BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29954_g1_i1 len=364 path=[1:0-363]

Length=364
                                                                      Score     E

ref|XP_009799299.1|  PREDICTED: uncharacterized protein LOC104245396    234   2e-68   
ref|XP_009617827.1|  PREDICTED: uncharacterized protein LOC104110107    233   4e-68   
ref|XP_011092225.1|  PREDICTED: uncharacterized protein LOC105172480    232   7e-68   
ref|XP_011019918.1|  PREDICTED: uncharacterized protein LOC105122493    230   5e-67   
ref|XP_002309040.1|  WD-40 repeat family protein                        230   6e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011087586.1|  PREDICTED: uncharacterized protein LOC105169027    229   1e-66   
ref|XP_004230382.1|  PREDICTED: uncharacterized protein LOC101246184    228   2e-66   
ref|XP_010095595.1|  Copia protein                                      227   4e-66   
ref|XP_006358496.1|  PREDICTED: uncharacterized protein LOC102597...    227   6e-66   
ref|XP_006358495.1|  PREDICTED: uncharacterized protein LOC102597...    227   6e-66   
gb|KDO46912.1|  hypothetical protein CISIN_1g000685mg                   225   7e-66   
ref|XP_009603523.1|  PREDICTED: uncharacterized protein LOC104098481    227   8e-66   
gb|KDO46909.1|  hypothetical protein CISIN_1g000685mg                   226   2e-65   
gb|KDO46910.1|  hypothetical protein CISIN_1g000685mg                   226   2e-65   
gb|KDO46911.1|  hypothetical protein CISIN_1g000685mg                   226   2e-65   
ref|XP_006478516.1|  PREDICTED: uncharacterized protein LOC102607648    226   2e-65   
ref|XP_006441965.1|  hypothetical protein CICLE_v10018511mg             226   2e-65   
ref|XP_009779221.1|  PREDICTED: uncharacterized protein LOC104228457    224   4e-65   
ref|XP_010541522.1|  PREDICTED: uncharacterized protein LOC104814960    224   5e-65   
gb|KDP36340.1|  hypothetical protein JCGZ_09760                         224   5e-65   
ref|XP_010495459.1|  PREDICTED: uncharacterized protein LOC104772556    215   2e-64   
ref|XP_009150997.1|  PREDICTED: uncharacterized protein LOC103874342    223   2e-64   
gb|ABD32844.1|  Peptidase S8 and S53, subtilisin, kexin, sedolisi...    219   4e-64   Medicago truncatula
emb|CDP17760.1|  unnamed protein product                                221   5e-64   
gb|KDP35792.1|  hypothetical protein JCGZ_10428                         218   5e-64   
emb|CDX87116.1|  BnaC09g04310D                                          221   5e-64   
ref|XP_009111642.1|  PREDICTED: uncharacterized protein LOC103837068    221   5e-64   
emb|CDX88129.1|  BnaA06g27200D                                          222   5e-64   
ref|XP_006394724.1|  hypothetical protein EUTSA_v10003520mg             221   7e-64   
ref|XP_004170301.1|  PREDICTED: uncharacterized LOC101213309            218   7e-64   
ref|XP_009342400.1|  PREDICTED: uncharacterized protein LOC103934376    221   1e-63   
emb|CDY19826.1|  BnaA09g04790D                                          220   1e-63   
ref|XP_004494493.1|  PREDICTED: uncharacterized protein LOC101494449    219   2e-63   
gb|EYU33240.1|  hypothetical protein MIMGU_mgv1a000222mg                219   2e-63   
ref|XP_008458090.1|  PREDICTED: uncharacterized protein LOC103497626    219   3e-63   
ref|XP_004149319.1|  PREDICTED: uncharacterized protein LOC101213309    219   3e-63   
gb|KHG23947.1|  hypothetical protein F383_29619                         209   3e-63   
dbj|BAB09653.1|  unnamed protein product                                217   3e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AES82322.2|  transducin/WD40 repeat protein                          219   3e-63   
ref|XP_009358942.1|  PREDICTED: uncharacterized protein LOC103949552    219   3e-63   
ref|XP_009359004.1|  PREDICTED: uncharacterized protein LOC103949623    216   3e-63   
ref|XP_008382760.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    220   3e-63   
ref|XP_003626104.1|  hypothetical protein MTR_7g111080                  219   4e-63   
ref|XP_002521175.1|  conserved hypothetical protein                     219   5e-63   Ricinus communis
ref|XP_007014608.1|  Transducin/WD40 repeat-like superfamily prot...    217   7e-63   
gb|EPS66148.1|  hypothetical protein M569_08629                         217   1e-62   
ref|XP_010913344.1|  PREDICTED: uncharacterized protein LOC105039060    217   1e-62   
ref|XP_006286796.1|  hypothetical protein CARUB_v10003471mg             217   1e-62   
ref|XP_002874217.1|  hypothetical protein ARALYDRAFT_489332             217   1e-62   
ref|NP_197859.4|  WD40 domain-containing protein                        217   1e-62   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01929.1|  hypothetical protein                                   217   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014605.1|  Transducin/WD40 repeat-like superfamily prot...    217   2e-62   
ref|XP_010421308.1|  PREDICTED: uncharacterized protein LOC104706...    216   2e-62   
gb|KHG10913.1|  tRNA modification GTPase MnmE                           211   2e-62   
ref|XP_007014607.1|  Transducin/WD40 repeat-like superfamily prot...    217   2e-62   
ref|XP_007014606.1|  Transducin/WD40 repeat-like superfamily prot...    217   2e-62   
gb|KCW84525.1|  hypothetical protein EUGRSUZ_B013612                    216   3e-62   
ref|XP_008235875.1|  PREDICTED: uncharacterized protein LOC103334677    216   3e-62   
ref|XP_007200336.1|  hypothetical protein PRUPE_ppa000254mg             216   3e-62   
ref|XP_010421309.1|  PREDICTED: uncharacterized protein LOC104706...    216   3e-62   
ref|XP_010454796.1|  PREDICTED: uncharacterized protein LOC104736495    216   3e-62   
ref|XP_010038005.1|  PREDICTED: uncharacterized protein LOC104426595    216   3e-62   
ref|XP_010673184.1|  PREDICTED: uncharacterized protein LOC104889623    216   4e-62   
ref|XP_004290117.1|  PREDICTED: uncharacterized protein LOC101292072    216   7e-62   
ref|XP_002263744.1|  PREDICTED: uncharacterized protein LOC100248418    215   7e-62   Vitis vinifera
emb|CBI31125.3|  unnamed protein product                                215   7e-62   
dbj|BAF02178.1|  hypothetical protein                                   214   9e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791408.1|  PREDICTED: uncharacterized protein LOC103708...    213   3e-61   
ref|XP_008791407.1|  PREDICTED: uncharacterized protein LOC103708...    213   4e-61   
gb|KHN14190.1|  hypothetical protein glysoja_028588                     213   5e-61   
ref|XP_003521631.1|  PREDICTED: uncharacterized protein LOC100777567    213   5e-61   
ref|XP_008791406.1|  PREDICTED: uncharacterized protein LOC103708...    213   7e-61   
ref|XP_010241186.1|  PREDICTED: uncharacterized protein LOC104585868    212   1e-60   
ref|XP_008798429.1|  PREDICTED: uncharacterized protein LOC103713325    211   1e-60   
gb|KHN43390.1|  hypothetical protein glysoja_001973                     210   4e-60   
ref|XP_009405577.1|  PREDICTED: uncharacterized protein LOC103988692    210   5e-60   
ref|XP_009420899.1|  PREDICTED: uncharacterized protein LOC104000536    208   2e-59   
ref|XP_007163270.1|  hypothetical protein PHAVU_001G220300g             208   3e-59   
ref|XP_006849192.1|  hypothetical protein AMTR_s00027p00213280          206   1e-58   
gb|EEE55099.1|  hypothetical protein OsJ_02855                          201   7e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043744.1|  Os01g0653800                                       201   7e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658273.1|  PREDICTED: uncharacterized protein LOC102709386    201   7e-57   
dbj|BAJ99483.1|  predicted protein                                      199   2e-56   
emb|CDM83562.1|  unnamed protein product                                199   5e-56   
dbj|BAJ95941.1|  predicted protein                                      199   5e-56   
ref|XP_010232091.1|  PREDICTED: uncharacterized protein LOC100836556    199   5e-56   
ref|XP_004969341.1|  PREDICTED: uncharacterized protein LOC101769092    198   8e-56   
ref|XP_008657818.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    197   2e-55   
ref|XP_008673286.1|  PREDICTED: hypothetical protein isoform X2         196   3e-55   
ref|XP_008673285.1|  PREDICTED: hypothetical protein isoform X1         196   4e-55   
ref|XP_002969859.1|  hypothetical protein SELMODRAFT_92496              180   2e-49   
ref|XP_002985192.1|  hypothetical protein SELMODRAFT_157186             179   2e-49   
ref|XP_001757483.1|  predicted protein                                  174   2e-47   
ref|XP_006849182.1|  hypothetical protein AMTR_s00027p00200330          120   1e-30   
ref|XP_007014609.1|  Transducin/WD40 repeat-like superfamily prot...    108   1e-24   
ref|XP_007014610.1|  Transducin/WD40 repeat-like superfamily prot...    108   1e-24   
gb|EMT09929.1|  hypothetical protein F775_29330                       99.4    4e-21   
gb|EMS55149.1|  hypothetical protein TRIUR3_19246                     99.4    4e-21   
gb|EEC71194.1|  hypothetical protein OsI_03100                        67.4    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_002458242.1|  hypothetical protein SORBIDRAFT_03g029780        45.8    2e-10   Sorghum bicolor [broomcorn]
ref|NP_001183062.1|  uncharacterized protein LOC100501410             48.9    3e-05   
ref|XP_002987801.1|  hypothetical protein SELMODRAFT_426615           47.0    7e-04   



