BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29858_g1_i1 len=798 path=[1:0-797]

Length=798
                                                                      Score     E

emb|CAA67118.1|  ACC synthase                                           197   1e-55   Nicotiana tabacum [American tobacco]
ref|XP_009626021.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    196   2e-55   
gb|AAR99391.1|  ACC synthase ACS2                                       196   3e-55   Nicotiana attenuata
ref|XP_009757887.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    195   6e-55   
emb|CAA06288.1|  1-cyclopropane-1-carboxylate synthase                  193   3e-54   Nicotiana tabacum [American tobacco]
ref|XP_009590054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    193   3e-54   
gb|AAC83147.1|  1-aminocyclopropane-1-carboxylate synthase              192   5e-54   Nicotiana glutinosa
ref|XP_004253425.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   9e-54   
ref|XP_009626433.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    191   4e-53   
ref|XP_009791163.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   1e-52   
ref|XP_009776307.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   1e-52   
ref|XP_004253426.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    184   1e-52   
gb|AAR99392.1|  ACC synthase ACS3a                                      189   2e-52   Nicotiana attenuata
ref|XP_011073274.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   2e-52   
gb|ABW97851.1|  ACS5                                                    187   3e-52   Nicotiana tabacum [American tobacco]
ref|XP_009590053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    186   1e-51   
dbj|BAG30909.1|  ACC synthase                                           186   1e-51   Capsicum chinense [bonnet pepper]
dbj|BAB89350.1|  1-aminocyclopropane-1-carboxylate synthase             186   1e-51   Diospyros kaki [Japanese persimmon]
gb|AAF97615.1|U18057_1  1-amino-cyclopropane-1-carboxylate synthase     186   3e-51   Solanum lycopersicum
ref|NP_001266271.1|  1-aminocyclopropane-1-carboxylate synthase-like    185   3e-51   
gb|AAR99393.1|  ACC synthase ACS3b                                      185   3e-51   Nicotiana attenuata
ref|XP_009771943.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    184   9e-51   
ref|XP_006343931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    183   2e-50   
gb|ABM88785.1|  1-aminocyclopropane-1-carboxylate synthase              182   3e-50   Camellia sinensis [black tea]
gb|AAF97614.1|U18056_1  1-amino-cyclopropane-1-carboxylate synthase     182   4e-50   Solanum lycopersicum
ref|NP_001233922.1|  1-aminocyclopropane-1-carboxylate synthase         182   4e-50   
emb|CDP12072.1|  unnamed protein product                                181   2e-49   
ref|XP_006343930.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    180   2e-49   
gb|AAC15777.1|  ACC synthase                                            180   3e-49   Nicotiana glutinosa
ref|XP_011080907.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    179   8e-49   
gb|ACX71871.1|  ACC synthase 1                                          177   3e-48   Lithospermum erythrorhizon
dbj|BAA25916.1|  1-aminocyclopropane-1-carboxylate synthase             177   3e-48   Solanum lycopersicum
ref|NP_001234164.1|  1-aminocyclopropane-1-carboxylate synthase         177   4e-48   
dbj|BAA34923.1|  1-aminocyclopropane-1-carboxylate synthase             177   4e-48   Solanum lycopersicum
ref|NP_001275367.1|  1-aminocyclopropane-1-carboxylate synthase         176   6e-48   
ref|XP_002278489.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    176   8e-48   Vitis vinifera
gb|ABB40579.2|  1-aminocyclopropane-1-carboxylate synthase              172   2e-46   Ipomoea nil [qian niu]
gb|KHN35042.1|  1-aminocyclopropane-1-carboxylate synthase              169   2e-45   
