+L  CRKM+ GVD+DGDG+I+ +EF  MM
Sbjct  116  SVYDKDGNGSISAEELFEVLKSLGDECSLAECRKMIGGVDADGDGMINFEEFKVMM  171


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A+++  F  FD++G+GKIS+ EL  ++  +G     D  R M+  VD+DGDG IDI EF 
Sbjct  36   AELEQVFNKFDVNGDGKISSSELGAIMGSLGHPATEDELRSMILEVDADGDGFIDINEFV  95

Query  417  KMMT  406
            ++ T
Sbjct  96   ELNT  99



>ref|XP_009413607.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 91/139 (65%), Gaps = 4/139 (3%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQE  637
             MD++ KVF+R+D +GDGRIS  E    ++ +G   +        A+ D D   ++D QE
Sbjct  23   RMDELEKVFARFDADGDGRISASELAAVLRALGSDPSPDEIRDMIAEMDADRDGFVDLQE  82

Query  636  FIAVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            F A H   +G G ++A++K+AF ++DLD +G IS +ELL+V+R +GE+C L+ C +M++ 
Sbjct  83   FAAFHRCGVGRGGAEAELKDAFRMYDLDSDGLISVDELLRVMRSLGEKCTLEDCARMIRS  142

Query  462  VDSDGDGLIDIKEFTKMMT  406
            VDSDGDG +  +EF  MMT
Sbjct  143  VDSDGDGSVSFEEFKTMMT  161



>ref|XP_006405836.1| hypothetical protein EUTSA_v10027972mg [Eutrema salsugineum]
 gb|ESQ47289.1| hypothetical protein EUTSA_v10027972mg [Eutrema salsugineum]
Length=159

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 92/148 (62%), Gaps = 9/148 (6%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +M+D+R+VF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  12   SMEDIRQVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDMDE  71

Query  636  FIAVHNLGGGISKA-------DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCR  478
            F+A+  +G             D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  CR
Sbjct  72   FVALFQIGVNQGGGNNNNDFRDLKEAFEIYDLDGNGRISAKELQSVMKNLGEKCSVQDCR  131

Query  477  KMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            KM+  VDSDGDG ++ +EF KMM   G 
Sbjct  132  KMISKVDSDGDGCVNFEEFKKMMNNGGA  159



>ref|XP_010435616.1| PREDICTED: calcium-binding protein CML24 [Camelina sativa]
 ref|XP_010435617.1| PREDICTED: calcium-binding protein CML24 [Camelina sativa]
 ref|XP_010435619.1| PREDICTED: calcium-binding protein CML24 [Camelina sativa]
Length=164

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 12/151 (8%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +MDD+RKVF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  14   SMDDIRKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDE  73

Query  636  FIAVHNLGGGISK----------ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLD  487
            F+A+  +G G             +D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++ 
Sbjct  74   FVALFQIGIGAGGGGGNNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQ  133

Query  486  SCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
             C+KM+  VD+DGDG ++  EF KMM+  G 
Sbjct  134  DCKKMISKVDTDGDGCVNFDEFKKMMSHGGA  164



>ref|XP_002870563.1| hypothetical protein ARALYDRAFT_493755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46822.1| hypothetical protein ARALYDRAFT_493755 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 94/143 (66%), Gaps = 5/143 (3%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +MDD++KVF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  14   SMDDIKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDE  73

Query  636  FIAVHNLGGGIS---KADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            F+A+  +G G     ++D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  C+KM+ 
Sbjct  74   FVALFQIGIGGGGNNRSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCKKMIS  133

Query  465  GVDSDGDGLIDIKEFTKMMTAAG  397
             VD DGDG ++  EF KMM+  G
Sbjct  134  KVDIDGDGCVNFDEFKKMMSNGG  156



>ref|XP_006285942.1| hypothetical protein CARUB_v10007462mg [Capsella rubella]
 gb|EOA18840.1| hypothetical protein CARUB_v10007462mg [Capsella rubella]
Length=163

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 94/150 (63%), Gaps = 11/150 (7%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +MDD+RKVF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  14   SMDDIRKVFQRFDKNGDGKISVDELKEVIRALSPSASPEETVTMMKQFDLDGNGFIDLDE  73

Query  636  FIAVHNLGGGISK---------ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDS  484
            F+A+  +G G            +D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  
Sbjct  74   FVALFQIGIGGGGGGGNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQD  133

Query  483  CRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            C+KM+  VD+DGDG ++  EF KMM+  G 
Sbjct  134  CKKMISKVDTDGDGCVNFDEFKKMMSHGGA  163



>ref|XP_003552973.1| PREDICTED: calcium-binding protein CML24-like isoform 1 [Glycine 
max]
Length=139

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFI  631
            +++RK+FS++D NGDG+IS  E K  M  +G   T        A+   +GDGYID +EF 
Sbjct  4    EEVRKIFSKFDKNGDGKISCAELKEMMAALGSKTTSDEVKRMMAELDRNGDGYIDLKEFG  63

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
              H  GGG  + +++ AF ++DLD NG ISA+EL  V+RR+GE+C+L  CR+M+  VD+D
Sbjct  64   EFHCGGGGDGR-ELREAFELYDLDKNGLISAKELHSVMRRLGEKCSLSDCRRMIGNVDAD  122

Query  450  GDGLIDIKEFTKMMT  406
            GDG ++ +EF KMM+
Sbjct  123  GDGNVNFEEFKKMMS  137


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  606  ISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIK  427
            + + +++  F+ FD +G+GKIS  EL +++  +G +   D  ++M+  +D +GDG ID+K
Sbjct  1    MDEEEVRKIFSKFDKNGDGKISCAELKEMMAALGSKTTSDEVKRMMAELDRNGDGYIDLK  60

Query  426  EFTKMMTAAGTTKR  385
            EF +     G   R
Sbjct  61   EFGEFHCGGGGDGR  74



>ref|XP_002314786.2| hypothetical protein POPTR_0010s11740g [Populus trichocarpa]
 gb|EEF00957.2| hypothetical protein POPTR_0010s11740g [Populus trichocarpa]
Length=197

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 95/141 (67%), Gaps = 4/141 (3%)
 Frame = -2

Query  819  FQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYID  646
             +P ++++ +VF ++D NGDG+IS  E    M  +G   TE        +  +DGDG+ID
Sbjct  40   LRPQVEELEQVFKKFDVNGDGKISSAELGSIMANLGHEATEDELQTMITEFDADGDGFID  99

Query  645  FQEFIAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
             QEF+A++  G   ++   ++K+AF+V+D+DGNG ISAEEL +V+  +GE C++  CRK+
Sbjct  100  LQEFVALNTQGVDTNEVMENLKDAFSVYDVDGNGSISAEELHKVMASLGEPCSMSECRKI  159

Query  471  VKGVDSDGDGLIDIKEFTKMM  409
            + GVDSDGDG+ID +EF  MM
Sbjct  160  ISGVDSDGDGMIDFEEFKVMM  180


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD++G+GKIS+ EL  ++  +G     D  + M+   D+DGDG ID++EF  
Sbjct  46   ELEQVFKKFDVNGDGKISSAELGSIMANLGHEATEDELQTMITEFDADGDGFIDLQEFVA  105

Query  414  MMT  406
            + T
Sbjct  106  LNT  108



>gb|AFK37714.1| unknown [Medicago truncatula]
 gb|KEH34669.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=138

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 93/139 (67%), Gaps = 4/139 (3%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQE  637
            + +++RK+F+++D NGDG+IS  E K  M  +G   T         + D +G  YID +E
Sbjct  2    DQEEVRKIFNKFDKNGDGKISRTELKEMMTALGSKTTTEEVTRMMEELDRNGDGYIDLKE  61

Query  636  FIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
            F  +HN GGG +K +++ AF ++DLD NG ISA+EL  V+RR+GE+C+L  CRKM+  VD
Sbjct  62   FGELHN-GGGDTK-ELREAFEMYDLDKNGLISAKELHAVMRRLGEKCSLGDCRKMIGNVD  119

Query  456  SDGDGLIDIKEFTKMMTAA  400
            +D DG ++ +EF KMM+ +
Sbjct  120  ADADGNVNFEEFKKMMSRS  138


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  606  ISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIK  427
            + + +++  F  FD +G+GKIS  EL +++  +G +   +   +M++ +D +GDG ID+K
Sbjct  1    MDQEEVRKIFNKFDKNGDGKISRTELKEMMTALGSKTTTEEVTRMMEELDRNGDGYIDLK  60

Query  426  EFTKMMTAAGTTKRF  382
            EF ++    G TK  
Sbjct  61   EFGELHNGGGDTKEL  75



>ref|XP_009105203.1| PREDICTED: calcium-binding protein CML24 [Brassica rapa]
 emb|CDX96150.1| BnaA07g25810D [Brassica napus]
Length=153

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 90/142 (63%), Gaps = 2/142 (1%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +M+D+R VF R+D NGDG+IS++E K  +  +    +         +   DG+GYID  E
Sbjct  11   SMEDIRAVFQRFDKNGDGKISIDELKDVIGALSPTASPEETTLMMKEFDLDGNGYIDMDE  70

Query  636  FIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
            F+A+  +  G    D+K AF ++DLDGNG+IS  EL  V++ +GE+C+L+ C++++  VD
Sbjct  71   FVALFQIEDGGDIRDLKEAFDLYDLDGNGRISVNELHSVMKNLGEKCSLEDCKRIISKVD  130

Query  456  SDGDGLIDIKEFTKMMTAAGTT  391
            +DGDG ++ +EF KMM     T
Sbjct  131  ADGDGCVNFEEFKKMMMNGRAT  152



>gb|KCW52116.1| hypothetical protein EUGRSUZ_J01551 [Eucalyptus grandis]
Length=166

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 97/162 (60%), Gaps = 11/162 (7%)
 Frame = -2

Query  843  KTATSTQVFQP-----NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafe  679
            K+  S+ + +P      MD++R VF++YD NGDG+IS +E + A+  +G        A  
Sbjct  3    KSGGSSSIPKPRCSLGTMDEVRLVFNKYDANGDGKISCDELRQALSALGPTAATLEEARR  62

Query  678  aads---dgdGYIDFQEFIAVHNLGGGISK---ADIKNAFTVFDLDGNGKISAEELLQVL  517
            A      +GDG+ID  EF  +   G G  +    ++K  F ++DLD NG+ISA+EL  V+
Sbjct  63   ALSEIDMNGDGFIDLNEFAEIFTWGPGGGRNEQEELKGVFDIYDLDKNGRISAKELHAVM  122

Query  516  RRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTT  391
            +++GE+C+L  CR+M+  VD DGDG +D  EF  MMT + ++
Sbjct  123  KKLGEKCSLSDCRRMIGSVDRDGDGQVDFDEFKAMMTKSSSS  164



>ref|XP_010440886.1| PREDICTED: calcium-binding protein CML24-like [Camelina sativa]
Length=164

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 12/151 (8%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +M+D+RKVF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  14   SMEDIRKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDE  73

Query  636  FIAVHNLGGGISK----------ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLD  487
            F+A+  +G G             +D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++ 
Sbjct  74   FVALFQIGIGAGGGGGNNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQ  133

Query  486  SCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
             C+KM+  VD+DGDG ++  EF KMM+  G 
Sbjct  134  DCKKMISKVDTDGDGCVNFDEFKKMMSHGGA  164



>gb|KDP38112.1| hypothetical protein JCGZ_04755 [Jatropha curcas]
Length=195

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = -2

Query  870  AAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaa  691
            A +  +   ++ + +   +   D+++ VF+++D NGDG+IS  E    M  +G   T+  
Sbjct  24   AGSPPDPLSRSGSQSLRLKHQTDELQHVFNKFDANGDGKISSAELGSIMASLGHKATDEE  83

Query  690  gafeaad--sdgdGYIDFQEFIAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQ  523
                  +  +DGDG+IDFQEF+ ++  G   ++A  ++++AF+V+D+DGNG ISAEEL +
Sbjct  84   LRKMIMEFDADGDGFIDFQEFVELNTQGVDTNEAMENLRDAFSVYDIDGNGSISAEELHR  143

Query  522  VLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            V+  +GE C++  CR+M+ GVD DGDG+ID +EF  MMT  
Sbjct  144  VMGSLGESCSIAECRRMISGVDGDGDGMIDFEEFKVMMTVG  184



>ref|XP_009380286.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 91/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEF  634
            MDD+RKVF+RYD +GDGRIS  E    ++ +G   + A         D+DGDG++D QEF
Sbjct  1    MDDLRKVFARYDADGDGRISASELADVLRSLGSDASPAEVRGMIAEMDADGDGFVDLQEF  60

Query  633  IAVHNLGG---GISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
               H       G  + +++ AF V+DLD NG ISAEEL +VLR +GE+C++  C +M++ 
Sbjct  61   ADFHRRRRRDDGAEERELREAFDVYDLDRNGLISAEELHRVLRLLGEKCSVKDCSRMIRS  120

Query  462  VDSDGDGLIDIKEFTKMMTAAGTTKR  385
             D DGDG ++ +EF KMM+  G   R
Sbjct  121  FDDDGDGSVNFEEFKKMMSNGGVGGR  146



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 9/145 (6%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaaga--feaadsdgdGYIDFQEF  634
            M++M++VF+++D NGDG+IS +E K  +  +G   +           D DG+GY+D  EF
Sbjct  8    MEEMKEVFNKFDKNGDGKISRDELKSILSALGSPPSSDEVDRIMSMMDKDGNGYVDLDEF  67

Query  633  IAVH--NLGGG-----ISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRK  475
            IA H  N+ G          ++K+AF ++DLD NG ISA EL  VL+R+GE+C+L  CR+
Sbjct  68   IAFHGTNINGNGDDSQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGEKCSLSDCRR  127

Query  474  MVKGVDSDGDGLIDIKEFTKMMTAA  400
            M+  VD DGDG ++ +EF KMMT A
Sbjct  128  MISQVDKDGDGNVNFEEFKKMMTNA  152



>ref|XP_007045260.1| Polcalcin Jun o, putative [Theobroma cacao]
 gb|EOY01092.1| Polcalcin Jun o, putative [Theobroma cacao]
Length=199

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 105/173 (61%), Gaps = 9/173 (5%)
 Frame = -2

Query  894  SRKSSSPAAAA----VKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLA  727
            S  + SPA  A      + P +T T   + Q  + ++ +VF ++D NGDG+IS  E    
Sbjct  20   SNLTGSPAVGANGSSFLQSPMRTPT-RNLTQTQLQELEEVFKKFDVNGDGKISSSELGSI  78

Query  726  MQVIggggteaagafeaad--sdgdGYIDFQEFIAVHNLGGGISKA--DIKNAFTVFDLD  559
            M  +G   +E        +  +DGDG I+F+EF+ ++  G    +   ++K+AF+V+D+D
Sbjct  79   MGSLGHKPSEDELQKMIKEFDADGDGSINFKEFVELNTKGVDSDEVLENLKDAFSVYDID  138

Query  558  GNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            GNG ISAEEL +VL+ +G+ C++  CRKM+ GVDSDGDG+ID +EF  MM A 
Sbjct  139  GNGSISAEELHEVLKSLGDECSIAECRKMISGVDSDGDGMIDFEEFKVMMMAG  191



>ref|XP_009801939.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
sylvestris]
Length=185

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 98/169 (58%), Gaps = 7/169 (4%)
 Frame = -2

Query  900  SFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQ  721
            +F +K S P +     R      S    +   +++ +VFS++D NGDG+IS  E    M 
Sbjct  8    NFKKKKSLPNSKTPSPRSSPPVNSPAKIE---EELEQVFSKFDMNGDGKISSLELGCIMA  64

Query  720  VIggggteaagafeaadsdgdG--YIDFQEFIAVH--NLGGGISKADIKNAFTVFDLDGN  553
             +G   TE        + D DG  +ID QEFI ++  N+       ++K AF+VFD+D N
Sbjct  65   SLGNAVTEEESVNMIKEVDADGDGFIDLQEFIELNTKNIDSNEILENLKEAFSVFDVDKN  124

Query  552  GKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            G ISA+EL  V++R+GE C+L+ CR+M+ GVD DGDG+ID +EF  MM 
Sbjct  125  GSISADELQNVMKRLGEECSLEECREMIGGVDCDGDGMIDFEEFKVMMV  173



>ref|XP_006301789.1| hypothetical protein CARUB_v10022253mg [Capsella rubella]
 gb|EOA34687.1| hypothetical protein CARUB_v10022253mg [Capsella rubella]
Length=153

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 90/141 (64%), Gaps = 3/141 (2%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M+D++KVF R+D N DG+IS++EFK  +  +    ++        +   DG+GYID  EF
Sbjct  13   MEDIKKVFQRFDKNNDGKISIDEFKDVIGALSPNASQEETKAMMKEFDLDGNGYIDMDEF  72

Query  633  IAVHNLGGGISK-ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
            +A+  +     +  D+K AF ++DLD NG+ISA EL  V++ +GE+C++  C++M+  VD
Sbjct  73   VALFQVKQDNDQIKDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCKRMISKVD  132

Query  456  SDGDGLIDIKEFTKMMTAAGT  394
            SDGDG +D  EF KMM+  G 
Sbjct  133  SDGDGCVDFDEFKKMMSHGGA  153



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIA  628
            ++ +VF ++D NGDG+IS  E    M  +G   ++       ++ D DG  +I+F+EF+ 
Sbjct  51   ELDQVFKKFDVNGDGKISSSELGAIMSSLGQASSDEELNSMISEVDSDGDGFINFKEFVE  110

Query  627  VHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            ++  G   ++A  ++K+AF+V+D+DGNG ISAEEL +VLR +G+ C++D CRKM+ GVDS
Sbjct  111  LNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGDECSIDECRKMIGGVDS  170

Query  453  DGDGLIDIKEFTKMM  409
            DGDG+I  +EF  MM
Sbjct  171  DGDGMISFEEFKVMM  185


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A++   F  FD++G+GKIS+ EL  ++  +G+  + +    M+  VDSDGDG I+ KEF 
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLGQASSDEELNSMISEVDSDGDGFINFKEFV  109

Query  417  KMMT  406
            ++ T
Sbjct  110  ELNT  113



>ref|NP_198593.1| calcium-binding protein CML24 [Arabidopsis thaliana]
 sp|P25070.2|CML24_ARATH RecName: Full=Calcium-binding protein CML24; AltName: Full=Calmodulin-like 
protein 24; AltName: Full=Touch-induced calmodulin-related 
protein 2 [Arabidopsis thaliana]
 gb|AAB82713.1| calmodulin-related protein [Arabidopsis thaliana]
 dbj|BAB10353.1| calmodulin-related protein 2, touch-induced [Arabidopsis thaliana]
 gb|AAM63501.1| touch-induced calmodulin-related protein TCH2 [Arabidopsis thaliana]
 gb|ABF82612.1| At5g37770 [Arabidopsis thaliana]
 dbj|BAE99241.1| CALMODULIN-RELATED PROTEIN 2 [Arabidopsis thaliana]
 gb|AED94229.1| calcium-binding protein CML24 [Arabidopsis thaliana]
Length=161

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 93/146 (64%), Gaps = 8/146 (5%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +MDD++KVF R+D NGDG+IS++E K  ++ +    +             DG+G+ID  E
Sbjct  14   SMDDIKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDE  73

Query  636  FIAVHNLGGGISK------ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRK  475
            F+A+  +G G         +D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  C+K
Sbjct  74   FVALFQIGIGGGGNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCKK  133

Query  474  MVKGVDSDGDGLIDIKEFTKMMTAAG  397
            M+  VD DGDG ++  EF KMM+  G
Sbjct  134  MISKVDIDGDGCVNFDEFKKMMSNGG  159



>ref|XP_006367611.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=174

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -2

Query  858  KERPKKTATSTQVFQPNM--DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaaga  685
            K+     A S  V  P M  +++++VF+++D NGDG+IS  E    M  +G   TE    
Sbjct  12   KKNDPTPANSPPVNSPIMIEEELQQVFNKFDINGDGKISFSELGFIMASLGTAVTEEESI  71

Query  684  feaadsdgdG--YIDFQEFIAVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVL  517
                + DGDG  +ID  EFI ++  N+       ++K+AF+VFD+D NG ISAEEL +V+
Sbjct  72   EMINEVDGDGDGFIDLSEFIELNTKNIDSDEVTENLKDAFSVFDVDKNGSISAEELQKVM  131

Query  516  RRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            +  GE C+LD CRKM+ GVD DGDG+ID +EF  MM
Sbjct  132  KSTGEECSLDECRKMIGGVDCDGDGMIDFEEFKVMM  167



>ref|XP_003538397.1| PREDICTED: probable calcium-binding protein CML27-like isoformX1 
[Glycine max]
 ref|XP_006591331.1| PREDICTED: probable calcium-binding protein CML27-like isoform 
X2 [Glycine max]
Length=137

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 4/135 (3%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++RK+FS++D NGDG+IS  E K  M  +G   T        A+ D +G  YID +EF 
Sbjct  3    EEVRKIFSKFDKNGDGKISCAELKEMMVALGSKTTSEEVKRMMAELDRNGDGYIDLKEFG  62

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
              H  GGG  + +++ AF ++DLD NG ISA+EL  V+RR+GE+C+L  CR+M+  VD+D
Sbjct  63   EFH-CGGGDGR-ELREAFELYDLDKNGLISAKELHSVMRRLGEKCSLSDCRRMIGNVDAD  120

Query  450  GDGLIDIKEFTKMMT  406
            GDG ++ +EF KMMT
Sbjct  121  GDGNVNFEEFKKMMT  135


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F+ FD +G+GKIS  EL +++  +G +   +  ++M+  +D +GDG ID+KEF +
Sbjct  4    EVRKIFSKFDKNGDGKISCAELKEMMVALGSKTTSEEVKRMMAELDRNGDGYIDLKEFGE  63

Query  414  MMTAAGTTKRF  382
                 G  +  
Sbjct  64   FHCGGGDGREL  74



>ref|XP_004228711.1| PREDICTED: probable calcium-binding protein CML25 [Solanum lycopersicum]
Length=172

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 97/158 (61%), Gaps = 6/158 (4%)
 Frame = -2

Query  858  KERPKKTATSTQVFQPNM--DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaaga  685
            K+     A S  V  P M  ++++ VF+++D NGDG+IS  E    M  +G   TE    
Sbjct  12   KKNDPTPANSPPVNTPVMIEEELQHVFNKFDINGDGKISFSELGFIMASLGTAVTEEESI  71

Query  684  feaadsdgdG--YIDFQEFIAVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVL  517
                + DGDG  +ID +EFI ++  N+       ++K+AF+VFD+D NG ISAEEL +V+
Sbjct  72   EMINEVDGDGDGFIDLREFIELNTKNIDSDEVMENLKDAFSVFDVDKNGSISAEELQKVM  131

Query  516  RRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTA  403
            + +GE C+LD CRKM+ GVD DGDG+ID +EF  MM  
Sbjct  132  KSIGEECSLDECRKMIGGVDCDGDGMIDFEEFKVMMIG  169



>ref|XP_010032678.1| PREDICTED: calcium-binding protein CML24 [Eucalyptus grandis]
Length=147

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 6/145 (4%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---YIDFQE  637
            MD++R VF++YD NGDG+IS +E + A+  +G        A  A          +ID  E
Sbjct  1    MDEVRLVFNKYDANGDGKISCDELRQALSALGPTAATLEEARRALSEIDMNGDGFIDLNE  60

Query  636  FIAVHNLGGG---ISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            F  +   G G     + ++K  F ++DLD NG+ISA+EL  V++++GE+C+L  CR+M+ 
Sbjct  61   FAEIFTWGPGGGRNEQEELKGVFDIYDLDKNGRISAKELHAVMKKLGEKCSLSDCRRMIG  120

Query  465  GVDSDGDGLIDIKEFTKMMTAAGTT  391
             VD DGDG +D  EF  MMT + ++
Sbjct  121  SVDRDGDGQVDFDEFKAMMTKSSSS  145



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIA  628
            ++ +VF ++D NGDG+IS  E    M  +G   ++       ++ D DG  +I+F+EF+ 
Sbjct  56   ELDQVFKKFDVNGDGKISSSELGAIMSSLGQPSSDEELNSMISEVDSDGDGFINFKEFVE  115

Query  627  VHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            ++  G   ++A  ++K+AF+V+D+DGNG ISAEEL +VLR +G+ C++D CR+M+ GVDS
Sbjct  116  LNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGDECSIDECRQMIGGVDS  175

Query  453  DGDGLIDIKEFTKMM  409
            DGDG+I  +EF  MM
Sbjct  176  DGDGMISFEEFKVMM  190


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A++   F  FD++G+GKIS+ EL  ++  +G+  + +    M+  VDSDGDG I+ KEF 
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLGQPSSDEELNSMISEVDSDGDGFINFKEFV  114

Query  417  KMMT  406
            ++ T
Sbjct  115  ELNT  118



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 83/151 (55%), Gaps = 3/151 (2%)
 Frame = -2

Query  840  TATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdg  661
            + +S     P  D++ +VF  YDTNGDG+IS  E +  M  +G    +            
Sbjct  25   SPSSPAATPPVEDELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEAD  84

Query  660  dG---YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNL  490
                 +I+  EF  ++  G G+ +AD++ AF VFD D +GKISA EL  VL+ +GE    
Sbjct  85   ADGDGFINLAEFKDINRAGEGVQEADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTT  144

Query  489  DSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
              CRKM++GVD DGDG++  +EF  MMT  G
Sbjct  145  AQCRKMIRGVDRDGDGMVSFQEFKVMMTGGG  175



>emb|CDY55679.1| BnaC06g43540D [Brassica napus]
Length=153

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 89/142 (63%), Gaps = 2/142 (1%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +M+D+R VF R+D NGDG+IS++E K  +  +    +         +   DG+GYID  E
Sbjct  11   SMEDIRAVFQRFDKNGDGKISIDELKDVIGALSPTASPEETTLMMKEFDLDGNGYIDMDE  70

Query  636  FIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
            F+A+     G    D+K AF ++DLDGNG+IS  EL  V++ +GE+C+++ C++++  VD
Sbjct  71   FVALFQTEDGGDIRDLKEAFDLYDLDGNGRISVNELHSVMKNLGEKCSVEDCKRIISKVD  130

Query  456  SDGDGLIDIKEFTKMMTAAGTT  391
            +DGDG ++ +EF KMM     T
Sbjct  131  ADGDGCVNFEEFKKMMMNGRAT  152



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 85/137 (62%), Gaps = 4/137 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIA  628
            ++ ++FS++D NGDG+IS  E K  +Q +G   +         + D DG  ++D  EF  
Sbjct  6    EIERIFSKFDANGDGKISATELKSLLQALGSETSTEEVKKMMEEMDKDGDGFVDLLEFSE  65

Query  627  VHNLGGGI--SKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
             H   GG   S  +++ AF ++D DGNGKISA EL  VL+ +GE+C+L  C+KM+  VD+
Sbjct  66   FHAGSGGNAGSTKELEEAFRLYDKDGNGKISARELYDVLKSLGEKCSLKDCKKMISSVDA  125

Query  453  DGDGLIDIKEFTKMMTA  403
            DGDG +D +EF KMM A
Sbjct  126  DGDGHVDFEEFKKMMAA  142


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            ++I+  F+ FD +G+GKISA EL  +L+ +G   + +  +KM++ +D DGDG +D+ EF+
Sbjct  5    SEIERIFSKFDANGDGKISATELKSLLQALGSETSTEEVKKMMEEMDKDGDGFVDLLEFS  64

Query  417  KMMTA----AGTTKRF  382
            +        AG+TK  
Sbjct  65   EFHAGSGGNAGSTKEL  80



>gb|KFK41060.1| hypothetical protein AALP_AA2G080200 [Arabis alpina]
Length=163

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 90/151 (60%), Gaps = 13/151 (9%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M D+RKVF R+D NGDG+ISMEE K  +  +    +         +   DG+G+ID  EF
Sbjct  13   MADIRKVFQRFDKNGDGKISMEELKDVIGALSPTASPEETKSMMKEFDLDGNGFIDMDEF  72

Query  633  IAVHNLGGGISKA-----------DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLD  487
            +A+  +G                 D+K AF ++DLD NG+ISA+EL  V++ +GE+C++ 
Sbjct  73   VALFQIGSKHGDETTGDGNNNEIRDLKEAFDLYDLDRNGRISAKELHSVMKNLGEKCSIQ  132

Query  486  SCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
             C++M+  VD+DGDG ++ +EF KMM+  G 
Sbjct  133  DCKRMISKVDADGDGCVNFEEFKKMMSNGGA  163



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 93/141 (66%), Gaps = 3/141 (2%)
 Frame = -2

Query  819  FQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYID  646
            +  +MD++RKVF+++D NGDG+IS +E K  ++ +G   +         +  +DGDGYID
Sbjct  11   YLGSMDEVRKVFNKFDKNGDGKISADELKDVLRSLGSKTSPEEVKRVMDEIDTDGDGYID  70

Query  645  FQEFIAVHNLGGGISKA-DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            F+EF   H  GG      ++K+AF ++D+D NG ISA EL  VL+++GE+ +L  C  M+
Sbjct  71   FKEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGEKSSLKDCVNMI  130

Query  468  KGVDSDGDGLIDIKEFTKMMT  406
            K VD+DGDG ++ +EF KMMT
Sbjct  131  KKVDADGDGHVNFEEFKKMMT  151


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKISA+EL  VLR +G + + +  ++++  +D+DGDG ID KEF+ 
Sbjct  17   EVRKVFNKFDKNGDGKISADELKDVLRSLGSKTSPEEVKRVMDEIDTDGDGYIDFKEFST  76

Query  414  MMTAAGTT  391
               A G+T
Sbjct  77   FHLAGGST  84



>ref|XP_006654163.1| PREDICTED: probable calcium-binding protein CML18-like [Oryza 
brachyantha]
Length=154

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 87/152 (57%), Gaps = 11/152 (7%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            M ++ +VF RYD NGDG+IS EE    ++ +G             + D D   ++D  EF
Sbjct  3    MAELEQVFRRYDANGDGKISAEELASVLRALGAPPGPGEVRRMMDEMDSDRDGFVDLTEF  62

Query  633  IAVHNLGG---------GISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSC  481
             A H  GG           S+A+++ AF ++D D NGKISA EL +VLR++G++C++  C
Sbjct  63   TAFHCSGGSGDSAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADC  122

Query  480  RKMVKGVDSDGDGLIDIKEFTKMMTAAGTTKR  385
             +M++ VD+DGDG ++  EF KMM      +R
Sbjct  123  SRMIRSVDADGDGCVNFDEFKKMMGGGAAGRR  154



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 87/138 (63%), Gaps = 2/138 (1%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            M ++ KVF ++DTNGDG+IS+ E    ++ +G   T         + D DG  +ID +EF
Sbjct  8    MKEVEKVFRKFDTNGDGKISLLELDEVLKALGTKTTPDEAKRMMLEVDTDGDGFIDLEEF  67

Query  633  IAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
             A H    G +  D+++AF ++D D NGKISA EL  V++ +GE+C+L  CR+M+  VD 
Sbjct  68   AAFHCPVEGSNSKDLRDAFDLYDKDKNGKISAAELHSVMKGIGEKCSLKDCRRMISSVDV  127

Query  453  DGDGLIDIKEFTKMMTAA  400
            DGDG ++ +EF KMMT A
Sbjct  128  DGDGSVNFEEFKKMMTKA  145



>gb|KFK44513.1| hypothetical protein AALP_AA1G266400 [Arabis alpina]
Length=194

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 102/174 (59%), Gaps = 17/174 (10%)
 Frame = -2

Query  897  FSRKSSSPAAAAVKERP----KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKL  730
            F++K  +  +++    P    K  +  T++ +     +  VF ++D NGDG+IS +E   
Sbjct  9    FNKKKGNEGSSSGASEPTFLQKARSGKTEIRE-----LEAVFKKFDVNGDGKISSKEIGA  63

Query  729  AMQVIggggteaagafeaad--sdgdGYIDFQEFIAVHNLGGGISKADI----KNAFTVF  568
             M  +G    E        +    GDGYI+F+EF+ ++  G  + + D+    K+AF+V+
Sbjct  64   IMTSLGHEVPEELLQKAITEIDQKGDGYINFEEFVELNTKG--MDQDDVLENLKDAFSVY  121

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            D+DGNG ISAEEL QVLR +G+ C++  CRKM+ GVD DGDG ID +EF  MMT
Sbjct  122  DIDGNGSISAEELHQVLRSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMMT  175



>ref|XP_003568726.2| PREDICTED: probable calcium-binding protein CML18 isoform X1 
[Brachypodium distachyon]
Length=178

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 92/150 (61%), Gaps = 9/150 (6%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M ++ +VF RYD NGDG+IS EE    ++ +G        A    +  +D DG++D +EF
Sbjct  24   MAELEQVFRRYDANGDGKISAEELASVLRALGAAPGPGEVARMMEEMDADRDGFVDLREF  83

Query  633  IAVHNLGGGI-------SKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRK  475
             A H   G         S+A++K AF ++D D NG ISA EL +VLR++G++C++  C +
Sbjct  84   AAFHCGQGAANQEQEAASEAELKEAFRMYDADRNGLISARELHRVLRQLGDKCSVADCSR  143

Query  474  MVKGVDSDGDGLIDIKEFTKMMTAAGTTKR  385
            M++ VD+DGDG ++  EF KMM   G++KR
Sbjct  144  MIRSVDADGDGSVNFDEFKKMMGGGGSSKR  173


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -2

Query  618  LGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGL  439
            L GGI  A+++  F  +D +G+GKISAEEL  VLR +G         +M++ +D+D DG 
Sbjct  18   LAGGIPMAELEQVFRRYDANGDGKISAEELASVLRALGAAPGPGEVARMMEEMDADRDGF  77

Query  438  IDIKEFTKMMTAAGTTKR  385
            +D++EF       G   +
Sbjct  78   VDLREFAAFHCGQGAANQ  95



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  843  KTATSTQ---VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaa  673
            KT T ++   V    MD++ KVF ++DTNGDG+IS+ E    +  +G   +         
Sbjct  3    KTPTDSKEPAVSTAEMDEVAKVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIML  62

Query  672  dsdgdG--YIDFQEFIAVHNLGG---GISKADIKNAFTVFDLDGNGKISAEELLQVLRRM  508
            + D DG  +ID +EF A H  GG   G    +++ AF ++D D NGKI+A EL  V++ +
Sbjct  63   EVDTDGDGFIDLKEFAAFHCPGGETNGDDSKELREAFDLYDKDKNGKITAAELHSVMKSL  122

Query  507  GERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            GE+C+L  CR+M+  VD DGDG ++ +EF KMM+
Sbjct  123  GEKCSLKDCRRMISSVDVDGDGCVNFEEFKKMMS  156


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++   F  FD +G+GKIS  EL  +L  +G   + D  ++++  VD+DGDG ID+KEF  
Sbjct  20   EVAKVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIMLEVDTDGDGFIDLKEFAA  79