>ref|XP_009799299.1| PREDICTED: uncharacterized protein LOC104245396 [Nicotiana sylvestris]
 ref|XP_009799300.1| PREDICTED: uncharacterized protein LOC104245396 [Nicotiana sylvestris]
Length=1390

 Score =   234 bits (597),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QSN
Sbjct  902   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSN  961

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLL MSNSRDIG E L LDLND+MN+T+KK+NVVEAVQGVVKFAKEFM+LIDA
Sbjct  962   DLKRALQCLLIMSNSRDIGQETLGLDLNDLMNMTKKKENVVEAVQGVVKFAKEFMDLIDA  1021

Query  3     A  1
             A
Sbjct  1022  A  1022



>ref|XP_009617827.1| PREDICTED: uncharacterized protein LOC104110107 [Nicotiana tomentosiformis]
Length=1376

 Score =   233 bits (594),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPG+SKRLEFDLA+QSN
Sbjct  902   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGLSKRLEFDLALQSN  961

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLL MSNSRDIG E L LDLND+MN+T+KK+NVVEAVQGVVKFAKEFM+LIDA
Sbjct  962   DLKRALQCLLIMSNSRDIGQETLGLDLNDLMNMTKKKENVVEAVQGVVKFAKEFMDLIDA  1021

Query  3     A  1
             A
Sbjct  1022  A  1022



>ref|XP_011092225.1| PREDICTED: uncharacterized protein LOC105172480 [Sesamum indicum]
Length=1354

 Score =   232 bits (592),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG EAL L+LNDIMNL+ KK++VV+AVQGVVKFAKEF+ LIDA
Sbjct  968   DLKRALQCLLTMSNSRDIGQEALGLNLNDIMNLSSKKEDVVDAVQGVVKFAKEFLELIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>ref|XP_011019918.1| PREDICTED: uncharacterized protein LOC105122493 [Populus euphratica]
Length=1335

 Score =   230 bits (586),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FM+GMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  907   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMMGMGYATEALHLPGISKRLEFDLAMQSN  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG + + LDLNDI+N+T KK+N+VEAVQG+VKFA+EF++LIDA
Sbjct  967   DLKRALQCLLTMSNSRDIGQDGIGLDLNDILNITAKKENIVEAVQGIVKFAREFLDLIDA  1026

Query  3     A  1
             A
Sbjct  1027  A  1027



>ref|XP_002309040.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE92563.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1464

 Score =   230 bits (586),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FM+GMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  1039  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMMGMGYATEALHLPGISKRLEFDLAMQSN  1098

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG + + LDLNDI+N+T KK+N+VEAVQG+VKFA+EF++LIDA
Sbjct  1099  DLKRALQCLLTMSNSRDIGQDGIGLDLNDILNITAKKENIVEAVQGIVKFAREFLDLIDA  1158

Query  3     A  1
             A
Sbjct  1159  A  1159



>ref|XP_011087586.1| PREDICTED: uncharacterized protein LOC105169027 [Sesamum indicum]
Length=1382

 Score =   229 bits (584),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA QSN
Sbjct  907   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLATQSN  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG E+L L+LNDIMNL+ KK+NVV+AVQGV KFAKEF++LIDA
Sbjct  967   DLKRALQCLLTMSNSRDIGQESLGLNLNDIMNLSSKKENVVDAVQGVAKFAKEFLHLIDA  1026

Query  3     A  1
             A
Sbjct  1027  A  1027



>ref|XP_004230382.1| PREDICTED: uncharacterized protein LOC101246184 [Solanum lycopersicum]
Length=1400

 Score =   228 bits (582),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 105/117 (90%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QSN
Sbjct  905   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSN  964

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DLRRALQCLLTMSNSRDIG E + LDLND+MN+T+KK+NVVEAVQGVVKFAKEFM L
Sbjct  965   DLRRALQCLLTMSNSRDIGQETVGLDLNDLMNMTKKKENVVEAVQGVVKFAKEFMEL  1021



>ref|XP_010095595.1| Copia protein [Morus notabilis]
 gb|EXB61168.1| Copia protein [Morus notabilis]
Length=1303

 Score =   227 bits (579),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  892   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  951

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G +   L+LNDI+NLT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  952   DLKRALQCLLTMSNSRDLGQDNAGLELNDILNLTAKKENMVEAVQGIVKFAKEFLDLIDA  1011

Query  3     A  1
             A
Sbjct  1012  A  1012



>ref|XP_006358496.1| PREDICTED: uncharacterized protein LOC102597779 isoform X2 [Solanum 
tuberosum]
Length=1395

 Score =   227 bits (578),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QSN
Sbjct  905   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSN  964

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG E + LDLND+MN+T+KK+NVVEAVQGVVKFAKEFM L
Sbjct  965   DLKRALQCLLTMSNSRDIGQETVGLDLNDLMNMTKKKENVVEAVQGVVKFAKEFMEL  1021



>ref|XP_006358495.1| PREDICTED: uncharacterized protein LOC102597779 isoform X1 [Solanum 
tuberosum]
Length=1411

 Score =   227 bits (578),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QSN
Sbjct  905   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSN  964

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG E + LDLND+MN+T+KK+NVVEAVQGVVKFAKEFM L
Sbjct  965   DLKRALQCLLTMSNSRDIGQETVGLDLNDLMNMTKKKENVVEAVQGVVKFAKEFMEL  1021



>gb|KDO46912.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1081

 Score =   225 bits (574),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD+VSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCL+TMSNSRDIG +   LDLNDI+ LT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  968   DLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>ref|XP_009603523.1| PREDICTED: uncharacterized protein LOC104098481 [Nicotiana tomentosiformis]
Length=1387

 Score =   227 bits (578),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QSN
Sbjct  905   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSN  964

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLL MSNSRDIG E L LDLND+MN+T+KK+NVVEAVQGVVKFAKEFM+L
Sbjct  965   DLKRALQCLLIMSNSRDIGQETLGLDLNDLMNMTKKKENVVEAVQGVVKFAKEFMDL  1021



