BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29974_g1_i1 len=933 path=[911:0-932]

Length=933
                                                                      Score     E

ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        303   9e-100   
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   303   9e-100   Nicotiana tabacum [American tobacco]
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       303   1e-99    
emb|CDP01275.1|  unnamed protein product                                296   3e-97    
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        295   9e-97    
gb|AAD02543.1|  PGPS/D1                                                 294   4e-96    Petunia x hybrida [garden petunia]
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     293   1e-95    Vitis vinifera
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     292   2e-95    
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        291   6e-95    
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        290   1e-94    
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             290   2e-94    
ref|XP_006422808.1|  hypothetical protein CICLE_v10029316mg             289   3e-94    
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        289   4e-94    
gb|ABK93551.1|  unknown                                                 288   6e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010938994.1|  PREDICTED: LIM domain-containing protein WLI...    288   8e-94    
ref|XP_006352087.1|  PREDICTED: pollen-specific protein SF3-like        288   1e-93    
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        288   1e-93    
ref|XP_002302405.2|  hypothetical protein POPTR_0002s11880g             288   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_004250748.1|  PREDICTED: LIM domain-containing protein WLI...    288   1e-93    
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    288   1e-93    
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     287   2e-93    Vitis vinifera
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             287   2e-93    
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    287   3e-93    
gb|AGE09584.1|  LIM1-like protein                                       286   3e-93    
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        286   3e-93    
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    286   3e-93    
ref|XP_004290976.1|  PREDICTED: pollen-specific protein SF3-like        286   4e-93    
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             286   5e-93    
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        285   6e-93    
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             286   7e-93    Populus trichocarpa [western balsam poplar]
gb|ABK58465.1|  LIM domain protein GLIM1b                               286   7e-93    Populus tremula x Populus alba [gray poplar]
gb|ABK94586.1|  unknown                                                 286   7e-93    Populus trichocarpa [western balsam poplar]
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    285   9e-93    
gb|AGE09578.1|  LIM-like protein                                        285   9e-93    
ref|NP_001235758.1|  uncharacterized protein LOC100305720               285   9e-93    
gb|KHN04435.1|  Pollen-specific protein SF3                             285   1e-92    
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          285   1e-92    
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    285   1e-92    
ref|NP_001238580.1|  uncharacterized protein LOC100499957               285   1e-92    
gb|EYU39077.1|  hypothetical protein MIMGU_mgv1a014557mg                285   2e-92    
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        285   2e-92    
gb|AFV60741.1|  LIM domain protein LIM-2                                284   2e-92    
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        285   2e-92    
ref|XP_010059807.1|  PREDICTED: pollen-specific protein SF3-like        284   3e-92    
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     284   3e-92    
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        284   3e-92    
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        284   3e-92    
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                284   4e-92    
gb|EYU36386.1|  hypothetical protein MIMGU_mgv1a009946mg                288   6e-92    
dbj|BAM05591.1|  LIM transcription factor                               283   6e-92    
dbj|BAB84581.1|  transcription factor LIM                               283   1e-91    Populus sieboldii x Populus grandidentata
ref|XP_002320687.1|  transcription factor LIM family protein            283   1e-91    Populus trichocarpa [western balsam poplar]
gb|ABK58464.1|  LIM domain protein GLIM1a                               283   1e-91    Populus tremula x Populus alba [gray poplar]
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        283   1e-91    
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             283   2e-91    
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             282   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    282   2e-91    
ref|XP_010094354.1|  Pollen-specific protein SF3                        282   2e-91    
ref|XP_007201308.1|  hypothetical protein PRUPE_ppa011881mg             282   2e-91    
gb|AFK42495.1|  unknown                                                 282   2e-91    
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        282   2e-91    
gb|AFK47041.1|  unknown                                                 282   2e-91    
gb|AAD39103.1|AF116849_1  LIM domain protein WLIM-1                     281   3e-91    Helianthus annuus
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    281   3e-91    
gb|ABY21316.1|  LIM1                                                    281   5e-91    Lilium longiflorum [Easter lily]
dbj|BAM05589.1|  LIM transcription factor                               281   5e-91    
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      281   5e-91    Nicotiana tabacum [American tobacco]
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    281   5e-91    
gb|ABK58467.1|  LIM domain protein WLIM1a                               281   6e-91    Populus tremula x Populus alba [gray poplar]
gb|KHN36972.1|  Pollen-specific protein SF3                             281   7e-91    
gb|ABK95336.1|  unknown                                                 280   8e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    280   9e-91    
ref|NP_001238429.1|  uncharacterized protein LOC100499947               280   1e-90    
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    280   1e-90    
gb|AAD56959.1|AF187105_1  LIM domain protein WLIM1                      280   1e-90    Helianthus annuus
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             280   1e-90    
emb|CDY20647.1|  BnaC08g14110D                                          280   2e-90    
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             280   2e-90    
ref|NP_172491.1|  transcription factor lim1                             280   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010999890.1|  PREDICTED: LIM domain-containing protein WLI...    280   2e-90    
ref|XP_008236308.1|  PREDICTED: pollen-specific protein SF3-like        280   2e-90    
gb|AII80544.1|  LIM-domain protein 10                                   280   2e-90    
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        280   2e-90    
ref|XP_007042657.1|  GATA type zinc finger transcription factor f...    280   2e-90    
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        280   2e-90    
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             279   3e-90    
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             279   3e-90    
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        279   4e-90    
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             279   4e-90    
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     278   4e-90    
gb|AII80541.1|  LIM-domain protein 7                                    279   4e-90    
ref|XP_010028358.1|  PREDICTED: pollen-specific protein SF3-like        279   4e-90    
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        279   4e-90    
ref|XP_009414770.1|  PREDICTED: pollen-specific protein SF3-like        278   5e-90    
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             278   5e-90    
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    278   5e-90    
ref|XP_008648273.1|  PREDICTED: LOC541782 isoform X1                    278   5e-90    
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    278   8e-90    
dbj|BAB84584.1|  transcription factor LIM                               278   8e-90    Nicotiana tabacum [American tobacco]
ref|XP_003589058.1|  Transcription factor lim1                          278   9e-90    
emb|CDX94916.1|  BnaC05g07550D                                          278   9e-90    
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        278   1e-89    Ricinus communis
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        277   1e-89    
gb|ABB51614.1|  LIM-domain protein                                      277   1e-89    Brassica napus [oilseed rape]
ref|XP_008364385.1|  PREDICTED: pollen-specific protein SF3-like        277   2e-89    
emb|CDO97286.1|  unnamed protein product                                277   2e-89    
gb|ABA99040.1|  Pollen-specific protein SF3, putative, expressed        277   2e-89    Oryza sativa Japonica Group [Japonica rice]
gb|AGJ83946.1|  lim protein 6                                           276   3e-89    
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              276   3e-89    Ricinus communis
gb|ACG34183.1|  pollen-specific protein SF3                             276   4e-89    Zea mays [maize]
ref|XP_002442217.1|  hypothetical protein SORBIDRAFT_08g016450          276   6e-89    Sorghum bicolor [broomcorn]
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        275   7e-89    
ref|NP_001237652.1|  uncharacterized protein LOC100527547               275   1e-88    
ref|XP_004289780.1|  PREDICTED: pollen-specific protein SF3-like        275   1e-88    
ref|XP_006664058.1|  PREDICTED: pollen-specific protein SF3-like        275   2e-88    
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         275   2e-88    
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    274   2e-88    
dbj|BAA82827.1|  transcription factor Ntlim1                            274   3e-88    Nicotiana tabacum [American tobacco]
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          273   4e-88    
ref|NP_001238190.1|  uncharacterized protein LOC100500444               273   5e-88    
gb|KHN16307.1|  Pollen-specific protein SF3                             273   5e-88    
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             273   7e-88    
ref|XP_004962903.1|  PREDICTED: pollen-specific protein SF3-like        273   7e-88    
gb|KDP44510.1|  hypothetical protein JCGZ_16343                         272   1e-87    
gb|KHN19331.1|  Pollen-specific protein SF3                             272   1e-87    
ref|NP_001148027.1|  pollen-specific protein SF3                        272   1e-87    Zea mays [maize]
ref|NP_001236461.1|  uncharacterized protein LOC100306027               271   2e-87    
ref|XP_003576026.1|  PREDICTED: LIM domain-containing protein WLIM1     272   2e-87    
gb|ABW69660.1|  transcription factor LIM                                271   5e-87    
ref|NP_001235271.1|  uncharacterized protein LOC100500501               270   7e-87    
ref|XP_010091018.1|  Pollen-specific protein SF3                        270   8e-87    
dbj|BAJ94823.1|  predicted protein                                      270   8e-87    
ref|XP_004238086.1|  PREDICTED: LIM domain-containing protein WLIM1     270   1e-86    
dbj|BAB84583.1|  transcription factor LIM                               269   2e-86    Nicotiana tabacum [American tobacco]
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    269   3e-86    
ref|NP_001104937.2|  LOC541782                                          269   4e-86    Zea mays [maize]
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              268   4e-86    Ricinus communis
gb|KHN06818.1|  Pollen-specific protein SF3                             268   4e-86    
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         268   7e-86    
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    267   1e-85    
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     266   3e-85    Vitis vinifera
ref|XP_007143127.1|  hypothetical protein PHAVU_007G046100g             266   3e-85    
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             266   4e-85    
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    266   5e-85    
gb|KHG14633.1|  Pollen-specific SF3                                     264   2e-84    
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        264   4e-84    
ref|XP_004299580.1|  PREDICTED: pollen-specific protein SF3-like        263   5e-84    
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    263   6e-84    
ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        263   7e-84    
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        262   1e-83    
gb|AAD32870.1|AC005489_8  F14N23.8                                      263   2e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AII80542.1|  LIM-domain protein 8                                    261   2e-83    
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             261   3e-83    
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        261   3e-83    
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        261   3e-83    
ref|XP_010111544.1|  Pollen-specific protein SF3                        261   5e-83    
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        260   6e-83    
gb|ABK23670.1|  unknown                                                 260   6e-83    Picea sitchensis
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        258   2e-82    
emb|CDP17006.1|  unnamed protein product                                259   2e-82    
ref|XP_004496871.1|  PREDICTED: pollen-specific protein SF3-like        258   3e-82    
gb|ABK22236.1|  unknown                                                 258   3e-82    Picea sitchensis
gb|KCW55096.1|  hypothetical protein EUGRSUZ_I01055                     258   4e-82    
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     258   5e-82    
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             258   5e-82    
gb|ACA33841.1|  LIM2 transcription factor                               257   8e-82    Pinus pinaster [cluster pine]
ref|XP_009389653.1|  PREDICTED: pollen-specific protein SF3-like        257   1e-81    
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        256   2e-81    
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             256   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    256   2e-81    
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        256   3e-81    
sp|P29675.1|SF3_HELAN  RecName: Full=Pollen-specific protein SF3        257   3e-81    Helianthus annuus
ref|XP_010274389.1|  PREDICTED: LIM domain-containing protein WLI...    256   3e-81    
gb|AAD56957.1|AF187103_1  LIM domain protein PLIM1b                     257   3e-81    Helianthus annuus
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    255   7e-81    
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    255   1e-80    
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    254   1e-80    
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             253   3e-80    Populus trichocarpa [western balsam poplar]
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        254   3e-80    
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     253   6e-80    
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   252   7e-80    Solanum lycopersicum
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    253   7e-80    
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    254   1e-79    
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        251   3e-79    
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    250   4e-79    
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    251   5e-79    
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        249   2e-78    
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                248   2e-78    
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    247   1e-77    
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                245   4e-77    
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        246   5e-77    
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    245   6e-77    
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        244   7e-77    
ref|XP_003608956.1|  LIM domain protein                                 243   2e-76    
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    245   2e-76    
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     243   2e-76    
gb|AFK42303.1|  unknown                                                 241   2e-75    
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        240   5e-75    
gb|EMT23508.1|  Pollen-specific protein SF3                             239   4e-74    
ref|XP_001765937.1|  predicted protein                                  235   5e-73    
gb|EMS67160.1|  Pollen-specific protein SF3                             232   5e-72    
ref|XP_001771340.1|  predicted protein                                  231   2e-71    
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             231   3e-71    
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             229   8e-71    
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             228   2e-70    
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    228   2e-70    
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        228   4e-70    
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        227   5e-70    
gb|EMS52970.1|  Pollen-specific protein SF3                             246   6e-70    
gb|EMT02506.1|  Pollen-specific protein SF3                             246   6e-70    
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    225   2e-69    
ref|XP_008649270.1|  PREDICTED: microtubule-associated protein fu...    244   5e-69    
ref|XP_010227809.1|  PREDICTED: enolase-phosphatase E1-like             243   2e-68    
gb|EEE65408.1|  hypothetical protein OsJ_20745                          226   2e-68    Oryza sativa Japonica Group [Japonica rice]
gb|KHN17859.1|  Pollen-specific protein SF3                             223   4e-68    
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        222   4e-68    
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    223   4e-68    
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             222   6e-68    
ref|NP_001241110.1|  uncharacterized protein LOC100809121               222   7e-68    
ref|XP_004965094.1|  PREDICTED: microtubule-associated protein fu...    241   9e-68    
gb|ABK58469.1|  LIM domain protein WLIM2a                               221   1e-67    Populus tremula x Populus alba [gray poplar]
gb|ABK22125.1|  unknown                                                 221   1e-67    Picea sitchensis
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          221   1e-67    
gb|AFK39062.1|  unknown                                                 221   2e-67    
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             221   2e-67    
ref|NP_001057248.1|  Os06g0237300                                       239   2e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002312139.1|  LIM domain-containing family protein               219   4e-67    Populus trichocarpa [western balsam poplar]
ref|XP_010093495.1|  Pollen-specific protein SF3                        219   5e-67    
gb|EEC80296.1|  hypothetical protein OsI_22314                          239   5e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    219   6e-67    
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         219   7e-67    
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    219   7e-67    
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          219   9e-67    
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              219   1e-66    Ricinus communis
gb|AGJ83945.1|  lim protein 5                                           219   1e-66    
gb|KHG07853.1|  Pollen-specific SF3                                     218   1e-66    
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    218   2e-66    
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    218   2e-66    
gb|ACX47456.1|  LIM1                                                    218   2e-66    Hevea brasiliensis [jebe]
ref|XP_002315180.1|  LIM domain-containing family protein               218   2e-66    Populus trichocarpa [western balsam poplar]
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        218   2e-66    
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        218   2e-66    
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        218   3e-66    
ref|XP_004307607.1|  PREDICTED: pollen-specific protein SF3-like        218   3e-66    
ref|XP_006656826.1|  PREDICTED: microtubule-associated protein fu...    236   3e-66    
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    218   3e-66    
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    217   3e-66    
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    218   4e-66    
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    217   4e-66    
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             217   5e-66    
ref|XP_003600847.1|  LIM domain-containing protein                      217   5e-66    
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    217   5e-66    
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    217   6e-66    
gb|ABK94608.1|  unknown                                                 216   8e-66    Populus trichocarpa [western balsam poplar]
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        216   1e-65    
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             216   1e-65    
emb|CDY20498.1|  BnaC04g05460D                                          216   1e-65    
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             216   2e-65    
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        216   2e-65    
emb|CDY24943.1|  BnaC03g22290D                                          216   2e-65    
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    216   2e-65    
emb|CBL95262.1|  lim domain protein                                     216   2e-65    
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    215   2e-65    Vitis vinifera
emb|CDY60999.1|  BnaA03g56620D                                          216   2e-65    
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             215   2e-65    
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    215   3e-65    
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    215   3e-65    
ref|NP_181519.1|  protein WLIM2A                                        214   6e-65    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               214   6e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AFK34184.1|  unknown                                                 214   6e-65    
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    214   7e-65    
ref|XP_002879831.1|  LIM domain-containing protein                      214   8e-65    
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             214   9e-65    
ref|XP_002876333.1|  LIM domain-containing protein                      214   1e-64    
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    213   1e-64    
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    213   1e-64    
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                213   1e-64    
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             214   1e-64    
gb|KHG27160.1|  Pollen-specific SF3                                     213   1e-64    
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    213   2e-64    
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        213   3e-64    
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        212   5e-64    
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    212   6e-64    
ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        211   7e-64    
gb|AGJ83942.1|  lim protein 2                                           211   7e-64    
emb|CDX76073.1|  BnaA04g03370D                                          214   9e-64    
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    211   9e-64    
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    211   9e-64    
dbj|BAH20111.1|  AT3G55770                                              211   1e-63    
gb|AAL38006.1|AF443117_1  LIM domain protein                            210   2e-63    
emb|CDX72203.1|  BnaC08g26710D                                          211   2e-63    
emb|CDY27267.1|  BnaA09g35350D                                          211   2e-63    
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             211   2e-63    
emb|CDY02959.1|  BnaC04g25270D                                          212   3e-63    
ref|XP_008452650.1|  PREDICTED: pollen-specific protein SF3-like ...    207   8e-63    
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    209   1e-62    
dbj|BAM13335.1|  LIM domain-containing protein                          208   2e-62    
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    207   2e-62    
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        207   3e-62    
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        207   3e-62    
ref|NP_001049655.1|  Os03g0266100                                       206   6e-62    
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    206   8e-62    
gb|AFY03627.1|  transcription factor LIM                                204   1e-61    
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    205   1e-61    
ref|NP_001147673.1|  pollen-specific protein SF3                        206   2e-61    
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    206   2e-61    
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          205   2e-61    
dbj|BAM13338.1|  LIM domain-containing protein                          205   2e-61    
dbj|BAM13339.1|  LIM domain-containing protein                          205   2e-61    
dbj|BAM13341.1|  LIM domain-containing protein                          205   3e-61    
dbj|BAM13340.1|  LIM domain-containing protein                          204   3e-61    
ref|XP_006291888.1|  hypothetical protein CARUB_v10018065mg             204   4e-61    
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        204   7e-61    
ref|XP_001764074.1|  predicted protein                                  204   1e-60    
ref|XP_008795679.1|  PREDICTED: pollen-specific protein SF3-like        205   1e-60    
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        203   2e-60    
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    203   2e-60    
emb|CAA62744.1|  transcription factor L2                                201   4e-60    
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        202   5e-60    
gb|EPS58831.1|  hypothetical protein M569_15983                         201   6e-60    
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        201   1e-59    
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    200   2e-59    
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        200   2e-59    
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        200   3e-59    
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        199   4e-59    
ref|XP_010089139.1|  Pollen-specific protein SF3                        206   7e-59    
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    199   1e-58    
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        199   2e-58    
ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    198   2e-58    
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        198   3e-58    
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             198   3e-58    
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    197   3e-58    
ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    197   6e-58    
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    197   7e-58    
ref|NP_001288583.1|  uncharacterized protein LOC101266456               197   7e-58    
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        196   7e-58    
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        196   1e-57    
dbj|BAK04207.1|  predicted protein                                      195   2e-57    
ref|NP_001190099.1|  actin bundler LIM family protein WLIM2b            196   2e-57    
emb|CDP08845.1|  unnamed protein product                                195   3e-57    
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        195   5e-57    
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        194   5e-57    
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    194   5e-57    
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        194   6e-57    
gb|EPS71497.1|  hypothetical protein M569_03263                         194   6e-57    
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    195   7e-57    
ref|XP_002438129.1|  hypothetical protein SORBIDRAFT_10g008510          210   7e-57    
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    194   8e-57    
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    194   9e-57    
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        194   9e-57    
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             194   1e-56    
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        193   1e-56    
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        193   2e-56    
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        193   2e-56    
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             193   2e-56    
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        192   3e-56    
ref|XP_003558280.1|  PREDICTED: LIM domain-containing protein WLI...    192   3e-56    
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    192   4e-56    
emb|CDP14069.1|  unnamed protein product                                193   4e-56    
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          191   4e-56    
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        191   6e-56    
gb|ACN26203.1|  unknown                                                 191   7e-56    
ref|XP_010923153.1|  PREDICTED: LIM domain-containing protein WLI...    190   7e-56    
ref|XP_004306805.1|  PREDICTED: pollen-specific protein SF3-like        192   7e-56    
ref|NP_001047550.1|  Os02g0641000                                       191   8e-56    
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        191   8e-56    
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    191   8e-56    
emb|CDX71757.1|  BnaC08g31170D                                          191   9e-56    
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    192   9e-56    
ref|XP_010107618.1|  Pollen-specific protein SF3                        191   9e-56    
gb|EMT19855.1|  Pollen-specific protein SF3                             191   9e-56    
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        191   1e-55    
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        190   1e-55    
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        191   1e-55    
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    190   2e-55    
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    190   2e-55    
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        190   3e-55    
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             190   3e-55    
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    189   5e-55    
gb|EPS59684.1|  hypothetical protein M569_15118                         188   5e-55    
ref|NP_001132843.1|  uncharacterized LOC100194335                       188   8e-55    
dbj|BAK06966.1|  predicted protein                                      188   8e-55    
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             189   1e-54    
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             188   1e-54    
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             188   1e-54    
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              188   1e-54    
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         188   1e-54    
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    188   2e-54    
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    188   2e-54    
ref|XP_002882034.1|  LIM domain-containing protein                      188   2e-54    
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    188   2e-54    
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    188   2e-54    
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    187   3e-54    
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    187   4e-54    
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    187   4e-54    
ref|XP_003623892.1|  LIM domain protein 2b                              187   4e-54    
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    187   5e-54    
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    187   5e-54    
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    187   6e-54    
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    186   6e-54    
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    186   7e-54    
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        186   7e-54    
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    186   8e-54    
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              186   8e-54    
gb|AII80545.1|  LIM-domain protein 11                                   186   8e-54    
ref|NP_182104.1|  protein PLIM2A                                        186   8e-54    
emb|CDY01571.1|  BnaC07g35610D                                          186   1e-53    
emb|CDY56926.1|  BnaAnng14450D                                          186   1e-53    
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    186   1e-53    
gb|KHG24101.1|  Pollen-specific SF3                                     186   1e-53    
ref|XP_002302574.1|  LIM domain-containing family protein               186   1e-53    
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             186   1e-53    
ref|XP_011071801.1|  PREDICTED: LIM domain-containing protein WLI...    184   1e-53    
gb|EMT25782.1|  Pollen-specific protein SF3                             186   1e-53    
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   185   1e-53    
ref|NP_171683.1|  LIM family protein                                    185   1e-53    
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    185   2e-53    
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    186   2e-53    
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          185   2e-53    
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        185   2e-53    
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    185   2e-53    
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    185   2e-53    
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    186   2e-53    
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             186   2e-53    
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        185   2e-53    
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                185   2e-53    
emb|CDY15152.1|  BnaC05g00310D                                          184   2e-53    
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    184   3e-53    
gb|KHG08337.1|  Pollen-specific SF3                                     185   3e-53    
gb|KCW77560.1|  hypothetical protein EUGRSUZ_D01873                     184   4e-53    
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    184   4e-53    
ref|XP_004510816.1|  PREDICTED: pollen-specific protein SF3-like        184   4e-53    
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             184   4e-53    
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    186   4e-53    
emb|CDY38028.1|  BnaCnng08890D                                          184   5e-53    
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             184   5e-53    
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                184   5e-53    
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    184   5e-53    
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             184   5e-53    
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    184   5e-53    
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    184   6e-53    
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             184   6e-53    
ref|NP_001140551.1|  uncharacterized LOC100272616                       184   6e-53    
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    184   7e-53    
ref|XP_009766754.1|  PREDICTED: pollen-specific protein SF3-like        183   7e-53    
ref|XP_002892043.1|  LIM domain-containing protein                      183   7e-53    
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             183   9e-53    
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        183   1e-52    
gb|KHN29376.1|  Pollen-specific protein SF3                             183   1e-52    
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    183   1e-52    
gb|AFK33321.1|  unknown                                                 183   1e-52    
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    185   1e-52    
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             183   1e-52    
gb|KEH21040.1|  GATA type zinc finger transcription factor family...    183   1e-52    
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    183   2e-52    
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        183   2e-52    
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             182   2e-52    
gb|ABK58466.1|  LIM domain protein PLIM2a                               182   2e-52    
ref|XP_002320783.2|  LIM domain-containing family protein               182   3e-52    
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        182   3e-52    
gb|KHG30571.1|  Pollen-specific SF3                                     180   4e-52    
emb|CDY18899.1|  BnaC04g04510D                                          182   4e-52    
ref|NP_001053405.1|  Os04g0532500                                       181   4e-52    
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       182   4e-52    
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        182   4e-52    
gb|KHG00940.1|  Pollen-specific SF3                                     181   4e-52    
ref|XP_009340168.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    182   6e-52    
gb|ACU13968.1|  unknown                                                 180   7e-52    
ref|XP_010055180.1|  PREDICTED: pollen-specific protein SF3-like        181   8e-52    
ref|XP_003521910.2|  PREDICTED: pollen-specific protein SF3-like        181   8e-52    
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        181   9e-52    
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        181   1e-51    
ref|XP_002878372.1|  LIM domain-containing protein                      181   1e-51    
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             181   1e-51    
ref|XP_004976340.1|  PREDICTED: pollen-specific protein SF3-like ...    181   1e-51    
gb|AGJ83944.1|  lim protein 4                                           180   2e-51    
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        180   2e-51    
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    180   2e-51    
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        180   2e-51    
emb|CAB71053.1|  LIM domain protein                                     180   2e-51    
ref|XP_004492709.1|  PREDICTED: pollen-specific protein SF3-like        180   3e-51    
gb|AGJ83943.1|  lim protein 3                                           179   3e-51    
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             180   3e-51    
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        179   4e-51    
gb|KHG24611.1|  Pollen-specific SF3                                     179   5e-51    
ref|XP_006431569.1|  hypothetical protein CICLE_v10003359mg             177   5e-51    
ref|XP_006445094.1|  hypothetical protein CICLE_v10022448mg             178   6e-51    
gb|AFW74661.1|  putative LIM-type zinc finger domain family protein     177   6e-51    
emb|CDY27358.1|  BnaC04g50470D                                          179   7e-51    
ref|XP_011072367.1|  PREDICTED: LIM domain-containing protein WLI...    178   9e-51    
gb|EAY79118.1|  hypothetical protein OsI_34224                          179   9e-51    
ref|NP_001064995.1|  Os10g0503100                                       179   9e-51    
dbj|BAJ86406.1|  predicted protein                                      178   1e-50    
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    178   1e-50    
emb|CDY37066.1|  BnaA04g26440D                                          178   1e-50    
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        178   1e-50    
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    177   2e-50    
gb|AEA86290.1|  transcription factor LIM                                174   2e-50    
ref|XP_010037593.1|  PREDICTED: pollen-specific protein SF3-like ...    176   2e-50    
ref|XP_009400630.1|  PREDICTED: pollen-specific protein SF3-like        176   3e-50    