Query  414  MMTAAGTT  391
                 G T
Sbjct  80   FHCPGGET  87



>ref|NP_564874.1| calmodulin like 23 [Arabidopsis thaliana]
 sp|Q9C8Y1.1|CML23_ARATH RecName: Full=Probable calcium-binding protein CML23; AltName: 
Full=Calmodulin-like protein 23 [Arabidopsis thaliana]
 gb|AAG52166.1|AC020665_11 calmodulin-related protein; 72976-72503 [Arabidopsis thaliana]
 gb|AAL36209.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AAM51400.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AEE34504.1| calmodulin like 23 [Arabidopsis thaliana]
Length=157

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 90/145 (62%), Gaps = 6/145 (4%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M+D++KVF R+D N DG+IS++E K  +  +    ++        +   DG+G+ID  EF
Sbjct  13   MEDIKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLDGNGFIDLDEF  72

Query  633  IAVHNLGGGISKA----DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            +A+  +    S      D+K AF ++DLD NG+ISA EL  V++ +GE+C++  C++M+ 
Sbjct  73   VALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCQRMIN  132

Query  465  GVDSDGDGLIDIKEFTKMMTAAGTT  391
             VDSDGDG +D +EF KMM   G+ 
Sbjct  133  KVDSDGDGCVDFEEFKKMMMINGSA  157



>gb|AAM67124.1| calmodulin-related protein [Arabidopsis thaliana]
Length=157

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 90/145 (62%), Gaps = 6/145 (4%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M+D++KVF R+D N DG+IS++E K  +  +    ++        +   DG+G+ID  EF
Sbjct  13   MEDIKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLDGNGFIDLDEF  72

Query  633  IAVHNLGGGISKA----DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            +A+  +    S      D+K AF ++DLD NG+ISA EL  V++ +GE+C++  C++M+ 
Sbjct  73   VALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCQRMIS  132

Query  465  GVDSDGDGLIDIKEFTKMMTAAGTT  391
             VDSDGDG +D +EF KMM   G+ 
Sbjct  133  KVDSDGDGCVDFEEFKKMMMINGSA  157



>gb|KHN17940.1| Putative calcium-binding protein CML27, partial [Glycine soja]
Length=141

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 90/135 (67%), Gaps = 7/135 (5%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++RK+FS++D NGDG+IS  E K  M  +G   T        A+ D +G  YI+F EF 
Sbjct  10   EEVRKIFSKFDKNGDGKISCAELKEMMAALGSKTTSDEVKRMMAELDRNGDGYIEFGEF-  68

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
               + GGG  + +++ AF ++DLD NG ISA+EL  V+RR+GE+C+L  CR+M+  VD+D
Sbjct  69   ---HCGGGDGR-ELREAFELYDLDKNGLISAKELHSVMRRLGEKCSLSDCRRMIGNVDAD  124

Query  450  GDGLIDIKEFTKMMT  406
            GDG ++ +EF KMMT
Sbjct  125  GDGNVNFEEFKKMMT  139



>ref|XP_007163392.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
 gb|ESW35386.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
Length=139

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 90/137 (66%), Gaps = 2/137 (1%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++RK+F+++D NGDG+IS  E +  M  +G   T        A+ D +G  YID +EF 
Sbjct  3    EEVRKIFNKFDKNGDGKISCSELRELMAALGSKTTTEEVRRMMAELDRNGDGYIDLKEFG  62

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
              H  GGG    +++ AF ++DLD NG ISA+EL  V+RR+GE+C+L  CR+M+  VD+D
Sbjct  63   EFHCGGGGGDGKELREAFELYDLDKNGLISAKELHSVMRRLGEKCSLSDCRRMIGNVDAD  122

Query  450  GDGLIDIKEFTKMMTAA  400
            GDG ++ +EF KMMT +
Sbjct  123  GDGNVNFEEFKKMMTRS  139



>ref|XP_004517285.1| PREDICTED: probable calcium-binding protein CML27-like [Cicer 
arietinum]
Length=137

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 88/135 (65%), Gaps = 4/135 (3%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            D++R +F+++D NGDG+IS  E    M  +    +E       A+ D +G  YID +EF 
Sbjct  3    DEVRTIFNKFDKNGDGKISSAELMEMMTALRSKTSEEEVNRMMAELDQNGDGYIDLKEFS  62

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
             +H  GG ++  +++ AF ++DLD NG ISA+EL  V+RR+GE+C+L  CR+M+  VD+D
Sbjct  63   ELHKDGGDVT--ELREAFEMYDLDKNGLISAKELHAVMRRLGEKCSLGDCRRMIGNVDAD  120

Query  450  GDGLIDIKEFTKMMT  406
            GDG ++ +EF KMM 
Sbjct  121  GDGNVNFEEFKKMMN  135


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKIS+ EL++++  +  + + +   +M+  +D +GDG ID+KEF++
Sbjct  4    EVRTIFNKFDKNGDGKISSAELMEMMTALRSKTSEEEVNRMMAELDQNGDGYIDLKEFSE  63

Query  414  MMTAAG  397
            +    G
Sbjct  64   LHKDGG  69



>ref|XP_010511464.1| PREDICTED: probable calcium-binding protein CML23 [Camelina sativa]
 ref|XP_010415182.1| PREDICTED: probable calcium-binding protein CML23 [Camelina sativa]
 ref|XP_010470515.1| PREDICTED: probable calcium-binding protein CML23 [Camelina sativa]
Length=158

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 90/146 (62%), Gaps = 8/146 (5%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M+D++KVF R+D N DG+IS++E K  +  +    ++        +   DG+GYID  EF
Sbjct  13   MEDIKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKSMMKEFDLDGNGYIDLDEF  72

Query  633  IA---VHNLGGGISKA---DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            +A   V    G  + +   D+K AF ++DLD NG+ISA EL  V++ +GE+C++  C++M
Sbjct  73   VALFQVKQEDGEDNNSEIRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCKRM  132

Query  471  VKGVDSDGDGLIDIKEFTKMMTAAGT  394
            +  VDSDGDG +D  EF KMMT  G 
Sbjct  133  ISKVDSDGDGCVDFDEFKKMMTNGGA  158



>ref|XP_008809157.1| PREDICTED: probable calcium-binding protein CML18 [Phoenix dactylifera]
Length=174

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 98/157 (62%), Gaps = 5/157 (3%)
 Frame = -2

Query  843  KTATSTQVFQP-NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVI--ggggteaagafeaa  673
            K   S +  +P +M+D+ +VF+RYD NGDG+IS  E    M+ +   G   E        
Sbjct  3    KPQESEKPPEPASMNDVERVFARYDANGDGKISASELANGMRALGFEGSDEELKAMMAEL  62

Query  672  dsdgdGYIDFQEFIAVHNLGGGIS--KADIKNAFTVFDLDGNGKISAEELLQVLRRMGER  499
            DSDGDG++D  +F A H+  G ++  + +++  F +FDLD NG+IS EEL  VL+R+GE+
Sbjct  63   DSDGDGFVDLNDFAAFHSGLGDVAGGERELRGFFAMFDLDKNGRISVEELHLVLKRLGEK  122

Query  498  CNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTK  388
            C++  C +M++ VDSDGDG ++ +EF KM+   G  K
Sbjct  123  CSVQDCAQMIRSVDSDGDGSVNFEEFKKMIGNGGGRK  159



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 88/144 (61%), Gaps = 5/144 (3%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaaga--feaadsdgdGYI  649
            V    MD++ KVF ++D NGDG+IS+ E    +  +G   +           D+DGDG+I
Sbjct  13   VSAAEMDEVAKVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIMLEVDTDGDGFI  72

Query  648  DFQEFIAVHNLGGGISKAD---IKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCR  478
            D +EF A H  GGG    D   ++ AF ++D D NGKI+A EL  V++ +GE+C+L  CR
Sbjct  73   DLKEFAAFHCPGGGTDGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGEKCSLKDCR  132

Query  477  KMVKGVDSDGDGLIDIKEFTKMMT  406
            +M+  VD DGDG ++ +EF KMM+
Sbjct  133  RMISSVDVDGDGCVNFEEFKKMMS  156


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++   F  FD +G+GKIS  EL  +L  +G   + D  ++++  VD+DGDG ID+KEF  
Sbjct  20   EVAKVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIMLEVDTDGDGFIDLKEFAA  79

Query  414  MMTAAGTT  391
                 G T
Sbjct  80   FHCPGGGT  87



>ref|XP_008809156.1| PREDICTED: probable calcium-binding protein CML18 [Phoenix dactylifera]
Length=177

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 98/160 (61%), Gaps = 8/160 (5%)
 Frame = -2

Query  843  KTATSTQVFQP-NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads  667
            K   S +  +P +M+D+ +VF+RYD NGDG+IS  E    M+ +G   ++       A+ 
Sbjct  3    KPQESEKPPEPASMNDVERVFTRYDANGDGKISASELANVMRALGSEVSDEELKAMMAEL  62

Query  666  dgdG--YIDFQEFIAVHNLGGGISKADI-----KNAFTVFDLDGNGKISAEELLQVLRRM  508
            D DG  ++D  EF A H+  GG +         ++AFT++DLD NG ISA+EL  VL+R+
Sbjct  63   DSDGDGFVDLNEFAAFHSGLGGAAGGGGGEGELRDAFTMYDLDKNGLISAKELHLVLKRL  122

Query  507  GERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTK  388
            GE+C++  C +M++ VDSDGDG ++ +EF KMM   G  K
Sbjct  123  GEKCSVQDCSRMIRSVDSDGDGSVNFEEFKKMMGNGGGRK  162



>ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
 sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: 
Full=Calmodulin-like protein 25 [Arabidopsis thaliana]
 gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana]
 gb|ABE65653.1| polcalcin [Arabidopsis thaliana]
 gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
Length=186

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        +    GDGYI+F+EF+ 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFEEFVE  96

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  97   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGV  154

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  155  DKDGDGTIDFEEFKIMMT  172



>ref|XP_010477987.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M+ +G    E        +    GDGYI+F+EF+ 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPEEELEKAINEIDRKGDGYINFEEFVE  96

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  97   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGV  154

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  155  DKDGDGTIDFEEFKIMMT  172



>ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 89/146 (61%), Gaps = 8/146 (5%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        +    GDGYI+F+EF+ 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVPEEELEKAITEIDRKGDGYINFEEFVE  96

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  97   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGV  154

Query  459  DSDGDGLIDIKEFTKMMTAAGTTKRF  382
            D DGDG ID +EF  MMT       F
Sbjct  155  DKDGDGTIDFEEFKIMMTMGSRRDNF  180



>ref|XP_010499149.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
 ref|XP_010460422.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M+ +G    E        +    GDGYI+F+EF+ 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPEEELEKAINEIDRKGDGYINFEEFVE  96

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  97   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGV  154

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  155  DKDGDGTIDFEEFKIMMT  172



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (56%), Gaps = 3/143 (2%)
 Frame = -2

Query  813  PNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---YIDF  643
            P  D++ +VF  YDTNGDG+IS  E +  M  +G                      +I  
Sbjct  26   PVEDELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFISL  85

Query  642  QEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
             EF  ++  G G+ + D+K AF VFD D +GKISA+EL  VL+ +GE+   + C++M++G
Sbjct  86   AEFKDINGAGEGVEEVDLKEAFAVFDEDRDGKISAKELQNVLKGLGEQVTTEQCQEMIRG  145

Query  462  VDSDGDGLIDIKEFTKMMTAAGT  394
            VD DGDG++  +EF  MMT  G 
Sbjct  146  VDRDGDGMVSFQEFKVMMTGGGA  168



>emb|CDX84967.1| BnaC05g20880D [Brassica napus]
Length=189

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        +    GDGYI+F+EF+ 
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVPEEVLEKAITEIDRKGDGYINFEEFVE  98

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  99   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIGECRKMIGGV  156

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  157  DKDGDGTIDFEEFKIMMT  174



>ref|XP_009109853.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY36129.1| BnaA08g19190D [Brassica napus]
Length=187

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 4/136 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        D    GDGYI+F+EF+ 
Sbjct  38   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEVLQKAITDIDRKGDGYINFEEFVE  97

Query  627  VHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            ++  G   ++   ++K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GVD 
Sbjct  98   LNTKGMDQNEVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGVDK  157

Query  453  DGDGLIDIKEFTKMMT  406
            DGDG ID +EF  MMT
Sbjct  158  DGDGTIDFEEFKIMMT  173



>ref|XP_009113828.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY27574.1| BnaA09g28330D [Brassica napus]
Length=191

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        +    GDGYI+F+EF+ 
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVPEEVLEKAITEIDRKGDGYINFEEFVE  98

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  99   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIGECRKMIGGV  156

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  157  DKDGDGTIDFEEFKIMMT  174



>ref|XP_006304603.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
 gb|EOA37501.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
Length=184

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M+ +G    E        +    GDGYI+F+EF+ 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPEEELEKAITEIDRKGDGYINFEEFVE  93

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  C+KM+ GV
Sbjct  94   LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECKKMIGGV  151

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  152  DKDGDGTIDFEEFKIMMT  169



>dbj|BAK02108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 91/146 (62%), Gaps = 8/146 (5%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad------sdgdGYIDFQ  640
            +++KVFSR+DT+GDGRIS  E     + I    TE+AG  E A       +D DGY+D  
Sbjct  57   EIKKVFSRFDTDGDGRISPSELAAVSRAIAPPATESAGGREVASMMDELDTDRDGYVDLG  116

Query  639  EFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            EF A H  G G  +  A++++AF V+D++G+G+IS  EL +VL R+GE C+   C KM+ 
Sbjct  117  EFAAFHGRGRGERELDAELRDAFDVYDINGDGRISVAELSKVLSRIGEGCSTQDCEKMIA  176

Query  465  GVDSDGDGLIDIKEFTKMMTAAGTTK  388
             VD DGDG +  +EF KMMT  G  +
Sbjct  177  SVDVDGDGCVGFEEFKKMMTGDGAAR  202



>ref|XP_009596484.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
tomentosiformis]
Length=179

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 102/175 (58%), Gaps = 13/175 (7%)
 Frame = -2

Query  915  LNFRGSFSRKSSS-PAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEE  739
            + F+  F+RK  S P +      P   ++  ++ +    ++ +VF+++D NGDG+IS  E
Sbjct  1    MGFKSLFNRKKKSFPNSKT----PSPVSSPPKIEE----ELEQVFNKFDINGDGKISSSE  52

Query  738  FKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVH--NLGGGISKADIKNAFTV  571
                M  +G   TE        + D DG  +ID QEFI ++  N+       ++K AF+V
Sbjct  53   LGCIMAGLGNAVTEEESVNMIKEVDADGDGFIDLQEFIELNTKNIDSNDILENLKEAFSV  112

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            FD+D NG ISA+EL  V++ +GE C+L+ CRKM+ GVD DGDG+ID +EF  MM 
Sbjct  113  FDVDKNGSISADELQNVMKSLGEECSLEECRKMIGGVDCDGDGMIDFEEFKVMMV  167



>gb|KFK33273.1| hypothetical protein AALP_AA6G353700 [Arabis alpina]
Length=151

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 2/136 (1%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            ++D+RKVF R+D NGDG+IS  E K  ++ +    T+            DG+G+ID  EF
Sbjct  14   IEDIRKVFQRFDKNGDGKISNNELKEVIRALSPSSTQEETVTMMKQFDLDGNGFIDMDEF  73

Query  633  IAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            + +          D+K AF ++DLDGNG+ISA+EL  V++ +GE+C++  C+KM+  VD 
Sbjct  74   VDLFKSNQESGVGDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCKKMISKVDV  133

Query  453  DGDGLIDIKEFTKMMT  406
            DGDG ++  EF KMM 
Sbjct  134  DGDGCVNFHEFKKMMN  149



>dbj|BAJ86493.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 91/146 (62%), Gaps = 8/146 (5%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad------sdgdGYIDFQ  640
            +++KVFSR+DT+GDGRIS  E     + I    TE+AG  E A       +D DGY+D  
Sbjct  65   EIKKVFSRFDTDGDGRISPSELAAVSRAIAPPATESAGGREVASMMDELDTDRDGYVDLG  124

Query  639  EFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            EF A H  G G  +  A++++AF V+D++G+G+IS  EL +VL R+GE C+   C KM+ 
Sbjct  125  EFAAFHGRGRGERELDAELRDAFDVYDINGDGRISVAELSKVLSRIGEGCSTQDCEKMIA  184

Query  465  GVDSDGDGLIDIKEFTKMMTAAGTTK  388
             VD DGDG +  +EF KMMT  G  +
Sbjct  185  SVDVDGDGCVGFEEFKKMMTGDGAAR  210



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIA  628
            ++ +VF ++D NGDG+IS  E    M  +G   ++       ++ D DG  +I+F+EF+ 
Sbjct  123  ELDQVFKKFDVNGDGKISSSELGAIMSSLGQPASDEELNGMISEVDSDGDGFINFKEFVE  182

Query  627  VHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            ++  G    +A  ++K+AF+V+D+DGNG IS EEL +VLR +G+ C++D CRKM+ GVDS
Sbjct  183  LNTKGIDPDEALENLKDAFSVYDIDGNGSISVEELYKVLRSLGDECSMDECRKMIGGVDS  242

Query  453  DGDGLIDIKEFTKMM  409
            DGDG+I+ +EF  MM
Sbjct  243  DGDGMINFEEFKVMM  257


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A++   F  FD++G+GKIS+ EL  ++  +G+  + +    M+  VDSDGDG I+ KEF 
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLGQPASDEELNGMISEVDSDGDGFINFKEFV  181

Query  417  KMMT  406
            ++ T
Sbjct  182  ELNT  185



>gb|EAZ09381.1| hypothetical protein OsI_31655 [Oryza sativa Indica Group]
Length=185

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 101/165 (61%), Gaps = 5/165 (3%)
 Frame = -2