>gb|KDO46909.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1331

 Score =   226 bits (575),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD+VSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCL+TMSNSRDIG +   LDLNDI+ LT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  968   DLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>gb|KDO46910.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1339

 Score =   226 bits (575),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD+VSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCL+TMSNSRDIG +   LDLNDI+ LT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  968   DLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>gb|KDO46911.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1352

 Score =   226 bits (575),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD+VSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCL+TMSNSRDIG +   LDLNDI+ LT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  968   DLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>ref|XP_006478516.1| PREDICTED: uncharacterized protein LOC102607648 [Citrus sinensis]
Length=1352

 Score =   226 bits (575),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD+VSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCL+TMSNSRDIG +   LDLNDI+ LT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  968   DLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>ref|XP_006441965.1| hypothetical protein CICLE_v10018511mg [Citrus clementina]
 gb|ESR55205.1| hypothetical protein CICLE_v10018511mg [Citrus clementina]
Length=1390

 Score =   226 bits (575),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD+VSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  946   CRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  1005

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCL+TMSNSRDIG +   LDLNDI+ LT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  1006  DLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDA  1065

Query  3     A  1
             A
Sbjct  1066  A  1066



>ref|XP_009779221.1| PREDICTED: uncharacterized protein LOC104228457 [Nicotiana sylvestris]
Length=1379

 Score =   224 bits (572),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 103/117 (88%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QSN
Sbjct  905   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSN  964

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLL MSNSRDIG E L LDLND+M++T+KK+NVVEAVQGVVKFAKEFM+L
Sbjct  965   DLKRALQCLLIMSNSRDIGQETLGLDLNDLMSMTKKKENVVEAVQGVVKFAKEFMDL  1021



>ref|XP_010541522.1| PREDICTED: uncharacterized protein LOC104814960 [Tarenaya hassleriana]
 ref|XP_010541523.1| PREDICTED: uncharacterized protein LOC104814960 [Tarenaya hassleriana]
Length=1322

 Score =   224 bits (571),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  903   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  962

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG +   LDL+DI++LT KK++VVEAVQG+VKFAKEF++LIDA
Sbjct  963   DLKRALQCLLTMSNSRDIGQDGSGLDLSDILSLTTKKEDVVEAVQGIVKFAKEFLDLIDA  1022

Query  3     A  1
             A
Sbjct  1023  A  1023



>gb|KDP36340.1| hypothetical protein JCGZ_09760 [Jatropha curcas]
Length=1328

 Score =   224 bits (571),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA++AVKW+SRLGREHHDDLA FMLGMGYAMEALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDAITAVKWSSRLGREHHDDLAQFMLGMGYAMEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG +   L L+DI+N+T KK+N+VEAV+G+VKFAKEF++LIDA
Sbjct  968   DLKRALQCLLTMSNSRDIGQDGTGLGLSDILNITSKKENIVEAVEGIVKFAKEFLDLIDA  1027

Query  3     A  1
             A
Sbjct  1028  A  1028



>ref|XP_010495459.1| PREDICTED: uncharacterized protein LOC104772556 [Camelina sativa]
Length=523

 Score =   215 bits (548),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  65   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  124

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
            DL+RAL CLLTMSNS+DIG +   LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  125  DLKRALHCLLTMSNSKDIGQDGAGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  184

Query  6    AA  1
            AA
Sbjct  185  AA  186



>ref|XP_009150997.1| PREDICTED: uncharacterized protein LOC103874342 [Brassica rapa]
Length=1371

 Score =   223 bits (567),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 104/122 (85%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  899   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  958

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNSRDIG + L LDL+DI++LT EKK++VVEAV+G+VKFAKEF++LID
Sbjct  959   DLKRALHCLLTMSNSRDIGQDGLGLDLSDILSLTAEKKEDVVEAVEGIVKFAKEFLDLID  1018

Query  6     AA  1
             AA
Sbjct  1019  AA  1020



>gb|ABD32844.1| Peptidase S8 and S53, subtilisin, kexin, sedolisin; WD40-like 
[Medicago truncatula]
Length=936

 Score =   219 bits (558),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 7/128 (5%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  761  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  820

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNL-------TEKKKNVVEAVQGVVKFAKE  25
            DL+RAL CLLTMSNSRDIGH+   L LNDI+NL       T+KK++VVE VQG+VKFAKE
Sbjct  821  DLKRALHCLLTMSNSRDIGHDGTGLGLNDILNLTDKKQDVTDKKQDVVEGVQGIVKFAKE  880

Query  24   FMNLIDAA  1
            F++LIDAA
Sbjct  881  FLDLIDAA  888



>emb|CDP17760.1| unnamed protein product [Coffea canephora]
Length=1353

 Score =   221 bits (564),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  906   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSS  965

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRD+G E L LDLNDIMNL  KK+NVV+AV+G+VKFAKEF++L
Sbjct  966   DLKRALQCLLTMSNSRDLGQETLGLDLNDIMNLNAKKENVVDAVEGIVKFAKEFLDL  1022



>gb|KDP35792.1| hypothetical protein JCGZ_10428 [Jatropha curcas]
Length=737

 Score =   218 bits (554),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAV+AVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  317  CRCLAAYGDAVTAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  376

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
            DL+RALQ +LTMSNSRDIG +   L L+DI+N+T KK+N+VEAV+G+VKFAKEF++LIDA
Sbjct  377  DLKRALQSVLTMSNSRDIGQDGTGLGLSDILNITAKKENIVEAVEGIVKFAKEFLDLIDA  436

Query  3    A  1
            A
Sbjct  437  A  437



>emb|CDX87116.1| BnaC09g04310D [Brassica napus]
Length=1375

 Score =   221 bits (564),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 103/122 (84%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  898   CRCLAAYGDAISAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  957

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNSRDIG + L LDL+DI++LT EKK++VVEAV+G+VKFAKEF++LID
Sbjct  958   DLKRALHCLLTMSNSRDIGQDGLGLDLSDILSLTAEKKEDVVEAVEGIVKFAKEFLDLID  1017

Query  6     AA  1
             AA
Sbjct  1018  AA  1019



>ref|XP_009111642.1| PREDICTED: uncharacterized protein LOC103837068 [Brassica rapa]
Length=1403

 Score =   221 bits (564),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 103/122 (84%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  898   CRCLAAYGDAISAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  957

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNSRDIG + L LDL+DI++LT EKK++VVEAV+G+VKFAKEF++LID
Sbjct  958   DLKRALHCLLTMSNSRDIGQDGLGLDLSDILSLTAEKKEDVVEAVEGIVKFAKEFLDLID  1017

Query  6     AA  1
             AA
Sbjct  1018  AA  1019



>emb|CDX88129.1| BnaA06g27200D [Brassica napus]
Length=1730

 Score =   222 bits (566),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 104/122 (85%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  751  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  810

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
            DL+RAL CLLTMSNSRDIG + L LDL+DI++LT EKK++VVEAV+G+VKFAKEF++LID
Sbjct  811  DLKRALHCLLTMSNSRDIGQDGLGLDLSDILSLTAEKKEDVVEAVEGIVKFAKEFLDLID  870

Query  6    AA  1
            AA
Sbjct  871  AA  872



>ref|XP_006394724.1| hypothetical protein EUTSA_v10003520mg [Eutrema salsugineum]
 gb|ESQ32010.1| hypothetical protein EUTSA_v10003520mg [Eutrema salsugineum]
Length=1369

 Score =   221 bits (563),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 103/122 (84%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  899   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  958

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNSRDIG + + LDL+DI++LT EKK++VVEAV+G+VKFAKEF++LID
Sbjct  959   DLKRALHCLLTMSNSRDIGQDGVGLDLSDILSLTAEKKEDVVEAVEGIVKFAKEFLDLID  1018