gb|ABQ51842.1|  1-aminocyclopropane-1-carboxylate synthase              168   3e-45   Pelargonium x hortorum [bedding geranium]
ref|XP_003538294.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    169   5e-45   
emb|CAD21842.1|  ACC synthase 1.1                                       163   5e-45   Fagus sylvatica
gb|AAC49153.1|  1-aminocyclopropane 1-carboxylate synthase              169   5e-45   Pelargonium x hortorum [bedding geranium]
gb|ABQ51839.1|  1-aminocyclopropane-1-carboxylate synthase              168   8e-45   Pelargonium x hortorum [bedding geranium]
gb|ABQ51840.1|  1-aminocyclopropane-1-carboxylate synthase              168   8e-45   Pelargonium x hortorum [bedding geranium]
gb|ABK95257.1|  unknown                                                 167   9e-45   Populus trichocarpa [western balsam poplar]
gb|AAB70885.1|  1-aminocyclopropane-1-carboxylate synthase              168   1e-44   Pelargonium x hortorum [bedding geranium]
gb|ABJ99502.1|  1-aminocyclopropane-1-carboxylate synthase              167   1e-44   Gossypium hirsutum [American cotton]
gb|ABA01475.2|  1-aminocyclopropane-1-carboxylate synthase              167   1e-44   Gossypium hirsutum [American cotton]
gb|ABC75833.1|  1-aminocyclopropane-1-carboxylate synthase              167   1e-44   Gossypium hirsutum [American cotton]
ref|XP_002298013.1|  1-aminocyclopropane-1-carboxylate synthase f...    167   2e-44   Populus trichocarpa [western balsam poplar]
gb|KHG22476.1|  1-aminocyclopropane-1-carboxylate synthase              166   3e-44   
ref|XP_007160107.1|  hypothetical protein PHAVU_002G293000g             166   4e-44   
ref|NP_001236141.1|  1-aminocyclopropane-1-carboxylate synthase         165   9e-44   
ref|XP_010089045.1|  1-aminocyclopropane-1-carboxylate synthase         165   1e-43   
gb|AAZ74655.1|  1-aminocyclopropane-1-carboxylate synthase              159   3e-43   Cucumis sativus [cucumbers]
ref|XP_011029354.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    164   3e-43   
emb|CAA77688.1|  1-aminocyclopropane 1-carboxylate synthase             163   4e-43   Vigna radiata var. radiata [golden gram]
ref|XP_004503673.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    163   5e-43   
gb|AAZ74656.1|  1-aminocyclopropane-1-carboxylate synthase              158   6e-43   Cucumis sativus [cucumbers]
gb|KCW44153.1|  hypothetical protein EUGRSUZ_L02436                     156   6e-43   
emb|CAN77934.1|  hypothetical protein VITISV_021265                     162   1e-42   Vitis vinifera
ref|XP_010041706.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   1e-42   
ref|XP_002276774.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    162   2e-42   Vitis vinifera
gb|AAZ74659.1|  1-aminocyclopropane-1-carboxylate synthase              157   2e-42   Cucumis sativus [cucumbers]
gb|AAL35745.1|  1-aminocyclopropanecarboxylic acid synthase             161   2e-42   Medicago truncatula
gb|KHN16788.1|  1-aminocyclopropane-1-carboxylate synthase              161   2e-42   
gb|KEH21137.1|  1-aminocyclopropane-1-carboxylate synthase              161   3e-42   
gb|AFM93771.1|  ACC synthetase                                          160   5e-42   
gb|KDP25384.1|  hypothetical protein JCGZ_20540                         160   7e-42   
gb|KHM99945.1|  1-aminocyclopropane-1-carboxylate synthase              160   7e-42   
ref|NP_001236858.1|  1-aminocyclopropane-1-carboxylate synthase         160   8e-42   
gb|AAL66205.1|AF386523_1  1-aminocyclopropane 1-carboxylate synth...    160   8e-42   Pyrus communis
dbj|BAA94599.1|  1-aminocyclopropane-1-carboxylate synthase             160   9e-42   Populus euphratica
ref|XP_009363394.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   1e-41   
gb|AAQ14268.1|AF248737_1  1-aminocyclopropane-1-carboxylate synthase    159   1e-41   Momordica charantia [balsam pear]