Query  894  SRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVI  715
            S+ +  P    +  R ++ +  T++++P+ D+M+KVF++     D RI+ ++ K  ++  
Sbjct  18   SKAAGRPTGRLLSGRDRQFSDLTRIYKPDDDEMKKVFNKIAGEHD-RITRKDLKGLLEKF  76

Query  714  ggggteaagafeaads--dgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKIS  541
            G     A        +    +GY+DF+EF+ VH    G+   D++ AF VFD DG+G+IS
Sbjct  77   GKADAAAEARRMICVADFKKNGYMDFEEFMEVHK--SGVPLGDMRRAFFVFDQDGDGRIS  134

Query  540  AEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            AEE++QVL ++G+ C+L+ CR+MVK +D + DG +D+ +F  MMT
Sbjct  135  AEEVMQVLHKLGDSCSLEDCREMVKKIDRNRDGFVDMDDFMAMMT  179



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 101/183 (55%), Gaps = 11/183 (6%)
 Frame = -2

Query  915  LNFRGSFSRK-------SSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDG  757
            + FR  F RK       SSSP             TS Q      +D+  VF ++D NGDG
Sbjct  1    MGFRSLFHRKKKLQNTTSSSPTEVTTNTTFLSRTTSLQSRVQFTEDLEHVFRKFDVNGDG  60

Query  756  RISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVH--NLGGGISKADI  589
            +IS  E    M  +G   TE        + D DG  +I+ +EFI ++  ++       ++
Sbjct  61   KISSSELGSIMGSLGQPATEEELDNMIREVDADGDGHINLEEFIELNTKDIDPNEILENL  120

Query  588  KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            K+AF+VFD+D NG ISAEEL  V+  +G++C+L  C+KM+ GVDSDGDG+ID +EF KMM
Sbjct  121  KDAFSVFDIDKNGSISAEELHNVMVSLGDQCSLAECQKMIGGVDSDGDGMIDFEEFKKMM  180

Query  408  TAA  400
              +
Sbjct  181  MGS  183



>ref|XP_007160530.1| hypothetical protein PHAVU_002G329300g [Phaseolus vulgaris]
 gb|ESW32524.1| hypothetical protein PHAVU_002G329300g [Phaseolus vulgaris]
Length=172

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 95/153 (62%), Gaps = 8/153 (5%)
 Frame = -2

Query  849  PKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgg--ggteaagafea  676
            P   A S+ V+  +MD+M++VFSR+DTNGDG+IS+ E    ++ +G      E     + 
Sbjct  17   PDAGAKSS-VYLQDMDEMKRVFSRFDTNGDGKISVSELDNVLRSLGSGVPPEELQNVMDD  75

Query  675  adsdgdGYIDFQEFIA---VHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMG  505
             D+D DG+I+  EF A        GG    ++++AF ++D D NG ISA EL QVL R+G
Sbjct  76   LDTDHDGFINLSEFAAFCRAETADGG--DTELQDAFNLYDQDKNGLISATELCQVLNRLG  133

Query  504  ERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
             RC++D C  M+K VDSDGDG ++ +EF +MM 
Sbjct  134  MRCSIDECHSMIKSVDSDGDGDVNFEEFKRMMC  166



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 96/143 (67%), Gaps = 6/143 (4%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
            +M++++K+F+++D N DG+IS  E +  +  +G   ++       A+  +DGDGYIDF E
Sbjct  8    SMEEVQKIFNKFDKNRDGKISRSELRDVLGALGSKTSDDEVKRVMAEIDADGDGYIDFDE  67

Query  636  FIAVHNLG----GGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMV  469
            F+  H+ G    G  ++ ++++AF ++DLD NG IS+ EL  VLR +GE+C+L  C +M+
Sbjct  68   FVKFHSGGSENDGAANEKELRDAFDLYDLDKNGVISSRELHSVLRSLGEKCSLSDCSRMI  127

Query  468  KGVDSDGDGLIDIKEFTKMMTAA  400
            + VD+DGDG ++ +EF KMMT A
Sbjct  128  RSVDADGDGSVNFEEFKKMMTRA  150



>ref|XP_004235822.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=164

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 95/164 (58%), Gaps = 10/164 (6%)
 Frame = -2

Query  867  AAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaag  688
            AA       + +   ++  NMD+++KVF R+DTNGDG IS EE    +  +G G +    
Sbjct  2    AATDNVNNNSVSKPSLYLQNMDEVQKVFQRFDTNGDGMISGEELSGVISALGSGTSPEEV  61

Query  687  afeaadsdgdG--YIDFQEFIA-----VHNLG-GGISKADIKNAFTVFDLDGNGKISAEE  532
            +    + D D   +I  QEF       ++++G GG+ +  ++ AF ++D D NG ISA E
Sbjct  62   SRMMNEIDSDRDGFISLQEFAEFCKGDINSIGDGGVRE--LREAFDLYDQDSNGLISAAE  119

Query  531  LLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            L Q+L R+GE C++  C KM+  VDSDGDG +  +EF KMMT +
Sbjct  120  LHQILTRLGENCSVQDCTKMINSVDSDGDGYVSFEEFKKMMTTS  163



>ref|XP_002974189.1| hypothetical protein SELMODRAFT_100711 [Selaginella moellendorffii]
 gb|EFJ25144.1| hypothetical protein SELMODRAFT_100711 [Selaginella moellendorffii]
Length=181

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 99/179 (55%), Gaps = 7/179 (4%)
 Frame = -2

Query  927  MSGFLNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRIS  748
            M  + + RG  S + S  A+ A +      A S         ++ +VF   DT+GDGRI 
Sbjct  1    MKFYRSLRGKKSGRDSPVASIAAEATVPSPARS---IDQRAKELEQVFRSIDTDGDGRIC  57

Query  747  MEEFKLAMQVIggggteaagafeaadsdgdG---YIDFQEFIAVHNLGGGISKADIKNAF  577
            +EE +  +++IG    +         +       +I  +EF+  ++ GG  S  D++ AF
Sbjct  58   LEELRAMLRLIGNANPDDTELLGLLRAIDSDGDGFISLEEFLRANDEGGS-SAGDLRAAF  116

Query  576  TVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             VFD+DGNG ISA+EL  VL++MG++     CR+M+KGVDSDG+GL+D +EF  MM  +
Sbjct  117  QVFDIDGNGFISADELHCVLQKMGDKITKSECRRMIKGVDSDGNGLVDFEEFRIMMAPS  175



>ref|XP_002888497.1| hypothetical protein ARALYDRAFT_475742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64756.1| hypothetical protein ARALYDRAFT_475742 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 89/139 (64%), Gaps = 6/139 (4%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M+D++KVF R+D N DG+IS++E K  +  +    T+        +   DG+G+ID  EF
Sbjct  13   MEDIKKVFQRFDKNNDGKISIDELKDVIGALSPNATQEETKSMMKEFDLDGNGFIDLDEF  72

Query  633  IAVHNLGGGISKA----DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            +A+  +    S +    D+K AF ++DLD NG+ISA EL  V++ +GE+C++  C++M+ 
Sbjct  73   VALFQINDQSSDSNEIRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSVQDCQRMIS  132

Query  465  GVDSDGDGLIDIKEFTKMM  409
             VDSDGDG +D +EF KMM
Sbjct  133  KVDSDGDGCVDFEEFKKMM  151



>ref|XP_002312460.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
 gb|EEE89827.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
Length=172

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 92/138 (67%), Gaps = 4/138 (3%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQE  637
             ++++ +VF ++D NGDG+IS  E     + +G   +E        +  +DGDG+ID QE
Sbjct  18   QVEELEQVFKKFDVNGDGKISSAELDSFWKKLGHEASEEELQRMITEFDADGDGFIDLQE  77

Query  636  FIAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
            F+A++  G   ++   ++K+AF+V+D+DGNG ISAEEL +V+  +GE C++  CRKM+ G
Sbjct  78   FVALNTQGVDTNEVMENLKDAFSVYDIDGNGSISAEELHKVMASLGEPCSMAECRKMISG  137

Query  462  VDSDGDGLIDIKEFTKMM  409
            VD DGDG+ID +EF  MM
Sbjct  138  VDRDGDGMIDFEEFKVMM  155


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD++G+GKIS+ EL    +++G   + +  ++M+   D+DGDG ID++EF  
Sbjct  21   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEASEEELQRMITEFDADGDGFIDLQEFVA  80

Query  414  MMT  406
            + T
Sbjct  81   LNT  83



>ref|XP_006829740.1| hypothetical protein AMTR_s00126p00123680 [Amborella trichopoda]
 gb|ERM97156.1| hypothetical protein AMTR_s00126p00123680 [Amborella trichopoda]
Length=147

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 82/140 (59%), Gaps = 11/140 (8%)
 Frame = -2

Query  798  MRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---------YID  646
            M+KVF ++DT+ DG+IS+EE    ++ +    +         +++            +ID
Sbjct  1    MKKVFEKFDTDSDGKISVEELVRVLKALDKDDSAPKAEVHKREAEKMMDVVDKNHDGFID  60

Query  645  FQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            F  F+ VH    G+   +I  AF +FD+DGNG+I A EL + L R+GE C L+ C++MV+
Sbjct  61   FDGFMDVHR--KGVMSCEILGAFRMFDIDGNGRIGANELFKALGRLGENCTLEECQRMVR  118

Query  465  GVDSDGDGLIDIKEFTKMMT  406
             +DSDGDG +DI EF  MMT
Sbjct  119  ALDSDGDGYVDIDEFMAMMT  138



>emb|CDY40786.1| BnaAnng06490D [Brassica napus]
 emb|CDY03874.1| BnaC07g10990D [Brassica napus]
Length=184

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E       A+    GDGYI+ +EF+ 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVPEEELQKAVAEIDKKGDGYINLEEFVE  93

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            +   G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  94   LFTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMISGV  151

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  152  DKDGDGTIDFEEFKVMMT  169



>gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea]
Length=164

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 84/135 (62%), Gaps = 4/135 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIA  628
            ++ +VF ++D NGDG+I   E    M  +G   TE        + DGDG  YI  QEFI 
Sbjct  12   ELEQVFHKFDVNGDGKIDASELGAVMGSLGQKATEQELINMLREVDGDGDGYISLQEFIE  71

Query  627  VHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            ++  G    +   ++K AF+VFD+DGNG I+AEEL  V+R +GE C L  CR+M+ GVDS
Sbjct  72   LNTKGVDSDEVLENLKEAFSVFDIDGNGSITAEELNTVMRSLGEECTLAECRRMISGVDS  131

Query  453  DGDGLIDIKEFTKMM  409
            DGDG+ID +EF  MM
Sbjct  132  DGDGMIDFEEFRVMM  146


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
            A+++  F  FD++G+GKI A EL  V+  +G++        M++ VD DGDG I ++EF 
Sbjct  11   AELEQVFHKFDVNGDGKIDASELGAVMGSLGQKATEQELINMLREVDGDGDGYISLQEFI  70

Query  417  KMMT  406
            ++ T
Sbjct  71   ELNT  74



>gb|EPS69688.1| hypothetical protein M569_05080, partial [Genlisea aurea]
Length=139

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = -2

Query  792  KVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHN  619
            +VF ++D +GDG+IS+ +    ++ +G   ++   A   ++ D DG  +ID +EF A H 
Sbjct  9    QVFKKFDADGDGKISVSDLSAILKSLGSTASKCDAASVMSELDVDGDGFIDLKEFKAFHC  68

Query  618  LGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGL  439
             GGG  K ++K AF ++D D NGKISA EL   LR +GE+C++  CRKM+  VD DGDG 
Sbjct  69   RGGGDGKKELKEAFDLYDKDKNGKISAAELHSTLRSLGEKCSMKDCRKMISSVDVDGDGC  128

Query  438  IDIKEFTKMMT  406
            ++ +EF +MM+
Sbjct  129  VNFEEFKRMMS  139



>ref|XP_004236933.1| PREDICTED: probable calcium-binding protein CML25 [Solanum lycopersicum]
Length=191

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 89/141 (63%), Gaps = 5/141 (4%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++ +VF ++D NGDG+I   E    M  +G   TE        + D DG  +ID QEFI
Sbjct  45   EELEQVFKKFDVNGDGKICSSELGFIMASLGNRATEEELVNMIREVDSDGDGFIDLQEFI  104

Query  630  AVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
             ++  ++        +K+AF+VFD+D NG ISAEELL VL+ +GE CNL  CRKM+ GVD
Sbjct  105  ELNTKDIDSNEVLESLKDAFSVFDMDKNGSISAEELLTVLQSLGEDCNLAECRKMISGVD  164

Query  456  SDGDGLIDIKEFTKMMTAAGT  394
             DGDG+I+ +EF K+M A G+
Sbjct  165  CDGDGMINFEEF-KIMMAKGS  184



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 91/138 (66%), Gaps = 6/138 (4%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFI  631
            D+++++F+++D NGDG+ISM E K  +  +G   T+       E  D +GDG+ID +EF 
Sbjct  3    DEVQQIFNKFDKNGDGKISMAELKDMLSALGSKTTDEELKRMIEELDQNGDGFIDLKEFA  62

Query  630  AVHNLGGGISKAD---IKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
              H   GG  K D   +++AF ++D+D NG ISA+EL  VLR +GE+C+L  CR+M+  V
Sbjct  63   DFH-CNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHHVLRNLGEKCSLSDCRRMISNV  121

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ++ +EF KMMT
Sbjct  122  DGDGDGNVNFEEFKKMMT  139


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKIS  EL  +L  +G +   +  ++M++ +D +GDG ID+KEF  
Sbjct  4    EVQQIFNKFDKNGDGKISMAELKDMLSALGSKTTDEELKRMIEELDQNGDGFIDLKEFAD  63

Query  414  MMTAAGTTK  388
                 G  K
Sbjct  64   FHCNGGAGK  72



>emb|CDY24421.1| BnaCnng04880D [Brassica napus]
Length=271

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        D D  G  YI+F+EF+ 
Sbjct  122  ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEVLQKAITDIDRKGDGYINFEEFVE  181

Query  627  VHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
            ++  G   ++   ++K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GVD 
Sbjct  182  LNTKGMDQNEVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGVDK  241

Query  453  DGDGLIDIKEFTKMMT  406
            DGDG ID +EF  MMT
Sbjct  242  DGDGTIDFEEFKIMMT  257



>ref|XP_006415824.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
 gb|ESQ34177.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
Length=198

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E        +    GDGYI+F+EF+ 
Sbjct  50   ELEAVFKKFDVNGDGKISSKELGAIMANLGHEVPEEELQKAITEIDRKGDGYINFEEFVE  109

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            ++  G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  110  LNTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDDCSIAECRKMIGGV  167

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  168  DKDGDGTIDFEEFKVMMT  185



>emb|CAC43238.1| calcium binding protein [Sesbania rostrata]
Length=172

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 95/167 (57%), Gaps = 9/167 (5%)
 Frame = -2

Query  885  SSSPAAA--AVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIg  712
            +++P A    V E+   T T   V+  +MD++++VFSR+D NGDG+IS+ E    ++ +G
Sbjct  2    ATNPTAPENTVTEQNPATKTKPSVYMEDMDELKRVFSRFDANGDGKISVNELDNVLRALG  61

Query  711  gggteaagafeaadsdgdG--YIDFQEFIAV---HNLGGGISKADIKNAFTVFDLDGNGK  547
                         D D D   +I+  EF A        GG S+  ++ AF ++D D NG 
Sbjct  62   STVPSDELERVMKDLDTDNDGFINLTEFAAFCRSDAADGGASE--LREAFDLYDQDKNGL  119

Query  546  ISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            ISA EL  VL R+G +C+++ C  M+K VDSDGDG ++  EF +MMT
Sbjct  120  ISAAELCLVLNRLGMKCSVEECHNMIKSVDSDGDGNVNFDEFKQMMT  166



>ref|XP_009103045.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
Length=184

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIA  628
            ++  VF ++D NGDG+IS +E    M  +G    E       A+    GDGYI+ +EF+ 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGSIMASLGHEVPEEELQKAVAEIDKKGDGYINLEEFVE  93

Query  627  VHNLGGGISKADI----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            +   G  + + D+    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GV
Sbjct  94   LFTKG--MDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMISGV  151

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ID +EF  MMT
Sbjct  152  DKDGDGTIDFEEFKVMMT  169



>ref|XP_008805404.1| PREDICTED: calmodulin-like protein 1 [Phoenix dactylifera]
 ref|XP_008777303.1| PREDICTED: calmodulin-like protein 1 [Phoenix dactylifera]
Length=181

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 98/172 (57%), Gaps = 5/172 (3%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEF  736
            LNF+   SR+        +  R ++ +   + F+PN+++M++VF +  + G G+IS    
Sbjct  7    LNFQLGISRRLPRKPVKWLSIRDRQVSDLMRSFKPNVEEMKQVFDKI-SEGSGKISENNL  65

Query  735  KLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDL  562
            K  ++ +G              +D D   ++DF+EF+ VH    GI   DIK+AF +FD 
Sbjct  66   KSLLEKLGKRDAACKAKRMIEAADLDRDGFLDFKEFMEVHK--NGIKTCDIKSAFRMFDQ  123

Query  561  DGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            DG+ +ISA+EL  +L ++GE  +LD CR+M+   D +GDG +D+ EF  MMT
Sbjct  124  DGDERISADELQSMLEKLGEYHSLDQCRRMINHADKNGDGFVDMNEFLAMMT  175



>ref|XP_010262278.1| PREDICTED: probable calcium-binding protein CML23 [Nelumbo nucifera]
Length=164

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 93/162 (57%), Gaps = 8/162 (5%)
 Frame = -2

Query  846  KKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads  667
            +K+     V   N+D++ KVF R+D NGDG+IS  E +  +  +G   +        ++ 
Sbjct  3    RKSPPPPSVSLQNVDEVEKVFKRFDANGDGKISSTELRDVLGALGSDTSPEEIHRMMSEI  62