Query  6     AA  1
             AA
Sbjct  1019  AA  1020



>ref|XP_004170301.1| PREDICTED: uncharacterized LOC101213309, partial [Cucumis sativus]
Length=844

 Score =   218 bits (556),  Expect = 7e-64, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQ N
Sbjct  676  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYAAEALHLPGISKRLEFDLAMQGN  735

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
            DL+RALQCLLTMSNSRD+G +   LDLNDI++LT KK+++VE  QG+VKFAKEF++LIDA
Sbjct  736  DLKRALQCLLTMSNSRDMGQDNAGLDLNDILSLTTKKEDMVETFQGIVKFAKEFLDLIDA  795

Query  3    A  1
            A
Sbjct  796  A  796



>ref|XP_009342400.1| PREDICTED: uncharacterized protein LOC103934376 [Pyrus x bretschneideri]
Length=1400

 Score =   221 bits (562),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  907   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSS  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG +  S DL DI+ +T KK+NV+EAVQG+VKF KEFM+LIDA
Sbjct  967   DLKRALQCLLTMSNSRDIGQQNTSFDLKDILTVTTKKENVLEAVQGIVKFVKEFMDLIDA  1026

Query  3     A  1
             A
Sbjct  1027  A  1027



>emb|CDY19826.1| BnaA09g04790D [Brassica napus]
Length=1239

 Score =   220 bits (560),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 103/122 (84%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  899   CRCLAAYGDAISAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  958

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNSRDIG + L LDL+DI++LT EKK++VVEAV+G+VKFAKEF++LID
Sbjct  959   DLKRALHCLLTMSNSRDIGQDGLGLDLSDILSLTAEKKEDVVEAVEGIVKFAKEFLDLID  1018

Query  6     AA  1
             AA
Sbjct  1019  AA  1020



>ref|XP_004494493.1| PREDICTED: uncharacterized protein LOC101494449 [Cicer arietinum]
Length=1329

 Score =   219 bits (559),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 6/127 (5%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  904   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  963

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVV------EAVQGVVKFAKEF  22
             DL+RAL CLLTMSNSRDIGH+   L LNDI+NLT+KK++VV      E VQG+VKFAKEF
Sbjct  964   DLKRALHCLLTMSNSRDIGHDGTGLGLNDILNLTDKKQDVVEGAQGIEGVQGIVKFAKEF  1023

Query  21    MNLIDAA  1
             ++LIDAA
Sbjct  1024  LDLIDAA  1030



>gb|EYU33240.1| hypothetical protein MIMGU_mgv1a000222mg [Erythranthe guttata]
Length=1413

 Score =   219 bits (559),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  941   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSS  1000

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQ LLTMSNSRDIG EAL LDLNDIMNL+ KK++VV+AVQGV KFAKEF++L
Sbjct  1001  DLKRALQSLLTMSNSRDIGQEALGLDLNDIMNLSSKKEDVVDAVQGVAKFAKEFLDL  1057



>ref|XP_008458090.1| PREDICTED: uncharacterized protein LOC103497626 [Cucumis melo]
Length=1342

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQ N
Sbjct  903   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYAAEALHLPGISKRLEFDLAMQGN  962

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G +   LDLNDI++LT KK+++VE  QG+VKFAKEF++LIDA
Sbjct  963   DLKRALQCLLTMSNSRDMGQDNAGLDLNDILSLTTKKEDMVETFQGIVKFAKEFLDLIDA  1022

Query  3     A  1
             A
Sbjct  1023  A  1023



>ref|XP_004149319.1| PREDICTED: uncharacterized protein LOC101213309 [Cucumis sativus]
 gb|KGN44669.1| hypothetical protein Csa_7G368210 [Cucumis sativus]
Length=1343

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQ N
Sbjct  903   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYAAEALHLPGISKRLEFDLAMQGN  962

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G +   LDLNDI++LT KK+++VE  QG+VKFAKEF++LIDA
Sbjct  963   DLKRALQCLLTMSNSRDMGQDNAGLDLNDILSLTTKKEDMVETFQGIVKFAKEFLDLIDA  1022

Query  3     A  1
             A
Sbjct  1023  A  1023



>gb|KHG23947.1| hypothetical protein F383_29619 [Gossypium arboreum]
Length=422

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWA RL REHHDDLA F+LGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  232  CRCLAAYGDAVSAVKWAIRLAREHHDDLAQFLLGMGYANEALHLPGISKRLEFDLAMKSN  291

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
            DL+RALQCLL MSNSRD+G +   LD NDI+NLT KK+N+VEAVQG+VKFAKEF++LIDA
Sbjct  292  DLKRALQCLLKMSNSRDMGQDNPGLDKNDILNLTAKKENLVEAVQGIVKFAKEFLDLIDA  351

Query  3    A  1
            A
Sbjct  352  A  352



>dbj|BAB09653.1| unnamed protein product [Arabidopsis thaliana]
Length=1003

 Score =   217 bits (553),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  527  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  586

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
            DL+RAL CLLTMSNS+DIG + + LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  587  DLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  646

Query  6    AA  1
            AA
Sbjct  647  AA  648



>gb|AES82322.2| transducin/WD40 repeat protein [Medicago truncatula]
Length=1329

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 7/128 (5%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  903   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  962

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNL-------TEKKKNVVEAVQGVVKFAKE  25
             DL+RAL CLLTMSNSRDIGH+   L LNDI+NL       T+KK++VVE VQG+VKFAKE
Sbjct  963   DLKRALHCLLTMSNSRDIGHDGTGLGLNDILNLTDKKQDVTDKKQDVVEGVQGIVKFAKE  1022

Query  24    FMNLIDAA  1
             F++LIDAA
Sbjct  1023  FLDLIDAA  1030



>ref|XP_009358942.1| PREDICTED: uncharacterized protein LOC103949552 [Pyrus x bretschneideri]
Length=1404

 Score =   219 bits (559),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  909   CRCLAAYGDAISAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSS  968

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G E  S DL DI+ +T KK+NV+EAVQG+VKF KEF++LIDA
Sbjct  969   DLKRALQCLLTMSNSRDVGQENTSFDLKDILTVTTKKENVLEAVQGIVKFVKEFLDLIDA  1028

Query  3     A  1
             A
Sbjct  1029  A  1029



>ref|XP_009359004.1| PREDICTED: uncharacterized protein LOC103949623 [Pyrus x bretschneideri]
Length=795

 Score =   216 bits (550),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDA+SAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  328  CRCLAAYGDAISAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSS  387

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLID  7
            DL+RALQCLLTMSNSRD+G E  S DL DI+ +T KK+NV+EAVQG+VKF KEF++LID
Sbjct  388  DLKRALQCLLTMSNSRDVGQENTSFDLKDILTVTTKKENVLEAVQGIVKFVKEFLDLID  446



>ref|XP_008382760.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103445517 
[Malus domestica]
Length=1934

 Score =   220 bits (560),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  1455  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSS  1514

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG E  S DL DI+ +T KK+N++EAVQG+VKF KEFM+LIDA
Sbjct  1515  DLKRALQCLLTMSNSRDIGXENTSFDLKDILTVTTKKENMLEAVQGIVKFVKEFMDLIDA  1574

Query  3     A  1
             A
Sbjct  1575  A  1575



>ref|XP_003626104.1| hypothetical protein MTR_7g111080 [Medicago truncatula]
Length=1516

 Score =   219 bits (558),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 7/128 (5%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  1090  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  1149

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNL-------TEKKKNVVEAVQGVVKFAKE  25
             DL+RAL CLLTMSNSRDIGH+   L LNDI+NL       T+KK++VVE VQG+VKFAKE
Sbjct  1150  DLKRALHCLLTMSNSRDIGHDGTGLGLNDILNLTDKKQDVTDKKQDVVEGVQGIVKFAKE  1209

Query  24    FMNLIDAA  1
             F++LIDAA
Sbjct  1210  FLDLIDAA  1217



>ref|XP_002521175.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41206.1| conserved hypothetical protein [Ricinus communis]
Length=1330