gb|ACK43795.1|  1-aminocyclopropane-1-carboxylate synthase              159   1e-41   Momordica charantia [balsam pear]
gb|AAQ14266.1|AF248735_1  1-aminocyclopropane-1-carboxylate synthase    159   1e-41   Momordica charantia [balsam pear]
ref|XP_009343873.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   1e-41   
emb|CBI40404.3|  unnamed protein product                                158   2e-41   
gb|KCW44151.1|  hypothetical protein EUGRSUZ_L024352                    155   2e-41   
gb|ABO76785.1|  1-aminocyclopropane-1-carboxylate synthase              159   2e-41   Citrullus colocynthis x Citrullus lanatus var. lanatus
ref|XP_006444953.1|  hypothetical protein CICLE_v10019970mg             159   2e-41   
emb|CAB60831.1|  ACC synthase                                           159   2e-41   Citrus sinensis [apfelsine]
ref|XP_004160953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   3e-41   
gb|ACT54524.2|  1-aminocyclopropane-1-carboxylate synthase              158   4e-41   Eriobotrya japonica [loquat]
ref|NP_001280870.1|  1-aminocyclopropane-1-carboxylate synthase         158   4e-41   
dbj|BAB18464.1|  1-aminocyclopropane-1-carboxylate synthase             158   5e-41   Cucumis melo [Oriental melon]
ref|XP_008452008.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   6e-41   
ref|XP_002509858.1|  acc synthase, putative                             157   6e-41   Ricinus communis
gb|ABM66813.1|  ACC synthase                                            157   6e-41   Gossypium hirsutum [American cotton]
dbj|BAA93713.1|  1-aminocyclopropane-1-carboxylate synthase             157   7e-41   Cucumis melo [Oriental melon]
ref|XP_007210019.1|  hypothetical protein PRUPE_ppa016458mg             157   9e-41   
ref|NP_001053637.1|  Os04g0578000                                       157   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001267589.1|  1-aminocyclopropane-1-carboxylate synthase-like    157   1e-40   
emb|CAH66732.1|  H0404F02.8                                             157   1e-40   Oryza sativa [red rice]
ref|XP_007040350.1|  1-aminocyclopropane-1-carboxylate synthase i...    156   1e-40   
gb|EYU32170.1|  hypothetical protein MIMGU_mgv1a025862mg                156   1e-40   
ref|XP_008238953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    156   2e-40   
ref|XP_010041705.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   2e-40   
ref|XP_010055081.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   3e-40   
ref|XP_007040349.1|  1-aminocyclopropane-1-carboxylate synthase i...    155   3e-40   
gb|KHG05668.1|  1-aminocyclopropane-1-carboxylate synthase              155   4e-40   
gb|ACD87813.1|  putative ACC synthase                                   155   5e-40   Vicia faba [broad bean]
ref|XP_010053217.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   5e-40   
gb|AAD04199.1|  1-aminocyclopropane-1-carboxylate synthase              155   5e-40   Pisum sativum [garden pea]
ref|XP_007158530.1|  hypothetical protein PHAVU_002G159800g             154   5e-40   
gb|AAC98809.1|  ACC synthase                                            155   6e-40   Carica papaya [mamon]
dbj|BAJ65574.1|  1-aminocyclopropane-1-carboxylate synthase             155   7e-40   
emb|CAN69483.1|  hypothetical protein VITISV_035777                     154   7e-40   Vitis vinifera
gb|AFT92042.2|  1-aminocyclopropane-1-carboxylate synthase              155   7e-40   
ref|NP_001280768.1|  1-aminocyclopropane-1-carboxylate synthase-like    154   8e-40   
ref|XP_007135134.1|  hypothetical protein PHAVU_010G103900g             154   1e-39   
ref|XP_010053213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    153   2e-39   
ref|XP_010669851.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    154   2e-39   
ref|XP_003552421.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    154   2e-39   
gb|ABW03086.1|  1-aminocyclopropane 1-carboxylate synthase 5            153   2e-39   Prunus salicina [Japanese plum]