Query  666  dgdG--YIDFQEFIAVHNLGG-GISKAD-----IKNAFTVFDLDGNGKISAEELLQVLRR  511
            D DG  +ID +EF   H   G G +KA+     +K+AF ++D D NG ISA+EL  VL+R
Sbjct  63   DTDGDGFIDLKEFAEFHKSNGTGNTKAEDELKELKDAFNLYDKDKNGLISAKELYTVLKR  122

Query  510  MGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTKR  385
            +GE+C+L  C +M+  VD DGDG ++ +EF  MMT      R
Sbjct  123  LGEKCSLQDCSRMINSVDVDGDGHVNFEEFKLMMTNGKAPSR  164



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 107/186 (58%), Gaps = 14/186 (8%)
 Frame = -2

Query  915  LNFRGSFSRKS--------SSPAAAAVKER--PKKTATSTQVFQPNMDDMRKVFSRYDTN  766
            + FR  F+RK         SSP AAA       +  + S++      +D+  VF ++D N
Sbjct  1    MGFRSLFNRKKKHQKKTTTSSPTAAATNSTFFSRNPSVSSRSRLHFTEDLEHVFRKFDVN  60

Query  765  GDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISK--  598
            GDG+IS  E    M  +G   TE        + D DG  +I+ +EFI ++      ++  
Sbjct  61   GDGKISSSELGSIMGSLGQPATEEELNNMIREVDADGDGHINLEEFIELNTKDVNPNEII  120

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
             ++K+AF++FD+DGNG I+AEEL  V+  +G++C+L  C+KM++GVD DGDG+ID +EF 
Sbjct  121  ENLKDAFSIFDIDGNGSITAEELHNVMVSIGDKCSLAECKKMIRGVDKDGDGMIDFEEFK  180

Query  417  KMMTAA  400
            +MM  +
Sbjct  181  RMMMGS  186



>emb|CDM80751.1| unnamed protein product [Triticum aestivum]
Length=187

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 89/141 (63%), Gaps = 8/141 (6%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad------sdgdGYIDFQ  640
            +++KVFSR+DT+GDGRIS  E     + I    TE+A   E A       +D DGY+D  
Sbjct  24   EIKKVFSRFDTDGDGRISPSELAAVSRAIAPPATESAQGREVASMMDELDTDRDGYVDLG  83

Query  639  EFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            EF A H  G    +  A++++AF V+D++G+G+IS  EL +VL R+GE C+ + C KM+ 
Sbjct  84   EFAAFHGRGREERELDAELRDAFDVYDINGDGRISVAELSKVLSRIGEGCSTEECEKMIA  143

Query  465  GVDSDGDGLIDIKEFTKMMTA  403
             VD DGDG +  +EF KMMTA
Sbjct  144  SVDVDGDGCVGFEEFKKMMTA  164



>ref|XP_002460339.1| hypothetical protein SORBIDRAFT_02g026670 [Sorghum bicolor]
 gb|EER96860.1| hypothetical protein SORBIDRAFT_02g026670 [Sorghum bicolor]
Length=184

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 95/163 (58%), Gaps = 5/163 (3%)
 Frame = -2

Query  888  KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgg  709
            K+  P    +  R ++  +    ++P+ ++M+KVFS       G+IS ++ +L ++  G 
Sbjct  19   KAGRPIGRPLSARDRQY-SDLSTYKPDDEEMKKVFSMIAGQSHGKISKKDLQLLLERFGK  77

Query  708  ggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAE  535
                A        +D +   Y+D +EF+ VH    G+   DI+ AF VFD +G+G+ISAE
Sbjct  78   ADAAAEARRMMCVADHNKDGYMDLEEFMEVHR--NGVQLGDIRRAFFVFDRNGDGRISAE  135

Query  534  ELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            E++ VL  +G+ C+LD CRKMV+ VD +GDG +D+ EF  MMT
Sbjct  136  EVMTVLCNLGQSCSLDDCRKMVREVDRNGDGFVDMDEFMVMMT  178



>ref|XP_002459097.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
 gb|EES04217.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
Length=189

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 96/172 (56%), Gaps = 5/172 (3%)
 Frame = -2

Query  897  FSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQV  718
            F R+S SP          K   S        ++M +VF ++D NGDGRIS  E     + 
Sbjct  12   FRRRSKSPPPQQQPAAEGKGTGSPPRAATAEEEMARVFRKFDANGDGRISRSELAALFES  71

Query  717  Iggggt--eaagafeaadsdgdGYIDFQEFIAVHNLGGGISKA---DIKNAFTVFDLDGN  553
            +G   +  E A     AD+DGDG+I   EF A++    G + A   D+++AF VFD DGN
Sbjct  72   LGHAASDDEVARMMAEADADGDGFISLDEFAALNATVAGDAAAVEEDLRHAFRVFDADGN  131

Query  552  GKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
            G ISA EL +VLR +GE  ++  CR+M++GVD +GDGLI  +EF  MM   G
Sbjct  132  GTISAAELARVLRGLGESASVAQCRRMIEGVDQNGDGLISFEEFKVMMAGGG  183



>ref|XP_006660702.1| PREDICTED: calmodulin-like protein 1-like [Oryza brachyantha]
Length=185

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 99/165 (60%), Gaps = 5/165 (3%)
 Frame = -2

Query  894  SRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVI  715
            S+ +  P    +  R ++ +    +++P+ D+MRKVF +     D RIS ++ +  ++  
Sbjct  18   SKAAGRPTGRLLSARDRQFSDLMMIYKPDDDEMRKVFDKIAGEPD-RISRKDLRGLLEKF  76

Query  714  ggggteaagafe--aadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKIS  541
            G              AD+  DG++DF+EF+ VH    G+   D++ AF VFD DG+G+IS
Sbjct  77   GKADAADEARRMICVADAKKDGHVDFEEFMEVHR--SGVPLGDMRRAFFVFDRDGDGRIS  134

Query  540  AEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            AEE+ +VLR++G+ C+L+ CRKMV+ VD + DG +D+ +F  MMT
Sbjct  135  AEEVKEVLRKLGDECSLEDCRKMVREVDRNHDGFVDMDDFMAMMT  179



>ref|XP_010528534.1| PREDICTED: calcium-binding protein CML24-like [Tarenaya hassleriana]
Length=168

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 92/156 (59%), Gaps = 17/156 (11%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdg--dGYIDFQE  637
            +M+++RKVF R+D NGDG+IS +E K  ++ +         A    + D   +G+ID  E
Sbjct  13   SMEEIRKVFQRFDKNGDGKISGDELKDVIRALSPSDPPEEAARMMEELDRDGNGFIDLDE  72

Query  636  FIA-----VHNLGGGISKA----------DIKNAFTVFDLDGNGKISAEELLQVLRRMGE  502
            F+A     V N G  +             D+K+AF ++DLDGNG+ISA EL  V++R+GE
Sbjct  73   FVAHFQIDVQNHGENVDGDNNGSNNNDVKDLKDAFDMYDLDGNGQISARELHAVMKRLGE  132

Query  501  RCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            +C++  C KM+  VD++GDG ++ +EF +MM   G 
Sbjct  133  KCSVRDCAKMISKVDANGDGYVNFEEFKRMMINGGA  168



>ref|XP_004490807.1| PREDICTED: calcium-binding protein CML24-like [Cicer arietinum]
Length=143

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 3/136 (2%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            D++RK+FS++D NGDG+IS  E K  +  +G   T           D +G  YID +EF 
Sbjct  7    DEVRKIFSKFDKNGDGKISSSELKEMLITLGTKTTSDEVKRMMEMIDQNGDGYIDLKEFS  66

Query  630  AVHNLGGGISKA-DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
              H +  G   A ++++AF ++DLD NG ISA EL  VL ++GE+C+L  CR+M+K VD 
Sbjct  67   DFHCIDAGKDDANELRDAFDLYDLDKNGLISANELHAVLIKLGEKCSLGDCRRMIKNVDV  126

Query  453  DGDGLIDIKEFTKMMT  406
            DGDG ++ +EF KMM 
Sbjct  127  DGDGNVNFEEFKKMMA  142



>ref|XP_011024051.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=195

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 98/160 (61%), Gaps = 6/160 (4%)
 Frame = -2

Query  876  PAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggte  697
            P+  A      K+ +     Q  ++++ +VF ++D NGDG+IS  E     + +G   +E
Sbjct  21   PSGMATSINGSKSPSVRLRLQ--VEELEQVFKKFDVNGDGKISSAELDSFWKKLGHEASE  78

Query  696  aagafeaad--sdgdGYIDFQEFIAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEEL  529
                    +  +DGDG+ID QEF+A++  G    +   ++K+AF+V+D+DGNG ISAEEL
Sbjct  79   EELLRMITEFDADGDGFIDLQEFVALNTQGVDTDEVMENLKDAFSVYDIDGNGSISAEEL  138

Query  528  LQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
             +V+  +GE C++  CRKM+ GVD DGDG+ID +EF  MM
Sbjct  139  HKVMASLGEPCSMAECRKMISGVDRDGDGMIDFEEFKVMM  178


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD++G+GKIS+ EL    +++G   + +   +M+   D+DGDG ID++EF  
Sbjct  44   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEASEEELLRMITEFDADGDGFIDLQEFVA  103

Query  414  MMT  406
            + T
Sbjct  104  LNT  106



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 87/144 (60%), Gaps = 7/144 (5%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---YIDFQ  640
            N+D +R+VF++YD NGDG+IS +E +  +  +G   T    A  A          +ID  
Sbjct  35   NVDQVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDKDGDGFIDLD  94

Query  639  EF----IAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            EF    +   + G      ++++AF ++DLDGNG IS  EL  V++++G++C+L  CRKM
Sbjct  95   EFAELILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLGQKCSLRDCRKM  154

Query  471  VKGVDSDGDGLIDIKEFTKMMTAA  400
            +  VD DGDG ++ +EF KMMTAA
Sbjct  155  ISSVDRDGDGNVNFEEFKKMMTAA  178



>ref|XP_006355093.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=194

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 5/141 (4%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++ +VF ++D NGDG+I   E    M  +G   TE        + D DG  +ID QEFI
Sbjct  45   EELEQVFKKFDMNGDGKICSSELGSIMASLGNPTTEEELVNMIREVDSDGDGFIDLQEFI  104

Query  630  AVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
             ++  ++        +K+AF+VFD+D NG ISAEELL VLR +GE C L  CRKM+ GVD
Sbjct  105  ELNTKDIDSNEVLESLKDAFSVFDMDKNGSISAEELLTVLRSLGEDCTLAECRKMISGVD  164

Query  456  SDGDGLIDIKEFTKMMTAAGT  394
             DGDG+I+ +EF K+M A G+
Sbjct  165  CDGDGMINFEEF-KIMMAKGS  184



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 106/184 (58%), Gaps = 10/184 (5%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVF--QPNMDDMRKVFSRYDTNGDGRISME  742
            + F+  FSRK  S  +    + P  + T+  +F  +  + ++ +VF+++D NGDG+I   
Sbjct  1    MGFKSLFSRKKKSHPST---DSPLGS-TTLPIFGSRTQIAELEQVFNKFDVNGDGKICSS  56

Query  741  EFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAFT  574
            E    M  +G   TE        + D DG  YID  EFI ++  G   ++   ++K+AF+
Sbjct  57   ELGSIMGSLGQPATEEELHNMIKEVDADGDGYIDLDEFIELNTKGVDSNEVLENLKDAFS  116

Query  573  VFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            V+D+DGNG I+AEEL +VL+ +G+ C+L  CRKM+ GVD +GDG+I   EF  MM +   
Sbjct  117  VYDIDGNGSITAEELHEVLKSLGDDCSLADCRKMITGVDKNGDGMISFDEFKVMMMSGSR  176

Query  393  TKRF  382
            +  F
Sbjct  177  SHGF  180



>gb|EMS60246.1| Calmodulin-like protein 1 [Triticum urartu]
Length=164

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 94/161 (58%), Gaps = 21/161 (13%)
 Frame = -2

Query  888  KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgg  709
            K S PA   +  R ++  +   +++P+ ++M KVF +      GRIS  + ++ +Q    
Sbjct  19   KPSRPAGRLLSARDRQQ-SDLMMYKPDEEEMAKVFDKI-AGEPGRISRSDLQVLLQ----  72

Query  708  ggteaagafeaadsdgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEEL  529
                         S+ DGY+D +EF+ VH    G+   DI+ AF VFD D +GKI+AEE+
Sbjct  73   -------------SNKDGYMDLEEFMEVHR--NGVQLGDIRRAFFVFDRDRDGKITAEEV  117

Query  528  LQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            + VLRR+G+ C+L+ CR+MVK +D + DG +D+ +F  MMT
Sbjct  118  MDVLRRLGDSCSLEDCRRMVKEIDRNHDGFVDMDDFMAMMT  158



>ref|XP_010531587.1| PREDICTED: probable calcium-binding protein CML25 [Tarenaya hassleriana]
Length=202

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 101/185 (55%), Gaps = 18/185 (10%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQP----------NMDDMRKVFSRYDTN  766
            + FR  F RK  S  ++++      T        P           + ++ +VF ++D N
Sbjct  1    MGFRTMFHRKKQSDGSSSMPPANGGTVARLGSESPFLMKNRSGKTEIRELEEVFKKFDVN  60

Query  765  GDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEFIAVHNLGGGISKAD  592
            GDG+IS  E    M  +G    E        +   DGDG I+F+EF+ ++  G  + + D
Sbjct  61   GDGKISSSELGSIMASLGHEVPEDELQKAITEIDGDGDGNINFEEFVELNTKG--MDQDD  118

Query  591  I----KNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKE  424
            +    K+AF+V+D+DGNG ISAEEL +VLR +G+ C++  CRKM+ GVD DGDG ID +E
Sbjct  119  VMENLKDAFSVYDIDGNGSISAEELYEVLRSLGDECSIGECRKMISGVDKDGDGSIDFEE  178

Query  423  FTKMM  409
            F  MM
Sbjct  179  FKVMM  183



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 89/137 (65%), Gaps = 6/137 (4%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFK--LAMQVIggggteaagafeaadsdgdGYIDFQEFIA  628
            ++R++F+++D NGDG+IS+ E K  LA         E     E  D +GDG+ID +EF  
Sbjct  4    EVRQIFNKFDKNGDGKISVTELKDMLAALGSKTTDEELKRMMEELDQNGDGFIDLKEFAD  63

Query  627  VHNLGGGISKAD---IKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
             H   GG  K D   +++AF ++D+D NG ISA+EL  VLR +GE+C+L  CR+M+  VD
Sbjct  64   FH-CNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHDVLRNLGEKCSLSDCRRMISNVD  122

Query  456  SDGDGLIDIKEFTKMMT  406
            +DGDG ++ +EF KMMT
Sbjct  123  ADGDGNVNFEEFKKMMT  139


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKIS  EL  +L  +G +   +  ++M++ +D +GDG ID+KEF  
Sbjct  4    EVRQIFNKFDKNGDGKISVTELKDMLAALGSKTTDEELKRMMEELDQNGDGFIDLKEFAD  63

Query  414  MMTAAGTTK  388
                 G  K
Sbjct  64   FHCNGGAGK  72



>ref|XP_009383649.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 93/145 (64%), Gaps = 3/145 (2%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            M+++ K+F+R+D +GDGRIS  +    ++ +G   +        A+ D D   ++D QEF
Sbjct  24   MEELEKIFARFDVDGDGRISTADLSGFIRALGSDASPDEIRDMIAEMDADRDGFVDLQEF  83

Query  633  IAV-HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
             AV H  GGG+++ ++K+AF+V+DL+ +G+I+ +EL QVL  +GE+C +  C +M+  VD
Sbjct  84   AAVCHGGGGGVTEEELKDAFSVYDLNNDGRITVKELHQVLNGLGEKCTMKECIQMIGAVD  143

Query  456  SDGDGLIDIKEFTKMMTAAGTTKRF  382
            SDGDG +  +EF  MMT +  T R 
Sbjct  144  SDGDGCVSFEEFKMMMTGSAQTTRL  168



>ref|NP_001063377.1| Os09g0458700 [Oryza sativa Japonica Group]
 dbj|BAD38377.1| calmodulin-like protein [Oryza sativa Japonica Group]
 dbj|BAF25291.1| Os09g0458700 [Oryza sativa Japonica Group]
 gb|EAZ44996.1| hypothetical protein OsJ_29637 [Oryza sativa Japonica Group]
Length=185

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 100/165 (61%), Gaps = 5/165 (3%)
 Frame = -2

Query  894  SRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVI  715
            S+ +  P    +    ++ +  T++++P+ D+M+KVF++     D RI+ ++ K  ++  
Sbjct  18   SKAAGRPTGRLLSGGDRQFSDLTRIYKPDDDEMKKVFNKIAGEHD-RITRKDLKGLLEKF  76

Query  714  ggggteaagafeaads--dgdGYIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKIS  541
            G     A        +    +GY+DF+EF+ VH    G+   D++ AF VFD DG+G+IS
Sbjct  77   GKADAAAEARRMICVADFKKNGYMDFEEFMEVHK--SGVPLGDMRRAFFVFDQDGDGRIS  134

Query  540  AEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            AEE++QVL ++G+ C+L+ CR+MVK +D + DG +D+ +F  MMT
Sbjct  135  AEEVMQVLHKLGDSCSLEDCREMVKKIDRNRDGFVDMDDFMAMMT  179