 Score =   219 bits (557),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 101/117 (86%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  905   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  964

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG +   L L DI+NLT KK+N+VEAVQGVVKFAKEF+ L
Sbjct  965   DLKRALQCLLTMSNSRDIGQDGTGLGLTDILNLTAKKENIVEAVQGVVKFAKEFLEL  1021



>ref|XP_007014608.1| Transducin/WD40 repeat-like superfamily protein isoform 4, partial 
[Theobroma cacao]
 gb|EOY32227.1| Transducin/WD40 repeat-like superfamily protein isoform 4, partial 
[Theobroma cacao]
Length=1050

 Score =   217 bits (552),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  686  CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  745

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
            DL+RALQCLLTMSNSRDIG +   LDLNDI+NLT KK+N+VEAVQG+VKFA EF+ L
Sbjct  746  DLKRALQCLLTMSNSRDIGQDNPGLDLNDILNLTAKKENLVEAVQGIVKFANEFLEL  802



>gb|EPS66148.1| hypothetical protein M569_08629, partial [Genlisea aurea]
Length=1199

 Score =   217 bits (552),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA+QS 
Sbjct  911   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLALQSK  970

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G EAL L+L++I+NL+ K  N+VEAVQG+VKFA EF+ LIDA
Sbjct  971   DLKRALQCLLTMSNSRDLGQEALGLNLSNILNLSSKDANIVEAVQGIVKFAAEFLELIDA  1030

Query  3     A  1
             A
Sbjct  1031  A  1031



>ref|XP_010913344.1| PREDICTED: uncharacterized protein LOC105039060 [Elaeis guineensis]
Length=1300

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  903   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  962

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RALQCLLTMSNSRDIG E  S D+ +I+NLT  K++N+V+AVQG+ KFAKEFM+LID
Sbjct  963   DLKRALQCLLTMSNSRDIGQETASTDVAEILNLTAAKQENLVDAVQGISKFAKEFMDLID  1022

Query  6     AA  1
             AA
Sbjct  1023  AA  1024



>ref|XP_006286796.1| hypothetical protein CARUB_v10003471mg [Capsella rubella]
 gb|EOA19694.1| hypothetical protein CARUB_v10003471mg [Capsella rubella]
Length=1371

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG + + LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>ref|XP_002874217.1| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50476.1| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. 
lyrata]
Length=1376

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG + + LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>ref|NP_197859.4| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AED93351.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=1377

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG + + LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>dbj|BAF01929.1| hypothetical protein [Arabidopsis thaliana]
Length=1377

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG + + LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>ref|XP_007014605.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY32224.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=1259

 Score =   217 bits (552),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  904   CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  963

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG +   LDLNDI+NLT KK+N+VEAVQG+VKFA EF+ L
Sbjct  964   DLKRALQCLLTMSNSRDIGQDNPGLDLNDILNLTAKKENLVEAVQGIVKFANEFLEL  1020



>ref|XP_010421308.1| PREDICTED: uncharacterized protein LOC104706783 isoform X1 [Camelina 
sativa]
Length=1213

 Score =   216 bits (551),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  750  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  809

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
            DL+RAL CLLTMSNS+DIG +   LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  810  DLKRALHCLLTMSNSKDIGQDGAGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  869

Query  6    AA  1
            AA
Sbjct  870  AA  871



>gb|KHG10913.1| tRNA modification GTPase MnmE [Gossypium arboreum]
Length=607

 Score =   211 bits (538),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 112/138 (81%), Gaps = 17/138 (12%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISK-----------  217
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISK           
Sbjct  145  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKSIEWSLTILCQ  204

Query  216  ------RLEFDLAMQSNDLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEA  55
                  RLEFDLAM+SNDL+RALQCLLTMSNSRD+G +   L LNDI+NLT KK+N+VEA
Sbjct  205  VGTAGSRLEFDLAMKSNDLKRALQCLLTMSNSRDVGQDNPGLGLNDILNLTAKKENLVEA  264

Query  54   VQGVVKFAKEFMNLIDAA  1
            VQG VKFAKEF++LIDAA
Sbjct  265  VQGTVKFAKEFLDLIDAA  282



>ref|XP_007014607.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY32226.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
Length=1351

 Score =   217 bits (552),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  904   CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  963

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG +   LDLNDI+NLT KK+N+VEAVQG+VKFA EF+ L
Sbjct  964   DLKRALQCLLTMSNSRDIGQDNPGLDLNDILNLTAKKENLVEAVQGIVKFANEFLEL  1020



>ref|XP_007014606.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY32225.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=1351

 Score =   217 bits (552),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  904   CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  963

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG +   LDLNDI+NLT KK+N+VEAVQG+VKFA EF+ L
Sbjct  964   DLKRALQCLLTMSNSRDIGQDNPGLDLNDILNLTAKKENLVEAVQGIVKFANEFLEL  1020



>gb|KCW84525.1| hypothetical protein EUGRSUZ_B013612, partial [Eucalyptus grandis]
Length=1302

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRC AAYGDAVSAVKWASRL REHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  834  CRCFAAYGDAVSAVKWASRLAREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSS  893

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
            DL+RALQCLLTMSNSR++G +++  DL DI+ +T KK+N+VEAVQGVVKFAKEF++LIDA
Sbjct  894  DLKRALQCLLTMSNSRELGQDSVGFDLKDILTVTTKKENLVEAVQGVVKFAKEFLDLIDA  953

Query  3    A  1
            A
Sbjct  954  A  954



>ref|XP_008235875.1| PREDICTED: uncharacterized protein LOC103334677 [Prunus mume]
Length=1384

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  902   CRCLAAYGDAISAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSN  961

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G E    DL DI+ +T  K+N++EAVQG+VKF KEF++LIDA
Sbjct  962   DLKRALQCLLTMSNSRDLGQENTGFDLKDILTVTTAKENILEAVQGIVKFVKEFLDLIDA  1021

Query  3     A  1
             A
Sbjct  1022  A  1022



>ref|XP_007200336.1| hypothetical protein PRUPE_ppa000254mg [Prunus persica]
 gb|EMJ01535.1| hypothetical protein PRUPE_ppa000254mg [Prunus persica]
Length=1384

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  902   CRCLAAYGDAISAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSN  961

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G E    DL DI+ +T  K+N++EAVQG+VKF KEF++LIDA
Sbjct  962   DLKRALQCLLTMSNSRDLGQENTGFDLKDILTVTTAKENILEAVQGIVKFVKEFLDLIDA  1021

Query  3     A  1
             A
Sbjct  1022  A  1022



>ref|XP_010421309.1| PREDICTED: uncharacterized protein LOC104706783 isoform X2 [Camelina 
sativa]
Length=1364

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG +   LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGAGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>ref|XP_010454796.1| PREDICTED: uncharacterized protein LOC104736495 [Camelina sativa]
Length=1375

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG +   LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGAGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>ref|XP_010038005.1| PREDICTED: uncharacterized protein LOC104426595 [Eucalyptus grandis]
Length=1375

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRC AAYGDAVSAVKWASRL REHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  907   CRCFAAYGDAVSAVKWASRLAREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSS  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSR++G +++  DL DI+ +T KK+N+VEAVQGVVKFAKEF++LIDA
Sbjct  967   DLKRALQCLLTMSNSRELGQDSVGFDLKDILTVTTKKENLVEAVQGVVKFAKEFLDLIDA  1026

Query  3     A  1
             A
Sbjct  1027  A  1027



>ref|XP_010673184.1| PREDICTED: uncharacterized protein LOC104889623 [Beta vulgaris 
subsp. vulgaris]
Length=1406

 Score =   216 bits (550),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQ N
Sbjct  897   CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYAAEALHLPGISKRLEFDLAMQGN  956

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRDIG E   LDL +++N+  KK+N+V+AVQG+ KFAK+F++LIDA
Sbjct  957   DLKRALQCLLTMSNSRDIGKETSGLDLTNLLNVAAKKENIVDAVQGITKFAKQFLDLIDA  1016