>ref|XP_009766668.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56950.1|AF184885_1 LIM domain protein PLIM1 [Nicotiana tabacum]
Length=191

 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC ACEKTVYLVDRLAADNR+YHK+CFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   PVD     G   S  F GT +KCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVTKPEK---PVDNENGSGSKVSSLFAGTREKCVGCTKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGTAYHKACFKCSH GCTISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL+S
Sbjct  118  YPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLES  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY +++++ +   YHK+CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGS---LDKSFEGIPKVA  560
            C+ H  QLFK  G+   L+   E  P ++
Sbjct  158  CKHHHIQLFKEKGNYSQLESDHETDPALS  186



>gb|AAF13231.1| pollen specific LIM domain protein 1a [Nicotiana tabacum]
Length=191

 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC ACEKTVYLVDRLAADNR+YHK+CFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   PVD     G   S  F GT +KCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVTKPEK---PVDNENGSGTKVSSLFAGTREKCVGCTKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGTAYHKACFKCSH GCTISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL+S
Sbjct  118  YPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLES  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY +++++ +   YHK+CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGS---LDKSFEGIPKVA  560
            C+ H  QLFK  G+   L+   E  P ++
Sbjct  158  CKHHHIQLFKEKGNYSQLESDHETDPALS  186



>dbj|BAO02514.1| predicted LIM domain-containing protein ortholog [Nicotiana alata]
Length=189

 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC ACEKTVYLVDRLAADNR+YHK+CFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   PVD     G   S  F GT +KCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVTKPEK---PVDNENGSGSKVSNLFAGTREKCVGCTKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGTAYHKACFKCSH GCTISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL+S
Sbjct  118  YPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLES  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY +++++ +   YHK+CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGS---LDKSFEGIPKVA  560
            C+ H  QLFK  G+   L+   E  P ++
Sbjct  158  CKHHHIQLFKEKGNYSQLESDHETDPALS  186



>emb|CDP01275.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 157/185 (85%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   PVD  + L    S  FVGT DKCV C+ TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEK---PVDFEKPLANKVSSMFVGTRDKCVGCSKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGTAYHK+CFKC+H GC ISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEKN  182


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = -3

Query  832  KQFQFKKTMA------FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKL  671
            K   F+K +A      F GT  KC+ C KTVY  ++++ +   YHKSCF+C H    +  
Sbjct  87   KPVDFEKPLANKVSSMFVGTRDKCVGCSKTVYPTEKVSVNGTAYHKSCFKCTHGGCVISP  146

Query  670  SNFNSFEGVLYCRPHFDQLFKRTGSLDK  587
            SN+ + EG LYC+ H  QL K  G+L +
Sbjct  147  SNYIAHEGRLYCKHHHIQLIKEKGNLSQ  174



>ref|XP_009606069.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF13232.1| pollen specific LIM domain protein 1b [Nicotiana tabacum]
Length=181

 Score =   295 bits (755),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC ACEKTVYLVDRLAADNR+YHK+CFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSF+G PKV +PEK    V+     G   S  F GT +KCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFDGTPKVTKPEKS---VENENGSGSKVSSLFAGTREKCVGCTKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGTAYHK CFKCSH GCTISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL+S
Sbjct  118  YPIEKVSVNGTAYHKGCFKCSHGGCTISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLES  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY +++++ +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKGCFKCSHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QLFK  G+  +
Sbjct  158  CKHHHIQLFKEKGNYSQ  174



>gb|AAD02543.1| PGPS/D1 [Petunia x hybrida]
Length=195

 Score =   294 bits (753),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC AC+KTVYLVDRLAADNRVYHK+CFRCYHCK TLKLSNFNSFEGV+YCR 
Sbjct  1    MTFAGTTQKCSACDKTVYLVDRLAADNRVYHKACFRCYHCKSTLKLSNFNSFEGVIYCRH  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK  +PEK   PVD     G   S  F GT DKCV C+ TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKFTKPEK---PVDNENGSGNKVSSLFGGTRDKCVGCSKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNG AYHKACFKC+H GCTISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL+S
Sbjct  118  YPIEKVSVNGAAYHKACFKCTHGGCTISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLES  177

Query  268  E  266
            E
Sbjct  178  E  178


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C KTVY +++++ +   YHK+CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSLFGGTRDKCVGCSKTVYPIEKVSVNGAAYHKACFKCTHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK-SFEGIPKVARP  554
            C+ H  QLFK  G+  +   E  P+ A P
Sbjct  158  CKHHHIQLFKEKGNYSQLESENEPESALP  186



>ref|XP_002285355.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CAN72849.1| hypothetical protein VITISV_013939 [Vitis vinifera]
 emb|CBI19396.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P+D+ + +    S  F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PIDSEKPIANKVSSMFAGTRDKCVGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGTAYHK+CFKC+H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTAYHKSCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC+ C+ TVY  +++  +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPIANKVSSMFAGTRDKCVGCKNTVYPTEKVTVNGTAYHKSCFKCTHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            EG LYC+ H  QL K  G+L +
Sbjct  153  EGRLYCKHHHTQLIKEKGNLSQ  174



>ref|XP_011074349.1| PREDICTED: LIM domain-containing protein WLIM1 [Sesamum indicum]
Length=193

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK   P D  + L    S  F GT +KC+ C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEK---PADIEKPLANKVSSMFAGTREKCLACKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT +KC+AC+ TVY  ++++ +   YHKSCF+C H    +  SN+ + 
Sbjct  93   KPLANKVSSMFAGTREKCLACKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPV  533
            EG LYC+ H  QL K  G+L +  EG         GA P 
Sbjct  153  EGRLYCKHHHIQLIKEKGNLSQ-LEGDHDKDSVRTGAVPA  191



>ref|XP_009598300.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=187

 Score =   291 bits (744),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P  A        S  FVGT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKDEKPQAAK------VSSMFVGTREKCFGCKNTV  114

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GCTISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  115  YPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  174

Query  268  EGSGN  254
            +   N
Sbjct  175  DHDKN  179


 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  95   KVSSMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLY  154

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  155  CKHHHIQLIKEKGNLSQ  171



>ref|XP_009769329.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=190

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 151/181 (83%), Gaps = 6/181 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P  A        S  FVGT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKDEKPQAAK------VSSMFVGTREKCFGCKNTV  114

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GCTISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  115  YPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  174

Query  268  E  266
            +
Sbjct  175  D  175


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  95   KVSSMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLY  154

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  155  CKHHHIQLIKEKGNLSQ  171



>ref|XP_008811666.1| PREDICTED: pollen-specific protein SF3 [Phoenix dactylifera]
Length=195

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT  KC AC KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTQTKCTACSKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   PVD  +      S  F GT +KCV C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEK---PVDTEKPTANRVSSSFAGTREKCVGCMKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP E+++VNGTAYHK+CFKC+H GC ISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL++
Sbjct  118  YPIERVTVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLET  177

Query  268  E  266
            +
Sbjct  178  D  178



>ref|XP_006422808.1| hypothetical protein CICLE_v10029316mg [Citrus clementina]
 ref|XP_006486914.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR36048.1| hypothetical protein CICLE_v10029316mg [Citrus clementina]
 gb|KDO57910.1| hypothetical protein CISIN_1g029230mg [Citrus sinensis]
Length=197

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 155/179 (87%), Gaps = 5/179 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSNFNSFEGVLYCRPHF
Sbjct  5    FGGTQQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNFNSFEGVLYCRPHF  64

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFKRTGSL+KSFEG PK+ +PEK    +   E   +V S  FVGT DKCV C  TVYP
Sbjct  65   DQLFKRTGSLEKSFEGTPKIVKPEK----LVENENAQKV-SNKFVGTRDKCVGCDRTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            TEK+SVNG AYH++CFKCSH GCTISPSNYIA+EG+LYCKHHHIQLF+EKGNYSQL+S+
Sbjct  120  TEKVSVNGAAYHRSCFKCSHGGCTISPSNYIAHEGKLYCKHHHIQLFREKGNYSQLESD  178


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C++TVY  ++++ +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNKFVGTRDKCVGCDRTVYPTEKVSVNGAAYHRSCFKCSHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QLF+  G+  +    + K    EK      A E
Sbjct  158  CKHHHIQLFREKGNYSQLESDLEKSQISEKPTPVQIAAE  196



>ref|XP_006342667.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=187

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 151/185 (82%), Gaps = 6/185 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNRV+HK+CFRCYHCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCYHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P  A        S  FVGT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKDEKPQAAK------VSSMFVGTREKCFGCKNTV  114

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHH+QL KEKGN SQL+ 
Sbjct  115  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHVQLIKEKGNLSQLEG  174

Query  268  EGSGN  254
            +   N
Sbjct  175  DHDKN  179


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  95   KVSSMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  154

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  155  CKHHHVQLIKEKGNLSQ  171



>gb|ABK93551.1| unknown [Populus trichocarpa]
 gb|ACN97187.1| LIM transcription factor [Populus trichocarpa]
Length=197

 Score =   288 bits (738),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVDRLAADNRVYHK+CFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDRLAADNRVYHKACFRCHHCRGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   PVD  + +    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKILKPEK---PVDGEKPISTKVSTMFAGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT+YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTSYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPISTKVSTMFAGTRDKCFGCKNTVYPTEKVSVNGTSYHKSCFKCIHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            EG LYC+ H +QL K  G+L +    + K +  +K  G
Sbjct  153  EGRLYCKHHHNQLIKEKGNLSQLEGDVEKDSMNDKTNG  190



>ref|XP_010938994.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=195

 Score =   288 bits (737),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT  KC AC KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTQTKCTACSKTVYLVDKLTADNRIYHKACFRCHHCQGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   PVD  +      S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEK---PVDTEKTAANRVSSQFAGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP E+++VNGTAYHK+CFKC+H GC ISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL++
Sbjct  118  YPIERVTVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLET  177

Query  268  E  266
            +
Sbjct  178  D  178



>ref|XP_006352087.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=193

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC AC+KTVYLVDRLAADNR+YHK+CFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCNACDKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK    VD     G   S  F GT +KCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKITKPEKS---VDNENGTGAKVSSLFAGTREKCVCCTKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++VNG AYHK CFKC+H GCTISPSNYIA+EG LYCKHHHIQLFKEKGNYSQL+
Sbjct  118  YPIEKVTVNGAAYHKTCFKCTHGGCTISPSNYIAHEGTLYCKHHHIQLFKEKGNYSQLE  176


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++++  +   YHK+CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSLFAGTREKCVCCTKTVYPIEKVTVNGAAYHKTCFKCTHGGCTISPSNYIAHEGTLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QLFK  G+  +
Sbjct  158  CKHHHIQLFKEKGNYSQ  174



>ref|XP_004142897.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004156385.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN62442.1| hypothetical protein Csa_2G354680 [Cucumis sativus]
Length=198

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ+FKRTGSLDKSFEG PK+ +PEK   P+D+        +  F GT DKC+ C  TV
Sbjct  61   HFDQIFKRTGSLDKSFEGTPKIVKPEK---PIDSERPTANKVASKFGGTRDKCLGCDNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GCTISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 1/95 (1%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C+ TVY  +++  +   YHKSCF+C H   T+  SN+ + EG LYC+ H 
Sbjct  103  FGGTRDKCLGCDNTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  622  DQLFKRTGSLDKSFEGIPKVARPEK-GAGPVDAGE  521
             QL K  G+L +      K+   EK   G V A E
Sbjct  163  IQLIKEKGNLSQLEGDHEKITAKEKINGGEVVASE  197



>ref|XP_002302405.2| hypothetical protein POPTR_0002s11880g [Populus trichocarpa]
 ref|XP_011017108.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
 gb|ABK58468.1| LIM domain protein WLIM1b [Populus tremula x Populus alba]
 gb|EEE81678.2| hypothetical protein POPTR_0002s11880g [Populus trichocarpa]
Length=197

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVDRLAADNRVYHK+CFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDRLAADNRVYHKACFRCHHCRGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   PVD  + +    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PVDGEKPISTKVSTMFAGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPISTKVSTMFAGTRDKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            EG LYC+ H +QL K  G+L +    + K +  +K  G
Sbjct  153  EGRLYCKHHHNQLIKEKGNLSQLEGDVEKDSMNDKTNG  190



>ref|XP_004250748.1| PREDICTED: LIM domain-containing protein WLIM1-like [Solanum 
lycopersicum]
Length=193

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M F GT QKC AC+KTVYLVDRLAADNRVYHK+CFRCYHCK TLKLSNFNSF+GV+YCRP
Sbjct  1    MTFAGTTQKCNACDKTVYLVDRLAADNRVYHKACFRCYHCKSTLKLSNFNSFDGVIYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK    VD         S  F GT +KCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKITKPEKT---VDNENGTSNKVSSLFAGTREKCVCCTKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++VNG AYHKACFKCSH GCTISPSNYIA+EG LYCKHHHIQLFKEKGNYSQL+
Sbjct  118  YPIEKVTVNGAAYHKACFKCSHGGCTISPSNYIAHEGTLYCKHHHIQLFKEKGNYSQLE  176


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++++  +   YHK+CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSLFAGTREKCVCCTKTVYPIEKVTVNGAAYHKACFKCSHGGCTISPSNYIAHEGTLY  157

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QLFK  G+
Sbjct  158  CKHHHIQLFKEKGN  171



>ref|XP_011092491.1| PREDICTED: LIM domain-containing protein WLIM1-like [Sesamum 
indicum]
Length=194

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 153/181 (85%), Gaps = 5/181 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GTNQKC AC  TVYLVD+LAADNR+YHK+CFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTNQKCTACNGTVYLVDKLAADNRIYHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   P++  E   +V S  F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEK---PLE-NENASKV-SSMFGGTKDKCVGCNKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGTAYHKACFKCSH GCTISPSNYIA+EG LYCKHHHIQL K KGNYSQL+S
Sbjct  116  YPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGVLYCKHHHIQLVKAKGNYSQLES  175

Query  268  E  266
            +
Sbjct  176  D  176


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C KTVY +++++ +   YHK+CF+C H   T+  SN+ + EGVLY
Sbjct  96   KVSSMFGGTKDKCVGCNKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGVLY  155

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QL K  G+
Sbjct  156  CKHHHIQLVKAKGN  169



>ref|XP_002266499.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CBI22440.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 152/182 (84%), Gaps = 4/182 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVDRL ADNR+YHK+CFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDRLTADNRIYHKACFRCHHCRGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLG-RVPSGHFVGTTDKCVTCTLT  452
            HFDQLFKRTGSLDKSFEG PK+ +PEK     D  E       S  FVGT DKCV C  T
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---TTDHSENAATNKVSNMFVGTKDKCVGCNKT  117

Query  451  VYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             YP EK++VNGT YHK+CFKC++ GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL+
Sbjct  118  AYPLEKVTVNGTPYHKSCFKCTYGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLE  177

Query  271  SE  266
            S+
Sbjct  178  SD  179


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C KT Y ++++  +   YHKSCF+C +   T+  SN+ + EG LY
Sbjct  99   KVSNMFVGTKDKCVGCNKTAYPLEKVTVNGTPYHKSCFKCTYGGCTISPSNYIAHEGKLY  158

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QLFK  G+
Sbjct  159  CKHHHIQLFKEKGN  172



>ref|XP_007225874.1| hypothetical protein PRUPE_ppa011761mg [Prunus persica]
 gb|EMJ27073.1| hypothetical protein PRUPE_ppa011761mg [Prunus persica]
Length=197

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PE+   PVD  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPER---PVDNEKPAVAKASSMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK CFKCSH GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DSEKN  182


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHTQLIKEKGNLSQ  174



>ref|XP_007018479.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOY15704.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=193

 Score =   287 bits (734),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYH++CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHEACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK A   DA +      SG F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKQA---DAEKPAATKASGMFAGTRDKCVGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTE+++VNGT YHK+CFKC+H GC ISPSNY+A+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTERVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGRLYCKHHHGQLIKEKGNLSQLEG  177

Query  268  E  266
            E
Sbjct  178  E  178


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C+ TVY  +R+  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KASGMFAGTRDKCVGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHGQLIKEKGNLSQ  174



>gb|AGE09584.1| LIM1-like protein [Eucalyptus cladocalyx]
Length=188

 Score =   286 bits (733),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNFNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   PVD         SG F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGNPKIAKPEK---PVDGERPAATKVSGMFGGTRDKCVGCKSTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNYIA+EG+LYC+HHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCRHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178



>ref|XP_008220373.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=197

 Score =   286 bits (733),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PE+   PVD+ +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPER---PVDSEKPAVAKASSMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK CFKCSH GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DYEKN  182


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHTQLIKEKGNLSQ  174



>ref|XP_004252738.1| PREDICTED: LIM domain-containing protein WLIM1-like [Solanum 
lycopersicum]
Length=187

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 151/185 (82%), Gaps = 6/185 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P  A        S  FVGT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKDEKPHAAK------VSSMFVGTREKCFGCKNTV  114

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHH+QL KEKGN SQL+ 
Sbjct  115  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHVQLIKEKGNLSQLEG  174

Query  268  EGSGN  254
            +   N
Sbjct  175  DHDKN  179


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  95   KVSSMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  154

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  155  CKHHHVQLIKEKGNLSQ  171



>ref|XP_004290976.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=191

 Score =   286 bits (732),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 152/183 (83%), Gaps = 3/183 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR++HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PE+   P+D+ +      SG F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPER---PIDSEKPAASKASGMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK CFKC+H GCTISPSNYIA+EGRLYCKHHH QL +EKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQLEG  177

Query  268  EGS  260
             G 
Sbjct  178  GGD  180


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASGMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL +  G+L +
Sbjct  158  CKHHHTQLIREKGNLSQ  174



>ref|XP_008444540.1| PREDICTED: pollen-specific protein SF3 [Cucumis melo]
Length=198

 Score =   286 bits (733),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ+FKRTGSLDKSFEG PK+ +PEK   P+D+ +      +  F GT DKC+ C  TV
Sbjct  61   HFDQIFKRTGSLDKSFEGTPKIVKPEK---PIDSEKPTANKVASMFGGTRDKCLGCDNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNG  YHK+CFKC H GCTISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGIPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 1/95 (1%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C+ TVY  +++  +   YHKSCF+C H   T+  SN+ + EG LYC+ H 
Sbjct  103  FGGTRDKCLGCDNTVYPTEKVTVNGIPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  622  DQLFKRTGSLDKSFEGIPKVARPEK-GAGPVDAGE  521
             QL K  G+L +      K+   EK   G V A E
Sbjct  163  IQLIKEKGNLSQLEGDHEKITAKEKINGGEVVASE  197



>ref|XP_004141291.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004163244.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN55277.1| hypothetical protein Csa_4G643070 [Cucumis sativus]
Length=179

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P D+ +      +  FVGT DKC+ C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIGKPEK---PGDSEKPTATKVASMFVGTKDKCLGCNKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YPTEK+SVNGT+YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+
Sbjct  118  YPTEKVSVNGTSYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLE  176



>ref|XP_002298780.2| hypothetical protein POPTR_0001s30020g [Populus trichocarpa]
 gb|EEE83585.2| hypothetical protein POPTR_0001s30020g [Populus trichocarpa]
Length=196

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 157/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKLSN++SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PVD-NENASKV-SNLFAGTREKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCNKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QLFK  G+
Sbjct  157  CKHHHIQLFKEKGN  170



>gb|ABK58465.1| LIM domain protein GLIM1b [Populus tremula x Populus alba]
Length=196

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 157/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKLSN++SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+A+PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIAKPEK---PVD-NENASKV-SNLFAGTREKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH+ CFKC+H GCT+SPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRRCFKCTHGGCTVSPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++++  +   YH+ CF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCNKTVYPIEKVTVNGTPYHRRCFKCTHGGCTVSPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QLFK  G+
Sbjct  157  CKHHHIQLFKEKGN  170



>gb|ABK94586.1| unknown [Populus trichocarpa]
Length=196

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 157/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKLSN++SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PVD-NENASKV-SNLFAGTREKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTQYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCNKTVYPIEKVTVNGTQYHRSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QLFK  G+  +
Sbjct  157  CKHHHIQLFKEKGNYSQ  173



>ref|XP_008452649.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=179

 Score =   285 bits (729),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P D+ +      +  F+GT DKC+ C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIGKPEK---PGDSEKPTATKVASMFIGTKDKCLGCNKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YPTEK+SVNGT+YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+
Sbjct  118  YPTEKVSVNGTSYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLE  176



>gb|AGE09578.1| LIM-like protein [Eucalyptus cladocalyx]
Length=192

 Score =   285 bits (730),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 155/185 (84%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ+FKRTGSL+KSFEGIPK+ +PE+   P+   +      SG F GT +KC  C  TV
Sbjct  61   HFDQIFKRTGSLEKSFEGIPKIVKPER---PLGGEKPAAAKVSGMFAGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GCTISPSNYIA+EG+L+CKHHH QL +EKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGKLFCKHHHAQLIREKGNLSQLEG  177

Query  268  EGSGN  254
            + +GN
Sbjct  178  DQAGN  182



>ref|NP_001235758.1| uncharacterized protein LOC100305720 [Glycine max]
 gb|ACU13553.1| unknown [Glycine max]
Length=196

 Score =   285 bits (730),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK      A  ++    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTGEEKPAATKV----SSMFGGTRDKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QL K  G+L +      K    EK  G V A E
Sbjct  157  CKHHHIQLIKEKGNLSQLEGDHEKSTEEEKINGEVVAAE  195



>gb|KHN04435.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK      A  ++    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTGEEKHAATKV----SSMFGGTRDKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QL K  G+L +      K    EK  G V A E
Sbjct  157  CKHHHIQLIKEKGNLSQLEGDHEKSTEEEKINGEVVAAE  195



>ref|XP_006857164.1| hypothetical protein AMTR_s00065p00168710 [Amborella trichopoda]
 gb|ERN18631.1| hypothetical protein AMTR_s00065p00168710 [Amborella trichopoda]
Length=193

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 155/183 (85%), Gaps = 4/183 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLVD+L ADNR +HK+CFRC+HCKGTLKLSN+ SFEGVLYCRP
Sbjct  1    MAFAGTTQKCHACEKTVYLVDKLTADNRSFHKACFRCHHCKGTLKLSNYCSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            H+DQLFKRTGSLDKSFEG PK+A+PEK   P+D+  +  RV SG F GT DKCV C  TV
Sbjct  61   HYDQLFKRTGSLDKSFEGTPKIAKPEK---PIDSEGQGARV-SGLFAGTRDKCVGCKKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++V+G+AYHK+CFKC H GC ISPSNYIA+EGRLYCKHHH QLFKEKGNYSQLD 
Sbjct  117  YPIEKVAVDGSAYHKSCFKCCHGGCVISPSNYIAHEGRLYCKHHHSQLFKEKGNYSQLDK  176

Query  268  EGS  260
             G+
Sbjct  177  SGN  179



>ref|XP_010548517.1| PREDICTED: LIM domain-containing protein WLIM1-like [Tarenaya 
hassleriana]
Length=186

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 153/183 (84%), Gaps = 4/183 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC++TVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDRTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+ +PEK  G   A  ++    S  F GT +KCV C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIVKPEKPDGERPATNKV----SSMFAGTREKCVGCDKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  117  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHVQLIKEKGNLSQLEG  176

Query  268  EGS  260
            + S
Sbjct  177  DNS  179


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSSMFAGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHVQLIKEKGNLSQ  173



>ref|NP_001238580.1| uncharacterized protein LOC100499957 [Glycine max]
 gb|ACU14335.1| unknown [Glycine max]
 gb|KHN45139.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK      A  ++    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTGEEKPAATKV----SSMFGGTRDKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKHHHVQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 53/99 (54%), Gaps = 0/99 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QL K  G+L +      K A  EK  G V A E
Sbjct  157  CKHHHVQLIKEKGNLSQLEGDHEKSAEQEKINGEVVAAE  195



>gb|EYU39077.1| hypothetical protein MIMGU_mgv1a014557mg [Erythranthe guttata]
Length=186

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC  TVYLVDRLAADNR++HK+CFRC+HCK TLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCTACSGTVYLVDRLAADNRIFHKACFRCHHCKSTLKLGNFNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK     +A +      S  F GT DKCV CT TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKTVENENASK-----VSSMFGGTRDKCVGCTKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNG AYHK+CFKCSH GCTISPSNYIA+EG LYCKHHHIQLFK KGNYSQL+S
Sbjct  116  YPIEKVSVNGAAYHKSCFKCSHGGCTISPSNYIAHEGTLYCKHHHIQLFKSKGNYSQLES  175

Query  268  EGS  260
            + +
Sbjct  176  DSA  178


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C KTVY +++++ +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  96   KVSSMFGGTRDKCVGCTKTVYPIEKVSVNGAAYHKSCFKCSHGGCTISPSNYIAHEGTLY  155

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QLFK  G+  +
Sbjct  156  CKHHHIQLFKSKGNYSQ  172



>ref|XP_009375152.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=197

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +P+K   P+D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPDK---PIDNEKSAVAKASSMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK CFKC+H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+ TVY  ++++ +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCFGCKNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEK-GAGPVDA  527
            C+ H  QL K  G+L +      K+A  EK GA  V A
Sbjct  158  CKHHHTQLIKEKGNLSQLEGDHEKIAEDEKVGAREVAA  195