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 105/183 (57%), Gaps = 8/183 (4%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQV-FQPNMDDMRKVFSRYDTNGDGRISMEE  739
            + F+  FSRK  S ++    + P  + T   +  +  + ++ +VF+++D NGDG+I   E
Sbjct  1    MGFKSLFSRKKKSHSST---DSPLGSTTLPILGSRTQIAELEQVFNKFDVNGDGKICSSE  57

Query  738  FKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAFTV  571
                M  +G   TE        + D DG  YID  EFI ++  G    +   ++K+AF+V
Sbjct  58   LGSIMGSLGQPATEEELQNMIKEVDADGDGYIDLDEFIELNTKGVDSDEVLENLKDAFSV  117

Query  570  FDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTT  391
            +D+DGNG I+AEEL +VL+ +G+ C+L  CRKM+ GVD +GDG+I   EF  MM +   +
Sbjct  118  YDIDGNGSITAEELHEVLKSLGDDCSLADCRKMITGVDKNGDGMISFDEFKVMMMSGSRS  177

Query  390  KRF  382
            + F
Sbjct  178  QGF  180



>ref|NP_001045400.1| Os01g0949500 [Oryza sativa Japonica Group]
 sp|Q8RZB5.1|CML10_ORYSJ RecName: Full=Probable calcium-binding protein CML10; AltName: 
Full=Calmodulin-like protein 10 [Oryza sativa Japonica Group]
 dbj|BAB86193.1| putative pollen allergen Jun o 4 [Oryza sativa Japonica Group]
 dbj|BAF07314.1| Os01g0949500 [Oryza sativa Japonica Group]
 dbj|BAG96408.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92083.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72159.1| hypothetical protein OsI_05196 [Oryza sativa Indica Group]
 gb|EEE56004.1| hypothetical protein OsJ_04761 [Oryza sativa Japonica Group]
Length=185

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 98/173 (57%), Gaps = 7/173 (4%)
 Frame = -2

Query  897  FSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQV  718
            F R+S S +    +  P     S     P  ++M +VF ++D NGDGRIS  E     + 
Sbjct  10   FRRRSGSKSPPLPQADPASGGGSPAP-TPE-EEMERVFRKFDANGDGRISRSELGALFES  67

Query  717  Iggggt--eaagafeaadsdgdGYIDFQEFIAVHNLGGGISKA---DIKNAFTVFDLDGN  553
            +G   T  E A     AD+DGDG+I   EF A++    G + A   D+++AF VFD DGN
Sbjct  68   LGHAATDDELARMMAEADADGDGFISLDEFAALNATASGDAAAVEEDLRHAFRVFDADGN  127

Query  552  GKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            G ISA EL +VL  +GE+  +  CR+M++GVD +GDGLI  +EF  MM   G+
Sbjct  128  GTISAAELARVLHGLGEKATVQQCRRMIEGVDQNGDGLISFEEFKVMMAGGGS  180



>ref|XP_006341535.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=164

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (58%), Gaps = 8/163 (5%)
 Frame = -2

Query  867  AAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaag  688
            AA       + +   ++  NMD+++KVF R+DTNGDG IS +E    +  +G G +    
Sbjct  2    AATDNVNNNSVSKPSLYLQNMDEVQKVFQRFDTNGDGMISGDELSGVISALGSGTSPDEV  61

Query  687  afeaadsdgdG--YIDFQEFIA-----VHNLGGGISKADIKNAFTVFDLDGNGKISAEEL  529
            A    + D D   +I  +EF       ++++G G  K +++ AF ++D D NG ISA EL
Sbjct  62   ARMMDEIDADRDGFISLKEFAEFCKGDINSVGDGGVK-ELREAFDLYDQDSNGLISAAEL  120

Query  528  LQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
             Q+L R+GE C++  C KM+  VDSDGDG +  +EF KMMT +
Sbjct  121  HQILNRLGESCSVQDCTKMITSVDSDGDGYVSFEEFKKMMTTS  163



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 86/142 (61%), Gaps = 3/142 (2%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YI  649
            V    MD++ KVF ++D NGDG+IS+ E    +  +G   +         + D DG  +I
Sbjct  13   VSSAEMDEVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIMLEVDTDGDGFI  72

Query  648  DFQEFIAVHNLGGGIS-KADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            D +EF A +  GG  S   +++ AF ++D D NGKI+A EL  V++ +GE+C+L  CR+M
Sbjct  73   DLKEFAAFYCPGGADSDNKELREAFDLYDKDKNGKITAAELHSVMKSLGEKCSLKDCRRM  132

Query  471  VKGVDSDGDGLIDIKEFTKMMT  406
            +  VD DGDG ++ +EF KMM+
Sbjct  133  ISKVDVDGDGCVNFEEFKKMMS  154


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKIS  EL  +L  +G + + D  ++++  VD+DGDG ID+KEF  
Sbjct  20   EVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIMLEVDTDGDGFIDLKEFAA  79

Query  414  MMTAAGT  394
                 G 
Sbjct  80   FYCPGGA  86



>ref|XP_009419453.1| PREDICTED: calmodulin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=197

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 103/190 (54%), Gaps = 6/190 (3%)
 Frame = -2

Query  939  LDIIMSGFLNFRGSFSRKSSSPAAAAVKERPKKTATS--TQVFQPNMDDMRKVFSRYDTN  766
            +  +M   LN R + S+K +      +  R ++ +     + ++P+ D+M++VF +  +N
Sbjct  1    MSCLMILCLNLRSTLSKKPNPRLEKMISTRERQVSDLGLMRRYEPDEDEMKQVFDKM-SN  59

Query  765  GDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKAD  592
               +I  E+ K  ++ +                  +    +DF +F+AVH   GG+  +D
Sbjct  60   NKAKIEFEDMKALLERLKVHDAAHEAKQILQTVGSNKDGSVDFGDFMAVHR-KGGVWTSD  118

Query  591  IKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKM  412
            I +AF +FD DG+G+ISA+E+  ++ R+GE C+L+ CR+MVK VD +GDGL+ + +F  M
Sbjct  119  IVSAFKMFDQDGDGQISAKEIKDMMGRLGEDCSLEECRRMVKEVDKNGDGLVGMDDFMAM  178

Query  411  MTAAGTTKRF  382
            MT      R 
Sbjct  179  MTRTMKLSRL  188



>gb|KCW69357.1| hypothetical protein EUGRSUZ_F02840 [Eucalyptus grandis]
Length=171

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 14/141 (10%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdGYIDFQEF-  634
            N+D +R+VF++YD NGDG+IS +E +   Q           A    D DGDG+ID  EF 
Sbjct  35   NVDQVRQVFAQYDKNGDGKISCDELREEAQA----------AMAEIDKDGDGFIDLDEFA  84

Query  633  ---IAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKG  463
               +   + G      ++++AF ++DLDGNG IS  EL  V++++G++C+L  CRKM+  
Sbjct  85   ELILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLGQKCSLRDCRKMISS  144

Query  462  VDSDGDGLIDIKEFTKMMTAA  400
            VD DGDG ++ +EF KMMTAA
Sbjct  145  VDRDGDGNVNFEEFKKMMTAA  165



>gb|EYU17655.1| hypothetical protein MIMGU_mgv1a015081mg [Erythranthe guttata]
Length=168

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 89/144 (62%), Gaps = 5/144 (3%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYI  649
            ++  +MD++RKVF R+DTNGDG+IS +E    +  +G G +    A    +  +D DG+I
Sbjct  13   MYLQDMDEVRKVFQRFDTNGDGKISSDELGGVLNALGSGTSADEVARMMEEIDTDKDGHI  72

Query  648  DFQEFIAVHNLGG---GISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCR  478
            + QEF A  +        ++ +++ AF ++D D NGKISA EL Q+L R+GE C+   C 
Sbjct  73   NLQEFAAFCSGDSDPYNSAEKELREAFQLYDQDHNGKISAAELHQILTRLGEHCSEQDCA  132

Query  477  KMVKGVDSDGDGLIDIKEFTKMMT  406
             M++ VDSDGDG +   EF KMMT
Sbjct  133  GMIRTVDSDGDGFVSFDEFRKMMT  156



>ref|XP_010231590.1| PREDICTED: probable calcium-binding protein CML18 isoform X2 
[Brachypodium distachyon]
Length=170

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 88/146 (60%), Gaps = 9/146 (6%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaad--sdgdGYIDFQEF  634
            M ++ +VF RYD NGDG+IS EE    ++ +G        A    +  +D DG++D +EF
Sbjct  24   MAELEQVFRRYDANGDGKISAEELASVLRALGAAPGPGEVARMMEEMDADRDGFVDLREF  83

Query  633  IAVHNLGGGI-------SKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRK  475
             A H   G         S+A++K AF ++D D NG ISA EL +VLR++G++C++  C +
Sbjct  84   AAFHCGQGAANQEQEAASEAELKEAFRMYDADRNGLISARELHRVLRQLGDKCSVADCSR  143

Query  474  MVKGVDSDGDGLIDIKEFTKMMTAAG  397
            M++ VD+DGDG ++  EF KMM   G
Sbjct  144  MIRSVDADGDGSVNFDEFKKMMGGGG  169


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -2

Query  618  LGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGL  439
            L GGI  A+++  F  +D +G+GKISAEEL  VLR +G         +M++ +D+D DG 
Sbjct  18   LAGGIPMAELEQVFRRYDANGDGKISAEELASVLRALGAAPGPGEVARMMEEMDADRDGF  77

Query  438  IDIKEFTKMMTAAGTTKR  385
            +D++EF       G   +
Sbjct  78   VDLREFAAFHCGQGAANQ  95



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf--eaadsdgdGYIDFQEFI  631
            D++R++F+++D NGDG+IS+ E +  +  +G   T+       E  D +GDGYID +EF 
Sbjct  3    DEVRQIFNKFDKNGDGKISITELRDMLGTLGSKTTKEELKRIMEELDQNGDGYIDLKEFA  62

Query  630  AVH-NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
              H N  G     ++++AF ++D+D NG ISA+EL  VL ++GE+C+L  CR+M+  VD+
Sbjct  63   DFHCNDAGNDESKELRDAFDLYDVDKNGLISAKELHDVLSKLGEKCSLSDCRRMISNVDA  122

Query  453  DGDGLIDIKEFTKMMTAA  400
            DGDG ++ +EF KMM  +
Sbjct  123  DGDGSVNFEEFKKMMARS  140



>ref|XP_010663678.1| PREDICTED: calcium-binding allergen Ole e 8 [Vitis vinifera]
 emb|CAN60554.1| hypothetical protein VITISV_014971 [Vitis vinifera]
Length=163

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 89/153 (58%), Gaps = 2/153 (1%)
 Frame = -2

Query  837  ATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgd  658
            +T   ++  + D+++KVF+R+D NGDG+IS  E    ++ +G   +    +    + D D
Sbjct  9    STKPNIYPQDKDELQKVFNRFDANGDGKISSSELANVLRALGSESSPEEMSRVMKEIDTD  68

Query  657  G--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDS  484
                I+ +EF      G      ++++AF ++D D NG ISA EL QVL+++GE+C++  
Sbjct  69   DDGCINLEEFAQFCKSGSNADAGELRDAFQLYDGDKNGLISAVELHQVLKQLGEKCSVQD  128

Query  483  CRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTKR  385
            C+KM+   DSDGDG I   EF +MMT +   +R
Sbjct  129  CQKMIGSFDSDGDGNISFDEFKEMMTKSSPKQR  161



>ref|XP_010271345.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=190

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 99/179 (55%), Gaps = 10/179 (6%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPN-----MDDMRKVFSRYDTNGDGRI  751
            +  R  FSRK  S +          ++ S+ + +P      ++++  VF ++D NGDG+I
Sbjct  1    MGIRSPFSRKKKSKSVPGSPRENSGSSRSSSLHEPGNSRTLVEELGAVFKKFDMNGDGKI  60

Query  750  SMEEFKLAMQVIggggteaagafeaadsdg--dGYIDFQEFIAVHNLGGGISKA--DIKN  583
            S  E    M+ +G   TE          D   +G+ID  EFI ++  G    KA  D+++
Sbjct  61   SWSELGSIMENLGNPVTEEELQKMVKVVDLDGNGFIDLNEFIDLNTNGVDSEKAVEDLRH  120

Query  582  AFTVFDLDGNGKISAEELLQVLRRMGE-RCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            AF +FD DGNG IS EEL  V R +G+ +C++  C+KM++GVD DGDGLI  +EF  MM
Sbjct  121  AFMIFDTDGNGSISPEELQAVFRSLGDDKCSIADCKKMIRGVDCDGDGLISFEEFKNMM  179


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  582  AFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
             F  FD++G+GKIS  EL  ++  +G     +  +KMVK VD DG+G ID+ EF  + T
Sbjct  48   VFKKFDMNGDGKISWSELGSIMENLGNPVTEEELQKMVKVVDLDGNGFIDLNEFIDLNT  106



>ref|XP_002968790.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
 gb|EFJ29906.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
Length=135

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 84/135 (62%), Gaps = 4/135 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG---YIDFQEFI  631
            ++ +VF   DT+GDGRI +EE +  +++IG    +         +       +I  +EF+
Sbjct  2    ELEQVFRSIDTDGDGRICLEELRAMLRLIGNANPDDTELLGLLRAIDSDGDGFISLEEFL  61

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
              ++ GG  S  D++ AF VFD+DGNG ISA+EL  VL++MG++     CR+M+KGVDSD
Sbjct  62   RANDEGGS-SADDLRAAFQVFDIDGNGFISADELHCVLQKMGDKITKSECRRMIKGVDSD  120

Query  450  GDGLIDIKEFTKMMT  406
            G+GL+D +EF  MM 
Sbjct  121  GNGLVDFEEFRIMMA  135



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 84/140 (60%), Gaps = 4/140 (3%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            M+++ KVF ++DTNGDG+IS+ E    +  +G   T         + D DG  +ID +EF
Sbjct  18   MEEVEKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMLEVDTDGDGFIDLKEF  77

Query  633  IAVHNL--GGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
             A H           D++ AF ++D D NGKISA EL  V++ +GE+C+L  CR+M+  V
Sbjct  78   AAFHCPVESPNTVNKDLREAFNLYDKDKNGKISAAELHSVMKGIGEKCSLKDCRRMISSV  137

Query  459  DSDGDGLIDIKEFTKMMTAA  400
            D DGDG ++ +EF KMM+ A
Sbjct  138  DDDGDGSVNFEEFKKMMSKA  157



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 93/168 (55%), Gaps = 9/168 (5%)
 Frame = -2

Query  900  SFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQ  721
            S +  + SPA      R        Q+     +++ +VF ++D NGDG+IS  E    M 
Sbjct  16   STANPNPSPAEVPFASRSPSVNGRAQI-----EELEQVFKKFDVNGDGKISSSELGAIMG  70

Query  720  VIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAFTVFDLDGN  553
             +G    E        + D DG  +ID +EFI ++  G    +   ++K+AF+V+D+D N
Sbjct  71   SLGQPSGEEELRKMIKEVDSDGDGFIDLKEFIELNTKGVDSDEVLENLKDAFSVYDIDKN  130

Query  552  GKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            G ISAEEL +VLR +G+ C++  CRKM+ GVD DGDG I  +EF  MM
Sbjct  131  GSISAEELYEVLRSLGDECSIAECRKMISGVDCDGDGTISFEEFKVMM  178


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD++G+GKIS+ EL  ++  +G+    +  RKM+K VDSDGDG ID+KEF +
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLGQPSGEEELRKMIKEVDSDGDGFIDLKEFIE  103

Query  414  MMT  406
            + T
Sbjct  104  LNT  106



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 101/183 (55%), Gaps = 13/183 (7%)
 Frame = -2

Query  915  LNFRGSFSRKS--------SSPAAAAVKERPKKTATSTQVFQPNMDD-MRKVFSRYDTNG  763
            + F+  F RK         +SP  A V+     + +S+   +  +++ + +VF ++D NG
Sbjct  1    MGFKALFKRKKKQRDGNGDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNG  60

Query  762  DGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--  595
            DG+IS  E    +  +G   TE        + D DG  +ID QEFIA++    G  +   
Sbjct  61   DGKISASELGSILGSVGQPATEEELRIMIQEVDADGDGFIDLQEFIALNTTDVGHEEVME  120

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++K+AF VFD+D NG I+AEEL  VL+ +GE C L  C KM+ GVDSDG G I+  EF  
Sbjct  121  NLKDAFKVFDIDKNGYITAEELQDVLQSLGEECTLAECEKMISGVDSDGSGTINFDEFKV  180

Query  414  MMT  406
            MMT
Sbjct  181  MMT  183



>ref|XP_011073627.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=148

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafe--aadsdgdGYIDFQEFI  631
            D++ KVF+++D NGDG+IS  E    +  +G   +           D+DGDG+ID  EF 
Sbjct  12   DEVEKVFNKFDANGDGKISSAELGAVLNGLGSAMSADEVERVMLELDTDGDGFIDLNEFK  71

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
            A H  GGG    ++K+AF ++D D NG+ISA EL  VLR +GE+C++  C  M+   D D
Sbjct  72   AFH-YGGGDEGRELKDAFDLYDKDKNGRISASELHGVLRNLGEKCSVKDCEGMISSFDVD  130

Query  450  GDGLIDIKEFTKMMTAA  400
            GDG I+ +EF KMMT A
Sbjct  131  GDGCINFEEFKKMMTGA  147


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKIS+ EL  VL  +G   + D   +++  +D+DGDG ID+ EF  
Sbjct  13   EVEKVFNKFDANGDGKISSAELGAVLNGLGSAMSADEVERVMLELDTDGDGFIDLNEFKA  72

Query  414  MMTAAGTTKR  385
                 G   R
Sbjct  73   FHYGGGDEGR  82



>gb|EMT22618.1| Calmodulin-like protein 1 [Aegilops tauschii]
Length=183

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 92/163 (56%), Gaps = 6/163 (4%)
 Frame = -2