Query  3     A  1
             A
Sbjct  1017  A  1017



>ref|XP_004290117.1| PREDICTED: uncharacterized protein LOC101292072 [Fragaria vesca 
subsp. vesca]
Length=1408

 Score =   216 bits (549),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQS+
Sbjct  899   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSS  958

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSRD+G +    DL DI+ +T KK+N++EAVQG+VKF KEF++LIDA
Sbjct  959   DLKRALQCLLTMSNSRDLGQDNSGFDLKDILTITTKKENILEAVQGIVKFTKEFLDLIDA  1018

Query  3     A  1
             A
Sbjct  1019  A  1019



>ref|XP_002263744.1| PREDICTED: uncharacterized protein LOC100248418 [Vitis vinifera]
Length=1296

 Score =   215 bits (548),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRL REHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  907   CRCLAAYGDAVSAVKWASRLAREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG E   L LNDI++LT KK+N+++AVQG+VKFAKEF++L
Sbjct  967   DLKRALQCLLTMSNSRDIGQENTGLSLNDILSLTTKKENILDAVQGIVKFAKEFLDL  1023



>emb|CBI31125.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score =   215 bits (548),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRL REHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  907   CRCLAAYGDAVSAVKWASRLAREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG E   L LNDI++LT KK+N+++AVQG+VKFAKEF++L
Sbjct  967   DLKRALQCLLTMSNSRDIGQENTGLSLNDILSLTTKKENILDAVQGIVKFAKEFLDL  1023



>dbj|BAF02178.1| hypothetical protein [Arabidopsis thaliana]
Length=1161

 Score =   214 bits (546),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RAL CLLTMSNS+DIG + + LDL+DI++LT  KK++VVEAV+G+VKFAKEF++LID
Sbjct  961   DLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAKEFLDLID  1020

Query  6     AA  1
             AA
Sbjct  1021  AA  1022



>ref|XP_008791408.1| PREDICTED: uncharacterized protein LOC103708316 isoform X3 [Phoenix 
dactylifera]
Length=1091

 Score =   213 bits (541),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDA+SAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  709  CRCLAAYGDAISAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  768

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
            +LRRALQCLLTMSNSRDIG E    D+ +I++LT  K++N+V+AVQG+ KFAKEFM+LID
Sbjct  769  NLRRALQCLLTMSNSRDIGQETAGTDVAEILSLTAAKQENLVDAVQGISKFAKEFMDLID  828

Query  6    AA  1
            AA
Sbjct  829  AA  830



>ref|XP_008791407.1| PREDICTED: uncharacterized protein LOC103708316 isoform X2 [Phoenix 
dactylifera]
Length=1137

 Score =   213 bits (541),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDA+SAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  755  CRCLAAYGDAISAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  814

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
            +LRRALQCLLTMSNSRDIG E    D+ +I++LT  K++N+V+AVQG+ KFAKEFM+LID
Sbjct  815  NLRRALQCLLTMSNSRDIGQETAGTDVAEILSLTAAKQENLVDAVQGISKFAKEFMDLID  874

Query  6    AA  1
            AA
Sbjct  875  AA  876



>gb|KHN14190.1| hypothetical protein glysoja_028588 [Glycine soja]
Length=1306

 Score =   213 bits (542),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 102/130 (78%), Positives = 112/130 (86%), Gaps = 9/130 (7%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA++SN
Sbjct  863  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAIKSN  922

Query  183  DLRRALQCLLTMSNSRDIGHEALS-LDLNDIMNLTEKKKN--------VVEAVQGVVKFA  31
            DLRRAL CLLTMSNSRDIGH+    L LNDI+NL++KK N        +VE VQG+VKFA
Sbjct  923  DLRRALHCLLTMSNSRDIGHDGTQGLGLNDILNLSDKKPNKVSDKKQDIVEGVQGIVKFA  982

Query  30   KEFMNLIDAA  1
            KEF++LIDAA
Sbjct  983  KEFLDLIDAA  992



>ref|XP_003521631.1| PREDICTED: uncharacterized protein LOC100777567 [Glycine max]
Length=1352

 Score =   213 bits (542),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 102/130 (78%), Positives = 112/130 (86%), Gaps = 9/130 (7%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLA++SN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAIKSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALS-LDLNDIMNLTEKKKN--------VVEAVQGVVKFA  31
             DLRRAL CLLTMSNSRDIGH+    L LNDI+NL++KK N        +VE VQG+VKFA
Sbjct  961   DLRRALHCLLTMSNSRDIGHDGTQGLGLNDILNLSDKKPNKVSDKKQDIVEGVQGIVKFA  1020

Query  30    KEFMNLIDAA  1
             KEF++LIDAA
Sbjct  1021  KEFLDLIDAA  1030



>ref|XP_008791406.1| PREDICTED: uncharacterized protein LOC103708316 isoform X1 [Phoenix 
dactylifera]
Length=1288

 Score =   213 bits (541),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDA+SAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  906   CRCLAAYGDAISAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  965

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             +LRRALQCLLTMSNSRDIG E    D+ +I++LT  K++N+V+AVQG+ KFAKEFM+LID
Sbjct  966   NLRRALQCLLTMSNSRDIGQETAGTDVAEILSLTAAKQENLVDAVQGISKFAKEFMDLID  1025

Query  6     AA  1
             AA
Sbjct  1026  AA  1027



>ref|XP_010241186.1| PREDICTED: uncharacterized protein LOC104585868 [Nelumbo nucifera]
Length=1306

 Score =   212 bits (539),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 95/117 (81%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  908   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  967

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQCLLTMSNSRDIG E   LD+ +I++LT K++N+V++VQG+VKFAK+F++L
Sbjct  968   DLKRALQCLLTMSNSRDIGQETTGLDVTNILSLTAKQENLVDSVQGIVKFAKQFLDL  1024



>ref|XP_008798429.1| PREDICTED: uncharacterized protein LOC103713325 [Phoenix dactylifera]
Length=1300

 Score =   211 bits (538),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 99/122 (81%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAA+GDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  903   CRCLAAHGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  962

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT-EKKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RALQCLLTMSNSRDIG E    D+ +I++LT  K++N+V+ VQG+ KFAKEFMNLID
Sbjct  963   DLKRALQCLLTMSNSRDIGQETAGTDVAEILSLTAAKQENLVDTVQGISKFAKEFMNLID  1022

Query  6     AA  1
             AA
Sbjct  1023  AA  1024



>gb|KHN43390.1| hypothetical protein glysoja_001973 [Glycine soja]
Length=1300

 Score =   210 bits (535),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 9/130 (7%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  865  CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  924

Query  183  DLRRALQCLLTMSNSRDIGHEALS-LDLNDIMNL--------TEKKKNVVEAVQGVVKFA  31
            DL+RAL CLLTMSNSRDIGH+    L LNDI++L        ++KK+++VE VQG+VKFA
Sbjct  925  DLKRALHCLLTMSNSRDIGHDGTQGLGLNDILSLSDKKPDKVSDKKQDIVEGVQGIVKFA  984

Query  30   KEFMNLIDAA  1
            KEF++LIDAA
Sbjct  985  KEFLDLIDAA  994



>ref|XP_009405577.1| PREDICTED: uncharacterized protein LOC103988692 [Musa acuminata 
subsp. malaccensis]
Length=1282

 Score =   210 bits (534),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RL REHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  907   CRCLAAYGDAVSAVKWATRLSREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTE-KKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RALQCLLTMSNSRD+G E  + D+ +I++LT  K++N+V+AVQG+ KFAKEF++LID
Sbjct  967   DLKRALQCLLTMSNSRDVGQETTAADITEILSLTAVKQENLVDAVQGIAKFAKEFLDLID  1026

Query  6     AA  1
             AA
Sbjct  1027  AA  1028



>ref|XP_009420899.1| PREDICTED: uncharacterized protein LOC104000536 [Musa acuminata 
subsp. malaccensis]
Length=1394