>gb|AFV60741.1| LIM domain protein LIM-2 [Gossypium hirsutum]
Length=190

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   PVD  + +    SG F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEK---PVDGEKPIATKVSGMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTE+++VNGT YHK+CFKC+H GC ISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGRLYCKHHHGQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC  C+ TVY  +R+  +   YHKSCF+C H    +  SN+ + 
Sbjct  93   KPIATKVSGMFGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            EG LYC+ H  QL K  G+L +
Sbjct  153  EGRLYCKHHHGQLIKEKGNLSQ  174



>ref|XP_008347599.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=197

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   P+D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PIDNEKPAVAKASSMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK CFKC+H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+ TVY  ++++ +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCFGCKNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPE  551
            C+ H  QL K  G+L +      ++A  E
Sbjct  158  CKHHHTQLIKEKGNLSQLEGDHERIAEDE  186



>ref|XP_010059807.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW66254.1| hypothetical protein EUGRSUZ_F00087 [Eucalyptus grandis]
Length=192

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ+FKRTGSL+KSFEGIPK+ +PE+   P+ + +      SG F GT +KC  C  TV
Sbjct  61   HFDQIFKRTGSLEKSFEGIPKIVKPER---PLGSEKPAAAKVSGMFAGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+L+CKHHH QL +EKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLFCKHHHAQLIREKGNLSQLEG  177

Query  268  EGSGN  254
            + +GN
Sbjct  178  DHAGN  182



>ref|XP_010544006.1| PREDICTED: LIM domain-containing protein WLIM1 [Tarenaya hassleriana]
Length=186

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 152/181 (84%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC++TVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDRTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+ +PEK  G   A  ++    S  F GT +KCV C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIGKPEKPDGERPAANKV----SSMFAGTREKCVGCDKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNY+A+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  117  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYVAHEGKLYCKHHHIQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSSMFAGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYVAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHIQLIKEKGNLSQ  173



>ref|XP_009408124.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 5/181 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT  KCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK TGSLDKSFEG PKV +PEK    VD  E   +V S  F GT +KCV C+ TV
Sbjct  61   HFDQLFKMTGSLDKSFEGTPKVVKPEK---YVD-NENANKVSSA-FAGTQEKCVGCSKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP E+++VNGTAYHK+CFKC H GC ISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++
Sbjct  116  YPIERVTVNGTAYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLEN  175

Query  268  E  266
            +
Sbjct  176  D  176


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY ++R+  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  96   KVSSAFAGTQEKCVGCSKTVYPIERVTVNGTAYHKSCFKCCHGGCVISPSNYIAHEGKLY  155

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            C+ H  QLFK  G+  +  E     A+ E  A 
Sbjct  156  CKHHHIQLFKEKGNYSQ-LENDEAEAKSESSAA  187



>ref|XP_010061652.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 dbj|BAD91878.1| transcription factor lim1 [Eucalyptus globulus]
 dbj|BAD91879.1| transcription factor lim1 [Eucalyptus globulus]
 dbj|BAD91880.1| transcription factor lim1 [Eucalyptus camaldulensis]
 dbj|BAD91881.1| transcription factor lim1 [Eucalyptus camaldulensis]
 dbj|BAM05590.1| LIM transcription factor [Eucalyptus pilularis]
 gb|KCW68639.1| hypothetical protein EUGRSUZ_F02243 [Eucalyptus grandis]
Length=188

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   PVD         S  F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEK---PVDGERPAATKASSMFGGTRDKCVGCKSTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNY+A+EG+LYC+HHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C+ TVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QL K  G+L +
Sbjct  158  CRHHHTQLIKEKGNLSQ  174



>gb|EYU25518.1| hypothetical protein MIMGU_mgv1a014425mg [Erythranthe guttata]
Length=190

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD L ADNR++HK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDMLTADNRIFHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +P+K   P +  +      S  F GT DKC+ C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPDK---PANIEKPNANKVSNMFAGTRDKCLACKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT+YHK CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTSYHKNCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+ TVY  ++++ +   YHK+CF+C H    +  SN+ + EG LY
Sbjct  98   KVSNMFAGTRDKCLACKNTVYPTEKVSVNGTSYHKNCFKCSHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEG  575
            C+ H  QL K  G+L +  EG
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEG  177



>gb|EYU36386.1| hypothetical protein MIMGU_mgv1a009946mg [Erythranthe guttata]
Length=326

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            + QGT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HC GTLKL+N+NSFEGVLYCRPH
Sbjct  141  SIQGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLANYNSFEGVLYCRPH  200

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSF+G PK+A+PEK   P D  +       G FVGT +KC+ C  TVY
Sbjct  201  FDQLFKRTGSLDKSFDGTPKIAKPEK---PSDTEKPQANKMIGMFVGTREKCLACKNTVY  257

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTEK+SVNGTAYHK+CFKCSH GC ISPSNYIA+EGRLYCKHHH+QL KEKGN SQL+ +
Sbjct  258  PTEKVSVNGTAYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHLQLIKEKGNLSQLEGD  317


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  505  PSGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYC  326
            P+    GTT KC+ C  TVY  +K++ +   YHKACF+C H   T+  +NY ++EG LYC
Sbjct  138  PAKSIQGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLANYNSFEGVLYC  197

Query  325  KHHHIQLFKEKGNYSQ  278
            + H  QLFK  G+  +
Sbjct  198  RPHFDQLFKRTGSLDK  213



>dbj|BAM05591.1| LIM transcription factor [Eucalyptus pyrocarpa]
 dbj|BAM05592.1| LIM transcription factor [Eucalyptus globulus subsp. globulus]
Length=188

 Score =   283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   P+D         S  F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEK---PIDGERPAATKVSSMFGGTRDKCVGCKSTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNY+A+EG+LYC+HHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C+ TVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QL K  G+L +
Sbjct  158  CRHHHTQLIKEKGNLSQ  174



>dbj|BAB84581.1| transcription factor LIM [Populus kitakamiensis]
Length=197

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   PVD  + +    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PVDGEKPVSTKVSTMFAGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPVSTKVSTMFAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            EG LYC+ H +QL K  G+L +    I K +   K  G   A E
Sbjct  153  EGRLYCKHHHNQLIKEKGNLSQLEGDIEKDSMSNKTNGREVAAE  196



>ref|XP_002320687.1| transcription factor LIM family protein [Populus trichocarpa]
 dbj|BAB84582.1| transcription factor LIM [Populus kitakamiensis]
 gb|EEE99002.1| transcription factor LIM family protein [Populus trichocarpa]
 gb|ACN97188.1| LIM transcription factor [Populus trichocarpa]
 gb|ACT64134.1| transcription factor Lim1 [Populus deltoides]
 gb|ACT64135.1| transcription factor Lim1 [Populus deltoides]
Length=197

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   PVD  + +    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PVDGEKPVSTKVSTMFAGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPVSTKVSTMFAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            EG LYC+ H +QL K  G+L +    I K +   K  G   A E
Sbjct  153  EGRLYCKHHHNQLIKEKGNLSQLEGDIEKDSMNNKTNGREVAAE  196



>gb|ABK58464.1| LIM domain protein GLIM1a [Populus tremula x Populus alba]
Length=195

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 156/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HC+GTLKLSN+ SFEGVLYCRPH
Sbjct  3    AFSGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PVD-NENASKV-SNLFAGTREKCVGCDKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS---LDKSFEGIPKVA  560
            C+ H  QLFK  G+   L+   E  P V+
Sbjct  157  CKHHHIQLFKEKGNYSQLENEREKNPVVS  185



>ref|XP_009360821.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=195

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PE+   PVD  +      S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPER---PVDNEKPAVAKASSMFGGTREKCFGCRNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK CFKC+H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C  TVY  ++++ +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTREKCFGCRNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDA  527
            C+ H  QL K  G+L +  EG  +    ++ A  V A
Sbjct  158  CKHHHTQLIKEKGNLSQ-LEGDNEKMAVDENAREVAA  193



>ref|XP_006433641.1| hypothetical protein CICLE_v10002540mg [Citrus clementina]
 ref|XP_006472306.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR46881.1| hypothetical protein CICLE_v10002540mg [Citrus clementina]
 gb|KDO37193.1| hypothetical protein CISIN_1g029070mg [Citrus sinensis]
Length=199

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRPH
Sbjct  4    AFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PK+A+PEK   P+D  +      S  F GT +KCV C  TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKIAKPEK---PIDGEKPNVAKVSTMFGGTREKCVGCKNTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ E
Sbjct  121  PTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEGE  180


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+ TVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  100  KVSTMFGGTREKCVGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  159

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERL  515
            C+ H +QL K  G+L +  EG       E     V+A ER+
Sbjct  160  CKHHHNQLIKEKGNLSQ-LEG-------EHEKTSVNANERV  192



>ref|XP_002313186.2| hypothetical protein POPTR_0009s09040g [Populus trichocarpa]
 gb|ABK93559.1| unknown [Populus trichocarpa]
 gb|EEE87141.2| hypothetical protein POPTR_0009s09040g [Populus trichocarpa]
Length=195

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 156/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HC+GTLKLSN+ SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PVD-NENASKV-SNLFAGTREKCVGCDKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS---LDKSFEGIPKVA  560
            C+ H  QLFK  G+   L+   E  P V+
Sbjct  157  CKHHHIQLFKEKGNYSQLENEREKNPVVS  185



>ref|XP_011030325.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=196

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 156/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKLSN++SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PVD-NENASKV-SNLFAGTREKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHH IQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHLIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCNKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QLFK  G+
Sbjct  157  CKHHLIQLFKEKGN  170



>ref|XP_010094354.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB55842.1| Pollen-specific protein SF3 [Morus notabilis]
Length=198

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ + EK   P+D+ +      +  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKAEK---PLDSDKPAVAKVTSMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GCTISPSNYIA+EGRLYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT  KC  C+ TVY  +++  +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVTSMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEG  575
            C+ H  QL K  G+L +  EG
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEG  177



>ref|XP_007201308.1| hypothetical protein PRUPE_ppa011881mg [Prunus persica]
 gb|EMJ02507.1| hypothetical protein PRUPE_ppa011881mg [Prunus persica]
Length=192

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 152/181 (84%), Gaps = 4/181 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKC ACEKTVYLVDRLAAD+RVYHK+CFRC+HC GTLKLSN+ SFEGVLYCRPH
Sbjct  3    TFAGTTQKCTACEKTVYLVDRLAADSRVYHKACFRCHHCTGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK +   + G  +  +    F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKILKPEKSSTDKENGNSVSNL----FAGTREKCVGCQKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK+SVNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  119  PIEKVSVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  178

Query  265  G  263
            G
Sbjct  179  G  179



>gb|AFK42495.1| unknown [Lotus japonicus]
Length=195

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKVA+PE+    +D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVAKPERN---IDNEKPAAAKVSSMFGGTRDKCAGCQKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEKN  182


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHIQLIKEKGNLSQ  174



>ref|XP_008393720.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008351969.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=195

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PE+   PVD  +      S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPER---PVDNEKPAVAKASSMFGGTREKCFGCRNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK CFKC+H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C  TVY  ++++ +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTREKCFGCRNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKG  545
            C+ H  QL K  G+L +      K+A  E G
Sbjct  158  CKHHHTQLIKEKGNLSQLEGDNEKIAVDENG  188



>gb|AFK47041.1| unknown [Lotus japonicus]
Length=195

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKVA+PE+    +D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVAKPERN---IDNEKPAAAKVSSMFGGTRDKCAGCQKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEKN  182


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHIQLIKEKGNLSQ  174



>gb|AAD39103.1|AF116849_1 LIM domain protein WLIM-1 [Helianthus annuus]
Length=188

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 151/184 (82%), Gaps = 3/184 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +  K    +D  + +    S  FVGT DKC+ C  TV
Sbjct  61   HFDQLFKKTGSLDKSFEGTPKIVKQPK---TIDGEKPMANKVSSMFVGTKDKCLGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGTAYHK+CFKCSH GCTISPSNYIA+EG LYC+HHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTAYHKSCFKCSHGGCTISPSNYIAHEGHLYCRHHHTQLIKEKGNLSQLEG  177

Query  268  EGSG  257
            E S 
Sbjct  178  ERSA  181


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC+ C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPMANKVSSMFVGTKDKCLGCKNTVYPTEKVSVNGTAYHKSCFKCSHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            EG LYCR H  QL K  G+L +
Sbjct  153  EGHLYCRHHHTQLIKEKGNLSQ  174



>ref|XP_010272870.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272878.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272885.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272891.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=196

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC KTVYLVD+L ADNR+YHKSCFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACAKTVYLVDQLTADNRIYHKSCFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK   P        +V S  F GT DKC+ C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEK---PESENATTNKV-SNMFGGTRDKCICCKKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++V+G AYHK CFKC+H GC ISPSNYIA+EG+LYC+HHH QLFKEKGNYSQL+ 
Sbjct  117  YPLEKVTVDGNAYHKICFKCTHGGCVISPSNYIAHEGKLYCRHHHTQLFKEKGNYSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C+KTVY ++++  D   YHK CF+C H    +  SN+ + EG LY
Sbjct  97   KVSNMFGGTRDKCICCKKTVYPLEKVTVDGNAYHKICFKCTHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS  596
            CR H  QLFK  G+
Sbjct  157  CRHHHTQLFKEKGN  170



>gb|ABY21316.1| LIM1 [Lilium longiflorum]
Length=181

 Score =   281 bits (718),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 150/179 (84%), Gaps = 5/179 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT QKCMAC KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTQKCMACTKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            H+DQLFKRTGSL+KSFEG PK+ +PEK  G  +A +      SG F GT +KCV C  TV
Sbjct  61   HYDQLFKRTGSLEKSFEGTPKIVKPEKPIGTENANK-----VSGAFAGTKEKCVGCQKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP E+++VNGT YHK+CFKC+H GCTISPSNYIA+EG LYCKHHHIQL KEKGN SQL+
Sbjct  116  YPIERVTVNGTCYHKSCFKCAHGGCTISPSNYIAHEGTLYCKHHHIQLIKEKGNLSQLE  174


 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C+KTVY ++R+  +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  96   KVSGAFAGTKEKCVGCQKTVYPIERVTVNGTCYHKSCFKCAHGGCTISPSNYIAHEGTLY  155

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  156  CKHHHIQLIKEKGNLSQ  172



>dbj|BAM05589.1| LIM transcription factor [Eucalyptus pilularis]
Length=188

 Score =   281 bits (718),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   PVD         S  F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEK---PVDGERPAATKASSMFGGTRDKCVGCKSTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNY+A+EG+LYC+HH  QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRHHXTQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C+ TVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QL K  G+L +
Sbjct  158  CRHHXTQLIKEKGNLSQ  174



>gb|AAD56948.1|AF184109_1 LIM domain protein WLIM1 [Nicotiana tabacum]
Length=193

 Score =   281 bits (718),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KT YLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTAYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +P+K   P+D+G+      +  F GT +KC  C  TV
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQK---PIDSGKPQVAKVTSMFGGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEMN  182


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+KTVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L K
Sbjct  158  CKHHHIQLIKEKGNLSK  174



>ref|XP_010942770.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=195

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT  KC AC KTVYLVD+L ADNR+YHK+CF+C+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTQTKCTACSKTVYLVDKLTADNRIYHKACFKCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK TGSLDKSFEG PK+ +PEK   PV   +      S  F GT +KCV C  TV
Sbjct  61   HFDQLFKMTGSLDKSFEGTPKIVKPEK---PVITEKPAAHKVSSAFAGTREKCVGCRKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTE+++VNGTAYH++CFKC+H GC ISPSNYIA+EGRLYCKHHHIQL KEKGNYSQL++
Sbjct  118  YPTERVTVNGTAYHRSCFKCTHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNYSQLET  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 4/99 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY  +R+  +   YH+SCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSAFAGTREKCVGCRKTVYPTERVTVNGTAYHRSCFKCTHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QL K  G+  +      K+        P  AGE
Sbjct  158  CKHHHIQLIKEKGNYSQLETDQEKMG----SEAPASAGE  192



>gb|ABK58467.1| LIM domain protein WLIM1a [Populus tremula x Populus alba]
Length=197

 Score =   281 bits (719),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 148/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR YHK+CFRC+HCKG LKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGALKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   PVD  + +    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PVDGEKPVSTKVSTMFAGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC H GCTISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPVSTKVSTMFAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            EG LYC+ H +QL K  G+L +    I K +   K  G   A E
Sbjct  153  EGRLYCKHHHNQLIKEKGNLSQLEGDIEKDSMNNKTNGREVAAE  196



>gb|KHN36972.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   281 bits (718),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK      A  ++    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKNLEEKPAAAKV----SSMFGGTRDKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHVQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHVQLIKEKGNLSQ  173



>gb|ABK95336.1| unknown [Populus trichocarpa]
Length=195

 Score =   280 bits (717),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 156/184 (85%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HC+GTLKLSN+ SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   PVD  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PVD-NENASKV-SNLFAGTREKCVGCDKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+L+CKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLHCKHHHIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG L+
Sbjct  97   KVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLH  156

Query  637  CRPHFDQLFKRTGS---LDKSFEGIPKVA  560
            C+ H  QLFK  G+   L+   E  P V+
Sbjct  157  CKHHHIQLFKEKGNYSQLENEREKNPVVS  185



>ref|XP_010458355.1| PREDICTED: LIM domain-containing protein WLIM1-like [Camelina 
sativa]
Length=191

 Score =   280 bits (717),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHLQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
             G  N
Sbjct  178  GGGDN  182


 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHLQLIKEKGNLSQ  174



>ref|NP_001238429.1| uncharacterized protein LOC100499947 [Glycine max]
 gb|ACU14298.1| unknown [Glycine max]
Length=196

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK      A  ++    S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKNLEERPAAAKV----SSMFGGTRDKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHVQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHVQLIKEKGNLSQ  173



>ref|XP_010475882.1| PREDICTED: LIM domain-containing protein WLIM1-like [Camelina 
sativa]
Length=191

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHLQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
             G  N
Sbjct  178  GGGDN  182


 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHLQLIKEKGNLSQ  174



>gb|AAD56959.1|AF187105_1 LIM domain protein WLIM1 [Helianthus annuus]
Length=188

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG P + +  K    +D  + +    S  FVGT DKC+ C  TV
Sbjct  61   HFDQLFKKTGSLDKSFEGTPNIVKQPK---TIDGEKPMANKVSSMFVGTKDKCLGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGTAYHK+CFKCSH GCTISPSNYIA+EG LYC+HHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTAYHKSCFKCSHGGCTISPSNYIAHEGHLYCRHHHTQLIKEKGNLSQLEG  177

Query  268  EGSG  257
            E S 
Sbjct  178  ERSA  181


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC+ C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPMANKVSSMFVGTKDKCLGCKNTVYPTEKVSVNGTAYHKSCFKCSHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            EG LYCR H  QL K  G+L +
Sbjct  153  EGHLYCRHHHTQLIKEKGNLSQ  174



>ref|XP_006417487.1| hypothetical protein EUTSA_v10008856mg [Eutrema salsugineum]
 dbj|BAJ34608.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35840.1| hypothetical protein EUTSA_v10008856mg [Eutrema salsugineum]
Length=189

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMACEKTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLE  176


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVAR  557
            C+ H  QL K  G+L +  EG    AR
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEGGDNAAR  183



>emb|CDY20647.1| BnaC08g14110D [Brassica napus]
Length=189

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P+K   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDK---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLE  176


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            C+ H  QL K  G+L +  EG    A+ +  A 
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEGGDNAAKDKVDAA  189



>ref|XP_006304225.1| hypothetical protein CARUB_v10010373mg [Capsella rubella]
 gb|EOA37123.1| hypothetical protein CARUB_v10010373mg [Capsella rubella]
Length=190

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EGS  260
             G 
Sbjct  178  GGD  180


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEK  548
            C+ H  QL K  G+L +  EG    A  EK
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEGGGDNATKEK  186



>ref|NP_172491.1| transcription factor lim1 [Arabidopsis thaliana]
 sp|Q94JX5.1|WLIM1_ARATH RecName: Full=LIM domain-containing protein WLIM1; AltName: Full=Widely-expressed 
LIM protein 1; Short=AtWLIM1 [Arabidopsis 
thaliana]
 gb|AAK49575.1|AF370569_1 similar to transcription factor SF3 (pir|IS37656) [Arabidopsis 
thaliana]
 gb|AAM62606.1| putative transcription factor [Arabidopsis thaliana]
 gb|AEE28552.1| transcription factor lim1 [Arabidopsis thaliana]
Length=190

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EG  263
             G
Sbjct  178  GG  179


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVAR  557
            C+ H  QL K  G+L +   G    A+
Sbjct  158  CKHHHIQLIKEKGNLSQLEGGGENAAK  184



>ref|XP_010999890.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=197

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 148/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ +PEK   PVD  + +    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK---PVDGEKPMSTKVSTMFAGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC H GCTISPSNYIA+EGRLYCK HH QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKPHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT +KC  C+ TVY  ++++ +   YHKSCF+C H   T+  SN+ + 
Sbjct  93   KPMSTKVSTMFAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            EG LYC+PH +QL K  G+L +    I K +   K  G   A E
Sbjct  153  EGRLYCKPHHNQLIKEKGNLSQLEGDIEKDSMNNKTNGREVAAE  196



>ref|XP_008236308.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=197

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKC ACEKTVYLVDRLAAD+RVYHK+CFRC+HC GTLKLSN+ SFEGVLYCRPH
Sbjct  3    TFAGTTQKCTACEKTVYLVDRLAADSRVYHKACFRCHHCTGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   P D  +  G   S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKILKPEK--PPTD--KENGNSVSNLFAGTREKCVGCQKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK+SVNG  YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  119  PIEKVSVNGIPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  178

Query  265  G  263
            G
Sbjct  179  G  179



>gb|AII80544.1| LIM-domain protein 10 [Gossypium hirsutum]
Length=190

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT Q+CMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQRCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PEK   PVD  + +    SG F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEK---PVDGEKPIATKVSGMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTE+++VNGT YHK+CFKC+H GC ISPSNYIA+E RLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAHECRLYCKHHHGQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC  C+ TVY  +R+  +   YHKSCF+C H    +  SN+ + 
Sbjct  93   KPIATKVSGMFGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            E  LYC+ H  QL K  G+L +
Sbjct  153  ECRLYCKHHHGQLIKEKGNLSQ  174



>ref|XP_009623970.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AFY06680.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +P+K   P+D+ +      +  F GT +KC  C  TV
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQK---PIDSEKPQVAKVTSMFGGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEMN  182


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+KTVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L K
Sbjct  158  CKHHHIQLIKEKGNLSK  174



>ref|XP_007042657.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX98488.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=196

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRPH
Sbjct  3    TFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK     +A + +       F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEKHIENENAQKVVNL-----FGGTREKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL+S+
Sbjct  118  PIEKVTVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLESD  177


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT +KC+ C KTVY ++++  +   YHKSCF+C H   T+  SN+ + EG LYC+ H 
Sbjct  102  FGGTREKCVGCNKTVYPIEKVTVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
             QLFK  G+  +      K    EK      A E
Sbjct  162  IQLFKEKGNYSQLESDREKTPMNEKLTSMEIAAE  195



>ref|XP_004136935.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155415.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN43845.1| hypothetical protein Csa_7G071340 [Cucumis sativus]
Length=201

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 160/205 (78%), Gaps = 8/205 (4%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKCMACEKTVYLVD+L ADNRV+HK+CFRCYHCKGTLKLSN+ SFEGVLYCRPH
Sbjct  3    SFSGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCYHCKGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PKV R EK +   +A     +  S  F GT DKC  CT TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKVMRSEKPSENENA-----KSVSNMFGGTRDKCSGCTKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
              EK++VNG AYHK+CFKCSH GCTISPS+YIA+EG+LYCKHHHIQLF EKGNYSQL++E
Sbjct  118  LIEKVTVNGNAYHKSCFKCSHGGCTISPSSYIAHEGKLYCKHHHIQLFMEKGNYSQLETE  177

Query  265  GSGNFsasdtesaaaaSVLPEEIAA  191
               N   +   +AA     P EIAA
Sbjct  178  RQKN---NSAIAAAIKLTTPMEIAA  199



>ref|XP_002892554.1| hypothetical protein ARALYDRAFT_471134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68813.1| hypothetical protein ARALYDRAFT_471134 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFVGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EG  263
             G
Sbjct  178  GG  179


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVAR  557
            C+ H  QL K  G+L +   G    A+
Sbjct  158  CKHHHIQLIKEKGNLSQLEGGGENAAK  184



>ref|XP_007136766.1| hypothetical protein PHAVU_009G072200g [Phaseolus vulgaris]
 gb|ESW08760.1| hypothetical protein PHAVU_009G072200g [Phaseolus vulgaris]
Length=196

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 152/185 (82%), Gaps = 4/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+P+K      A  ++  +    F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPDKTGEEKPAATKVLNM----FGGTRDKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC+H GC ISPSNYIA++G+LYCKHHHIQL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHDGKLYCKHHHIQLIKEKGNLSQLEG  176

Query  268  EGSGN  254
            +   N
Sbjct  177  DHEKN  181


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + +G LYC+ H 
Sbjct  102  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHDGKLYCKHHH  161

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
             QL K  G+L +      K A  EK  G V A E
Sbjct  162  IQLIKEKGNLSQLEGDHEKNAIQEKTNGEVVAAE  195



>ref|XP_009144466.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDY31040.1| BnaA08g25900D [Brassica napus]
Length=189

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLE  176


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            C+ H  QL K  G+L +  EG    A+ +  A 
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEGGDNAAKDKVDAA  189



>ref|XP_009148339.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDX93448.1| BnaA06g06000D [Brassica napus]
Length=190

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EG  263
             G
Sbjct  178  GG  179


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YH+SCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVAR  557
            C+ H  QL K  G+L +   G    A+
Sbjct  158  CKHHHIQLIKEKGNLSQLEGGGENAAK  184



>ref|XP_010490782.1| PREDICTED: LIM domain-containing protein WLIM1 [Camelina sativa]
Length=190

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHLQLIKEKGNLSQLEG  177

Query  268  EGS  260
             G 
Sbjct  178  GGD  180


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEK  548
            C+ H  QL K  G+L +  EG    A  EK
Sbjct  158  CKHHHLQLIKEKGNLSQ-LEGGGDNAAKEK  186