Query  888  KSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgg  709
            K S PA   +  R ++  +   +++P+ ++M KVF +      GRIS  + +  +Q    
Sbjct  19   KPSRPAGRLLSARDRQQ-SDLMMYKPDEEEMAKVFDKI-AGEPGRISRSDLQALLQRFEK  76

Query  708  ggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAE  535
                         +D +   Y+D +EF+ VH    G+   DI+ AF VFD D +G+I+AE
Sbjct  77   ADAAGEARRMVCAADSNKDGYMDLEEFMEVHR--NGVQLGDIRRAFFVFDRDRDGRITAE  134

Query  534  ELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            E++ VLRR+G+ C+L+ CRKMVK +D + DG +D+ +F  MMT
Sbjct  135  EVMDVLRRLGDSCSLEDCRKMVKEIDRNHDGFVDMDDFMAMMT  177



>ref|XP_009392676.1| PREDICTED: probable calcium-binding protein CML10 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 82/140 (59%), Gaps = 4/140 (3%)
 Frame = -2

Query  801  DMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgd---GYIDFQEFI  631
            D+ +VF+++D NGDG+IS  E    ++++ G                    G+I F EF+
Sbjct  37   DLERVFNKFDANGDGKISSAELAAVLEILSGQPPSEEELGRMMREADVDGDGFISFAEFV  96

Query  630  AVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSD  451
             ++     + + D++ AF VFDLD +G ISA+EL  +L  +GE  +L  CR+M+ GVD D
Sbjct  97   DLNTAPAALEE-DLRLAFAVFDLDRSGSISADELAHILGGIGEGASLAQCRRMIDGVDRD  155

Query  450  GDGLIDIKEFTKMMTAAGTT  391
            GDGL+  +EF  MMTA G++
Sbjct  156  GDGLVSFEEFKAMMTAGGSS  175



>ref|XP_007153253.1| hypothetical protein PHAVU_003G019600g [Phaseolus vulgaris]
 gb|ESW25247.1| hypothetical protein PHAVU_003G019600g [Phaseolus vulgaris]
Length=192

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 88/141 (62%), Gaps = 4/141 (3%)
 Frame = -2

Query  813  PNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQ  640
            P   ++  VF ++DTNGDGRIS  E    M+ +G   TE   +    + D DG  +I+ Q
Sbjct  50   PVTVELEYVFRKFDTNGDGRISSSELGSMMKCLGQHATEEEVSRMIQEIDCDGDGHINLQ  109

Query  639  EFIAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVK  466
            EFI ++  G    +   ++K AF++FD+DGNG I+AEEL  V+  +G+ C+LD C +M+ 
Sbjct  110  EFIELNTKGVEPDEVLENLKEAFSIFDIDGNGSITAEELHMVMASLGDECSLDECHRMIA  169

Query  465  GVDSDGDGLIDIKEFTKMMTA  403
            GVD DG+G+I+ +EF  MMT 
Sbjct  170  GVDGDGNGMINFEEFKIMMTG  190



>ref|XP_002532464.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF29920.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=154

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 95/153 (62%), Gaps = 8/153 (5%)
 Frame = -2

Query  837  ATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQV--Iggggteaagafeaadsd  664
            A ST    PN ++MRK+F ++D +GDG+IS +E + ++    +     E     +  D +
Sbjct  2    ARSTISVNPN-EEMRKIFEKFDKDGDGKISSDEVRDSLNDLDVKVSLQEVELMMQQYDKN  60

Query  663  gdGYIDFQEFIAVHNL----GGGISK-ADIKNAFTVFDLDGNGKISAEELLQVLRRMGER  499
             DGYID +EF  ++      GGG S+  D+K+AF ++D+D NG ISA EL  VL ++GE+
Sbjct  61   DDGYIDLEEFADLYKHIGLDGGGTSQETDLKDAFDMYDIDKNGLISATELHSVLNKIGEK  120

Query  498  CNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            C++  C +M+  VD DGDG ++ +EF KMM+ +
Sbjct  121  CSVSDCVRMISKVDMDGDGHVNFEEFKKMMSNS  153



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 86/136 (63%), Gaps = 3/136 (2%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            D++RK+FS++D NGDG+IS  E K  +  +G   T         + D +G  +ID +EF 
Sbjct  3    DEVRKIFSKFDKNGDGKISRSELKEMLLTLGSETTSEEVKRMMEELDQNGDGFIDLKEFA  62

Query  630  AVHNLGGGISKA-DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDS  454
              H    G  ++ ++++AF ++DLD NG ISA EL  VL ++GE+C+L+ C+KM+  VD 
Sbjct  63   DFHCTEPGKDESSELRDAFDLYDLDKNGLISANELHAVLMKLGEKCSLNDCKKMISNVDV  122

Query  453  DGDGLIDIKEFTKMMT  406
            DGDG ++ +EF KMM 
Sbjct  123  DGDGNVNFEEFKKMMA  138



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads---dgdGYIDFQ  640
            +M++++KVF ++D NGDGRIS EE +     +G                  DGDG+ID  
Sbjct  18   SMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAEFDKDGDGHIDIV  77

Query  639  EFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            EF  + N   G S  ++++AF ++DLD NG IS  EL +VL+R+G++C+L  C KM+  V
Sbjct  78   EFAEIIN---GGSTKELRDAFDLYDLDKNGLISTSELHEVLKRLGQKCSLKDCAKMISSV  134

Query  459  DSDGDGLIDIKEFTKMMT  406
            D+DGDG ++  EF KMMT
Sbjct  135  DADGDGHVNFAEFKKMMT  152


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -2

Query  615  GGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMG-ERCNLDSCRKMVKGVDSDGDGL  439
            G   S  ++K  F  FD +G+G+IS EEL  V   +G E  +L+  ++++   D DGDG 
Sbjct  14   GAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAEFDKDGDGH  73

Query  438  IDIKEFTKMMTAAGTTKRF  382
            IDI EF +++   G+TK  
Sbjct  74   IDIVEFAEIIN-GGSTKEL  91



>ref|XP_011008351.1| PREDICTED: probable calcium-binding protein CML27 [Populus euphratica]
Length=174

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 9/156 (6%)
 Frame = -2

Query  849  PKKTAT-STQVFQPNMDDM---RKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf  682
            P+ TA  S+  F  N+DDM   RKVF+++DTNGDG+IS  E    ++ +G   T      
Sbjct  10   PETTAPESSTTF--NLDDMAELRKVFNQFDTNGDGKISASELGDVLKSMGSTYTMEELLR  67

Query  681  eaadsdgdG--YIDFQEFIAV-HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRR  511
               D D D   YID  EF  +  +     + +++++AF ++D +G+G ISA EL QVL R
Sbjct  68   VMEDVDTDKDGYIDLAEFAKLCRSSSAAAAASELRDAFDLYDQNGDGMISAAELHQVLNR  127

Query  510  MGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTA  403
            +G +C +D C +M+K VDSDGDG ++ +EF KMM A
Sbjct  128  LGMKCKVDECFQMIKNVDSDGDGCVNFEEFQKMMAA  163



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 4/137 (3%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            ++++ +VF ++D NGDG+IS  E    M  +G   TE   A    + D DG  +IDF EF
Sbjct  41   IEELEQVFRKFDANGDGKISASELGSIMSSLGHPETEEELAKMVREVDSDGDGFIDFDEF  100

Query  633  IAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            + ++  G   ++A  ++++AF+V+D+DG+G I+AEEL +V+R +GE  +L  CRKM+ GV
Sbjct  101  VELNTKGVDPAEAMENLRDAFSVYDIDGDGSITAEELHKVMRSLGEENSLAECRKMIGGV  160

Query  459  DSDGDGLIDIKEFTKMM  409
            DSDGDG+I  +EF  MM
Sbjct  161  DSDGDGMISFEEFKVMM  177


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            +++  F  FD +G+GKISA EL  ++  +G     +   KMV+ VDSDGDG ID  EF +
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLGHPETEEELAKMVREVDSDGDGFIDFDEFVE  102

Query  414  MMT  406
            + T
Sbjct  103  LNT  105



>ref|XP_010943035.1| PREDICTED: calmodulin-like protein 1 [Elaeis guineensis]
Length=181

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 95/174 (55%), Gaps = 5/174 (3%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEF  736
            LNF+ S SR+        +  + ++ +     F+PN+++M++VF +     D +IS    
Sbjct  7    LNFQLSLSRRLPLKPVKWLSIKDRQVSDLGLFFKPNVEEMKQVFDKISEKSD-KISENNL  65

Query  735  KLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDL  562
            K  ++ +G              +D D   +IDF EF+ VH    GI   +IK AF +FD 
Sbjct  66   KSLLEKLGKANAACEAKRMIEVADLDRDGFIDFNEFMQVHK--KGIRTREIKCAFWMFDQ  123

Query  561  DGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAA  400
            D +G+ISAEEL  +L ++GE   LD CR+M+K VD +GDG +D+ +F  MMT  
Sbjct  124  DKDGRISAEELQNMLEKLGENHTLDDCRRMIKHVDKNGDGFVDMDDFLAMMTCT  177



>ref|XP_011008803.1| PREDICTED: probable calcium-binding protein CML27 [Populus euphratica]
Length=174

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 9/156 (6%)
 Frame = -2

Query  849  PKKTAT-STQVFQPNMDDM---RKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf  682
            P+ TA  S+  F  N+DDM   RKVF+++DTNGDG+IS  E    ++ +G   T      
Sbjct  10   PETTAPESSTTF--NLDDMAELRKVFNQFDTNGDGKISASELGDVLKSMGSTYTMEELRR  67

Query  681  eaadsdgdG--YIDFQEFIAV-HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRR  511
               D D D   YID  EF  +  +     + +++++AF ++D +G+G ISA EL QVL R
Sbjct  68   VMEDVDTDKDGYIDLAEFAKLCRSSSAAAAASELRDAFDLYDQNGDGMISAAELHQVLNR  127

Query  510  MGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTA  403
            +G +C +D C +M+K VDSDGDG ++ +EF KMM A
Sbjct  128  LGMKCKVDECFQMIKNVDSDGDGCVNFEEFQKMMAA  163



>gb|EMS61162.1| putative calcium-binding protein CML16 [Triticum urartu]
Length=184

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 95/159 (60%), Gaps = 14/159 (9%)
 Frame = -2

Query  858  KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafe  679
            +++ KK A +  +      +++KVFSR+DT+GDGRIS  E     + I    TE+A   E
Sbjct  8    QQQAKKPAAAEDI------EIKKVFSRFDTDGDGRISPSELAAVSRAIAPPATESAQGRE  61

Query  678  aad------sdgdGYIDFQEFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEELLQ  523
             A       +D DGY+D  EF A H  G G  +  A++++AF ++D++G+G+IS  EL +
Sbjct  62   VASMMDELDTDRDGYVDLGEFAAFHGRGRGERELDAELRDAFDIYDINGDGRISVAELSK  121

Query  522  VLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
            VL R+GE  + + C KM+  VD DGDG +   EF KMMT
Sbjct  122  VLSRIGEGGSTEDCEKMIASVDVDGDGCVGFDEFKKMMT  160



>ref|XP_002322096.1| calcium binding family protein [Populus trichocarpa]
 gb|EEF06223.1| calcium binding family protein [Populus trichocarpa]
Length=174

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 5/154 (3%)
 Frame = -2

Query  849  PKKTA--TSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafea  676
            P+ TA  +ST +   +  ++RKVF+++DTNGDG+IS  E    ++ +G   T        
Sbjct  10   PETTAPASSTTINLDDTAELRKVFNQFDTNGDGKISASELGEVLKSMGSTYTMEELHRVM  69

Query  675  adsdgdG--YIDFQEFIAV-HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMG  505
             D D D   YID  EF  +  +     + +++++AF ++D +G+G ISA EL QVL R+G
Sbjct  70   EDVDTDKDGYIDLAEFAKLCRSSSAAAAASELRDAFDLYDQNGDGMISAAELHQVLNRLG  129

Query  504  ERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTA  403
             +C +D C +M+K VDSDGDG ++ +EF KMM A
Sbjct  130  MKCKVDECFQMIKNVDSDGDGCVNFEEFQKMMAA  163



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 13/178 (7%)
 Frame = -2

Query  915  LNFRGSFSRK-----SSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRI  751
            + F+  F RK     +SS +  AV   P +     ++     +++  VF ++D NGDG+I
Sbjct  1    MGFKSLFKRKKKSLINSSQSTPAVSRSPSQNGGRCRI----EEELEHVFKKFDVNGDGKI  56

Query  750  SMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKN  583
               E    M  +G   TE        + D DG  +ID +EFI ++  G G  +   ++++
Sbjct  57   CAAELGSIMGSLGHPATEEELRTMIQEVDSDGDGFIDLREFIELNTNGIGQDEVIENLRD  116

Query  582  AFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            AF VFD+D NG ISAEEL  VL+ +GE C L  CRKM+ GVD+DG+G I   EF  MM
Sbjct  117  AFEVFDMDKNGSISAEELHNVLKSLGEECTLAECRKMISGVDADGNGTICFDEFKVMM  174


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  600  KADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEF  421
            + ++++ F  FD++G+GKI A EL  ++  +G     +  R M++ VDSDGDG ID++EF
Sbjct  38   EEELEHVFKKFDVNGDGKICAAELGSIMGSLGHPATEEELRTMIQEVDSDGDGFIDLREF  97

Query  420  TKMMT  406
             ++ T
Sbjct  98   IELNT  102



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 92/156 (59%), Gaps = 6/156 (4%)
 Frame = -2

Query  876  PAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggte  697
            P+A++   R   T+ S         ++ +VF ++D NGDG+IS  E    M  +G   TE
Sbjct  15   PSASSTPSR--STSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSLGQPATE  72

Query  696  aagafe--aadsdgdGYIDFQEFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEEL  529
                      D DGDG I  QEFI ++  G    +   ++K+AF VFD+DGNG I+AEEL
Sbjct  73   QELDNMIREVDGDGDGCISLQEFIELNTKGVDSDEILENLKDAFAVFDMDGNGSITAEEL  132

Query  528  LQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEF  421
              V+R +GE C+L  CR+M+ GVDSDGDG+ID +EF
Sbjct  133  NTVMRSLGEECSLAECRRMIGGVDSDGDGMIDFEEF  168


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
             +++  F  FD++G+GKISA EL  ++  +G+         M++ VD DGDG I ++EF 
Sbjct  37   GELEQVFKKFDVNGDGKISASELGSIMGSLGQPATEQELDNMIREVDGDGDGCISLQEFI  96

Query  417  KMMT  406
            ++ T
Sbjct  97   ELNT  100



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = -2

Query  807  MDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEF  634
            M++++KVF ++DTNGDG+IS+ E    +  +G   T         + D DG  +ID +EF
Sbjct  18   MEEVKKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMIEVDTDGDGFIDLKEF  77

Query  633  IAVHNL--GGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
             A H           D+++AF ++D D NGKISA EL  V++ +GE+C+L  CR+M+  V
Sbjct  78   AAFHCPVESPNTVNKDLRDAFNLYDKDKNGKISAAELHSVMKGIGEKCSLKDCRRMISSV  137

Query  459  DSDGDGLIDIKEFTKMMTAA  400
            D D DG ++ +EF KMM+ A
Sbjct  138  DDDCDGSVNFEEFKKMMSKA  157



>ref|XP_009797345.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
sylvestris]
Length=189

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++ +VF ++D NGDG+I   E    M  +G   TE        + D DG  +ID QEFI
Sbjct  40   EELEQVFKKFDVNGDGKICSSELGSIMASLGNAATEEELLNMIREVDADGDGFIDLQEFI  99

Query  630  AVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
             ++  ++       ++K+AF+VFD+D NG ISAEEL  VLR +GE C+L  CRKM+ GVD
Sbjct  100  ELNTKDVDSDEVLENLKDAFSVFDMDKNGSISAEELQTVLRSLGEDCSLAECRKMISGVD  159

Query  456  SDGDGLIDIKEFTKMM  409
             DGDG+I+ +EF  MM
Sbjct  160  CDGDGMINFEEFKVMM  175


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  600  KADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEF  421
            + +++  F  FD++G+GKI + EL  ++  +G     +    M++ VD+DGDG ID++EF
Sbjct  39   EEELEQVFKKFDVNGDGKICSSELGSIMASLGNAATEEELLNMIREVDADGDGFIDLQEF  98

Query  420  TKMMT  406
             ++ T
Sbjct  99   IELNT  103



>ref|XP_009608299.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
tomentosiformis]
Length=189

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 4/137 (3%)
 Frame = -2

Query  804  DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQEFI  631
            +++ +VF ++D NGDG+I   E    M  +G   TE        + D DG  +ID QEFI
Sbjct  40   EELEQVFKKFDVNGDGKICSSELGSIMASLGNAATEEELLNMIREVDADGDGFIDLQEFI  99

Query  630  AVH--NLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVD  457
             ++  ++       ++K+AF+VFD+D NG ISAEEL  VLR +GE C+L  CRKM+ GVD
Sbjct  100  ELNTKDIDSDEVLENLKDAFSVFDMDKNGSISAEELQTVLRSLGEDCSLAECRKMISGVD  159

Query  456  SDGDGLIDIKEFTKMMT  406
             DGDG+I+ +EF  MM 
Sbjct  160  CDGDGMINFEEFKVMMV  176



>ref|XP_010551871.1| PREDICTED: calcium-binding protein CML24-like [Tarenaya hassleriana]
Length=167

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 89/152 (59%), Gaps = 14/152 (9%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdg--dGYIDFQE  637
            +M ++R+VF R+D NGDG+IS +E K  ++ +    T    A    + D   +G+ID  E
Sbjct  15   SMAEIREVFQRFDKNGDGKISGDELKDVIRALSPSATPEEAARMMKELDRDGNGFIDMDE  74