 Score =   208 bits (530),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 95/122 (78%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RL REHHDDLA FMLGMGYA EALHLPGISKRLEF+LAMQSN
Sbjct  937   CRCLAAYGDAVSAVKWATRLSREHHDDLAQFMLGMGYATEALHLPGISKRLEFELAMQSN  996

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTE-KKKNVVEAVQGVVKFAKEFMNLID  7
             DL+RALQCLLTMSNSRD+G E  + D+ +I++LT  K++N+V+AVQG+ KFAKEF++LID
Sbjct  997   DLKRALQCLLTMSNSRDVGQETTAADITEILSLTAVKQENLVDAVQGIAKFAKEFLDLID  1056

Query  6     AA  1
             AA
Sbjct  1057  AA  1058



>ref|XP_007163270.1| hypothetical protein PHAVU_001G220300g [Phaseolus vulgaris]
 gb|ESW35264.1| hypothetical protein PHAVU_001G220300g [Phaseolus vulgaris]
Length=1342

 Score =   208 bits (529),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 9/130 (7%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAM+SN
Sbjct  901   CRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMKSN  960

Query  183   DLRRALQCLLTMSNSRDIGH-EALSLDLNDIMNL--------TEKKKNVVEAVQGVVKFA  31
             DL+RAL CLLTMSNSRDIG  +   L LNDI+NL        ++KK+++VE VQG+VKFA
Sbjct  961   DLKRALHCLLTMSNSRDIGQDDTPGLGLNDILNLSDKKQEKISDKKQDMVEGVQGIVKFA  1020

Query  30    KEFMNLIDAA  1
             KEF++LIDAA
Sbjct  1021  KEFLDLIDAA  1030



>ref|XP_006849192.1| hypothetical protein AMTR_s00027p00213280 [Amborella trichopoda]
 gb|ERN10773.1| hypothetical protein AMTR_s00027p00213280 [Amborella trichopoda]
Length=1275

 Score =   206 bits (524),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 94/121 (78%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWASRL REHHDDLA F+LGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  904   CRCLAAYGDAVSAVKWASRLAREHHDDLAQFLLGMGYATEALHLPGISKRLEFDLAMQSN  963

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
             DL+RALQCLLTMSNSR IG E +  ++ +I+NL  K +N+V+ VQG+ KFAKEF++LIDA
Sbjct  964   DLKRALQCLLTMSNSRHIGQENVGREVTEILNLAAKAENLVDTVQGIEKFAKEFLDLIDA  1023

Query  3     A  1
             A
Sbjct  1024  A  1024



>gb|EEE55099.1| hypothetical protein OsJ_02855 [Oryza sativa Japonica Group]
Length=1377

 Score =   201 bits (512),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
             DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  961   DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQGIVKFVKEFFD  1020

Query  15    LIDAA  1
             LIDAA
Sbjct  1021  LIDAA  1025



>ref|NP_001043744.1| Os01g0653800 [Oryza sativa Japonica Group]
 dbj|BAD68693.1| WD-40 repeat family protein-like [Oryza sativa Japonica Group]
 dbj|BAF05658.1| Os01g0653800 [Oryza sativa Japonica Group]
 gb|EEC71196.1| hypothetical protein OsI_03104 [Oryza sativa Indica Group]
Length=1377

 Score =   201 bits (512),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  901   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  960

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
             DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  961   DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQGIVKFVKEFFD  1020

Query  15    LIDAA  1
             LIDAA
Sbjct  1021  LIDAA  1025



>ref|XP_006658273.1| PREDICTED: uncharacterized protein LOC102709386 [Oryza brachyantha]
Length=1384

 Score =   201 bits (512),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  907   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  966

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
             DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  967   DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESMADAVQGIVKFVKEFFD  1026

Query  15    LIDAA  1
             LIDAA
Sbjct  1027  LIDAA  1031



>dbj|BAJ99483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1042

 Score =   199 bits (505),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS 
Sbjct  572  CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSK  631

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
            DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  632  DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQGIVKFVKEFFD  691

Query  15   LIDAA  1
            LIDAA
Sbjct  692  LIDAA  696



>emb|CDM83562.1| unnamed protein product [Triticum aestivum]
Length=1360

 Score =   199 bits (505),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS 
Sbjct  898   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSK  957

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
             DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  958   DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQGIVKFVKEFFD  1017

Query  15    LIDAA  1
             LIDAA
Sbjct  1018  LIDAA  1022



>dbj|BAJ95941.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1368

 Score =   199 bits (505),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS 
Sbjct  898   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSK  957

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
             DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  958   DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQGIVKFVKEFFD  1017

Query  15    LIDAA  1
             LIDAA
Sbjct  1018  LIDAA  1022



>ref|XP_010232091.1| PREDICTED: uncharacterized protein LOC100836556 [Brachypodium 
distachyon]
Length=1381

 Score =   199 bits (505),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQS 
Sbjct  898   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSK  957

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQGVVKFAKEFMN  16
             DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQG+VKF KEF +
Sbjct  958   DLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQGIVKFVKEFFD  1017

Query  15    LIDAA  1
             LIDAA
Sbjct  1018  LIDAA  1022



>ref|XP_004969341.1| PREDICTED: uncharacterized protein LOC101769092 [Setaria italica]
Length=1380

 Score =   198 bits (504),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 7/128 (5%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  900   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  959

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLND---IMNLT----EKKKNVVEAVQGVVKFAKE  25
             DL+RAL CLLTMSNSRD+G E  + D+ D   I+NL      K++++ +AVQG+VKF KE
Sbjct  960   DLKRALACLLTMSNSRDVGQETAAADVTDVTQILNLAVAKQAKQESLADAVQGIVKFVKE  1019

Query  24    FMNLIDAA  1
             F +LIDAA
Sbjct  1020  FFDLIDAA  1027



>ref|XP_008657818.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103637390 
[Zea mays]
Length=1317

 Score =   197 bits (501),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 94/128 (73%), Positives = 106/128 (83%), Gaps = 7/128 (5%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  844  CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  903

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLND---IMNLT----EKKKNVVEAVQGVVKFAKE  25
            DL+RAL CLLTMSNSRD+G E  + D  D   I+NL      K++++ +AVQG+VKF KE
Sbjct  904  DLKRALACLLTMSNSRDVGQETAAADATDVTQILNLAVAKQAKQESLADAVQGIVKFVKE  963

Query  24   FMNLIDAA  1
            F +LIDAA
Sbjct  964  FFDLIDAA  971



>ref|XP_008673286.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=1229

 Score =   196 bits (499),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  750  CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  809

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTE-------KKKNVVEAVQGVVKFAKE  25
            DL+RAL CLLTMSNSRD+G E  + D  D+  +         K++++ +AVQG+VKF KE
Sbjct  810  DLKRALACLLTMSNSRDVGQETAAADATDVTQILSLAVAKQAKQESLTDAVQGIVKFVKE  869

Query  24   FMNLIDAA  1
            F +LIDAA
Sbjct  870  FFDLIDAA  877



>ref|XP_008673285.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=1379

 Score =   196 bits (499),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGD VSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKRLEFDLAMQSN
Sbjct  900   CRCLAAYGDPVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSN  959

Query  183   DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTE-------KKKNVVEAVQGVVKFAKE  25
             DL+RAL CLLTMSNSRD+G E  + D  D+  +         K++++ +AVQG+VKF KE
Sbjct  960   DLKRALACLLTMSNSRDVGQETAAADATDVTQILSLAVAKQAKQESLTDAVQGIVKFVKE  1019

Query  24    FMNLIDAA  1
             F +LIDAA
Sbjct  1020  FFDLIDAA  1027



>ref|XP_002969859.1| hypothetical protein SELMODRAFT_92496 [Selaginella moellendorffii]
 gb|EFJ28983.1| hypothetical protein SELMODRAFT_92496 [Selaginella moellendorffii]
Length=1180