>gb|AII80541.1| LIM-domain protein 7 [Gossypium hirsutum]
Length=208

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 152/179 (85%), Gaps = 5/179 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            FQGT QKC AC KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRPH+
Sbjct  4    FQGTQQKCNACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHY  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFKRTGSLDKSFEG PKV RPE+    +D+   L  + S  F GT +KC  C+ T YP
Sbjct  64   DQLFKRTGSLDKSFEGTPKVVRPER---QIDSESALKVMNS--FGGTREKCAACSKTAYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             E+++VNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  119  IERVTVNGTIYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLETE  177


 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  820  FKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVL  641
             K   +F GT +KC AC KT Y ++R+  +  +YHKSCF+C H   T+  SN+ + EG L
Sbjct  96   LKVMNSFGGTREKCAACSKTAYPIERVTVNGTIYHKSCFKCTHGGCTISPSNYIAHEGKL  155

Query  640  YCRPHFDQLFKRTGSLDK  587
            YC+ H  QLFK  G+  +
Sbjct  156  YCKHHHIQLFKEKGNYSQ  173



>ref|XP_010028358.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
Length=195

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLVD+L A++RVYHK+CFRC+HC GTLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCTACEKTVYLVDKLTANSRVYHKACFRCHHCNGTLKLGNFNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ+FKRTGSLDKSFEG PK+ +P  GA   +      RV S  F GT DKC +C  T 
Sbjct  61   HFDQIFKRTGSLDKSFEGTPKIVKP--GATDNENAATANRV-SAFFAGTRDKCASCNKTA  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++VNGT YHK CFKC+H GCTISPSNYIA+EG+LYCKHHH QLFKEKGNYSQLD+
Sbjct  118  YPIEKVTVNGTGYHKRCFKCAHGGCTISPSNYIAHEGKLYCKHHHTQLFKEKGNYSQLDT  177



>ref|XP_009765343.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=193

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +P K   P+D+ +      +  F GT +KC  C  TV
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPHK---PIDSEKPQVAKVTSMFGGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHETN  182


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+KTVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L K
Sbjct  158  CKHHHIQLIKEKGNLSK  174



>ref|XP_009414770.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=193

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT  KC AC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK TGSLDKSFEG PK+ +PEK        E   +V S  F GT +KCV C  TV
Sbjct  61   HFDQLFKMTGSLDKSFEGTPKIVKPEKHV----ENENASKVSSA-FAGTREKCVGCNKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP E+++VNGTAYHK+CFKCS  GC ISPSNYIA+EGRLYCKHHHIQLFKEKGNYSQL++
Sbjct  116  YPIERVTVNGTAYHKSCFKCSRGGCVISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLEN  175


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY ++R+  +   YHKSCF+C      +  SN+ + EG LY
Sbjct  96   KVSSAFAGTREKCVGCNKTVYPIERVTVNGTAYHKSCFKCSRGGCVISPSNYIAHEGRLY  155

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVA  560
            C+ H  QLFK  G+  +   G  K++
Sbjct  156  CKHHHIQLFKEKGNYSQLENGEEKIS  181



>ref|XP_007160919.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 ref|XP_007160920.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 gb|ESW32913.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 gb|ESW32914.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
Length=196

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK         ++    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTLEEKPGAAKV----SSMFGGTREKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHIQLIKEKGNLSQ  173



>ref|XP_011002116.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=195

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HC+GTLKLSN+ SFEGVLYCRPH
Sbjct  3    AFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK   P+D  E   +V S  F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIVKPEK---PID-NENASKV-SNLFAGTREKCVGCDKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHH IQLFKEKGNYSQL++E
Sbjct  118  PIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHLIQLFKEKGNYSQLENE  177

Query  265  GSGN  254
               N
Sbjct  178  REKN  181


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++  +   YH+SCF+C H   T+  SN+ + EG LY
Sbjct  97   KVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QLFK  G+
Sbjct  157  CKHHLIQLFKEKGN  170



>ref|XP_008648273.1| PREDICTED: LOC541782 isoform X1 [Zea mays]
 gb|ACG33608.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG42218.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG46790.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG47580.1| pollen-specific protein SF3 [Zea mays]
 gb|ACL54041.1| unknown [Zea mays]
 gb|AFW74663.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05891.1| LIM transcription factor, partial [Zea mays]
Length=195

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+  G     E   +V S  F GT +KCV C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVG----NENATKVSSA-FAGTREKCVGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTE+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN+SQL+++
Sbjct  119  PTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNFSQLEND  178


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY  +R+  +N +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGER  518
            C+ H  QL K  G+  +      K ++    AG ++  E+
Sbjct  158  CKHHHIQLIKEKGNFSQLENDHEKTSQ----AGSLEEDEQ  193



>ref|XP_006595535.1| PREDICTED: uncharacterized protein LOC100527547 isoform X1 [Glycine 
max]
 ref|XP_006595536.1| PREDICTED: uncharacterized protein LOC100527547 isoform X2 [Glycine 
max]
 gb|KHN07659.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK      A  ++    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKNLEEKPAAAKV----SSMFGGTREKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHH+QL KEKGN +QL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHVQLIKEKGNLTQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHVQLIKEKGNLTQ  173



>dbj|BAB84584.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+  ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKFTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +P+K   P+D+ +      +  F GT +KC  C  TV
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQK---PIDSEKPQVAKVTSMFGGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEMN  182


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+KTVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L K
Sbjct  158  CKHHHIQLIKEKGNLSK  174



>ref|XP_003589058.1| Transcription factor lim1 [Medicago truncatula]
 gb|ACJ84036.1| unknown [Medicago truncatula]
 gb|AES59309.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK36922.1| unknown [Medicago truncatula]
Length=195

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 150/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC KTVYLVD+L ADNR++HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACNKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+ +PE+    +D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIVKPERN---IDNEKPAAAKASSMFGGTRDKCSGCQKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL K+KGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKQKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEKN  182


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 6/99 (6%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KASSMFGGTRDKCSGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QL K+ G+L +  EG       EK AG ++  E
Sbjct  158  CKHHHIQLIKQKGNLSQ-LEG-----DHEKNAGKINGEE  190



>emb|CDX94916.1| BnaC05g07550D [Brassica napus]
Length=189

 Score =   278 bits (710),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+SVNGT YH++CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+
Sbjct  118  YPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLE  176


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YH+SCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            C+ H  QL K  G+L +  EG    A+ +  A 
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEGGDNAAKDKVDAA  189



>ref|XP_002532425.1| Cysteine and glycine-rich protein, putative [Ricinus communis]
 gb|EEF29966.1| Cysteine and glycine-rich protein, putative [Ricinus communis]
Length=196

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 156/179 (87%), Gaps = 5/179 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+ SFEGVLYCRPH+
Sbjct  5    FGGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYCSFEGVLYCRPHY  64

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PKVA+PEK   P+D+ E   +V S  F GT +KCV C+ TVYP
Sbjct  65   DQLFKLTGSLDKSFEGTPKVAKPEK---PIDS-ENASKV-SNKFAGTREKCVGCSKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             E+++VNGT YH++CFKC++ GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  120  IERVTVNGTPYHRSCFKCTYGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  178


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C KTVY ++R+  +   YH+SCF+C +   T+  SN+ + EG LY
Sbjct  98   KVSNKFAGTREKCVGCSKTVYPIERVTVNGTPYHRSCFKCTYGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H  QLFK  G+  +  E   + A  EK      A E
Sbjct  158  CKHHHIQLFKEKGNYSQ-LENERQPATTEKITAVEIAAE  195



>ref|XP_004501516.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=191

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 151/185 (82%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCM+C+KTVYLVD+L ADNR+YHK CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMSCDKTVYLVDKLTADNRIYHKGCFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+A+PEK +   +      +V S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKSS--YNEKPAAAKV-SSMFGGTREKCSGCQKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCIHGGCVISPSNYIAHEGKLYCKHHHVQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEKN  182


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+KTVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSMFGGTREKCSGCQKTVYPTEKVSVNGTPYHKSCFKCIHGGCVISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHVQLIKEKGNLSQ  174



>gb|ABB51614.1| LIM-domain protein [Brassica napus]
 gb|ABB51648.1| LIM domain protein [Brassica napus]
Length=189

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEG LYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGALYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KCV C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCVGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLE  176


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAG  539
            C+ H  QL K  G+L +  EG    A+ +  A 
Sbjct  158  CKHHHIQLIKEKGNLSQ-LEGGDNAAKDKVDAA  189



>ref|XP_008364385.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364386.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364388.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364390.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=197

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 148/180 (82%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F  T QKC ACEKTVYLVDRLAAD+R+YHK+CFRC+HCK TLKL N+ SFEGVLYCRPH
Sbjct  3    SFASTTQKCTACEKTVYLVDRLAADSRIYHKACFRCHHCKSTLKLINYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PKV +P   A P    E    V S  F GT DKCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKVVKP---ARPSTENENAKSV-SNLFAGTRDKCVGCEKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK+SVNGT YHK+CFKCSH GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  119  PIEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  178



>emb|CDO97286.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 5/181 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC  CEKTVYLVD+LAADNR+YHK+CFRC+HC+ TLKL NFNSF+GVLYCRP
Sbjct  1    MAFVGTTQKCTVCEKTVYLVDKLAADNRIYHKACFRCHHCQRTLKLGNFNSFDGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV +PEK   PVD  E   +V S  FVGT DKC+ C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEK---PVDH-ENATKV-SSLFVGTRDKCIGCDKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++VNG  YH++CFKCSH GCTISPSNYIA+EG LYCKHHH QL KEKGNYSQL++
Sbjct  116  YPIEKVTVNGKPYHRSCFKCSHGGCTISPSNYIAHEGTLYCKHHHAQLVKEKGNYSQLEN  175

Query  268  E  266
            +
Sbjct  176  D  176


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+ C+KTVY ++++  + + YH+SCF+C H   T+  SN+ + EG LY
Sbjct  96   KVSSLFVGTRDKCIGCDKTVYPIEKVTVNGKPYHRSCFKCSHGGCTISPSNYIAHEGTLY  155

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QL K  G+
Sbjct  156  CKHHHAQLVKEKGN  169



>gb|ABA99040.1| Pollen-specific protein SF3, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ20639.1| hypothetical protein OsJ_36255 [Oryza sativa Japonica Group]
Length=195

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PEK        E   +V S  F GT +KCV C  TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPEKTV----ENENAIKVSSA-FAGTREKCVGCNKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNFSQLEND  178


 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -3

Query  820  FKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVL  641
             K + AF GT +KC+ C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L
Sbjct  97   IKVSSAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  640  YCRPHFDQLFKRTGSLDK  587
            YC+ H  QL K  G+  +
Sbjct  157  YCKHHHIQLIKEKGNFSQ  174



>gb|AGJ83946.1| lim protein 6 [Gossypium hirsutum]
Length=196

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRPH
Sbjct  3    TFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+A+PEK     +A + +       F GT +KCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKIAKPEKHIENENAQKVVNL-----FGGTKEKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YH+ CFKCSH GCTISPSNY+A+EG+LYCKHHH+QLFKEKGNYSQL+ +
Sbjct  118  PIEKVTVDGTSYHRGCFKCSHGGCTISPSNYVAHEGKLYCKHHHVQLFKEKGNYSQLEGD  177



>ref|XP_002510088.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF52275.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=197

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PK+ + +K   P D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKTDK---PADGEKPNAAKVSSMFGGTRDKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C+ TVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H +QL K  G+L +    + K +  +   G   A E
Sbjct  158  CKHHHNQLIKEKGNLSQLEGDVEKESTTQNANGREVAAE  196



>gb|ACG34183.1| pollen-specific protein SF3 [Zea mays]
Length=195

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+  G     E   +V S  F GT +KCV C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVG----NENATKVSSA-FAGTREKCVGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTE+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQ  KEKGN+SQL+++
Sbjct  119  PTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQXIKEKGNFSQLEND  178


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 4/100 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY  +R+  +N +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGER  518
            C+ H  Q  K  G+  +      K ++    AG ++  E+
Sbjct  158  CKHHHIQXIKEKGNFSQLENDHEKTSQ----AGSLEEDEQ  193



>ref|XP_002442217.1| hypothetical protein SORBIDRAFT_08g016450 [Sorghum bicolor]
 gb|EES16055.1| hypothetical protein SORBIDRAFT_08g016450 [Sorghum bicolor]
Length=194

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+  G     E   +V S  F GT +KCV C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVG----NENAVKVSSA-FAGTREKCVGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNFSQLEND  178


 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSAFAGTREKCVGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+  +
Sbjct  158  CKHHHIQLIKEKGNFSQ  174



>ref|XP_004498991.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=195

 Score =   275 bits (704),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+A+PE+     D  +      S  F GT DKC  C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPERNN---DNEKPAAVKASSMFGGTRDKCSGCQKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHHIQL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEKN  182


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = -3

Query  832  KQFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K    K +  F GT  KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + 
Sbjct  93   KPAAVKASSMFGGTRDKCSGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAH  152

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            EG LYC+ H  QL K  G+L +
Sbjct  153  EGKLYCKHHHIQLIKEKGNLSQ  174



>ref|NP_001237652.1| uncharacterized protein LOC100527547 [Glycine max]
 gb|ACU16643.1| unknown [Glycine max]
Length=196

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRV+HK+CFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG  K+A+PEK      A  ++    S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTSKIAKPEKNLEEKPAAAKV----SSMFGGTREKCAGCQKTV  116

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EG+LYCKHHH+QL KEKGN +QL+ 
Sbjct  117  YPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHHVQLIKEKGNLTQLEG  176

Query  268  E  266
            +
Sbjct  177  D  177


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+KTVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  97   KVSSMFGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  157  CKHHHVQLIKEKGNLTQ  173



>ref|XP_004289780.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=195

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT+QKC ACEKTVYLVD+L AD+R YHK+CFRC+HCKGTLKLSN+ SFEGVLYCRPH
Sbjct  3    TFAGTSQKCTACEKTVYLVDKLTADSRSYHKACFRCHHCKGTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSLDKSFEG PK+ +PEK     +      +  S  F GT DKCV C  TVY
Sbjct  63   YDQLFKRTGSLDKSFEGTPKILKPEKPTENENT-----KAVSSLFGGTKDKCVGCEKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK+SVNGTAYH+ CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  118  PIEKVSVNGTAYHRRCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLENE  177



>ref|XP_006664058.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=195

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PEK        E   +V S  F GT +KCV C  TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPEKTV----ENENAMKVSSA-FAGTREKCVGCNKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNFSQLEND  178


 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -3

Query  820  FKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVL  641
             K + AF GT +KC+ C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L
Sbjct  97   MKVSSAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  640  YCRPHFDQLFKRTGSLDK  587
            YC+ H  QL K  G+  +
Sbjct  157  YCKHHHIQLIKEKGNFSQ  174



>gb|KDP41612.1| hypothetical protein JCGZ_16019 [Jatropha curcas]
Length=197

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSL+KSFEG PK+ +P+K   P D  +      S  F GT +KC  C  TV
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIVKPDK---PADGEKPSAAKVSSMFGGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK++VNGT YHK+CFKC H GC ISPSNYIA+EGRLYCKHHH QL KEKGN SQL+ 
Sbjct  118  YPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLYCKHHHNQLIKEKGNLSQLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 0/99 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+ TVY  +++  +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVSSMFGGTREKCFGCKNTVYPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ H +QL K  G+L +      K +  EK  G   A E
Sbjct  158  CKHHHNQLIKEKGNLSQLEGDNEKDSVNEKANGREAAAE  196



>gb|KFK43312.1| hypothetical protein AALP_AA1G108000 [Arabis alpina]
Length=186

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ FKRTGSL+KSFEG PK+ +P++   P++     G   S  F GT +KC  C  TV
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDR---PLEGERPAGTKVSNMFGGTREKCHGCDKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+SVNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHH+QL KEKGN SQL+
Sbjct  118  YPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHLQLIKEKGNLSQLE  176


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC  C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSNMFGGTREKCHGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L +
Sbjct  158  CKHHHLQLIKEKGNLSQ  174



>dbj|BAA82827.1| transcription factor Ntlim1 [Nicotiana tabacum]
Length=200

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 150/185 (81%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGT+KL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTVKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +P+K   P+D+ +      +  F GT +KC  C  TV
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQK---PIDSEKPQVAKVTSMFGGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+S NGT YHK+CF+CSH GC ISPSNY A+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSANGTPYHKSCFQCSHGGCVISPSNYTAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEMN  182


 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+KTVY  ++++A+   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKKTVYPTEKVSANGTPYHKSCFQCSHGGCVISPSNYTAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+L K
Sbjct  158  CKHHHIQLIKEKGNLSK  174



>ref|XP_006836719.1| hypothetical protein AMTR_s00088p00121090 [Amborella trichopoda]
 gb|ERM99572.1| hypothetical protein AMTR_s00088p00121090 [Amborella trichopoda]
Length=192

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLVD+L ADNRVYHK+CFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCQACEKTVYLVDQLTADNRVYHKACFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFKRTGSLDKSFEG PKV + +K    VD         S  F GT DKCV C  TV
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKADKS---VDHEGHATNKVSSLFAGTQDKCVACKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++V+GT+YH+ CFKC+H GC ISPSNY+A+EGRLYCKHHH QLFKEKGN+SQLD
Sbjct  118  YPIEKVAVDGTSYHRPCFKCTHGGCVISPSNYVAHEGRLYCKHHHNQLFKEKGNFSQLD  176


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+KTVY ++++A D   YH+ CF+C H    +  SN+ + EG LY
Sbjct  98   KVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRPCFKCTHGGCVISPSNYVAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H +QLFK  G+  +
Sbjct  158  CKHHHNQLFKEKGNFSQ  174



>ref|NP_001238190.1| uncharacterized protein LOC100500444 [Glycine max]
 gb|ACU15531.1| unknown [Glycine max]
Length=192

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN++YHKSCFRCYHCKGTLKLSN+ SFEGVLYC+PH
Sbjct  4    SFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK+TGSLDKSFEGIP+ AR E+ A  V    ++  +    F GT +KCV C  TVY
Sbjct  64   FDQLFKKTGSLDKSFEGIPRTARLERSADQVQTNTKVSNL----FAGTQEKCVACKKTVY  119

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD +
Sbjct  120  PIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQLDKQ  179


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E
Sbjct  95   QTNTKVSNLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHE  154

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK+ G+  +
Sbjct  155  HRLYCRHHHTQLFKQKGNFSQ  175



>gb|KHN16307.1| Pollen-specific protein SF3 [Glycine soja]
Length=192

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN++YHKSCFRCYHCKGTLKLSN+ SFEGVLYC+PH
Sbjct  4    SFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK+TGSLDKSFEGIP+ AR E+ A  V    ++  +    F GT +KCV C  TVY
Sbjct  64   FDQLFKKTGSLDKSFEGIPRTARLERSADQVQTNTKVSNL----FAGTQEKCVACKKTVY  119

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD +
Sbjct  120  PIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQLDKQ  179


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E
Sbjct  95   QTNTKVSNLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHE  154

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK+ G+  +
Sbjct  155  HRLYCRHHHTQLFKQKGNFSQ  175



>ref|XP_007138113.1| hypothetical protein PHAVU_009G181200g [Phaseolus vulgaris]
 gb|ESW10107.1| hypothetical protein PHAVU_009G181200g [Phaseolus vulgaris]
Length=191

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN++YHKSCFRCYHCKGTLKLSN+ SFEGVLYC+PH
Sbjct  3    SFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK+TGSLDKSFEGIP+ AR E+ A  V    ++  +    F GT +KCV C  TVY
Sbjct  63   FDQLFKKTGSLDKSFEGIPRTARLERSADQVHTNSKVSNL----FAGTQEKCVACKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD +
Sbjct  119  PIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQLDKQ  178


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  98   KVSNLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK+ G+  +
Sbjct  158  CRHHHTQLFKQKGNFSQ  174



>ref|XP_004962903.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=195

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+     +A +      S  F GT +KCV C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVENENAIK-----VSSVFAGTREKCVGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNFSQLEND  178


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -3

Query  820  FKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVL  641
             K +  F GT +KC+ C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L
Sbjct  97   IKVSSVFAGTREKCVGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  640  YCRPHFDQLFKRTGSLDK  587
            YC+ H  QL K  G+  +
Sbjct  157  YCKHHHIQLIKEKGNFSQ  174



>gb|KDP44510.1| hypothetical protein JCGZ_16343 [Jatropha curcas]
Length=191

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKCMACEKTVYLVD+LAADNR+YH++CF+C+HCK TLKL N+ SFEGVLYCRPH
Sbjct  6    SFGGTQQKCMACEKTVYLVDKLAADNRIYHRTCFKCHHCKNTLKLGNYCSFEGVLYCRPH  65

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTG L+KSFEGIPK+A+P K   P+D    +    S  F GT ++CV C+ T Y
Sbjct  66   YDQLFKRTGCLNKSFEGIPKIAKPGK---PIDV--EVANKVSNKFGGTRERCVGCSKTAY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VNGT YHK+CFKC H GCTISPSNYIAYEG+LYCKHHHIQLFKE+GNYSQL+SE
Sbjct  121  PIERVTVNGTPYHKSCFKCIHGGCTISPSNYIAYEGKLYCKHHHIQLFKERGNYSQLESE  180


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT ++C+ C KT Y ++R+  +   YHKSCF+C H   T+  SN+ ++EG LY
Sbjct  100  KVSNKFGGTRERCVGCSKTAYPIERVTVNGTPYHKSCFKCIHGGCTISPSNYIAYEGKLY  159

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QLFK  G+  +
Sbjct  160  CKHHHIQLFKERGNYSQ  176



>gb|KHN19331.1| Pollen-specific protein SF3 [Glycine soja]
Length=192

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 148/180 (82%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN++YHKSCFRCYHCKGTLKLSN+ SFEGVLYC+PH
Sbjct  4    SFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK+TGSLDKSFEGIP+ AR E+    V    ++  +    F GT +KCV C  TVY
Sbjct  64   FDQLFKKTGSLDKSFEGIPRTARLERSTDQVQTNSKVSNL----FAGTQEKCVACKKTVY  119

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD +
Sbjct  120  PIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQLDKQ  179


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E
Sbjct  95   QTNSKVSNLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHE  154

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK+ G+  +
Sbjct  155  HRLYCRHHHTQLFKQKGNFSQ  175



>ref|NP_001148027.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG29494.1| pollen-specific protein SF3 [Zea mays]
 tpg|DAA55370.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB05750.1| LIM transcription factor, partial [Zea mays]
Length=196

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSF+GVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFDGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSF+G PKV +PE+  G     E   +V S  F GT +KCV C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFQGTPKVVKPERNVG----NENATKVSSA-FAGTREKCVGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK CFKC H GCTISPSNYIA+EG+LYCKHHH+QL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKCCFKCCHGGCTISPSNYIAHEGKLYCKHHHVQLIKEKGNFSQLEND  178


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY ++R+  +N +YHK CF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSAFAGTREKCVGCSKTVYPIERVTVNNTMYHKCCFKCCHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K  G+  +
Sbjct  158  CKHHHVQLIKEKGNFSQ  174



>ref|NP_001236461.1| uncharacterized protein LOC100306027 [Glycine max]
 gb|ACU14005.1| unknown [Glycine max]
Length=179

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 152/180 (84%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKCMAC KTVYLVD+L AD+RVYHK+CFRCYHC+ TLKLSN+ SFEGVLYCRPH
Sbjct  3    SFGGTTQKCMACAKTVYLVDKLTADSRVYHKACFRCYHCRNTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQL+KRTGSLDKSFEGIPK+ +PEK   PV   E   +V +  F+GT DKCV C  TVY
Sbjct  63   YDQLYKRTGSLDKSFEGIPKIQKPEK---PVTGNENT-KVLANVFLGTRDKCVCCNKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTE+++VNGT YHK CFKC++ GCT+S SN+I +EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  119  PTERVTVNGTPYHKGCFKCTYGGCTVSSSNFITHEGKLYCKHHHIQLFKEKGNYSQLENE  178



>ref|XP_003576026.1| PREDICTED: LIM domain-containing protein WLIM1 [Brachypodium 
distachyon]
Length=196

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 149/181 (82%), Gaps = 5/181 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+        E   +V S  F GT +KCV C  TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNV----ENENAIKVSSA-FAGTREKCVGCNKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+L+CKHHHIQL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKHHHIQLIKEKGNFSQLEND  178

Query  265  G  263
             
Sbjct  179  S  179


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -3

Query  820  FKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVL  641
             K + AF GT +KC+ C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L
Sbjct  97   IKVSSAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  640  YCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            +C+ H  QL K  G+  +      K ++    AG VD  E
Sbjct  157  FCKHHHIQLIKEKGNFSQLENDSEKTSQ---SAGSVDDEE  193



>gb|ABW69660.1| transcription factor LIM [Triticum aestivum]
Length=196

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+  G     E   +V S  F GT +KC  C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVG----NENATKVSSA-FAGTREKCFGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+L+CKHHH QL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKHHHTQLIKEKGNFSQLEND  178


 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC  C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L+
Sbjct  98   KVSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLF  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVD  530
            C+ H  QL K  G+  +      K ++    AG VD
Sbjct  158  CKHHHTQLIKEKGNFSQLENDHDKTSQ---SAGSVD  190



>ref|NP_001235271.1| uncharacterized protein LOC100500501 [Glycine max]
 gb|ACU15600.1| unknown [Glycine max]
Length=192

 Score =   270 bits (691),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN++YHKSCFRCYHCKGTLKLSN+ SFEGVLYC+PH
Sbjct  4    SFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK+TGSLDKSFEGIP+ AR E+    V    ++  +    F GT +KCV C  TVY
Sbjct  64   FDQLFKKTGSLDKSFEGIPRTARLERSTDQVQTNNKVSNL----FAGTQEKCVACKKTVY  119

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD +
Sbjct  120  PIEKVAVDGTFYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQLDKQ  179


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  99   KVSNLFAGTQEKCVACKKTVYPIEKVAVDGTFYHKACFRCTHGGCVISPSNYVAHEHRLY  158