gb|ABB70229.1|  1-aminocyclopropane-1-carboxylate synthase              153   2e-39   Glycine max [soybeans]
gb|EYU23427.1|  hypothetical protein MIMGU_mgv1a005590mg                153   3e-39   
gb|AAC05377.1|  1-aminocyclopropane-1-carboxylate synthase 2            145   3e-39   Dianthus caryophyllus [carnation]
ref|XP_010053212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    153   3e-39   
gb|KHG06607.1|  1-aminocyclopropane-1-carboxylate synthase              152   3e-39   
gb|AAD22099.2|  1-aminocyclopropane-1-carboxylate synthase              152   4e-39   Musa acuminata [banana]
emb|CAD44267.2|  putative aminocyclopropane carboxylic acid synthase    152   4e-39   Musa acuminata [banana]
ref|XP_010279043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   4e-39   
ref|XP_002304518.2|  1-aminocyclopropane-1-carboxylate synthase f...    152   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_004492797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   5e-39   
ref|XP_006360739.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   6e-39   
gb|AAP14019.1|AF380836_1  putative ACC synthase 1                       152   6e-39   Lactuca sativa [cultivated lettuce]
ref|XP_011022618.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   7e-39   
ref|XP_011092964.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   9e-39   
gb|AEO92026.1|  1-aminocyclopropane-1-carboxylic acid synthase          150   1e-38   
ref|XP_004298832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   1e-38   
ref|XP_010053215.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   1e-38   
ref|XP_006339629.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   1e-38   
ref|XP_008364813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   2e-38   
ref|XP_010053214.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    151   2e-38   
gb|ACV33064.1|  1-aminocyclopropane-1-carboxylate synthase              150   2e-38   Musa acuminata AAA Group [Cavendish banana]
gb|KCW44817.1|  hypothetical protein EUGRSUZ_L016171                    148   2e-38   
gb|AAU09672.1|  ACC synthase                                            150   2e-38   Musa acuminata AAA Group [Cavendish banana]
gb|ACV30003.1|  ACC synthase family protein                             150   2e-38   Musa acuminata AAA Group [Cavendish banana]
gb|KHG14845.1|  1-aminocyclopropane-1-carboxylate synthase              150   2e-38   
ref|XP_004252649.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   2e-38   
gb|AAO91942.1|  1-aminocyclopropane-1-carboxylate synthase              150   2e-38   Musa acuminata [banana]
gb|AAD28181.1|AF109927_1  1-aminocyclopropane-1-carboxylate synthase    150   2e-38   Musa acuminata [banana]
gb|AAC31571.1|  1-aminocyclopropane-1-carboxylate synthase              150   2e-38   Musa acuminata [banana]
ref|XP_009397633.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   2e-38   
emb|CAE53271.1|  1-aminocyclopropane-1-carboxylate synthase             150   2e-38   Musa acuminata [banana]
emb|CAA75749.1|  1-aminocyclopropane-1-carboxylate synthase             150   2e-38   Musa acuminata AAA Group [Cavendish banana]
gb|KCW77477.1|  hypothetical protein EUGRSUZ_D01815                     151   3e-38   
gb|ABD16181.1|  1-aminocyclopropane-1-carboxylate synthase              149   3e-38   Cicer arietinum [garbanzo]
gb|ACT54523.3|  1-aminocyclopropane-1-carboxylate synthase              150   4e-38   Eriobotrya japonica [loquat]
ref|XP_010919415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   4e-38   
ref|XP_003534540.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   4e-38   
ref|XP_003529924.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   4e-38   
gb|KHN29314.1|  1-aminocyclopropane-1-carboxylate synthase CMW33        150   4e-38   
gb|AES80303.2|  1-aminocyclopropane-1-carboxylate synthase              148   4e-38   