 Score =   180 bits (456),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 5/121 (4%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAA+GDAVSAVKWA RLGREHHDDLA FMLGMGYA EALHLPGISKRLE++LAMQS 
Sbjct  875  CRCLAAHGDAVSAVKWAFRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEYELAMQSG  934

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
            DL+RALQCL+T+SNS+ +G EA ++ L     LT K+K   +A+QG+VKF+KEF+ L+DA
Sbjct  935  DLKRALQCLVTLSNSKTLGQEADAVSL----ALTTKEK-TSDALQGIVKFSKEFLELVDA  989

Query  3    A  1
            A
Sbjct  990  A  990



>ref|XP_002985192.1| hypothetical protein SELMODRAFT_157186 [Selaginella moellendorffii]
 gb|EFJ13686.1| hypothetical protein SELMODRAFT_157186 [Selaginella moellendorffii]
Length=1180

 Score =   179 bits (455),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 5/121 (4%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
            CRCLAA+GDAVSAVKWA RLGREHHDDLA FMLGMGYA EALHLPGISKRLE++LAMQS 
Sbjct  875  CRCLAAHGDAVSAVKWAFRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEYELAMQSG  934

Query  183  DLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDA  4
            DL+RALQCL+T+SNS+ +G EA ++ L     LT K+K   +A+QG+VKF+KEF+ L+DA
Sbjct  935  DLKRALQCLVTLSNSKTLGQEADAVSL----ALTTKEK-TSDALQGIVKFSKEFLELVDA  989

Query  3    A  1
            A
Sbjct  990  A  990



>ref|XP_001757483.1| predicted protein [Physcomitrella patens]
 gb|EDQ77540.1| predicted protein [Physcomitrella patens]
Length=1168

 Score =   174 bits (441),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKRLEFDLAMQSN  184
             CRCLAAYGDAVSAVKWA+RLGREHHDDLA+FM+GMGYA EALHLPGISKRLEFDLAMQS 
Sbjct  896   CRCLAAYGDAVSAVKWAARLGREHHDDLAYFMVGMGYAKEALHLPGISKRLEFDLAMQSG  955

Query  183   DLRRALQCLLTMSNSRDIGHEA-LSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNL  13
             DL+RALQ L+ +S+SR IG +  LS +   +++LT  ++   EAV GVVKFA+EF++L
Sbjct  956   DLKRALQTLIILSSSRSIGQDIDLSTEGIGVLSLTATQEAKAEAVFGVVKFAREFLDL  1013



>ref|XP_006849182.1| hypothetical protein AMTR_s00027p00200330 [Amborella trichopoda]
 gb|ERN10763.1| hypothetical protein AMTR_s00027p00200330 [Amborella trichopoda]
Length=255

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 8/106 (8%)
 Frame = -2

Query  312  SRLGREHHDDLAHF--MLGMGYAMEALHLPGISKRLEFDLAMQSNDLRRALQCLLTMSNS  139
            SRL REHHDDLA F   L +   +E L      +RLEFDLAM+SNDL+RALQCLLTMSNS
Sbjct  49   SRLAREHHDDLAQFDTQLKLFTCLEYL------RRLEFDLAMKSNDLKRALQCLLTMSNS  102

Query  138  RDIGHEALSLDLNDIMNLTEKKKNVVEAVQGVVKFAKEFMNLIDAA  1
            RDIG E +  ++ +I++L  K +N+V  VQG+ KFAKEF++LIDAA
Sbjct  103  RDIGQENVGREVTEILSLAAKPENLVYTVQGIEKFAKEFLDLIDAA  148



>ref|XP_007014609.1| Transducin/WD40 repeat-like superfamily protein isoform 5 [Theobroma 
cacao]
 gb|EOY32228.1| Transducin/WD40 repeat-like superfamily protein isoform 5 [Theobroma 
cacao]
Length=969

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKR  214
            CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKR
Sbjct  904  CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKR  953



>ref|XP_007014610.1| Transducin/WD40 repeat-like superfamily protein isoform 6 [Theobroma 
cacao]
 gb|EOY32229.1| Transducin/WD40 repeat-like superfamily protein isoform 6 [Theobroma 
cacao]
Length=973

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  363  CRCLAAYGDAVSAVKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISKR  214
            CRCLAAYGDAVSAVKWA+RLGREHHDDLA FMLGMGYA EALHLPGISKR
Sbjct  904  CRCLAAYGDAVSAVKWATRLGREHHDDLAQFMLGMGYATEALHLPGISKR  953



>gb|EMT09929.1| hypothetical protein F775_29330 [Aegilops tauschii]
Length=1253

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 4/76 (5%)
 Frame = -2

Query  216  RLEFDLAMQSNDLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQ  49
            RLEFDLAMQS DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQ
Sbjct  799  RLEFDLAMQSKDLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQ  858

Query  48   GVVKFAKEFMNLIDAA  1
            G+VKF KEF +LIDAA
Sbjct  859  GIVKFVKEFFDLIDAA  874



>gb|EMS55149.1| hypothetical protein TRIUR3_19246 [Triticum urartu]
Length=1352

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 4/76 (5%)
 Frame = -2

Query  216  RLEFDLAMQSNDLRRALQCLLTMSNSRDIGHEALSLDLNDIMNLT----EKKKNVVEAVQ  49
            RLEFDLAMQS DL+RAL CLLTMSNSRD+G E  + D+  I+NL      K++++ +AVQ
Sbjct  876  RLEFDLAMQSKDLKRALACLLTMSNSRDVGQETTATDVTQILNLAVAKQAKQESLADAVQ  935

Query  48   GVVKFAKEFMNLIDAA  1
            G+VKF KEF +LIDAA
Sbjct  936  GIVKFVKEFFDLIDAA  951



>gb|EEC71194.1| hypothetical protein OsI_03100 [Oryza sativa Indica Group]
Length=655

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  324  VKWASRLGREHHDDLAHFMLGMGYAMEALHLPGISK  217
            V  A+RL REHHDDLA FMLGMGYA EALHLPGISK
Sbjct  162  VDRATRLDREHHDDLAQFMLGMGYATEALHLPGISK  197



>ref|XP_002458242.1| hypothetical protein SORBIDRAFT_03g029780 [Sorghum bicolor]
 gb|EES03362.1| hypothetical protein SORBIDRAFT_03g029780 [Sorghum bicolor]
Length=1048

 Score = 45.8 bits (107),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = -3

Query  305   LAGSIMMTWHTLCLGWVMQWRHFTCLEYLNG*SLIWPCRVM  183
             LA SI MTW +LC  W M  + F CLEYL   SL   CR M
Sbjct  1007  LAESITMTWLSLCWVWAMPLKLFICLEYLRDWSLTLQCRAM  1047


 Score = 45.1 bits (105),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  363   CRCLAAYGDAVSAVKWASRLG  301
             CRCLAAYGD VSAVKWA+RL 
Sbjct  988   CRCLAAYGDPVSAVKWATRLA  1008



>ref|NP_001183062.1| uncharacterized protein LOC100501410 [Zea mays]
 gb|ACR35604.1| unknown [Zea mays]
Length=93

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  128  PISLLLLIVKRHCSALLKSLLCMARSNSNRLDIPG  232
            P S LLLIV R  SAL +SLLC+ARSNS+ LDIPG
Sbjct  58   PTSRLLLIVNRQASALFRSLLCIARSNSSLLDIPG  92



>ref|XP_002987801.1| hypothetical protein SELMODRAFT_426615 [Selaginella moellendorffii]
 gb|EFJ11104.1| hypothetical protein SELMODRAFT_426615 [Selaginella moellendorffii]
Length=253

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 1/25 (4%)
 Frame = -2

Query  360  RCLAAYGDAVSAVKWASRLGREHHD  286
            RCLAA+GD VSAVKWA RLGREHHD
Sbjct  222  RCLAAHGD-VSAVKWAFRLGREHHD  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516420797772