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK+ G+  +
Sbjct  159  CRHHHTQLFKQKGNFSQ  175



>ref|XP_010091018.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB41829.1| Pollen-specific protein SF3 [Morus notabilis]
Length=196

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 149/184 (81%), Gaps = 5/184 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC AC KTVYLVD+L AD R YHK+CFRC+HC+ TLKLS++ SFEGVLYCRPH
Sbjct  3    SFAGTTQKCTACNKTVYLVDKLTADTRAYHKACFRCHHCRNTLKLSSYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFKRTGSL+KSFEG PK+++PEK     +A     ++ S  F GT DKCV C  TVY
Sbjct  63   YDQLFKRTGSLEKSFEGTPKISKPEKPTTSENA-----KIVSSLFGGTRDKCVGCNKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++VNGT YHK+CFKC+H GCTISPSNYIA+EG+LYCKHHHIQLFKEKGNYSQL+  
Sbjct  118  PIEKVTVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLEGI  177

Query  265  GSGN  254
            G  N
Sbjct  178  GENN  181



>dbj|BAJ94823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+  G     E   +V S  F GT +KC  C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVG----NENAIKVSSA-FAGTREKCFGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E+++VN T YHK+CFKC H GCTISPSNYIA+EG+L+CKHHH QL KEKGN+SQL+++
Sbjct  119  PIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKHHHTQLIKEKGNFSQLEND  178


 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = -3

Query  820  FKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVL  641
             K + AF GT +KC  C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L
Sbjct  97   IKVSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  640  YCRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVD  530
            +C+ H  QL K  G+  +      K ++    AG VD
Sbjct  157  FCKHHHTQLIKEKGNFSQLENDHDKTSQ---SAGSVD  190



>ref|XP_004238086.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
Length=193

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 148/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK+TGSLDKSFEG PK+ +P+K    +D+ +      +  F GT +KC  C  TV
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQK---LIDSEKPQVAKVTSMFGGTREKCFGCKNTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK CFKCSH GC IS SNYIA+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSVNGTPYHKNCFKCSHGGCVISLSNYIAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  E  266
            +
Sbjct  178  D  178


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+ TVY  ++++ +   YHK+CF+C H    + LSN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKNTVYPTEKVSVNGTPYHKNCFKCSHGGCVISLSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDK---SFEGIPKVA  560
            C+ H  QL K  G+L K     E IP + 
Sbjct  158  CKHHHIQLIKEKGNLSKLEGDHETIPAIT  186



>dbj|BAB84583.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 147/185 (79%), Gaps = 3/185 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNR+YHK+CFRC+HCK TLKL N NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKATLKLGNSNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            H   LFK+TGSLDKSFEG PK+ RP+K   P+D+ +      +  F GT +KC  C  TV
Sbjct  61   HLIGLFKQTGSLDKSFEGTPKIVRPQK---PIDSEKPQVAKVTSMFGGTREKCFGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YPTEK+SVNGT YHK+CFKCSH GC ISPSNYIA+EGRLYCKHHHIQL KEKGN S+L+ 
Sbjct  118  YPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHHIQLIKEKGNLSKLEG  177

Query  268  EGSGN  254
            +   N
Sbjct  178  DHEMN  182


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K T  F GT +KC  C+KTVY  ++++ +   YHKSCF+C H    +  SN+ + EG LY
Sbjct  98   KVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEG  575
            C+ H  QL K  G+L K  EG
Sbjct  158  CKHHHIQLIKEKGNLSK-LEG  177



>ref|XP_010254782.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=191

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 148/177 (84%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC AC+KTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACQKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PKV+R +K    VD G    +V S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGAPKVSRTDKS---VDQGNANNKV-STLFAGTQDKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+G++YHKACFKC+H GC ISPSNY+A+E RLYC+HHH QLFKEKGN+SQLD
Sbjct  120  IEKVAVDGSSYHKACFKCTHGGCVISPSNYVAHEHRLYCRHHHSQLFKEKGNFSQLD  176


 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+KTVY ++++A D   YHK+CF+C H    +  SN+ + E  LY
Sbjct  98   KVSTLFAGTQDKCVACKKTVYPIEKVAVDGSSYHKACFKCTHGGCVISPSNYVAHEHRLY  157

Query  637  CRPHFDQLFKRTGS---LDKS  584
            CR H  QLFK  G+   LDK+
Sbjct  158  CRHHHSQLFKEKGNFSQLDKN  178



>ref|NP_001104937.2| LOC541782 [Zea mays]
 gb|AAF67835.2|AF135591_1 LIM transcription factor homolog [Zea mays]
Length=197

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNR+YHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFEG PKV +PE+  G  +A +      S  F GT +KCV C+ TVY
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPERNVGNENATK-----VSSAFAGTREKCVGCSKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            PTE+++VN T YHK+CFKC H GCTISPSNYIA+EG+LYCKHHHIQL KE+G  + L
Sbjct  119  PTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHHIQLIKERGTSASL  175


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C KTVY  +R+  +N +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KVSSAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLY  157

Query  637  CRPHFDQLFKRTGS  596
            C+ H  QL K  G+
Sbjct  158  CKHHHIQLIKERGT  171



>ref|XP_002511450.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF52052.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=190

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R ++ A   ++  R+    S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGTPKTVRVDRSADQFNSNSRV----SSMFAGTQDKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  120  IEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEQRLYCRHHHNQLFKQKGNFSQLD  176



>gb|KHN06818.1| Pollen-specific protein SF3 [Glycine soja]
Length=179

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKCMAC KTVYLVD+L AD+RVYHK+CFRC+HC  TLKLSN+ SFEGVLYCRPH
Sbjct  3    SFGGTTQKCMACAKTVYLVDKLTADSRVYHKACFRCHHCGNTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQL+KRTGSLDKSFEGIPK+ +PEK   PV   E   +V +  F+GT DKCV C  TVY
Sbjct  63   YDQLYKRTGSLDKSFEGIPKIQKPEK---PVTGNENT-KVLANVFLGTRDKCVCCNKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTE+++VNGT YHK CFKC++ GCT+S SN+I +EG+LYCKHHHIQLFKEKGNYSQL++E
Sbjct  119  PTERVTVNGTPYHKGCFKCTYGGCTVSSSNFITHEGKLYCKHHHIQLFKEKGNYSQLENE  178



>gb|KDP31140.1| hypothetical protein JCGZ_11516 [Jatropha curcas]
Length=191

 Score =   268 bits (685),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R +K A  V    ++    S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGTPKTVRVDKSADQVHTNSKV----SSMFAGTQDKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             EK++V+G +YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD +
Sbjct  120  LEKVAVDGMSYHKACFRCTHGGCVISPSNYVAHEQRLYCRHHHNQLFKQKGNFSQLDKQ  178


 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  98   KVSSMFAGTQDKCVACKKTVYPLEKVAVDGMSYHKACFRCTHGGCVISPSNYVAHEQRLY  157

Query  637  CRPHFDQLFKRTGS---LDKSFEGIP  569
            CR H +QLFK+ G+   LDK     P
Sbjct  158  CRHHHNQLFKQKGNFSQLDKQEHAKP  183



>ref|XP_010272036.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=183

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLV++L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVEQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PKVAR ++ +   +A  ++  +    F GT +KCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGAPKVARTDRSSDQGNANSKVSSL----FSGTQEKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YH+ACFKCSH GC ISPSNY+A+E R+YC+HHH QLFKEKGN+SQLD
Sbjct  120  IEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEQRIYCRHHHSQLFKEKGNFSQLD  176


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+AC+KTVY ++++A D   YH++CF+C H    +  SN+ + E  +Y
Sbjct  98   KVSSLFSGTQEKCVACKKTVYPIEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEQRIY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK  G+  +
Sbjct  158  CRHHHSQLFKEKGNFSQ  174



>ref|XP_002283525.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CBI15078.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 145/179 (81%), Gaps = 7/179 (4%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R       VD G+   +V S  F GT +KCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGAPKTVR------SVDQGQTNSKV-SSMFAGTQEKCVACKKTVYP  116

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             EK+ V+GT+YHKACF+C+H GCTISPSNYIA+E RLYC+HHH QLFKEKGN+SQLD +
Sbjct  117  IEKVGVDGTSYHKACFRCTHGGCTISPSNYIAHEHRLYCRHHHSQLFKEKGNFSQLDKQ  175


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+AC+KTVY ++++  D   YHK+CFRC H   T+  SN+ + E
Sbjct  91   QTNSKVSSMFAGTQEKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCTISPSNYIAHE  150

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK  G+  +
Sbjct  151  HRLYCRHHHSQLFKEKGNFSQ  171



>ref|XP_007143127.1| hypothetical protein PHAVU_007G046100g [Phaseolus vulgaris]
 gb|ESW15121.1| hypothetical protein PHAVU_007G046100g [Phaseolus vulgaris]
Length=187

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKCMAC+KTVYLVD+L AD RVYHK+CFRC+HC+ TLKLSN+ SFEGVLYCRPH
Sbjct  3    SFGGTTQKCMACDKTVYLVDKLTADGRVYHKACFRCHHCRNTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQL+KRTGSLDKSFEG PKV +PEK     +  + L  V    F+GT DKCV C  TVY
Sbjct  63   YDQLYKRTGSLDKSFEGTPKVQKPEKPITENENSKGLANV----FLGTRDKCVCCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTE++++NGT YHK+CFKC++ GCTIS SN+I +EG+LYCKHHHIQLFKEKGNYSQL+++
Sbjct  119  PTERVTINGTPYHKSCFKCTYGGCTISSSNFITHEGKLYCKHHHIQLFKEKGNYSQLEND  178



>ref|XP_006439752.1| hypothetical protein CICLE_v10022413mg [Citrus clementina]
 ref|XP_006476731.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR52992.1| hypothetical protein CICLE_v10022413mg [Citrus clementina]
 gb|KDO69762.1| hypothetical protein CISIN_1g029735mg [Citrus sinensis]
Length=189

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN+ SFEGVLYC+PH
Sbjct  3    SFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYCSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEG PK  R E+ A  V       RV S  F GT DKCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGTPKTVRVERSADQVTN----SRV-SSMFAGTQDKCVACKKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            P EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD+
Sbjct  118  PIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHNQLFKQKGNFSQLDN  176



>ref|XP_011087164.1| PREDICTED: LIM domain-containing protein WLIM1-like [Sesamum 
indicum]
Length=188

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+V+HK+CFRC+HCKGTLKLSN++S+EGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYSSYEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK AR E+   P     ++  +    F GT DKCV C   VYP
Sbjct  64   DQLFKMTGSLDKSFEGAPKTARAERSVEPGVTNSKVSSL----FAGTQDKCVACNKKVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSEG  263
             EK++V+GT+YH+ACFKCSH GCTISPSNY+A+E +LYC+HHH QLFK+KGN+SQLD   
Sbjct  120  LEKVAVDGTSYHRACFKCSHGGCTISPSNYVAHEHQLYCRHHHTQLFKQKGNFSQLDKHE  179

Query  262  SG  257
             G
Sbjct  180  QG  181


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC K VY ++++A D   YH++CF+C H   T+  SN+ + E  LY
Sbjct  98   KVSSLFAGTQDKCVACNKKVYPLEKVAVDGTSYHRACFKCSHGGCTISPSNYVAHEHQLY  157

Query  637  CRPHFDQLFKRTGS---LDKSFEG  575
            CR H  QLFK+ G+   LDK  +G
Sbjct  158  CRHHHTQLFKQKGNFSQLDKHEQG  181



>gb|KHG14633.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 145/177 (82%), Gaps = 5/177 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R ++ A  V   +      SG F GT +KCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGTPKTVRVDRSADQVTNSKF-----SGLFAGTQEKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  119  IEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHNQLFKQKGNFSQLD  175



>ref|XP_003550749.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHN18484.1| Pollen-specific protein SF3 [Glycine soja]
Length=209

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 147/182 (81%), Gaps = 4/182 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEK VY V++L ADN+VYHKSCFRC+HCKGTLKLSN+ SFEGVLYC+PH
Sbjct  3    SFAGTTQKCTACEKKVYWVEQLTADNKVYHKSCFRCHHCKGTLKLSNYCSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEGIP+ AR E+ A  V +  ++ R+    F GT +KCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGIPRSARVERSADQVQSNNKVSRL----FSGTQEKCVGCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+G +YHK+CF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD  
Sbjct  119  PIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQLDKH  178

Query  265  GS  260
             S
Sbjct  179  DS  180


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+ C+KTVY ++++A D + YHKSCFRC H    +  SN+ + E
Sbjct  94   QSNNKVSRLFSGTQEKCVGCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHE  153

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK+ G+  +
Sbjct  154  HRLYCRHHHTQLFKQKGNFSQ  174



>ref|XP_004299580.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 143/177 (81%), Gaps = 7/177 (4%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK+ R         + +++    S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGNPKIVRDR-------SADQVNSKVSSMFAGTQDKCVACKKTVYP  116

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK+ V+GT+YHKACF+C+H GC ISPSNY+A+E RLYCKHHH QLFK+KGN+SQLD
Sbjct  117  IEKVGVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCKHHHNQLFKQKGNFSQLD  173


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++  D   YHK+CFRC H    +  SN+ + E
Sbjct  91   QVNSKVSSMFAGTQDKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCVISPSNYVAHE  150

Query  649  GVLYCRPHFDQLFKRTGS---LDKSFEG  575
              LYC+ H +QLFK+ G+   LDK  E 
Sbjct  151  HRLYCKHHHNQLFKQKGNFSQLDKHEEA  178



>ref|XP_007036121.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 ref|XP_007036122.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20622.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20623.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
Length=189

 Score =   263 bits (671),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD++VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADSKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFKRTGSLDKSFEG PK  R ++ A  V       RV S  F GT +KCV C  TVYP
Sbjct  64   DQLFKRTGSLDKSFEGTPKTVRVDRSADQVTN----SRVSSL-FAGTQEKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+G++YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  119  IEKVAVDGSSYHKACFRCTHGGCVISPSNYVAHEQRLYCRHHHNQLFKQKGNFSQLD  175



>ref|XP_009590601.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 147/177 (83%), Gaps = 5/177 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRPHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R E+ A   D G+   +V S  F GT DKCV C  TVYP
Sbjct  64   DQLFKLTGSLDKSFEGAPKTVR-ERSA---DQGQSNSKVSSL-FGGTQDKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YH+ACFKCSH GC ISPSNY+A+E +LYC+HHH QLFKE+GN+SQ++
Sbjct  119  LEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEHKLYCRHHHTQLFKERGNFSQME  175


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YH++CF+C H    +  SN+ + E
Sbjct  93   QSNSKVSSLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHE  152

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK  G+  +
Sbjct  153  HKLYCRHHHTQLFKERGNFSQ  173



>ref|XP_008453121.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=186

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 143/179 (80%), Gaps = 4/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC+KTVYLVD+L ADN+VYHK+CFRC+HCK TLKL N++SFEGVLYC+P
Sbjct  3    MAFLGTTQKCKACDKTVYLVDQLTADNKVYHKACFRCHHCKSTLKLFNYSSFEGVLYCKP  62

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK TGSL+KSFEG P+  R ++    V    +L  +    F GT DKCVTC  TV
Sbjct  63   HFDQLFKMTGSLEKSFEGTPRTVRTDRSTNQVQTNSKLSSL----FAGTQDKCVTCKKTV  118

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++V+  +YH+ACF+CSH GC ISPSNYIA+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  119  YPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHEHRLYCRHHHNQLFKQKGNFSQLD  177


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+ C+KTVY ++++A D++ YH++CFRC H    +  SN+ + E
Sbjct  95   QTNSKLSSLFAGTQDKCVTCKKTVYPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHE  154

Query  649  GVLYCRPHFDQLFKRTGS---LDKSFE  578
              LYCR H +QLFK+ G+   LDK  E
Sbjct  155  HRLYCRHHHNQLFKQKGNFSQLDKHEE  181



>gb|AAD32870.1|AC005489_8 F14N23.8 [Arabidopsis thaliana]
Length=223

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 151/215 (70%), Gaps = 36/215 (17%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKCMAC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEG---------------------------------IPKVARPEK  548
            HFDQ FKRTGSL+KSFEG                                  PK+ +P++
Sbjct  61   HFDQNFKRTGSLEKSFEGKLPKTDQNVKSFVSGDFKFGIIYLKFDSYICTGTPKIGKPDR  120

Query  547  GAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTI  368
               P++     G   S  F GT +KCV C  TVYP EK+SVNGT YHK+CFKC+H GCTI
Sbjct  121  ---PLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTI  177

Query  367  SPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSEG  263
            SPSNYIA+EG+LYCKHHHIQL KEKGN SQL+  G
Sbjct  178  SPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEGGG  212


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY +++++ +  +YHKSCF+C H   T+  SN+ + EG LY
Sbjct  131  KVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLY  190

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVAR  557
            C+ H  QL K  G+L +   G    A+
Sbjct  191  CKHHHIQLIKEKGNLSQLEGGGENAAK  217



>gb|AII80542.1| LIM-domain protein 8 [Gossypium hirsutum]
Length=189

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 144/176 (82%), Gaps = 5/176 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R ++ A  V   +      SG F GT +KCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGTPKTVRVDRSADQVTNSKF-----SGLFAGTQEKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
             EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQL
Sbjct  119  IEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHNQLFKQKGNFSQL  174



>ref|XP_007209651.1| hypothetical protein PRUPE_ppa012024mg [Prunus persica]
 ref|XP_008239721.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
 gb|EMJ10850.1| hypothetical protein PRUPE_ppa012024mg [Prunus persica]
Length=187

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 143/180 (79%), Gaps = 9/180 (5%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVP-SGHFVGTTDKCVTCTLTVY  446
            DQLFK TGSLDKSFEGIPK  R        D  E++     S  F GT DKCV C  TVY
Sbjct  64   DQLFKMTGSLDKSFEGIPKTVR--------DRSEQVNNSKVSSLFAGTQDKCVACKKTVY  115

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YHK CF+CSH GC ISPSNY+A+E RLYC+HHH QLFKEKGN+SQL  +
Sbjct  116  PIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHEHRLYCRHHHSQLFKEKGNFSQLSKQ  175


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+KTVY ++++A D   YHK CFRC H    +  SN+ + E  LY
Sbjct  95   KVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHEHRLY  154

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK  G+  +
Sbjct  155  CRHHHSQLFKEKGNFSQ  171



>ref|XP_009803543.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=189

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 5/178 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKC  CEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRPH
Sbjct  3    TFGGTTQKCKGCEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEG PK  R E+ A   D G+   +V S  F GT DKCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGAPKTVR-ERSA---DQGQSNSKVSS-LFGGTQDKCVACKKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+GT+YH+ACFKCSH GC ISPSNY+A+E +LYC+HHH QLFKE+GN+SQ++
Sbjct  118  PLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEHKLYCRHHHTQLFKERGNFSQME  175


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YH++CF+C H    +  SN+ + E
Sbjct  93   QSNSKVSSLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHE  152

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK  G+  +
Sbjct  153  HKLYCRHHHTQLFKERGNFSQ  173



>ref|XP_004501954.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=192

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEK VYLVD+L ADN+VYHKSCFRC+HCKGTLKLSNF+SFEGVLYC+PH
Sbjct  3    SFAGTTQKCKACEKIVYLVDQLTADNKVYHKSCFRCHHCKGTLKLSNFSSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK+TGSLDKSFEGIP+ +R E+    V +  +   +    F GT +KCV C  TVY
Sbjct  63   FDQLFKKTGSLDKSFEGIPRTSRVERSTNQVQSNSQFSNL----FAGTQEKCVACKRTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK+ V G +YHK CF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KG +SQLD
Sbjct  119  PIEKVGVYGISYHKGCFRCNHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGKFSQLD  176



>ref|XP_010111544.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC31177.1| Pollen-specific protein SF3 [Morus notabilis]
Length=201

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 143/177 (81%), Gaps = 5/177 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCK TLKLS+++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKRTLKLSDYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQL K TGSLDKSFEG PK  R ++ A  +    R+ R+    F GT +KCV C  TVYP
Sbjct  64   DQLLKMTGSLDKSFEGTPKTVR-DRSADQIQTNSRVSRL----FAGTQEKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYCKHHH QLFK KGN+SQLD
Sbjct  119  IEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEQRLYCKHHHTQLFKAKGNFSQLD  175



>ref|XP_004138126.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155009.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN63605.1| Pollen-specific protein SF3 [Cucumis sativus]
Length=186

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC+KTVYLVD+L ADN+VYHK+CFRC+HCK TLKL N++SFEGVLYC+P
Sbjct  3    MAFLGTTQKCKACDKTVYLVDQLTADNKVYHKACFRCHHCKSTLKLFNYSSFEGVLYCKP  62

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQLFK TGSL+KSFE  P+  R ++    V    +L  +    F GT DKCVTC  TV
Sbjct  63   HFDQLFKMTGSLEKSFEATPRTVRTDRSTNQVQTNSKLSSL----FAGTQDKCVTCKKTV  118

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++V+  +YH+ACF+CSH GC ISPSNYIA+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  119  YPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHEHRLYCRHHHNQLFKQKGNFSQLD  177


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+ C+KTVY ++++A D++ YH++CFRC H    +  SN+ + E
Sbjct  95   QTNSKLSSLFAGTQDKCVTCKKTVYPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHE  154

Query  649  GVLYCRPHFDQLFKRTGS---LDKSFE  578
              LYCR H +QLFK+ G+   LDK  E
Sbjct  155  HRLYCRHHHNQLFKQKGNFSQLDKHEE  181



>gb|ABK23670.1| unknown [Picea sitchensis]
 gb|ABK26097.1| unknown [Picea sitchensis]
Length=191

 Score =   260 bits (665),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 143/181 (79%), Gaps = 9/181 (5%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLVD+L ADN VYHKSCFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCKACEKTVYLVDQLTADNSVYHKSCFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVP---SGHFVGTTDKCVTCT  458
            HFDQLFKRTGSLDKSFE IP+ +R +K        E   + P   S  F GT DKCV C 
Sbjct  61   HFDQLFKRTGSLDKSFEAIPRASRNDK------TQENESKTPNRVSTMFSGTQDKCVACG  114

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK++V+GT+YH+ CFKC H GC ISPSNY+A+EGRLYC+HH  QLF+EKGN+SQ
Sbjct  115  KTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCRHHSSQLFREKGNFSQ  174

Query  277  L  275
            L
Sbjct  175  L  175


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -3

Query  811  TMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCR  632
            +  F GT  KC+AC KTVY ++++A D   YH+ CF+C H    +  SN+ + EG LYCR
Sbjct  100  STMFSGTQDKCVACGKTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCR  159

Query  631  PHFDQLFKRTGSLDKSFEGIP  569
             H  QLF+  G+  +  +G P
Sbjct  160  HHSSQLFREKGNFSQLAKGTP  180



>ref|XP_010027995.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW83415.1| hypothetical protein EUGRSUZ_B00345 [Eucalyptus grandis]
Length=182

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 142/179 (79%), Gaps = 6/179 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKC AC+KTVYLVD+L ADN+V+HK+CFRC+HCKGTLKLSN+ SFEGVLYC+PH
Sbjct  4    AFAGTQQKCKACDKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYCSFEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            F+QLFK TGSLDKSFEG PK        G  +A        S  F GT DKCV C  TVY
Sbjct  64   FNQLFKMTGSLDKSFEGTPKTVNRSSEQGQSNAK------VSSMFAGTQDKCVACKKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            P EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFKEKGN+SQLDS
Sbjct  118  PIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHHNQLFKEKGNFSQLDS  176


 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E
Sbjct  93   QSNAKVSSMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHE  152

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H +QLFK  G+  +
Sbjct  153  HRLYCRHHHNQLFKEKGNFSQ  173



>emb|CDP17006.1| unnamed protein product [Coffea canephora]
Length=190

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 147/177 (83%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC  CEKTVYLVD+L AD++VYHKSCFRC+HC+GTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKTCEKTVYLVDQLQADSKVYHKSCFRCHHCRGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK AR ++ A   + G+   +V S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGAPKTARADRVA---NQGQTNSKV-SSMFAGTQDKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YH+ACF+CSH GC ISPSNYIA++ +LYC+HHH QLFK+KGN+SQL+
Sbjct  120  LEKVAVDGTSYHRACFRCSHGGCMISPSNYIAHDHKLYCRHHHSQLFKKKGNFSQLE  176


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YH++CFRC H    +  SN+ + +
Sbjct  94   QTNSKVSSMFAGTQDKCVACKKTVYPLEKVAVDGTSYHRACFRCSHGGCMISPSNYIAHD  153

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK+ G+  +
Sbjct  154  HKLYCRHHHSQLFKKKGNFSQ  174



>ref|XP_004496871.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=181

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L AD R YH +CFRC+HC+ TLKLSN+ SFEGVLYCRPH
Sbjct  3    SFAGTTQKCTACEKTVYLVDKLTADGRTYHMACFRCHHCRNTLKLSNYCSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQL+KRTGSLDKSF+G PK+ + EK     +  + L  V    FVGTTDKC+ C  TVY
Sbjct  63   YDQLYKRTGSLDKSFDGTPKIQKAEKQTSENENAKTLANV----FVGTTDKCMCCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PTE+++VNGT YHK CFKC++ GCTIS +N++ +E +LYCKHHHIQLFKEKGNYSQL+++
Sbjct  119  PTERVTVNGTPYHKGCFKCTYGGCTISSANFVTHETKLYCKHHHIQLFKEKGNYSQLEND  178



>gb|ABK22236.1| unknown [Picea sitchensis]
Length=187

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVY+VD+L AD  V+HK+CFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTQQKCKACEKTVYVVDQLTADGSVFHKACFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEK-GAGPVDAGERLGRVPSGHFVGTTDKCVTCTLT  452
            HFDQLFKRTGSLDKSFEG PK  + EK   G +    R+    S  F GT +KC+ C  T
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKAVKNEKLNDGEIKTPSRV----SALFSGTQEKCLACGNT  116