ref|NP_001275831.1|  1-aminocyclopropane-1-carboxylate synthase-like    150   4e-38   
ref|XP_006598931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    149   4e-38   
dbj|BAB89349.1|  1-aminocyclopropane-1-carboxylate synthase             150   4e-38   Diospyros kaki [Japanese persimmon]
gb|KDO76335.1|  hypothetical protein CISIN_1g011570mg                   149   4e-38   
gb|AAB96658.1|  1-aminocyclopropane-1-carboxylate synthase              149   7e-38   Rumex palustris
gb|ACL53889.1|  unknown                                                 147   7e-38   Zea mays [maize]
ref|XP_010676415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    149   9e-38   
ref|XP_010261352.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    149   9e-38   
ref|XP_002511916.1|  acc synthase, putative                             149   1e-37   Ricinus communis
ref|XP_003580370.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    148   1e-37   
gb|AES80302.2|  1-aminocyclopropane-1-carboxylate synthase              148   1e-37   
dbj|BAC66952.1|  ACC synthase                                           147   2e-37   Striga hermonthica [purple witchweed]
ref|NP_001146401.1|  1-aminocyclopropane-1-carboxylate synthase7        148   2e-37   Zea mays [maize]
gb|AAR25559.1|  acc synthase                                            147   2e-37   Zea mays [maize]
emb|CDP08761.1|  unnamed protein product                                147   2e-37   
ref|XP_010040891.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    147   3e-37   
ref|XP_006652680.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    147   3e-37   
dbj|BAG30910.1|  ACC synthase                                           147   3e-37   Capsicum chinense [bonnet pepper]
dbj|BAA94600.1|  1-aminocyclopropane-1-carboxylate synthase             147   3e-37   Populus x canadensis [Canadian poplar]
ref|XP_009366562.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    147   4e-37   
gb|AAM80888.1|  1-aminocyclopropane-1-carboxylate synthase              147   4e-37   Betula pendula [white birch]
emb|CAA72191.1|  1-aminocyclopropane-1-carboxylate synthase             147   4e-37   Carica papaya [mamon]
gb|ACN78835.1|  1-aminocyclopropane-1-carboxylate synthase              147   4e-37   Paeonia suffruticosa [moutan peony]
gb|AAA33111.1|  1-aminocyclopropane-1-carboxylate synthase              147   4e-37   Cucurbita pepo
gb|ABC69166.2|  1-aminocyclopropane-1-carboxylate synthase              147   4e-37   Paeonia suffruticosa [moutan peony]
dbj|BAA84945.1|  ACC synthase                                           147   4e-37   Musa acuminata AAA Group [Cavendish banana]
gb|KDP28564.1|  hypothetical protein JCGZ_14335                         147   4e-37   
sp|P23279.1|1A11_CUCPE  RecName: Full=1-aminocyclopropane-1-carbo...    147   5e-37   Cucurbita pepo
gb|ACN31344.1|  unknown                                                 146   6e-37   Zea mays [maize]
ref|XP_006305031.1|  hypothetical protein CARUB_v10009396mg             145   6e-37   
emb|CAA79478.1|  1-aminocyclopropane-1-carboxylate synthase             146   6e-37   Petunia x hybrida [garden petunia]
sp|Q00379.1|1A12_CUCPE  RecName: Full=1-aminocyclopropane-1-carbo...    146   7e-37   Cucurbita pepo
ref|XP_003624085.1|  1-aminocyclopropane-1-carboxylate synthase         145   7e-37   
gb|AAA33112.1|  1-aminocyclopropane-1-carboxylate synthase              146   7e-37   Cucurbita pepo
sp|P23599.1|1A11_CUCMA  RecName: Full=1-aminocyclopropane-1-carbo...    146   8e-37   Cucurbita maxima [Boston marrow]
ref|NP_001275873.1|  1-aminocyclopropane-1-carboxylate synthase 1...    146   8e-37   
gb|ABK97620.1|  1-aminocyclopropane-1-carboxylic acid synthase          146   9e-37   Durio zibethinus [durian]
ref|XP_010422075.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    146   1e-36   
ref|XP_010455533.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    146   1e-36   