Query  636  FIAVHNLGGGISKA------------DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
            F+A   +G                  D+K+AF ++DLDGNG ISA EL  V++R+GE+C+
Sbjct  75   FVAHFQIGDQNRGGDGKNNGNGNDVKDLKDAFDMYDLDGNGLISASELHAVMKRLGEKCS  134

Query  492  LDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAG  397
            +  C +M+  VD+DGDG ++ +EF KMM   G
Sbjct  135  VRDCARMISKVDTDGDGHVNFEEFKKMMINGG  166



>ref|XP_010938627.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
 ref|XP_010938628.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=189

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 99/167 (59%), Gaps = 7/167 (4%)
 Frame = -2

Query  882  SSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIgggg  703
            S+PA A+    P  TA         +D++ +VF ++D+NGDG+IS  E     Q +G   
Sbjct  17   STPATASTPTSP--TAGGGAGAAAAVDEVERVFKKFDSNGDGKISSAELAAIFQNLGHPA  74

Query  702  teaagafeaadsdgdG--YIDFQEFI--AVHNLGGGISKADIKNAFTVFDLDGNGKISAE  535
            TE        ++D DG  +I   EF+   V  +    +  D+++AF+VFDLD NG ISA+
Sbjct  75   TEEELQRMMGEADADGDGFISLDEFVDLNVRTVDDSAALEDLRHAFSVFDLDRNGAISAD  134

Query  534  ELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            EL +VLR +GE  ++  C++M++GVD DGDGL+  +EF K+M A G+
Sbjct  135  ELARVLRSIGEGASVTQCKRMIEGVDRDGDGLVSFEEF-KLMMANGS  180



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 91/151 (60%), Gaps = 5/151 (3%)
 Frame = -2

Query  819  FQP-NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YI  649
            F P  + ++ +VF+++D NGDG+I   E    M  +G   TE        + D DG  YI
Sbjct  12   FSPCQIAELEQVFNKFDVNGDGKICSSELGSIMGSLGQPATEEELQNMIKEVDADGDGYI  71

Query  648  DFQEFIAVHNLGGGISKA--DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRK  475
            D  EFI ++  G    +   ++K+AF+V+D+DGNG I+AEEL +VL+ +G+ C+L  CRK
Sbjct  72   DLDEFIELNTKGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDDCSLADCRK  131

Query  474  MVKGVDSDGDGLIDIKEFTKMMTAAGTTKRF  382
            M+ GVD +GDG+I   EF  MM +   ++ F
Sbjct  132  MITGVDKNGDGMISFDEFKVMMMSGSRSQGF  162



>ref|XP_006643684.1| PREDICTED: probable calcium-binding protein CML16-like [Oryza 
brachyantha]
Length=180

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 92/158 (58%), Gaps = 9/158 (6%)
 Frame = -2

Query  858  KERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafe  679
            K + ++ A       P+ + + +VF+R+D +GDGRIS  E     + I    +E+A   E
Sbjct  8    KTQQQQKAEKPTALAPDAE-IERVFTRFDADGDGRISPSELAAVTRAIAPPSSESAAGRE  66

Query  678  aadsdgd------GYIDFQEFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEELLQ  523
             A    +      G++D  EF A H  G G ++  A+++ AF V+D+DG+G+I+A EL +
Sbjct  67   VAAMMSELDTDRDGFVDLGEFAAFHGRGRGDAEQEAELRAAFDVYDVDGDGRITAAELGK  126

Query  522  VLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            VL R+GE C+ + C +M+  VD DGDG +  +EF KMM
Sbjct  127  VLGRIGEGCSTEECERMIASVDVDGDGCVGFEEFKKMM  164



>sp|O64943.2|POLC2_JUNOX RecName: Full=Polcalcin Jun o 2; AltName: Full=Calcium-binding 
pollen allergen Jun o 2; AltName: Allergen=Jun o 2 [Juniperus 
oxycedrus]
 gb|AAC15474.2| pollen allergen Jun o 4 [Juniperus oxycedrus]
Length=165

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 92/155 (59%), Gaps = 5/155 (3%)
 Frame = -2

Query  843  KTATSTQV-FQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads  667
            K+A S +V  + ++ ++ +VF ++D NGDG+IS  E    ++ +G    EA       ++
Sbjct  11   KSACSGEVVMEQSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEA  70

Query  666  dgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCN  493
            D DG  Y+  QEF+ ++N G  +   D+KNAF VFD D NG ISA EL   L  +GE C 
Sbjct  71   DADGDGYVSLQEFVDLNNKGASVK--DLKNAFKVFDRDCNGSISAAELCHTLESVGEPCT  128

Query  492  LDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTK  388
            ++  + ++  VD +GDGLI ++EF  MMT+  T K
Sbjct  129  IEESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDK  163



>ref|NP_001041950.2| Os01g0135700 [Oryza sativa Japonica Group]
 sp|Q5ZCK5.1|CML16_ORYSJ RecName: Full=Probable calcium-binding protein CML16; AltName: 
Full=Calmodulin-like protein 16 [Oryza sativa Japonica Group]
 dbj|BAD52815.1| putative calcium binding protein [Oryza sativa Japonica Group]
 gb|EAY72427.1| hypothetical protein OsI_00281 [Oryza sativa Indica Group]
 gb|EAZ10442.1| hypothetical protein OsJ_00275 [Oryza sativa Japonica Group]
 dbj|BAG88421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF03864.2| Os01g0135700 [Oryza sativa Japonica Group]
Length=181

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 94/159 (59%), Gaps = 13/159 (8%)
 Frame = -2

Query  846  KKTATSTQVFQPNM-----DDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagaf  682
            KK     QV +P        ++ +VF+R+D +GDGRIS  E     + I    +E+AG  
Sbjct  7    KKMPQQQQVERPTALAPADAEIERVFTRFDADGDGRISPSELAAVTRAIAPPPSESAGGR  66

Query  681  eaad------sdgdGYIDFQEFIAVHNLGGGISK--ADIKNAFTVFDLDGNGKISAEELL  526
            E A       +D DG++D  EF A H  G G ++  A+++ AF V+D+DG+G+I+A EL 
Sbjct  67   EVAAMMNELDTDRDGFVDLGEFAAFHGRGRGDAEHEAELRAAFDVYDVDGDGRITAAELG  126

Query  525  QVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            +VL R+GE C+ + C +M+  VD DGDG +  +EF KMM
Sbjct  127  KVLGRIGEGCSAEECERMIASVDVDGDGCVGFEEFKKMM  165



>ref|XP_007160425.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
 gb|ESW32419.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
Length=188

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 98/173 (57%), Gaps = 8/173 (5%)
 Frame = -2

Query  915  LNFRGSFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEF  736
            +  +  F+R+  +    A     + T+ S +       ++ +VF ++D NGDG+IS  E 
Sbjct  1    MGLKSLFNREEGTTTGGA----SRSTSLSVRSRVRMAGELEQVFKKFDVNGDGKISASEL  56

Query  735  KLAMQVIggggteaagafeaadsdgdG--YIDFQEFIAVHNLGGGISKA--DIKNAFTVF  568
               M+ +G   TE        + DGDG   I  QEFI ++  G    +   ++K+AF+VF
Sbjct  57   GSIMRSLGQEATEQEVDNMIREVDGDGDGCISLQEFIELNTKGVDSDEVLENLKDAFSVF  116

Query  567  DLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMM  409
            D+DGNG I+AEEL  V+R +GE C+L  CR+M+ GVD DGDG ID +EF  MM
Sbjct  117  DMDGNGLITAEELNTVMRSLGEECSLAECRRMIGGVDRDGDGTIDFEEFRVMM  169


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  597  ADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFT  418
             +++  F  FD++G+GKISA EL  ++R +G+         M++ VD DGDG I ++EF 
Sbjct  34   GELEQVFKKFDVNGDGKISASELGSIMRSLGQEATEQEVDNMIREVDGDGDGCISLQEFI  93

Query  417  KMMT  406
            ++ T
Sbjct  94   ELNT  97



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 85/138 (62%), Gaps = 6/138 (4%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads---dgdGYIDFQ  640
            +M++++KVF ++D NGDGRIS +E +     +G                  DGDG+ID +
Sbjct  18   SMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDGDGHIDIE  77

Query  639  EFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            EF  + N G   S  ++++AF ++DLD NG IS  EL +VL+R+G++C+L  C KM+  V
Sbjct  78   EFAEIINGG---STKELRDAFDLYDLDKNGLISTSELHEVLKRLGQKCSLKDCAKMISSV  134

Query  459  DSDGDGLIDIKEFTKMMT  406
            D DGDG ++  EF KMMT
Sbjct  135  DVDGDGHVNFAEFKKMMT  152



>ref|XP_006583713.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=182

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 96/170 (56%), Gaps = 12/170 (7%)
 Frame = -2

Query  900  SFSRKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQ  721
            + S  SS P A  V     + +         M+D+  VF ++D NGDG+IS  E    M+
Sbjct  17   TMSSSSSLPHAPPVSLHSSRASV--------MEDLEYVFKKFDANGDGKISASELGSMMK  68

Query  720  VIggggteaagafeaadsdgdG--YIDFQEFIAVH--NLGGGISKADIKNAFTVFDLDGN  553
             +G   TE        + D DG  +I+ +EF  ++  ++       ++K+AF++FDLDGN
Sbjct  69   SLGQPATEEELKKLIREVDSDGDGHINLEEFTELNTKDVDPDEVLENLKDAFSIFDLDGN  128

Query  552  GKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTA  403
            G I+AEEL  V+  +G+ C+++ CRKM+ GVD +GDG+I+  EF  MMT 
Sbjct  129  GSITAEELKMVMASLGDACSIEECRKMIAGVDGNGDGMINFDEFQIMMTG  178



>ref|XP_002892987.1| hypothetical protein ARALYDRAFT_889234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69246.1| hypothetical protein ARALYDRAFT_889234 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 92/157 (59%), Gaps = 6/157 (4%)
 Frame = -2

Query  870  AAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaa  691
            A+A  E  K T  S  +  P  D+++KVF ++D+NGDG+IS+ E     + +G   TE  
Sbjct  2    ASANPETAKPTPASVDMANP--DELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETE  59

Query  690  gafeaadsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVL  517
                  + D D   YI+  EF  +       S A+I++AF ++D D NG ISA EL QVL
Sbjct  60   LNRVLEEVDTDRDGYINLDEFSTLCR--SSSSAAEIRDAFDLYDQDKNGLISAAELHQVL  117

Query  516  RRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMT  406
             R+G  C+++ C +M+  VD+DGDG ++ +EF KMMT
Sbjct  118  NRLGMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMT  154



>gb|KDP23917.1| hypothetical protein JCGZ_27077 [Jatropha curcas]
Length=158

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 91/144 (63%), Gaps = 3/144 (2%)
 Frame = -2

Query  822  VFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YI  649
            ++  +M +++KVF ++DTNGDG+IS  E    ++ +G   T A       D D D   +I
Sbjct  3    LYLQDMKELKKVFDQFDTNGDGKISTAELGGILKAMGSTYTIAELDRVMDDVDTDKDGFI  62

Query  648  DFQEFIAV-HNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            + +EF  +  +  GG + +++++AF ++D + NG IS+ EL QVL R+G  C +D C +M
Sbjct  63   NLEEFAQLCRSSSGGSAVSELRDAFDLYDQNKNGLISSSELYQVLTRLGMSCTVDDCVQM  122

Query  471  VKGVDSDGDGLIDIKEFTKMMTAA  400
            +KGVDSDGDG +  +EF KMM A+
Sbjct  123  IKGVDSDGDGCVSFEEFRKMMDAS  146



>ref|XP_008787648.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=187

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 95/170 (56%), Gaps = 11/170 (6%)
 Frame = -2

Query  891  RKSSSPAAAAVKERPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIg  712
            R  +SPA A+    P              D++  VF ++D+NGDGRIS  E     Q +G
Sbjct  16   RSKASPATASSPTSPTAGPAGA------TDELEWVFKKFDSNGDGRISSPELAAIFQSLG  69

Query  711  gggteaagafeaadsdgdG--YIDFQEFI--AVHNLGGGISKADIKNAFTVFDLDGNGKI  544
               ++        ++D DG  +I + EF+   V  +    +  D+++AF+VFDLD NG I
Sbjct  70   HPASDEELERMMGEADTDGDGFISYDEFVDLNVRTVDDSTALEDLRHAFSVFDLDRNGAI  129

Query  543  SAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGT  394
            SA+EL  VLR +GE  ++  C++M+ GVD DGDG+I  +EF K+M A G+
Sbjct  130  SADELASVLRSIGEGASVAQCKRMIDGVDRDGDGVISFEEF-KLMMANGS  178



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 86/138 (62%), Gaps = 6/138 (4%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads---dgdGYIDFQ  640
            +M++++K+F+++D NGDGRIS +E +     +G                  DGDG+ID  
Sbjct  18   SMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIMAEFDKDGDGHIDIA  77

Query  639  EFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            EF  + N G   S  ++++AF ++DLD NG IS  EL +VL+R+G++C+L  C KM+  V
Sbjct  78   EFAEIINGG---STKELRDAFDLYDLDKNGLISKSELHEVLKRLGQKCSLKECAKMIGSV  134

Query  459  DSDGDGLIDIKEFTKMMT  406
            D+DGDG ++  EF KMMT
Sbjct  135  DADGDGHVNFAEFKKMMT  152


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -2

Query  618  LGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMG-ERCNLDSCRKMVKGVDSDGDG  442
            +G   S  ++K  F  FD +G+G+IS +EL  +   +G E  +L+  ++++   D DGDG
Sbjct  13   IGASGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIMAEFDKDGDG  72

Query  441  LIDIKEFTKMMTAAGTTKRF  382
             IDI EF +++   G+TK  
Sbjct  73   HIDIAEFAEIIN-GGSTKEL  91



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 87/142 (61%), Gaps = 7/142 (5%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaadsdgdG--YIDFQE  637
            NM+++++VF R+D NGDG+IS +E    ++ +G   +    A    + D D   +I  +E
Sbjct  17   NMEEVKRVFDRFDANGDGKISSDELGGVIEALGSETSADEVARMMEEIDTDKDGFISLEE  76

Query  636  FIAVHNL-----GGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKM  472
            F    +      GGG S+ +++ AF ++D D +G+IS  EL  +L R+GERC+++ C +M
Sbjct  77   FAVFCSADSDPSGGGNSEKELREAFDLYDQDHDGQISKTELHLILTRLGERCSVNDCSEM  136

Query  471  VKGVDSDGDGLIDIKEFTKMMT  406
            ++ VDSDGDG +   EF KMMT
Sbjct  137  IRSVDSDGDGFVSFDEFRKMMT  158


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  594  DIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGVDSDGDGLIDIKEFTK  415
            ++K  F  FD +G+GKIS++EL  V+  +G   + D   +M++ +D+D DG I ++EF  
Sbjct  20   EVKRVFDRFDANGDGKISSDELGGVIEALGSETSADEVARMMEEIDTDKDGFISLEEFAV  79

Query  414  MMTA  403
              +A
Sbjct  80   FCSA  83



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 86/138 (62%), Gaps = 6/138 (4%)
 Frame = -2

Query  810  NMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaads---dgdGYIDFQ  640
            +M++++K+F+++D NGDGRIS +E +     +G                  DGDG+ID  
Sbjct  18   SMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIMAEFDKDGDGHIDIA  77

Query  639  EFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGERCNLDSCRKMVKGV  460
            EF  + N G   S  ++++AF ++DLD NG IS  EL +VL+R+G++C+L  C KM+  V
Sbjct  78   EFAEIINGG---STKELRDAFDLYDLDKNGLISKSELHEVLKRLGQKCSLKECAKMIGSV  134

Query  459  DSDGDGLIDIKEFTKMMT  406
            D+DGDG ++  EF KMMT
Sbjct  135  DADGDGHVNFAEFKKMMT  152


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -2

Query  618  LGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMG-ERCNLDSCRKMVKGVDSDGDG  442
            +G   S  ++K  F  FD +G+G+IS +EL  +   +G E  +L+  ++++   D DGDG
Sbjct  13   IGAAGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIMAEFDKDGDG  72

Query  441  LIDIKEFTKMMTAAGTTKRF  382
             IDI EF +++   G+TK  
Sbjct  73   HIDIAEFAEIIN-GGSTKEL  91



>emb|CDM86445.1| unnamed protein product [Triticum aestivum]
Length=190

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 89/157 (57%), Gaps = 4/157 (3%)
 Frame = -2

Query  852  RPKKTATSTQVFQPNMDDMRKVFSRYDTNGDGRISMEEFKLAMQVIggggteaagafeaa  673
            RP   A S    +   ++M +VF ++D NGDGRIS  E     + +G   TE       A
Sbjct  34   RPASGAGSPA--RSAEEEMERVFRKFDANGDGRISRPELAALFESLGHAATEDELTRMMA  91

Query  672  dsdgdG--YIDFQEFIAVHNLGGGISKADIKNAFTVFDLDGNGKISAEELLQVLRRMGER  499
            ++D DG  +I  +EF A++    G  + D++ AF VFD DG+G ISA EL +VL  +GE+
Sbjct  92   EADADGDGFISLEEFAALNATAAGDDEEDLRLAFKVFDADGSGDISAAELARVLHGLGEK  151

Query  498  CNLDSCRKMVKGVDSDGDGLIDIKEFTKMMTAAGTTK  388
              +  CR+M++GVD +GDGLI   EF  MM +    K
Sbjct  152  ATVQQCRRMIEGVDKNGDGLISFDEFKVMMASGLAAK  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2617529946528