Query  451  VYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            VYP EK+SV G  YHK CFKC H GC ISPSNYIA EGRLYCKHHH QLFKEKGNYSQL
Sbjct  117  VYPIEKVSVEGVGYHKQCFKCIHGGCVISPSNYIAIEGRLYCKHHHAQLFKEKGNYSQL  175



>gb|KCW55096.1| hypothetical protein EUGRSUZ_I01055 [Eucalyptus grandis]
Length=177

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 138/180 (77%), Gaps = 21/180 (12%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLVD+L A++RVYHK+CFRC+HC GTLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCTACEKTVYLVDKLTANSRVYHKACFRCHHCNGTLKLGNFNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ+FKRTGSLDKSFE                      RV S  F GT DKC +C  T 
Sbjct  61   HFDQIFKRTGSLDKSFEA--------------------NRV-SAFFAGTRDKCASCNKTA  99

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++VNGT YHK CFKC+H GCTISPSNYIA+EG+LYCKHHH QLFKEKGNYSQLD+
Sbjct  100  YPIEKVTVNGTGYHKRCFKCAHGGCTISPSNYIAHEGKLYCKHHHTQLFKEKGNYSQLDT  159



>ref|XP_010322559.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
 gb|AAX73300.1| putative pollen specific LIM domain-containing protein [Solanum 
lycopersicum]
Length=179

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 144/178 (81%), Gaps = 6/178 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRPH
Sbjct  3    SFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEG PK  R E+ A   D G       S  F GT DKCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGAPKTVR-ERSA---DQGS--NSKVSSLFGGTQDKCVACKKTVY  116

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+GT+YH+ CFKCSH GC ISPSNY+A+E RLYC+HHH QLFKE+GN+SQ++
Sbjct  117  PLEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHEHRLYCRHHHTQLFKERGNFSQME  174


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+KTVY ++++A D   YH+ CF+C H    +  SN+ + E  LY
Sbjct  96   KVSSLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHEHRLY  155

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK  G+  +
Sbjct  156  CRHHHTQLFKERGNFSQ  172



>ref|XP_007155394.1| hypothetical protein PHAVU_003G197600g [Phaseolus vulgaris]
 gb|ESW27388.1| hypothetical protein PHAVU_003G197600g [Phaseolus vulgaris]
Length=204

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEK VY V++L ADN++YHKSCFRC+HCKGTLKL N+ SFEGVLYC+PH
Sbjct  3    SFAGTTQKCTACEKKVYWVEQLTADNKLYHKSCFRCHHCKGTLKLGNYCSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSL+KSFEGIP++AR E+ A  V    ++ R+    F GT +KCV C  TVY
Sbjct  63   FDQLFKMTGSLEKSFEGIPRIARVERSADQVQTNNKISRL----FSGTQEKCVVCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            P EK++V+G +YHK+CF+C+H GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQL
Sbjct  119  PIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHEHRLYCRHHHTQLFKQKGNFSQL  175


 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++A D + YHKSCFRC H    +  SN+ + E  LY
Sbjct  98   KISRLFSGTQEKCVVCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHEHRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK+ G+  +
Sbjct  158  CRHHHTQLFKQKGNFSQ  174



>gb|ACA33841.1| LIM2 transcription factor [Pinus pinaster]
Length=182

 Score =   257 bits (657),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 142/181 (78%), Gaps = 9/181 (5%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLVD+L ADN V+HKSCFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCKACEKTVYLVDQLTADNSVFHKSCFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVP---SGHFVGTTDKCVTCT  458
            HFDQLFKRTGSLDKSF  IP+ +R +K        E   R P   S  F GT DKCV C 
Sbjct  61   HFDQLFKRTGSLDKSFAAIPRASRNDK------MHENENRTPSRVSALFSGTQDKCVACG  114

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK++V+GT+YH+ CFKC H GC ISPSNY+A+EGRLYC+HH  QLF+EKGN+SQ
Sbjct  115  KTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCRHHSSQLFREKGNFSQ  174

Query  277  L  275
            L
Sbjct  175  L  175


 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+AC KTVY ++++A D   YH+ CF+C H    +  SN+ + EG LYCR H 
Sbjct  103  FSGTQDKCVACGKTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCRHHS  162

Query  622  DQLFKRTGSLDKSFEGIPK  566
             QLF+  G+  +  +  P+
Sbjct  163  SQLFREKGNFSQLSKATPQ  181



>ref|XP_009389653.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 150/181 (83%), Gaps = 5/181 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAFQGT  KC AC KTVYLV++L ADNRVYHK+CFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTTKCTACTKTVYLVEKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HFDQ++K TGSLDKSFEG PKV +PEK    VD  E   +V S  F GT +KCV C  TV
Sbjct  61   HFDQIYKSTGSLDKSFEGTPKVVKPEKF---VD-NENANKVSSA-FAGTREKCVGCKKTV  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP E+++VNGTAYHK+CFKCSH GCTISPSNYIA+EG LYCKHHHIQL K+KGNYS+L+ 
Sbjct  116  YPIERVTVNGTAYHKSCFKCSHGGCTISPSNYIAHEGTLYCKHHHIQLIKQKGNYSKLED  175

Query  268  E  266
            E
Sbjct  176  E  176


 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC+ C+KTVY ++R+  +   YHKSCF+C H   T+  SN+ + EG LY
Sbjct  96   KVSSAFAGTREKCVGCKKTVYPIERVTVNGTAYHKSCFKCSHGGCTISPSNYIAHEGTLY  155

Query  637  CRPHFDQLFKRTGSLDK  587
            C+ H  QL K+ G+  K
Sbjct  156  CKHHHIQLIKQKGNYSK  172



>ref|XP_008374471.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=188

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 8/176 (5%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L ADN++YHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADNKIYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEGIPK  R        +  ++     S  F GT DKCV C  TVY 
Sbjct  64   DQLFKMTGSLDKSFEGIPKTVR--------ERSDQTNSKVSNLFAGTQDKCVACKKTVYX  115

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
             EK++V+GT+YHK CF+CSH GC ISPSNY+A+E RLYC+HHH QLFKEKGN+SQL
Sbjct  116  IEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHEHRLYCRHHHSQLFKEKGNFSQL  171


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YHK CFRC H    +  SN+ + E
Sbjct  90   QTNSKVSNLFAGTQDKCVACKKTVYXIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHE  149

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK  G+  +
Sbjct  150  HRLYCRHHHSQLFKEKGNFSQ  170



>ref|XP_002321571.1| hypothetical protein POPTR_0015s08360g [Populus trichocarpa]
 gb|EEF05698.1| hypothetical protein POPTR_0015s08360g [Populus trichocarpa]
Length=191

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 142/176 (81%), Gaps = 4/176 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC AC+KTVYLVD+L  DN+ YHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACDKTVYLVDQLTVDNKFYHKACFRCHHCKGTLKLSNYSSFEGVLYCQPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R ++ A  V +  ++    S  F GT +KCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGTPKTVRGDRSADQVLSNSKV----SSMFAGTQEKCVACNKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
             EK++V+GT+YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLFKEKGN+SQ 
Sbjct  120  LEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHEHRLYCRHHHNQLFKEKGNFSQF  175


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+AC KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  98   KVSSMFAGTQEKCVACNKTVYPLEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHEHRLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H +QLFK  G+  +
Sbjct  158  CRHHHNQLFKEKGNFSQ  174



>ref|XP_011028613.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=191

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 142/176 (81%), Gaps = 4/176 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC AC+KTVYLVD+L  DN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACDKTVYLVDQLTVDNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK  R ++ A  V +  ++    S  F GT +KCV C  TVYP
Sbjct  64   DQLFKMTGSLDKSFEGTPKTVRGDRSADQVLSNSKV----SSMFAGTQEKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
             EK++V+GT+YHKACF+C+H GC ISPSNY+A+E  LYC+HHH QLFKEKGN+SQ 
Sbjct  120  LEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHEHSLYCRHHHNQLFKEKGNFSQF  175


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  98   KVSSMFAGTQEKCVACKKTVYPLEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHEHSLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H +QLFK  G+  +
Sbjct  158  CRHHHNQLFKEKGNFSQ  174



>ref|XP_008393059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=188

 Score =   256 bits (654),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKC ACEKTVYLVD+  ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PH
Sbjct  3    TFGGTTQKCKACEKTVYLVDQXTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEGIPK  R        +  ++     S  F GT DKCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGIPKTVR--------ERSDQTNSKVSSLFAGTQDKCVACKKTVY  114

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            P EK++V+GT+YHK CF+C+H GC ISPSNY+A+E RLYC+HHH QLFKEKGN+SQL
Sbjct  115  PIEKVAVDGTSYHKPCFRCTHGGCVISPSNYVAHEHRLYCRHHHSQLFKEKGNFSQL  171


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YHK CFRC H    +  SN+ + E
Sbjct  90   QTNSKVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCTHGGCVISPSNYVAHE  149

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK  G+  +
Sbjct  150  HRLYCRHHHSQLFKEKGNFSQ  170



>sp|P29675.1|SF3_HELAN RecName: Full=Pollen-specific protein SF3 [Helianthus annuus]
 gb|AAD56958.1|AF187104_1 LIM domain protein PLIM1a [Helianthus annuus]
 emb|CAA45731.1| Transcription factor SF3 [Helianthus annuus]
Length=219

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 139/180 (77%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC  CEKTVYLVD+L A+ RVYHK+CFRC+HC  TLKLSNFNSF+GV+YCR H
Sbjct  3    SFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCRHH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSL+KSF+G PK       +    +  RL    S  F GT DKC  C   VY
Sbjct  63   FDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSANRL----SSFFEGTRDKCNACAKIVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E++ V+GTAYH+ACFKC H GCTISPSNYIA+EGRLYCKHHHIQLFK+KGNYSQL+ E
Sbjct  119  PIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLFKKKGNYSQLEVE  178



>ref|XP_010274389.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=186

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 143/181 (79%), Gaps = 3/181 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC AC KTV+LVD+L ADNR++HKSCFRC+HC GTLKL NF+SFEGVLYCRP
Sbjct  1    MSFAGTTQKCQACNKTVHLVDQLTADNRIFHKSCFRCHHCNGTLKLGNFSSFEGVLYCRP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            H+DQLFKRTG LDKSFEG PKVA+ EK   PVD+        S  F GT +KCV C  TV
Sbjct  61   HYDQLFKRTGRLDKSFEGAPKVAKSEK---PVDSQSVGSNRVSNMFGGTQEKCVGCKKTV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++V+G  YHK CF+C   GC +S S+YIA+EG+LYC+HHH QLFKEKGNYSQL++
Sbjct  118  YPLEKVTVDGNVYHKICFRCVRGGCVLSTSSYIAHEGKLYCRHHHTQLFKEKGNYSQLEN  177

Query  268  E  266
            +
Sbjct  178  D  178



>gb|AAD56957.1|AF187103_1 LIM domain protein PLIM1b [Helianthus annuus]
Length=214

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 139/180 (77%), Gaps = 4/180 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC  CEKTVYLVD+L A+ RVYHK+CFRC+HC  TLKLSNFNSF+GV+YCR H
Sbjct  3    SFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCRHH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSL+KSF+G PK       +    +  RL    S  F GT DKC  C   VY
Sbjct  63   FDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSANRL----SSFFEGTRDKCNACAKIVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P E++ V+GTAYH+ACFKC H GCTISPSNYIA+EGRLYCKHHHIQLFK+KGNYSQL+ E
Sbjct  119  PIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLFKKKGNYSQLEVE  178



>ref|XP_009610584.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=189

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD++VYHK+CFRC+HCKGTLKLSN+NS+EGVLYCRPHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLKADSKVYHKACFRCHHCKGTLKLSNYNSYEGVLYCRPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSL+KSFEG P+ AR        D G+   +V S  F GT DKCV+C  TVYP
Sbjct  64   DQLFKMTGSLNKSFEGAPRTARER----SADQGQSNSKV-SALFGGTQDKCVSCKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             EK++V+GT+YH+ACFKCSH GC ISPSNY+A++ +LYC+HHH QLFK++GN+S ++ +
Sbjct  119  LEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDHKLYCRHHHTQLFKQRGNFSHMEDQ  177


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC++C+KTVY ++++A D   YH++CF+C H    +  SN+ + +
Sbjct  93   QSNSKVSALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHD  152

Query  649  GVLYCRPHFDQLFKRTGSL  593
              LYCR H  QLFK+ G+ 
Sbjct  153  HKLYCRHHHTQLFKQRGNF  171



>ref|XP_007036120.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY20621.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=207

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 147/190 (77%), Gaps = 13/190 (7%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD++VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKACEKTVYLVDQLTADSKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAG-----------PVDAG--ERLGRVPSGHFVGT  482
            DQLFKRTGSLDKSFEG PK  R ++ A             + +G  +      S  F GT
Sbjct  64   DQLFKRTGSLDKSFEGTPKTVRVDRSADHALKVVLPYLLLILSGTLQVTNSRVSSLFAGT  123

Query  481  TDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLF  302
             +KCV C  TVYP EK++V+G++YHKACF+C+H GC ISPSNY+A+E RLYC+HHH QLF
Sbjct  124  QEKCVACKKTVYPIEKVAVDGSSYHKACFRCTHGGCVISPSNYVAHEQRLYCRHHHNQLF  183

Query  301  KEKGNYSQLD  272
            K+KGN+SQLD
Sbjct  184  KQKGNFSQLD  193



>ref|XP_011071800.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Sesamum indicum]
Length=182

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L AD +VYHK+CFRC+HCKGTLKLSN+ S+EGVLYC+PH
Sbjct  3    SFAGTTQKCKACEKTVYLVDQLTADTKVYHKTCFRCHHCKGTLKLSNYCSYEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            F+QLFK TGSLDKSFEG P+ AR ++         +   +    F GT DKCV C   VY
Sbjct  63   FNQLFKMTGSLDKSFEGAPRTARADRSTEQAPTYSKFSSL----FAGTQDKCVACNKKVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+G++YH+ CFKCSH+GC ISPSNYIA+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  119  PLEKVAVDGSSYHRTCFKCSHSGCVISPSNYIAHEHRLYCRHHHTQLFKQKGNFSQLD  176



>ref|XP_002318024.1| hypothetical protein POPTR_0012s07870g [Populus trichocarpa]
 gb|EEE96244.1| hypothetical protein POPTR_0012s07870g [Populus trichocarpa]
Length=191

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 143/177 (81%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC +CEKTVY VD+L AD++VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKSCEKTVYFVDQLTADDKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQL K TGSLDKSF+G  K  R ++ A  V +  ++    S  F GT +KCV C  TVYP
Sbjct  64   DQLLKMTGSLDKSFKGTSKTVRVDRSADQVQSNSKV----SSMFAGTQEKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             E+++V+GT+YHKACF+C+H GC ISPSN++A+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  120  IERVAVDGTSYHKACFRCAHGGCVISPSNFVAHEHRLYCRHHHNQLFKQKGNFSQLD  176


 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+AC+KTVY ++R+A D   YHK+CFRC H    +  SNF + E
Sbjct  94   QSNSKVSSMFAGTQEKCVACKKTVYPIERVAVDGTSYHKACFRCAHGGCVISPSNFVAHE  153

Query  649  GVLYCRPHFDQLFKRTGS---LDKSFEGIP  569
              LYCR H +QLFK+ G+   LDK     P
Sbjct  154  HRLYCRHHHNQLFKQKGNFSQLDKHEHVTP  183



>ref|XP_003525489.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHN48618.1| Pollen-specific protein SF3 [Glycine soja]
Length=215

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEK VY V++L ADN+VYHKSCFRC+HCKGTLKLSN+ SFEGVLYC+PH
Sbjct  3    SFAGTTQKCTACEKKVYWVEQLTADNKVYHKSCFRCHHCKGTLKLSNYCSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            F QLFK TGSLDKSFEG+P+  R E+ A  V    ++ R+    F GT +KCV C  TVY
Sbjct  63   FHQLFKMTGSLDKSFEGVPRSVRVERSADQVQTN-KVSRL----FSGTQEKCVGCKKTVY  117

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+G +YHK+CF+C+H GC ISPSNYIA+E RLYC+HHH QLFK+KGN+SQLD
Sbjct  118  PIEKVAVDGKSYHKSCFRCTHGGCVISPSNYIAHEHRLYCRHHHTQLFKQKGNFSQLD  175


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++A D + YHKSCFRC H    +  SN+ + E  LY
Sbjct  97   KVSRLFSGTQEKCVGCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYIAHEHRLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H  QLFK+ G+  +
Sbjct  157  CRHHHTQLFKQKGNFSQ  173



>ref|XP_010687903.1| PREDICTED: LIM domain-containing protein WLIM1 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 145/176 (82%), Gaps = 5/176 (3%)
 Frame = -3

Query  793  TNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHFDQL  614
            TN KC AC+KTVYLVD+L ADN+V+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRPHFDQL
Sbjct  8    TNPKCKACDKTVYLVDKLTADNKVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQL  67

Query  613  FKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYPTEK  434
            +K+TGSLDKSF+G PK  +PE+    VD+ +   ++ S  F GT DKC  C+ T YPTEK
Sbjct  68   YKQTGSLDKSFDGTPKT-KPERH---VDSEKPPSKI-SSMFGGTRDKCAGCSKTAYPTEK  122

Query  433  ISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            ++VNG+AYHK+CFKC   GCTISPSNYI +EGRLYCKHHH QL KEKGN SQL+ +
Sbjct  123  VTVNGSAYHKSCFKCYQGGCTISPSNYIGHEGRLYCKHHHAQLIKEKGNLSQLEGD  178


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C KT Y  +++  +   YHKSCF+CY    T+  SN+   EG LY
Sbjct  98   KISSMFGGTRDKCAGCSKTAYPTEKVTVNGSAYHKSCFKCYQGGCTISPSNYIGHEGRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEG  575
            C+ H  QL K  G+L +  EG
Sbjct  158  CKHHHAQLIKEKGNLSQ-LEG  177



>gb|AAX95760.2| Pollen-specific protein SF3, putative [Solanum lycopersicum]
Length=184

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 144/183 (79%), Gaps = 11/183 (6%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC ACEKTVYLVD+L ADN+VYHK+CFRC+HCKGTLKLSN+NSFEGVLYCRPH
Sbjct  3    SFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEG PK  R E+ A   D G       S  F GT DKCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGAPKTVR-ERSA---DQGS--NSKVSSLFGGTQDKCVACKKTVY  116

Query  445  PTEK-----ISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYS  281
            P EK     ++V+GT+YH+ CFKCSH GC ISPSNY+A+E RLYC+HHH QLFKE+GN+S
Sbjct  117  PLEKTRAEQVAVDGTSYHRPCFKCSHGGCVISPSNYVAHEHRLYCRHHHTQLFKERGNFS  176

Query  280  QLD  272
            Q++
Sbjct  177  QME  179


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDR-----LAADNRVYHKSCFRCYHCKGTLKLSNFNSF  653
            K +  F GT  KC+AC+KTVY +++     +A D   YH+ CF+C H    +  SN+ + 
Sbjct  96   KVSSLFGGTQDKCVACKKTVYPLEKTRAEQVAVDGTSYHRPCFKCSHGGCVISPSNYVAH  155

Query  652  EGVLYCRPHFDQLFKRTGSLDK  587
            E  LYCR H  QLFK  G+  +
Sbjct  156  EHRLYCRHHHTQLFKERGNFSQ  177



>ref|XP_011044348.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=191

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC +CEKTVY VD+L ADN+VYHK+CFRC+HCKGTLKLSN++SFEGVLYC+PHF
Sbjct  4    FAGTTQKCKSCEKTVYFVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQL K TGSLDKSF+G  K  R ++ A  V +  ++    S  F GT +KCV C  TVYP
Sbjct  64   DQLLKMTGSLDKSFKGTSKTVRGDRSADQVQSNSKV----SSMFAGTQEKCVACKKTVYP  119

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             E+++V+GT+YHKACF+C+H GC ISPSN++A+E RLYC+HHH QLFK+KGN+SQ D
Sbjct  120  LERVAVDGTSYHKACFRCAHGGCVISPSNFVAHEHRLYCRHHHNQLFKQKGNFSQFD  176


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC+AC+KTVY ++R+A D   YHK+CFRC H    +  SNF + E
Sbjct  94   QSNSKVSSMFAGTQEKCVACKKTVYPLERVAVDGTSYHKACFRCAHGGCVISPSNFVAHE  153

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H +QLFK+ G+  +
Sbjct  154  HRLYCRHHHNQLFKQKGNFSQ  174



>ref|XP_010928557.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=248

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKC ACEKTVYLVD+L AD RVYHK+CFRC+HCKGTLKLSN++S +GVLYC+PH
Sbjct  5    AFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKPH  64

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQLFK TGSLDKSFEG  + A+ ++  G  +   R     S  FVGT DKCV C  TVY
Sbjct  65   YDQLFKMTGSLDKSFEGSSRSAKADRSNGHENTANRRF---SSMFVGTQDKCVVCKKTVY  121

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+GT+YH+ CFKCS  GC ISPSNYIA+EGRLYCKHHH QLF  KGN+SQL+
Sbjct  122  PIEKVAVDGTSYHRPCFKCSRGGCVISPSNYIAHEGRLYCKHHHSQLFMAKGNFSQLE  179


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  508  VPSGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLY  329
            + SG F GTT KC  C  TVY  ++++ +G  YHKACF+C H   T+  SNY + +G LY
Sbjct  1    MASGAFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLY  60

Query  328  CKHHHIQLFKEKGNYSQ  278
            CK H+ QLFK  G+  +
Sbjct  61   CKPHYDQLFKMTGSLDK  77


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C+KTVY ++++A D   YH+ CF+C      +  SN+ + EG LYC+ H 
Sbjct  106  FVGTQDKCVVCKKTVYPIEKVAVDGTSYHRPCFKCSRGGCVISPSNYIAHEGRLYCKHHH  165

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERL  515
             QLF   G+  +  +    +  P +   P D  E+L
Sbjct  166  SQLFMAKGNFSQLEDRHESIKVPTENLSPDDNAEKL  201



>ref|XP_009786244.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=190

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 145/178 (81%), Gaps = 6/178 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD++VYHKSCFRC+HCKGTLKLSN+NS+EGVLYCRPHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLKADSKVYHKSCFRCHHCKGTLKLSNYNSYEGVLYCRPHF  63

Query  622  DQLFKRTGSLDKSFE-GIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            DQLFK TGSL+KSFE G P+ AR        D G+   +V S  F GT DKCV+C  TVY
Sbjct  64   DQLFKMTGSLNKSFEVGAPRTARER----SADQGQSNSKV-SALFGGTQDKCVSCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+GT+YH+ACFKCSH GC ISPSNY+A++ +LYC+HHH QLFK++GN+S ++
Sbjct  119  PLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDHKLYCRHHHTQLFKQRGNFSHME  176


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC++C+KTVY ++++A D   YH++CF+C H    +  SN+ + +
Sbjct  94   QSNSKVSALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHD  153

Query  649  GVLYCRPHFDQLFKRTGSL  593
              LYCR H  QLFK+ G+ 
Sbjct  154  HKLYCRHHHTQLFKQRGNF  172



>ref|XP_009610583.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=190

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 146/180 (81%), Gaps = 6/180 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD++VYHK+CFRC+HCKGTLKLSN+NS+EGVLYCRPHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLKADSKVYHKACFRCHHCKGTLKLSNYNSYEGVLYCRPHF  63

Query  622  DQLFKRTGSLDKSFE-GIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            DQLFK TGSL+KSFE G P+ AR        D G+   +V S  F GT DKCV+C  TVY
Sbjct  64   DQLFKMTGSLNKSFEVGAPRTARER----SADQGQSNSKV-SALFGGTQDKCVSCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++V+GT+YH+ACFKCSH GC ISPSNY+A++ +LYC+HHH QLFK++GN+S ++ +
Sbjct  119  PLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDHKLYCRHHHTQLFKQRGNFSHMEDQ  178


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC++C+KTVY ++++A D   YH++CF+C H    +  SN+ + +
Sbjct  94   QSNSKVSALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHD  153

Query  649  GVLYCRPHFDQLFKRTGSL  593
              LYCR H  QLFK+ G+ 
Sbjct  154  HKLYCRHHHTQLFKQRGNF  172



>ref|XP_008793824.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Phoenix 
dactylifera]
Length=214

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 143/179 (80%), Gaps = 5/179 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF GT QKC ACEKTVYLVD+L AD RVYHK+CFRC+HCKGTLKLSN++S +GVLYC+PH
Sbjct  5    AFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKPH  64

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAG-PVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            +DQLFK TGSLDKSFEG  + A+ ++  G   +A  R   +    FVGT DKCV C  TV
Sbjct  65   YDQLFKMTGSLDKSFEGSSRSAKADRSNGHESNANSRFLSM----FVGTQDKCVVCKKTV  120

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++++GT+YH+ CFKCSH GC ISPSNYIA++GRLYCKHHH QLF  KGN+SQL+
Sbjct  121  YPIEKVALDGTSYHRPCFKCSHGGCVISPSNYIAHDGRLYCKHHHSQLFMAKGNFSQLE  179


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  508  VPSGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLY  329
            + SG F GTT KC  C  TVY  ++++ +G  YHKACF+C H   T+  SNY + +G LY
Sbjct  1    MASGAFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLY  60

Query  328  CKHHHIQLFKEKGNYSQ  278
            CK H+ QLFK  G+  +
Sbjct  61   CKPHYDQLFKMTGSLDK  77



>ref|XP_004508840.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=192

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC  CEK VY V++L ADN+VYHKSCF+C+HCKGTLKLSN+ S+EGVLYC+PH
Sbjct  3    SFTGTTQKCKVCEKKVYWVEQLTADNKVYHKSCFKCHHCKGTLKLSNYCSYEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSLDKSFEGI ++AR E+ A  V A +++ R+    F+GT +KCV C  TVY
Sbjct  63   FDQLFKMTGSLDKSFEGIARIARFERSADQVQANKKVSRL----FIGTQEKCVGCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            P EK+ V+G +YHK+CF+C+H GC ISPSNY+ +E  LYC+HHH QLFK KGN+SQ 
Sbjct  119  PIEKVGVDGKSYHKSCFRCTHGGCVISPSNYVTHEHSLYCRHHHNQLFKHKGNFSQF  175