gb|AAC05376.1|  1-aminocyclopropane-1-carboxylate synthase 3            144   2e-36   Dianthus caryophyllus [carnation]
ref|XP_011023276.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    145   2e-36   
ref|XP_003624084.1|  1-aminocyclopropane-1-carboxylate synthase         145   2e-36   
ref|XP_008669001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    144   3e-36   
ref|XP_009591161.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    144   3e-36   
ref|XP_002302608.2|  1-aminocyclopropane-1-carboxylate synthase f...    144   3e-36   Populus trichocarpa [western balsam poplar]
ref|NP_001284464.1|  1-aminocyclopropane-1-carboxylate synthase 1       144   4e-36   
dbj|BAA93712.1|  1-aminocyclopropane-1-carboxylate synthase             144   5e-36   Cucumis melo [Oriental melon]
ref|XP_010474747.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    144   6e-36   
ref|XP_007139782.1|  hypothetical protein PHAVU_008G058400g             144   6e-36   
gb|AEY82446.1|  1-aminocyclopropane-1-carboxylate synthase              144   7e-36   
ref|NP_001289261.1|  1-aminocyclopropane-1-carboxylate synthase 1       143   1e-35   
ref|XP_009398061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    143   1e-35   
gb|AAF22109.1|AF119411_1  1-aminocyclopropane-1-carboxylate synth...    143   1e-35   Lupinus albus
dbj|BAA78333.1|  1-aminocyclopropane-1-carboxylic acid synthase         143   1e-35   Pyrus pyrifolia [sha li]
gb|AER35096.1|  1-aminocyclopropane-1-carboxylate synthase              142   1e-35   
sp|Q07262.1|1A1C_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...    142   2e-35   Nicotiana tabacum [American tobacco]
ref|XP_008345341.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    142   2e-35   
ref|XP_009786813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    142   2e-35   
ref|XP_003622479.1|  1-aminocyclopropane-1-carboxylate synthase         142   2e-35   
dbj|BAF33503.1|  ACC synthase                                           142   2e-35   Orobanche minor
gb|AAL66200.1|AF386518_1  1-aminocyclopropane 1-carboxylate synth...    142   2e-35   Pyrus communis
ref|XP_008779569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    142   2e-35   
gb|ADZ96243.1|  ACC synthase 1                                          142   2e-35   
ref|XP_007051710.1|  1-aminocyclopropane-1-carboxylate synthase         142   3e-35   
gb|AGF95122.1|  1-aminocyclopropane-1-carboxylate synthase              135   3e-35   
ref|XP_004976571.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    142   3e-35   
emb|CDY15174.1|  BnaC05g00530D                                          142   4e-35   
gb|AAC41663.1|  1-aminocyclopropane-1-carboxylate synthase              141   4e-35   Solanum tuberosum [potatoes]
ref|XP_006396926.1|  hypothetical protein EUTSA_v10028605mg             141   5e-35   
ref|XP_010092578.1|  1-aminocyclopropane-1-carboxylate synthase 1       141   5e-35   
ref|XP_004306735.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    141   6e-35   
ref|XP_006345579.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    140   1e-34   
gb|ABO76787.1|  1-aminocyclopropane-1-carboxylate synthase              140   1e-34   Citrullus colocynthis x Citrullus lanatus var. lanatus
ref|XP_010480237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    140   1e-34   
ref|XP_010457119.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    140   1e-34   
dbj|BAA33374.1|  ACC synthase                                           140   2e-34   Cucumis sativus [cucumbers]
ref|XP_004159772.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    140   2e-34   
gb|ACZ54911.3|  1-aminocyclopropane-1-carboxylic acid synthase          140   2e-34   Narcissus tazetta var. chinensis
gb|KGN45694.1|  hypothetical protein Csa_6G006800                       140   2e-34   