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++  D + YHKSCFRC H    +  SN+ + E  LY
Sbjct  98   KVSRLFIGTQEKCVGCKKTVYPIEKVGVDGKSYHKSCFRCTHGGCVISPSNYVTHEHSLY  157

Query  637  CRPHFDQLFKRTGSLDK  587
            CR H +QLFK  G+  +
Sbjct  158  CRHHHNQLFKHKGNFSQ  174



>gb|EYU29934.1| hypothetical protein MIMGU_mgv1a014656mg [Erythranthe guttata]
Length=182

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            + GT QKC ACEKTVYLVD+L ADN+VYHK CFRC+HC  TLKLSN++S+EGVLYC+PHF
Sbjct  5    YGGTTQKCKACEKTVYLVDQLTADNKVYHKPCFRCHHCNATLKLSNYSSYEGVLYCKPHF  64

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSLDKSFEG PK +R ++      A  +     S  F GT DKCV C+ TVYP
Sbjct  65   DQLFKMTGSLDKSFEGGPKTSRIDRSTDHGAANSKF----SSMFAGTQDKCVACSKTVYP  120

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK+ V+G +YH+ CFKCSH GC ISPSNY+A+E +LYC+HHH QLFK+KGN+SQLD
Sbjct  121  LEKVGVDGVSYHRPCFKCSHGGCVISPSNYVAHEHQLYCRHHHNQLFKQKGNFSQLD  177


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC KTVY ++++  D   YH+ CF+C H    +  SN+ + E  LY
Sbjct  99   KFSSMFAGTQDKCVACSKTVYPLEKVGVDGVSYHRPCFKCSHGGCVISPSNYVAHEHQLY  158

Query  637  CRPHFDQLFKRTGS---LDKSFEG  575
            CR H +QLFK+ G+   LDK  E 
Sbjct  159  CRHHHNQLFKQKGNFSQLDKHEEA  182



>ref|XP_010037591.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW49320.1| hypothetical protein EUGRSUZ_K02874 [Eucalyptus grandis]
Length=191

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 7/178 (4%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
             F GT QKC ACEKTVY V++L ADN+VYH++CFRC+HCKGTLKLSN++SFEGVLYC+PH
Sbjct  3    TFSGTTQKCKACEKTVYFVEQLTADNKVYHRTCFRCHHCKGTLKLSNYSSFEGVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSL+KSFEG P   R    +  V    ++ R     F GT +KCV C  TVY
Sbjct  63   FDQLFKMTGSLNKSFEGTP---RTVNKSDQVQTNSKVSRF----FSGTQEKCVACKKTVY  115

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+GT+YHKACF+CSH GC ISPSNYI +  RLYCKHHH QLFK KGN+SQLD
Sbjct  116  PIEKVAVDGTSYHKACFRCSHGGCVISPSNYITHLNRLYCKHHHNQLFKVKGNFSQLD  173


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT +KC+AC+KTVY ++++A D   YHK+CFRC H    +  SN+ +    LYC+ H 
Sbjct  100  FSGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCSHGGCVISPSNYITHLNRLYCKHHH  159

Query  622  DQLFKRTGS---LDK--SFEGIPKVARPE  551
            +QLFK  G+   LDK    E +PK+   E
Sbjct  160  NQLFKVKGNFSQLDKHAKIEEVPKLPVAE  188



>gb|EYU42534.1| hypothetical protein MIMGU_mgv1a021971mg [Erythranthe guttata]
Length=188

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 140/179 (78%), Gaps = 8/179 (4%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            + GTNQKC  C KTVYLVD+L ADN+VYH  CFRC+HCKGTLKLSN++S+EGVLYC+PHF
Sbjct  4    YGGTNQKCKTCYKTVYLVDQLTADNKVYHNFCFRCHHCKGTLKLSNYSSYEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKG--AGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            DQLFK TGSL+KSFEG PK AR E+    GP ++        S  F GT DKC+ C   V
Sbjct  64   DQLFKMTGSLNKSFEGAPKTARAERSNEQGPTNSK------FSSLFGGTQDKCIACDKKV  117

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK++V+GT YH+ CFKCSH GC ISPSNYIA+E RLYC+HHH QLF++KGN+S+LD
Sbjct  118  YPLEKVAVDGTLYHRCCFKCSHGGCVISPSNYIAHEHRLYCRHHHTQLFRQKGNFSKLD  176


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -3

Query  499  GHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKH  320
             ++ GT  KC TC  TVY  ++++ +   YH  CF+C H   T+  SNY +YEG LYCK 
Sbjct  2    ANYGGTNQKCKTCYKTVYLVDQLTADNKVYHNFCFRCHHCKGTLKLSNYSSYEGVLYCKP  61

Query  319  HHIQLFKEKGNYSQ  278
            H  QLFK  G+ ++
Sbjct  62   HFDQLFKMTGSLNK  75



>ref|XP_009418011.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = -3

Query  811  TMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCR  632
            +M F GT QKC AC KTVYLVD+LAAD R+YH++CFRC+HC+GTLK SN++S EGVLYC+
Sbjct  3    SMLFGGTTQKCQACRKTVYLVDQLAADGRIYHRACFRCHHCRGTLKFSNYSSIEGVLYCK  62

Query  631  PHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVD-AGERLGRVPSGHFVGTTDKCVTCTL  455
            PH+DQLFK TGSLDKSFEG PK A+ ++ +G    A  R   +    F+GT DKCV C  
Sbjct  63   PHYDQLFKMTGSLDKSFEGAPKSAKIDRSSGQQGVANSRYASI----FLGTRDKCVECKK  118

Query  454  TVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            TVYP EK++V+G +YH+ CF+C+H GCTISPSN++ +EGRLYCKHHH QLF  KGN+S  
Sbjct  119  TVYPIEKVAVDGNSYHRPCFRCTHGGCTISPSNFVTHEGRLYCKHHHAQLFMTKGNFSSF  178



>ref|XP_010913501.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=202

 Score =   245 bits (626),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 5/181 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            AF  T QKC ACEKTVYLVD+L AD R+YHK+CFRC+HCKGTL+LSN++S +GVLYC+PH
Sbjct  5    AFGRTTQKCKACEKTVYLVDQLTADGRIYHKACFRCHHCKGTLRLSNYSSIDGVLYCKPH  64

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAG-PVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            +DQLFK TGSLDKSFE  P+ AR ++ +G   +A  R     S  FVGT DKCV C  TV
Sbjct  65   YDQLFKMTGSLDKSFEDAPRSARADRSSGHESNANSRF----SSMFVGTQDKCVVCKKTV  120

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++V+GT+ H+ CFKCSH GC ISPSNY+A+EG++YCKHHH QLF  KGN+SQL  
Sbjct  121  YPIEKVAVDGTSCHRPCFKCSHGGCVISPSNYVAHEGKVYCKHHHSQLFMIKGNFSQLQD  180

Query  268  E  266
            +
Sbjct  181  K  181


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -3

Query  508  VPSGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLY  329
            + SG F  TT KC  C  TVY  ++++ +G  YHKACF+C H   T+  SNY + +G LY
Sbjct  1    MASGAFGRTTQKCKACEKTVYLVDQLTADGRIYHKACFRCHHCKGTLRLSNYSSIDGVLY  60

Query  328  CKHHHIQLFKEKGNYSQ  278
            CK H+ QLFK  G+  +
Sbjct  61   CKPHYDQLFKMTGSLDK  77


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 0/94 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C+KTVY ++++A D    H+ CF+C H    +  SN+ + EG +YC+ H 
Sbjct  106  FVGTQDKCVVCKKTVYPIEKVAVDGTSCHRPCFKCSHGGCVISPSNYVAHEGKVYCKHHH  165

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
             QLF   G+  +  +    +  P K   P D  E
Sbjct  166  SQLFMIKGNFSQLQDKHENIKVPIKYPVPDDNAE  199



>ref|XP_006345025.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   244 bits (624),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD+RVYHKSCFRC HCKGTLKL N+NS+EGVLYCRPHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLKADSRVYHKSCFRCNHCKGTLKLGNYNSYEGVLYCRPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSL+KSFEG P+  +       +D  +   +V S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLNKSFEGGPRTVKER----SLDKAQAANKV-SALFGGTQDKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
             EK++V+GT+YH+ CFKCSH GC ISPSNY+A++ +LYC+HHH QLFK++GN+S ++
Sbjct  119  LEKVAVDGTSYHRPCFKCSHGGCIISPSNYVAHDHKLYCRHHHTQLFKQRGNFSHME  175


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC+AC+KTVY ++++A D   YH+ CF+C H    +  SN+ + +  LY
Sbjct  97   KVSALFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCIISPSNYVAHDHKLY  156

Query  637  CRPHFDQLFKRTGSL  593
            CR H  QLFK+ G+ 
Sbjct  157  CRHHHTQLFKQRGNF  171



>ref|XP_003608956.1| LIM domain protein [Medicago truncatula]
 gb|AES91153.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=181

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC  CEK VY V++L ADN+V+HKSCFRC+HCKGTLKLSN+ SFE VLYC+PH
Sbjct  3    SFAGTAQKCNTCEKKVYWVEQLTADNKVFHKSCFRCHHCKGTLKLSNYCSFESVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSL KSFEGI ++ R E+    V A  ++ R     F GT +KCV C  TVY
Sbjct  63   FDQLFKMTGSLYKSFEGITRIYRVERSTDQVQAYNKVSRF----FAGTQEKCVGCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+G +YHK CF+C+H GC ISPSNY+A+E RLYC+HHH Q+FK+KGN+SQ D
Sbjct  119  PIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLYCRHHHTQIFKQKGNFSQFD  176


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  98   KVSRFFAGTQEKCVGCKKTVYPIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKV  563
            CR H  Q+FK+ G+  + F+ I +V
Sbjct  158  CRHHHTQIFKQKGNFSQ-FDKIEQV  181



>ref|XP_010678700.1| PREDICTED: LIM domain-containing protein WLIM1-like [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD +V+HK+CFRC+HCK TLKL NF+SFEGVLYC+PHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLTADGKVFHKACFRCHHCKSTLKLHNFSSFEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
             QLFK TGSLDKSFE  P+  R        + G+   +V S  F GT +KCV+C  TVYP
Sbjct  64   AQLFKMTGSLDKSFEAAPRTVRDR----SYEQGQTNSKVSS-MFGGTQEKCVSCKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             EK++V+G +YHKACF+CSH GC ISPSNY+A+E RLYC+HHH QLFK+KGN+SQL ++
Sbjct  119  IEKVAVDGDSYHKACFRCSHGGCVISPSNYVAHEHRLYCRHHHSQLFKQKGNFSQLATQ  177


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT +KC++C+KTVY ++++A D   YHK+CFRC H    +  SN+ + E
Sbjct  93   QTNSKVSSMFGGTQEKCVSCKKTVYPIEKVAVDGDSYHKACFRCSHGGCVISPSNYVAHE  152

Query  649  GVLYCRPHFDQLFKRTGSLDK  587
              LYCR H  QLFK+ G+  +
Sbjct  153  HRLYCRHHHSQLFKQKGNFSQ  173



>ref|XP_004236135.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
Length=189

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 140/178 (79%), Gaps = 5/178 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVYLVD+L AD+RVYHK+CFRC HCKGTLKL N+NS+EGVLYCRPHF
Sbjct  4    FGGTTQKCKACEKTVYLVDQLKADSRVYHKACFRCNHCKGTLKLGNYNSYEGVLYCRPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            DQLFK TGSL+KSFEG P+  + E+      A  ++    S  F GT DKCV C  TVYP
Sbjct  64   DQLFKMTGSLNKSFEGGPRTVK-ERSLDKAQANNKV----SALFGGTQDKCVACKKTVYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
             EK++V+GT+YH+ CFKCSH GC ISPSNY+A++ +LYC+HHH QLFK++GN+S ++ 
Sbjct  119  LEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHDHKLYCRHHHTQLFKQRGNFSHMED  176


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -3

Query  829  QFQFKKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFE  650
            Q   K +  F GT  KC+AC+KTVY ++++A D   YH+ CF+C H    +  SN+ + +
Sbjct  93   QANNKVSALFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHD  152

Query  649  GVLYCRPHFDQLFKRTGSL  593
              LYCR H  QLFK+ G+ 
Sbjct  153  HKLYCRHHHTQLFKQRGNF  171



>gb|AFK42303.1| unknown [Medicago truncatula]
Length=181

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 137/178 (77%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +F GT QKC  CEK VY V++L ADN+V+HKSCFRC+HCKGTLKLSN+ SFE VLYC+PH
Sbjct  3    SFAGTAQKCNTCEKKVYWVEQLTADNKVFHKSCFRCHHCKGTLKLSNYCSFESVLYCKPH  62

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFK TGSL KSFEGI ++ R E+    V A  ++ R     F GT +KCV C  TVY
Sbjct  63   FDQLFKMTGSLYKSFEGITRIYRVERSTDQVQAYNKVSRF----FAGTQEKCVGCKKTVY  118

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK++V+G +YHK CF+C+H GC ISPSNY+A+E RLYC+ HH Q+FK+KGN+SQ D
Sbjct  119  PIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLYCRRHHTQIFKQKGNFSQFD  176


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC+ C+KTVY ++++A D   YHK+CFRC H    +  SN+ + E  LY
Sbjct  98   KVSRFFAGTQEKCVGCKKTVYPIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLY  157

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKV  563
            CR H  Q+FK+ G+  + F+ I +V
Sbjct  158  CRRHHTQIFKQKGNFSQ-FDKIEQV  181



>ref|XP_009415386.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=202

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC AC+KTVYLVD+LAAD R+YH++CFRC+HCKGTLK SN++S +GVLYC+PH+
Sbjct  5    FGGTTQKCQACQKTVYLVDQLAADGRIYHRACFRCHHCKGTLKFSNYSSIDGVLYCKPHY  64

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVD-AGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            DQLFK TGSLDK FEG PK ++ ++  G    A  R   +    F+GT DKCV C  TVY
Sbjct  65   DQLFKMTGSLDKIFEGAPKSSKIDRSIGQQGIANNRYSTI----FLGTQDKCVECKKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            P EK++V+G +YH+ CF+CSH GCTISPSN+I +EGRLYCKHHH QLF  KGN+S  
Sbjct  121  PIEKVAVDGNSYHRPCFRCSHGGCTISPSNFITHEGRLYCKHHHAQLFMTKGNFSSF  177



>gb|EMT23508.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=240

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 145/221 (66%), Gaps = 43/221 (19%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEG------IPKVARPEKGAGPVDAGERLGRV--------------  506
            FDQLFKRTGSLDKSFE       I  + R     G +  G R   +              
Sbjct  64   FDQLFKRTGSLDKSFEESNGGMLIQALQRLSSQKGML--GMRWSTIVPKMIQKHTPKIIQ  121

Query  505  ---------------------PSGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKC  389
                                  S  F GT +KC  C+ TVYP E+++VN T YHK+CFKC
Sbjct  122  NIHRFFFFFSNHATELHNATKVSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKC  181

Query  388  SHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
             H GCTISPSNYIA+EG+L+CKHHH QL KEKGN+SQL+++
Sbjct  182  CHGGCTISPSNYIAHEGKLFCKHHHTQLIKEKGNFSQLEND  222


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K + AF GT +KC  C KTVY ++R+  +N +YHKSCF+C H   T+  SN+ + EG L+
Sbjct  142  KVSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLF  201

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVD  530
            C+ H  QL K  G+  +      K ++    AG VD
Sbjct  202  CKHHHTQLIKEKGNFSQLENDHDKTSQ---SAGSVD  234


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -3

Query  493  FVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHH  314
            F GTT KC  C  TVY  +K++ +   YHKACF+C H   T+  +NY ++EG LYC+ H 
Sbjct  5    FQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPHF  64

Query  313  IQLFKEKGNYSQLDSEGSG  257
             QLFK  G+  +   E +G
Sbjct  65   DQLFKRTGSLDKSFEESNG  83



>ref|XP_001765937.1| predicted protein [Physcomitrella patens]
 gb|EDQ69258.1| predicted protein [Physcomitrella patens]
Length=191

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVYLV++L AD  VYHKSCFRC HCKGTLKL+N+ S EGVLYC+P
Sbjct  1    MAFSGTTQKCKACEKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLANYASLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSG---HFVGTTDKCVTCT  458
            HF+QL K TGS DKSFE      +P +G    + GE   + PS     F GT +KC+ C+
Sbjct  61   HFEQLLKVTGSFDKSFEH-----KPSEGLKKAEKGEN--KAPSKASLMFSGTQEKCIACS  113

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK +V G  YHK CFKC H GCTISPSNY A EGRLYCK H+ QLFKEKGNYSQ
Sbjct  114  KTVYPIEKTTVEGLPYHKQCFKCVHGGCTISPSNYAALEGRLYCKPHYSQLFKEKGNYSQ  173

Query  277  L  275
            L
Sbjct  174  L  174


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K ++ F GT +KC+AC KTVY +++   +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  97   KASLMFSGTQEKCIACSKTVYPIEKTTVEGLPYHKQCFKCVHGGCTISPSNYAALEGRLY  156

Query  637  CRPHFDQLFKRTGSLDK  587
            C+PH+ QLFK  G+  +
Sbjct  157  CKPHYSQLFKEKGNYSQ  173



>gb|EMS67160.1| Pollen-specific protein SF3 [Triticum urartu]
Length=188

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 136/180 (76%), Gaps = 13/180 (7%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            +FQGT  KC AC+KTVYLVD+L ADNRVYHK+CFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            FDQLFKRTGSLDKSFE          G   + A +RL        +G +       +T  
Sbjct  64   FDQLFKRTGSLDKSFE-------ESNGGMLIQALQRLSSRKG--MLGMS----ALIMTPA  110

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            PT +++VN T YHK+CFKC H GCTISPSNYIA+EG+L+CKHHH QL KEKGN+SQL+++
Sbjct  111  PTLQVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKHHHTQLIKEKGNFSQLEND  170


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -3

Query  493  FVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHH  314
            F GTT KC  C  TVY  +K++ +   YHKACF+C H   T+  +NY ++EG LYC+ H 
Sbjct  5    FQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPHF  64

Query  313  IQLFKEKGNYSQLDSEGSG  257
             QLFK  G+  +   E +G
Sbjct  65   DQLFKRTGSLDKSFEESNG  83



>ref|XP_001771340.1| predicted protein [Physcomitrella patens]
 gb|EDQ63900.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC+KTVYLV++L AD  VYHKSCFRC HCKGTLKL+++ S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACDKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLASYASLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPV-DAGERLGRVPSGHFVGTTDKCVTCTLT  452
            HF+QL K TGS DKSFE      +P +G   + + GE++    S  F GT DKC+ C+ T
Sbjct  61   HFEQLLKLTGSFDKSFE-----HKPSEGLKKLPEKGEKVPSKASLMFSGTQDKCIACSKT  115

Query  451  VYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
            VYP +K +V G  YHK CFKC H GCTISPSNY A EGRLYCK H+ QLFKEKGNYSQL
Sbjct  116  VYPIDKTTVEGLPYHKHCFKCVHGGCTISPSNYAALEGRLYCKPHYSQLFKEKGNYSQL  174


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K ++ F GT  KC+AC KTVY +D+   +   YHK CF+C H   T+  SN+ + EG LY
Sbjct  97   KASLMFSGTQDKCIACSKTVYPIDKTTVEGLPYHKHCFKCVHGGCTISPSNYAALEGRLY  156

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKG  545
            C+PH+ QLFK  G+  +  +   K+ RP K 
Sbjct  157  CKPHYSQLFKEKGNYSQLTKK--KMIRPTKA  185



>ref|XP_002969252.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
 gb|EFJ29340.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
Length=194

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 139/186 (75%), Gaps = 4/186 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF    QKC +CEKTVYLVD+L+AD  +YHK+CFRC HCKGTLKLSN+ S EGVLYC+P
Sbjct  1    MAFAVRQQKCKSCEKTVYLVDQLSADGVLYHKACFRCQHCKGTLKLSNYASLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFE--GIPKVA-RPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            H +QLF++TGS DKSF+  G PK + + E+    V +   + ++ S  F GT +KCV+C+
Sbjct  61   HLEQLFRKTGSFDKSFDSVGTPKNSLKQERERETVPSKPVVSKL-SRLFSGTQEKCVSCS  119

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK+SV G +YHK+CFKC+H GC ISPSNY A EG LYCKHH+ QLF EKGNYSQ
Sbjct  120  KTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGMLYCKHHYSQLFMEKGNYSQ  179

Query  277  LDSEGS  260
            L    S
Sbjct  180  LTKAAS  185


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC++C KTVY +++++ + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  103  KLSRLFSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGMLY  162

Query  637  CRPHFDQLFKRTGS  596
            C+ H+ QLF   G+
Sbjct  163  CKHHYSQLFMEKGN  176



>ref|XP_002965335.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
 ref|XP_002977179.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ21788.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ34173.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
Length=185

 Score =   229 bits (584),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 132/183 (72%), Gaps = 12/183 (7%)
 Frame = -3

Query  811  TMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCR  632
            + +F GT QKC AC+KTVYLVD+L AD  VYHK+CFRC+HCKGTLKLSN+ S EGVLYC+
Sbjct  3    SFSFAGTQQKCKACDKTVYLVDQLTADGVVYHKACFRCHHCKGTLKLSNYASLEGVLYCK  62

Query  631  PHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGH---FVGTTDKCVTC  461
            PHFDQLFK TGS DKSFE          G      GE   + PS     F GT +KC  C
Sbjct  63   PHFDQLFKLTGSFDKSFES---------GLLHKPVGEEASKTPSKTSLLFSGTQEKCFAC  113

Query  460  TLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYS  281
              TVYP EK++V  T+YHK+CFKCSH GCTISPSNY A+EGRLYC+HH+ QL KEKG++S
Sbjct  114  GKTVYPIEKVTVENTSYHKSCFKCSHGGCTISPSNYQAHEGRLYCRHHYAQLVKEKGDFS  173

Query  280  QLD  272
             L 
Sbjct  174  NLS  176


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K ++ F GT +KC AC KTVY ++++  +N  YHKSCF+C H   T+  SN+ + EG LY
Sbjct  98   KTSLLFSGTQEKCFACGKTVYPIEKVTVENTSYHKSCFKCSHGGCTISPSNYQAHEGRLY  157

Query  637  CRPHFDQLFKRTGSLD  590
            CR H+ QL K  G   
Sbjct  158  CRHHYAQLVKEKGDFS  173



>ref|XP_002960609.1| hypothetical protein SELMODRAFT_229974 [Selaginella moellendorffii]
 gb|EFJ38148.1| hypothetical protein SELMODRAFT_229974 [Selaginella moellendorffii]
Length=180

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 133/183 (73%), Gaps = 12/183 (7%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF    QKC +CEKTVYLVD+L+AD  +YHK+CFRC HCKGTLKLSN+ S EGVLYC+P
Sbjct  1    MAFAVRQQKCKSCEKTVYLVDQLSADGVLYHKACFRCQHCKGTLKLSNYASLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            H +QLF++TGS DKSF+     ++P           +L R+    F GT +KCV+C+ TV
Sbjct  61   HLEQLFRKTGSFDKSFDSGKVPSKP--------VVSKLSRL----FSGTQEKCVSCSKTV  108

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK+SV G +YHK+CFKC+H GC ISPSNY A EG LYCKHH+ QLF EKGNYSQL  
Sbjct  109  YPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGMLYCKHHYSQLFMEKGNYSQLTK  168

Query  268  EGS  260
              S
Sbjct  169  AAS  171


 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT +KC++C KTVY +++++ + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  89   KLSRLFSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGMLY  148

Query  637  CRPHFDQLFKRTGS  596
            C+ H+ QLF   G+
Sbjct  149  CKHHYSQLFMEKGN  162



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC KTVYL+D+L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TGS +KSF+   K A    PE    P  A        +G F GT +KC TC 
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKA--------AGMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH GC ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  L  275
            L
Sbjct  173  L  173



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC KTVYL+D+L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TGS +KSF+   K A    PE    P  A        +G F GT +KCV C 
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKA--------AGMFSGTQEKCVACG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH GC ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  L  275
            L
Sbjct  173  L  173



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 130/183 (71%), Gaps = 5/183 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC+KTVYL+D+L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HF+QLFK TGS +KSF+   K A       P     R     +G F GT +KC TC  T 
Sbjct  61   HFEQLFKETGSFNKSFQSPAKPAEK-----PTPELTRSRSKAAGMFSGTQEKCATCGKTA  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++V G AYHK CF+CSH GC+ISPSNY A EG LYCKHH  QLFKEKG+Y+ L  
Sbjct  116  YPLEKVTVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIK  175

Query  268  EGS  260
              S
Sbjct  176  SAS  178



>gb|EMS52970.1| Pollen-specific protein SF3 [Triticum urartu]
Length=1238

 Score =   246 bits (628),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 106/178 (60%), Positives = 134/178 (75%), Gaps = 3/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C K VY V+ LAAD R YH+ CFRC+HCK TL+ SN++S EGVLYC+PH
Sbjct  4    AWGGTTQKCASCGKKVYPVEELAADGRAYHRPCFRCHHCKSTLQFSNYSSIEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG+ + A+ EK  GP   G++  R  S  FVGT DKCV C  TVY
Sbjct  64   YDQILKSTGSLEKSFEGVTRSAKSEKSNGP--KGQQNSRF-SSMFVGTQDKCVVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK+ +NG AYHK+CF+C+H GCT+SPSN + +EG+LYCK HH QLF  KGN+SQ +
Sbjct  121  PLEKVDLNGGAYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHHSQLFMVKGNFSQFE  178



>gb|EMT02506.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=1279

 Score =   246 bits (628),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 107/184 (58%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C K VY V+ LAAD R YH+ CFRC+HCK TL+ SN++S EGVLYC+PH
Sbjct  4    AWGGTTQKCASCGKKVYPVEELAADGRAYHRPCFRCHHCKSTLQFSNYSSIEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG+ + A+ EK  GP   G++  R  S  FVGT DKCV C  TVY
Sbjct  64   YDQILKSTGSLEKSFEGVTRAAKSEKSNGP--KGQQNSRF-SSMFVGTQDKCVVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK+ +NG +YHK+CF+C+H GCT+SPSN + +EG+LYCK HH QLF  KGN+SQ + E
Sbjct  121  PLEKVDLNGGSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHHSQLFMVKGNFSQFE-E  179

Query  265  GSGN  254
             + N
Sbjct  180  NTAN  183



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC+KTVYL+D+L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            HF+QLFK TGS +KSF+   K A  EK    +    R     +G F GT +KC TC  T 
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSA--EKSNPELT---RSRSKAAGMFSGTLEKCATCGKTA  115

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDS  269
            YP EK++V G AYHK+CF+CSH GC ISPSNY A EG LYCKHH  QLFKEKG+Y+ L  
Sbjct  116  YPLEKVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIK  175

Query  268  EGS  260
              S
Sbjct  176  SAS  178



>ref|XP_008649270.1| PREDICTED: microtubule-associated protein futsch-like [Zea mays]
 gb|AFW76823.1| putative LIM-type zinc finger domain family protein [Zea mays]
Length=1453

 Score =   244 bits (624),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 107/184 (58%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C + VY V+ LAAD RVYH+ CFRC+HCK TL+ SN++S EGVLYC+PH
Sbjct  4    AWGGTTQKCASCGRRVYPVEELAADGRVYHRPCFRCHHCKSTLQFSNYSSVEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG+ + A+ EK  G    G++  R  S  FVGT +KCV C  TVY
Sbjct  64   YDQILKSTGSLEKSFEGVARSAKSEKSNG--HKGQQSSRF-SNMFVGTQEKCVVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK+++NG +YHK+CF+C+H GCT+SPSN+I +EG+LYCK HH QLF  KGN+SQ + +
Sbjct  121  PLEKVALNGNSYHKSCFRCTHGGCTLSPSNHITHEGKLYCKTHHSQLFMVKGNFSQFE-D  179

Query  265  GSGN  254
             SGN
Sbjct  180  NSGN  183


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -3

Query  502  SGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCK  323
            SG + GTT KC +C   VYP E+++ +G  YH+ CF+C H   T+  SNY + EG LYCK
Sbjct  2    SGAWGGTTQKCASCGRRVYPVEELAADGRVYHRPCFRCHHCKSTLQFSNYSSVEGVLYCK  61

Query  322  HHHIQLFKEKGNYSQ  278
             H+ Q+ K  G+  +
Sbjct  62   PHYDQILKSTGSLEK  76



>ref|XP_010227809.1| PREDICTED: enolase-phosphatase E1-like [Brachypodium distachyon]
Length=1414

 Score =   243 bits (619),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 105/179 (59%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC AC +TVY V+ LAAD R YH+ CFRC+HCK TL+ SN++S EGVLYC+PH
Sbjct  4    AWGGTTQKCAACGRTVYPVEELAADGRAYHRPCFRCHHCKSTLQFSNYSSIEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAG-PVDAGERLGRVPSGHFVGTTDKCVTCTLTV  449
            +DQ+ K TGSLDKSFEG+ + A+ E   G  V    R     S  FVGT +KCV C  TV
Sbjct  64   YDQILKSTGSLDKSFEGVTRSAKSENSNGHKVLKSSRF----SSMFVGTQEKCVVCNKTV  119

Query  448  YPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            YP EK+ +NG +YHK+CF+C+H GCT+SPSN+I +EG+LYCK HH QLF  KGN+SQ +
Sbjct  120  YPLEKVDLNGGSYHKSCFRCTHGGCTLSPSNHITHEGKLYCKTHHSQLFMVKGNFSQFE  178



>gb|EEE65408.1| hypothetical protein OsJ_20745 [Oryza sativa Japonica Group]
Length=268

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C +TVY V+ LAAD RVYH+ CFRC HCK TL+ SN++S EGVLYC+PH
Sbjct  5    AWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCFRCTHCKATLQFSNYSSVEGVLYCKPH  64

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG  K A+ EK  G      R     S  FVGT DKCV C  TVY
Sbjct  65   YDQILKSTGSLEKSFEGTSKSAKAEKSNGNKGQPNRF----SSMFVGTQDKCVVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK+++NG++YHK+CF+C+H GCT+SPSN + +EG+LYCK HH QLF  KGN+S  +
Sbjct  121  PLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHHSQLFMVKGNFSNFE  178


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 58/118 (49%), Gaps = 3/118 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C KTVY ++++  +   YHKSCFRC H   TL  SN  + EG LYC+ H 
Sbjct  105  FVGTQDKCVVCNKTVYPLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHH  164

Query  622  DQLFKRTGSLDKSFEGIPKV-ARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLT  452
             QLF   G+     +  P      EK     DA +  G    G   G T+K +   LT
Sbjct  165  SQLFMVKGNFSNFEDSTPNAKVDIEKQPEHEDATKNPGG--PGQGDGLTEKPLESELT  220



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY VD+L+AD   YHK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK +GS  K+F+   K+A              L R PS     F GT +KC TC 
Sbjct  61   HFEQLFKESGSFSKNFQSPAKLAD--------KTTHELTRSPSKAASMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LTKSAS  178


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_008441430.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441431.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441432.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 gb|KGN45769.1| hypothetical protein Csa_6G009480 [Cucumis sativus]
Length=189

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 131/186 (70%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V++L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A        +G F GT DKC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKA--------AGMFSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK++V   +YHK+CFKCSH GC +SPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTVYPLEKVTVESQSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY VD+L+AD   YHK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK +GS  K+F+   K+A              L R PS     F GT +KC TC 
Sbjct  61   HFEQLFKESGSFSKNFQSPAKLAD--------KTTHELTRSPSKAASMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LTKSAS  178


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY VD+L+AD   YHK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVA---RPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            H++QLFK TG+  K+F+   K+A    PE    P  A           F GT +KC TC 
Sbjct  61   HYEQLFKETGTFSKNFQSPAKLADKTTPELTRSPSKAASM--------FSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LTKSAS  178


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY VD+L+AD   YHK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVA---RPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            H++QLFK +GS  K+F+   K+A    PE    P  A           F GT +KC TC 
Sbjct  61   HYEQLFKESGSFSKNFQSPAKLADKTTPELTRSPSKAASM--------FSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LTKSAS  178


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_004965094.1| PREDICTED: microtubule-associated protein futsch-like [Setaria 
italica]
Length=1441

 Score =   241 bits (614),  Expect = 9e-68, Method: Composition-based stats.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 12/215 (6%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C +TVY V+ LAAD RVYH+ CFRC HCK TL+ SN++S EGVLYC+PH
Sbjct  4    AWGGTTQKCASCGRTVYPVEELAADGRVYHRPCFRCNHCKSTLQFSNYSSVEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSLDKSFEG  + A+PEK  G    G++  R  S  FVGT DKC+ C  TVY
Sbjct  64   YDQILKSTGSLDKSFEGASRSAKPEKSNG--HKGQQRSRF-SSMFVGTQDKCIVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSE  266
            P EK++++G++YHK+CF+C+H GCT+SPSN+I +EG+LYCK HH QLF  KGN+SQ + +
Sbjct  121  PLEKVALDGSSYHKSCFRCTHGGCTLSPSNHITHEGKLYCKTHHSQLFMVKGNFSQFE-D  179

Query  265  GSGNFsasdtesaaaaSVLPEEIAAAE*SPDRSEL  161
             SGN   +  +        P E   A  +P +SEL
Sbjct  180  SSGNAKVATEK--------PPETEEATKNPGQSEL  206


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  502  SGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCK  323
            SG + GTT KC +C  TVYP E+++ +G  YH+ CF+C+H   T+  SNY + EG LYCK
Sbjct  2    SGAWGGTTQKCASCGRTVYPVEELAADGRVYHRPCFRCNHCKSTLQFSNYSSVEGVLYCK  61

Query  322  HHHIQLFKEKGN  287
             H+ Q+ K  G+
Sbjct  62   PHYDQILKSTGS  73



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 130/186 (70%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+AD   YHKSCF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HFDQLFK TG+ +K+F+   K A    PE    P  A        +G F GT +KC TC 
Sbjct  61   HFDQLFKETGNFNKNFQSPAKTAEKLTPELTRSPSKA--------AGMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PS+Y A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSSYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 131/181 (72%), Gaps = 9/181 (5%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC AC+KTVY VD+L+AD   YHKSCFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSG---HFVGTTDKCVTCT  458
            HFDQLF+ +G+ +K+F+   + ++   G  P      L R PS     F GT DKC TC 
Sbjct  61   HFDQLFRESGNFNKNFQS-QRSSKVIDGLSP-----ELTRSPSKVSMMFSGTQDKCATCG  114

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   +YHK+CFKCSH GC+ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  115  KTAYPLEKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNH  174

Query  277  L  275
            L
Sbjct  175  L  175


 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 8/94 (9%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +M F GT  KC  C KT Y ++++  ++  YHKSCF+C H   ++  SN+ + EG+LY
Sbjct  98   KVSMMFSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILY  157

Query  637  CRPHFDQLFKRTGSLD--------KSFEGIPKVA  560
            C+ HF QLFK  GS +        K    +P+VA
Sbjct  158  CKHHFSQLFKEKGSYNHLIKTATMKRAAAVPEVA  191



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 138/211 (65%), Gaps = 21/211 (10%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC  C+KTVY+VD L+AD   YHKSCF+C HCKGTL +SN++S EGVLYC+P
Sbjct  1    MAFSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCFKCSHCKGTLSISNYSSLEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVP---SGHFVGTTDKCVTCT  458
            HF+QLFK TGS +KSF+  PK A         D    L R P   S  F GT DKC TC 
Sbjct  61   HFEQLFKETGSFNKSFQLPPKSA---------DKQHDLARAPSKLSSLFSGTQDKCATCY  111

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G +YHK+CFKCSH GC ++PS Y A +G LYCKHH  QLFKEKGNY+ 
Sbjct  112  KTAYPLEKVTVEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKHHFAQLFKEKGNYNH  171

Query  277  LDSEGSGNFsasdtesaaaaSVLPEEIAAAE  185
            L    S             A+++P E AAA+
Sbjct  172  LIKTAS---------MKRNAALIPAEEAAAD  193


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 4/99 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K +  F GT  KC  C KT Y ++++  +   YHKSCF+C H    L  S + + +G+LY
Sbjct  95   KLSSLFSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLTPSTYAALDGILY  154

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGE  521
            C+ HF QLFK  G    ++  + K A  ++ A  + A E
Sbjct  155  CKHHFAQLFKEKG----NYNHLIKTASMKRNAALIPAEE  189



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 130/186 (70%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY VD+L+AD   YHK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVA---RPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            H++QLFK TG+  K+F+   K+A    PE    P  A        +G F GT +KC TC 
Sbjct  61   HYEQLFKETGTFKKNFQSPAKLADKNTPELTRSPSKA--------AGMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 130/186 (70%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC  CEKTVY V++L+AD  VYHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK +G+ +K+F+   K A    PE    P  A           F GT +KC +C+
Sbjct  61   HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQEKCASCS  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK++V   AYHK CFKCSH GC+ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTVYPLEKVAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC +C KTVY ++++A +N+ YHK+CF+C H   ++  SN+ + EG+LY
Sbjct  96   KAASMFSGTQEKCASCSKTVYPLEKVAVENQAYHKTCFKCSHGGCSISPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|NP_001057248.1| Os06g0237300 [Oryza sativa Japonica Group]
 dbj|BAD37892.1| putative pollen-specific LIM domain protein [Oryza sativa Japonica 
Group]
 dbj|BAF19162.1| Os06g0237300 [Oryza sativa Japonica Group]
Length=1303

 Score =   239 bits (610),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C +TVY V+ LAAD RVYH+ CFRC HCK TL+ SN++S EGVLYC+PH
Sbjct  5    AWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCFRCTHCKATLQFSNYSSVEGVLYCKPH  64

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG  K A+ EK  G      R     S  FVGT DKCV C  TVY
Sbjct  65   YDQILKSTGSLEKSFEGTSKSAKAEKSNGNKGQPNRF----SSMFVGTQDKCVVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK+++NG++YHK+CF+C+H GCT+SPSN + +EG+LYCK HH QLF  KGN+S  +
Sbjct  121  PLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHHSQLFMVKGNFSNFE  178


 Score = 73.6 bits (179),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C KTVY ++++  +   YHKSCFRC H   TL  SN  + EG LYC+ H 
Sbjct  105  FVGTQDKCVVCNKTVYPLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHH  164

Query  622  DQLFKRTGSLDKSFEGIP  569
             QLF   G+     +  P
Sbjct  165  SQLFMVKGNFSNFEDSTP  182



>ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|ABK94456.1| unknown [Populus trichocarpa]
 gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 128/181 (71%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+ D   YHKSCF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HFDQLFK TG+ +K+F+   K A    PE    P  A        +G F GT +KC TC 
Sbjct  61   HFDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKA--------AGMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  L  275
            L
Sbjct  173  L  173



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 129/181 (71%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC AC+KTVY V++L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK TGS +K+F+       P K A  ++    L R PS     F GT DKC TC 
Sbjct  61   HFEQLFKETGSFNKNFQS------PAKSAEKLNP--ELTRSPSKAASMFSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V    YHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKGNY+ 
Sbjct  113  KTAYPLEKVTVESLTYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFAQLFKEKGNYNH  172

Query  277  L  275
            +
Sbjct  173  V  173


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  ++  YHKSCF+C H    +  SN+ + EGVLY
Sbjct  96   KAASMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITPSNYAALEGVLY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  G+ +
Sbjct  156  CKHHFAQLFKEKGNYN  171



>gb|EEC80296.1| hypothetical protein OsI_22314 [Oryza sativa Indica Group]
Length=1863

 Score =   239 bits (610),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 104/178 (58%), Positives = 131/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C +TVY V+ LAAD RVYH+ CFRC HCK TL+ SN++S EGVLYC+PH
Sbjct  5    AWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCFRCTHCKTTLQFSNYSSVEGVLYCKPH  64

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG  K A+ EK  G      R     S  FVGT DKCV C  TVY
Sbjct  65   YDQILKSTGSLEKSFEGTSKSAKAEKSNGNKGQPNRF----SSMFVGTQDKCVVCNKTVY  120

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK+++NG++YHK+CF+C+H GCT+SPSN + +EG+LYCK HH QLF  KGN+S  +
Sbjct  121  PLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHHSQLFMVKGNFSNFE  178


 Score = 73.6 bits (179),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT  KC+ C KTVY ++++  +   YHKSCFRC H   TL  SN  + EG LYC+ H 
Sbjct  105  FVGTQDKCVVCNKTVYPLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHH  164

Query  622  DQLFKRTGSLDKSFEGIP  569
             QLF   G+     +  P
Sbjct  165  SQLFMVKGNFSNFEDNTP  182



>ref|XP_011040324.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011040398.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
Length=189

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+AD   YHK+CF+C+HCKGTLKL N++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLGNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HFDQLFK TG+ +K+F+   K A    PE    P  A        +G F GT +KC TC 
Sbjct  61   HFDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKA--------AGMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+AD   YHKSCF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC++SPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  +++ YHKSCF+C H   +L  SN+ + EGVLY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_007009108.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOY17918.1| GATA type zinc finger transcription factor family protein isoform 
3 [Theobroma cacao]
Length=197

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 127/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKL N++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+ +  +               L R PS     F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSLSLILLSAAAKSAEKLTPELTRSPSKAASMFSGTQEKCATCG  120

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G +YHK+CFKCSH GC ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  121  KTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNH  180

Query  277  LDSEGS  260
            L    S
Sbjct  181  LIKSAS  186


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H    +  SN+ + EG+LY
Sbjct  104  KAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILY  163

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  164  CKHHFSQLFKEKGSYN  179



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 126/181 (70%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            MAF GT QKC ACEKTVY++D+L+AD  +YHKSCF+C HCKGTLKL N++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TGS +KSF+   K      PE    P  A           F GT DKC TC 
Sbjct  61   HFEQLFKETGSFNKSFQSPAKSVEKLTPELTRSPSKAASM--------FSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   +YHK+CFKCSH GC I+PS Y A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSTYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  L  275
            L
Sbjct  173  L  173


 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  +++ YHKSCF+C H    +  S + + EG+LY
Sbjct  96   KAASMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSTYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPV  533
            C+ HF QLFK  G    S+  + K A  ++ A PV
Sbjct  156  CKHHFSQLFKEKG----SYNHLIKCATMKRQAAPV  186



>ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=189

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+AD   YHKSCF+C+HCKGTLKLSN++S EGV+YC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVVYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC+ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCSISPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  +++ YHKSCF+C H   ++  SN+ + EGVLY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSISPSNYAALEGVLY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>gb|AGJ83945.1| lim protein 5 [Gossypium hirsutum]
Length=189

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKL+N++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPEMTRSPSKAASM--------FSGTVEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G +YHK+CFKCSH GC++SPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H   +L  SN+ + EG+LY
Sbjct  96   KAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCSLSPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>gb|KHG07853.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 130/186 (70%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKL+N++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLANYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSSAKAAEKLTPELTRSPSKAASM--------FSGTVEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G +YHK+CFKCSH+GC++SPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQSYHKSCFKCSHSGCSLSPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H   +L  SN+ + EG+LY
Sbjct  96   KAASMFSGTVEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHSGCSLSPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAG  524
            C+ HF QLFK  G    S+  + K A  ++ A  V  G
Sbjct  156  CKHHFSQLFKEKG----SYNHLIKSASIKRTAASVPEG  189



>ref|XP_008392904.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Malus 
domestica]
 ref|XP_009351067.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Pyrus x bretschneideri]
Length=199

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 127/186 (68%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT DKC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 128/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC AC+KTVY VD+L+AD   YHK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            H++QLFK TGS  K+F+   K A        V     L R PS     F GT +KC TC 
Sbjct  61   HYEQLFKETGSFKKNFQSPAKQA--------VKTTPELTRSPSKAASMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V G AYHK+CFKCSH  C I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H    +  SN+ + EGVLY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVLY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 128/181 (71%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+AD   YHKSCF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC++SPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  L  275
            L
Sbjct  173  L  173


 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  +++ YHKSCF+C H   +L  SN+ + EGVLY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY ++ L+AD   YHK+CF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+       P K A  ++    L R PS     F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQS------PAKSAEKLNP--ELTRSPSKAASMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHFSQLFKEKGSYNH  172

Query  277  L  275
            L
Sbjct  173  L  173


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EGVLY
Sbjct  96   KAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_009344420.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=199

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 127/186 (68%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT DKC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_008381875.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=199

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 127/186 (68%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A           F GT DKC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 127/181 (70%), Gaps = 6/181 (3%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC AC+KTVYL+D+L AD  V+HKSCF+C HCKGTL LS ++S EGVLYC+PHF
Sbjct  5    FTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPHF  64

Query  622  DQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVYP  443
            +QLFK +G+ +K+F+       P K A       R     +  F GT +KC TCT T YP
Sbjct  65   EQLFKESGNFNKNFQS------PAKSAEKAPELTRSTSKAASMFSGTQEKCATCTKTAYP  118

Query  442  TEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLDSEG  263
             EK++V G AYHK+CFKCSH GC+I+PSNY A EG LYCKHH  QLFKEKG+Y+ L    
Sbjct  119  LEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSA  178

Query  262  S  260
            S
Sbjct  179  S  179


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  + + YHKSCF+C H   ++  SN+ + EG+LY
Sbjct  97   KAASMFSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGILY  156

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  157  CKHHFSQLFKEKGSYN  172


 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -3

Query  496  HFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHH  317
            +F GT  KC  C  TVY  ++++ +G  +HK+CFKC+H   T++ S Y + EG LYCK H
Sbjct  4    NFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPH  63

Query  316  HIQLFKEKGNYSQ  278
              QLFKE GN+++
Sbjct  64   FEQLFKESGNFNK  76



>ref|XP_004307607.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=200

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC AC+KTVY V+ L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACQKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+   K A    PE    P  A        +G F GT +KC TC 
Sbjct  61   HFEQLFKETGNFNKNFQSPAKSAEKLTPEMTRSPSKA--------AGMFSGTQEKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



>ref|XP_006656826.1| PREDICTED: microtubule-associated protein futsch-like [Oryza 
brachyantha]
Length=1324

 Score =   236 bits (602),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 102/178 (57%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -3

Query  805  AFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPH  626
            A+ GT QKC +C +TVY V+ L AD RV+H+ CFRC HCK TL+ SN+ S EGVLYC+PH
Sbjct  4    AWGGTKQKCASCGRTVYPVEELTADGRVFHRPCFRCSHCKSTLQFSNYCSIEGVLYCKPH  63

Query  625  FDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLTVY  446
            +DQ+ K TGSL+KSFEG  K A+ EK  G      R     S  FVGT DKCV C  TVY
Sbjct  64   YDQILKSTGSLEKSFEGTSKSAKAEKSNGQKGQQNRF----SSMFVGTQDKCVVCNKTVY  119

Query  445  PTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQLD  272
            P EK+ +NG++YHK+CF+C+H GCT+SPSN + +EG+LYCK HH QLF  KGN+S+ +
Sbjct  120  PLEKVDLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHHSQLFMVKGNFSKFE  177


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -3

Query  502  SGHFVGTTDKCVTCTLTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCK  323
            +G + GT  KC +C  TVYP E+++ +G  +H+ CF+CSH   T+  SNY + EG LYCK
Sbjct  2    AGAWGGTKQKCASCGRTVYPVEELTADGRVFHRPCFRCSHCKSTLQFSNYCSIEGVLYCK  61

Query  322  HHHIQLFKEKGNYSQ  278
             H+ Q+ K  G+  +
Sbjct  62   PHYDQILKSTGSLEK  76



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 125/179 (70%), Gaps = 11/179 (6%)
 Frame = -3

Query  802  FQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRPHF  623
            F GT QKC ACEKTVY+VD+L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+PHF
Sbjct  4    FGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHF  63

Query  622  DQLFKRTGSLDKSFEGIPKVAR---PEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCTLT  452
            +QLFK TGS  K+F+   K A    PE    P  A           F GT +KC TC  T
Sbjct  64   EQLFKETGSFKKNFQSPAKSAEKLTPELTRSPSKAASM--------FSGTQEKCATCGKT  115

Query  451  VYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQL  275
             YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ L
Sbjct  116  AYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHL  174


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT +KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EG+LY
Sbjct  97   KAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILY  156

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  157  CKHHFSQLFKEKGSYN  172



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 127/186 (68%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY VD+L+AD   YHK+CFRC HCKGTLKLS+++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVA---RPEKGAGPVDAGERLGRVPSGHFVGTTDKCVTCT  458
            H++QLFK TG+  K+F    K+A    PE    P  A           F GT DKC TC 
Sbjct  61   HYEQLFKETGTFKKNFTSPAKLADKTTPELTRSPSKAASM--------FSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EG+LY
Sbjct  96   KAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILY  155

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  156  CKHHFSQLFKEKGSYN  171



>ref|XP_008392902.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_008392903.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_009351060.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Pyrus x bretschneideri]
Length=200

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 128/186 (69%), Gaps = 10/186 (5%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+  P     EK          L R PS     F GT DKC TC 
Sbjct  61   HFEQLFKETGNFNKNFQS-PAAKSAEK------LTPELTRSPSKAASMFSGTQDKCATCG  113

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   AYHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  114  KTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  173

Query  277  LDSEGS  260
            L    S
Sbjct  174  LIKSAS  179


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  817  KKTMAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLY  638
            K    F GT  KC  C KT Y ++++  +++ YHKSCF+C H    +  SN+ + EG+LY
Sbjct  97   KAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILY  156

Query  637  CRPHFDQLFKRTGSLD  590
            C+ HF QLFK  GS +
Sbjct  157  CKHHFSQLFKEKGSYN  172



>ref|XP_010534537.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534538.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534539.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
 ref|XP_010534540.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Tarenaya 
hassleriana]
Length=199

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 129/186 (69%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT QKC ACEKTVY V+ L+AD   YHKSCF+C HCK  L+LSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVSYHKSCFKCTHCKSRLQLSNYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK TGS  K+F+     A+P +   P      L R PS   G F GT DKC TC 
Sbjct  61   HFEQLFKETGSFHKNFQS---PAKPAEKPTP-----ELTRTPSKVAGMFSGTQDKCTTCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             TVYP EK++V   +YHK+CFKCSH GC ISPSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTVYPLEKVTVESQSYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



>ref|XP_010067487.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067488.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 ref|XP_010067489.1| PREDICTED: pollen-specific protein SF3 [Eucalyptus grandis]
 gb|KCW65631.1| hypothetical protein EUGRSUZ_G03023 [Eucalyptus grandis]
Length=189

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 130/186 (70%), Gaps = 11/186 (6%)
 Frame = -3

Query  808  MAFQGTNQKCMACEKTVYLVDRLAADNRVYHKSCFRCYHCKGTLKLSNFNSFEGVLYCRP  629
            M+F GT  KC ACEKTVY V++L+AD   YHKSCF+C HCKGTLKLS+++S EGVLYC+P
Sbjct  1    MSFTGTQVKCKACEKTVYPVEQLSADGVAYHKSCFKCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  628  HFDQLFKRTGSLDKSFEGIPKVARPEKGAGPVDAGERLGRVPS---GHFVGTTDKCVTCT  458
            HF+QLFK TG+ +K+F+       P K A  +     L R PS   G F GT DKC TC 
Sbjct  61   HFEQLFKETGNFNKNFQS------PAKSADKLTP--ELARSPSKAAGMFSGTQDKCATCG  112

Query  457  LTVYPTEKISVNGTAYHKACFKCSHAGCTISPSNYIAYEGRLYCKHHHIQLFKEKGNYSQ  278
             T YP EK++V   +YHK+CFKCSH GC I+PSNY A EG LYCKHH  QLFKEKG+Y+ 
Sbjct  113  KTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNH  172

Query  277  LDSEGS  260
            L    S
Sbjct  173  LIKSAS  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1985022489692