gb|KFK42535.1|  hypothetical protein AALP_AA1G007100                    140   2e-34   
dbj|BAK19925.1|  1-aminocyclopropane-1-carboxylate synthase             139   2e-34   
ref|XP_003620110.1|  1-aminocyclopropane-1-carboxylate synthase         140   2e-34   
ref|XP_010559100.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    139   2e-34   
ref|XP_008362641.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    139   2e-34   
gb|AAR99390.1|  ACC synthase ACS1                                       139   3e-34   Nicotiana attenuata
gb|AFO63004.1|  ACC synthase                                            139   3e-34   
dbj|BAJ10410.1|  1-aminocyclopropane-1-carboxylate synthase             139   3e-34   
emb|CDX90035.1|  BnaA10g00470D                                          138   3e-34   
dbj|BAJ95898.1|  predicted protein                                      139   3e-34   
dbj|BAJ10416.1|  1-aminocyclopropane-1-carboxylate synthase             139   4e-34   
ref|XP_010919134.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    137   5e-34   
dbj|BAJ10412.1|  1-aminocyclopropane-1-carboxylate synthase             138   5e-34   
ref|XP_010541198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    138   5e-34   
ref|XP_010556574.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    138   6e-34   
dbj|BAJ10406.1|  1-aminocyclopropane-1-carboxylate synthase             138   6e-34   
dbj|BAJ10414.1|  1-aminocyclopropane-1-carboxylate synthase             138   6e-34   
dbj|BAJ10420.1|  1-aminocyclopropane-1-carboxylate synthase             138   6e-34   
gb|EMT04664.1|  1-aminocyclopropane-1-carboxylate synthase              138   7e-34   
emb|CAJ34918.1|  1-aminocyclopropane-1-carboxylate synthase             138   7e-34   Carica papaya [mamon]
gb|AAB18416.1|  ACC synthase                                            137   8e-34   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK19923.1|  1-aminocyclopropane-1-carboxylate synthase             138   8e-34   
ref|XP_010544766.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    137   9e-34   
ref|XP_010544767.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    137   9e-34   
ref|XP_007219056.1|  hypothetical protein PRUPE_ppa004774mg             137   9e-34   
ref|XP_006287590.1|  hypothetical protein CARUB_v10000800mg             137   9e-34   
dbj|BAA96743.1|  1-aminocyclopropane-1-carboxylate synthase             137   1e-33   Prunus persica
emb|CDP10864.1|  unnamed protein product                                137   1e-33   
ref|XP_009624194.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    137   1e-33   
dbj|BAK19928.1|  1-aminocyclopropane-1-carboxylate synthase             137   1e-33   
dbj|BAK19924.1|  1-aminocyclopropane-1-carboxylate synthase             137   1e-33   
ref|XP_002878386.1|  predicted protein                                  137   1e-33   
dbj|BAK19927.1|  1-aminocyclopropane-1-carboxylate synthase             137   1e-33   
gb|ACM48506.3|  1-aminocyclopropane-carboxylate synthase                137   1e-33   Dimocarpus longan [longan]
ref|XP_002448372.1|  hypothetical protein SORBIDRAFT_06g026160          137   1e-33   Sorghum bicolor [broomcorn]
ref|XP_009386742.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    137   1e-33   
emb|CAA44397.1|  1-aminocyclopropane 1-carboxylate synthase             137   1e-33   Solanum lycopersicum
ref|NP_192867.1|  1-aminocyclopropane-1-carboxylate synthase 6          137   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872570.1|  1-aminocyclopropane-1-carboxylic acid (acc) ...    137   2e-33   
emb|CAA41856.1|  1-aminocyclopropane 1-carboxylate synthase             137   2e-33   Solanum lycopersicum
sp|P18485.2|1A12_SOLLC  RecName: Full=1-aminocyclopropane-1-carbo...    137   2e-33   Solanum lycopersicum
ref|NP_001234178.1|  1-aminocyclopropane-1-carboxylate synthase 2       137   2e-33   
gb|AAX99362.1|  1-aminocyclopropane-1-carboxylate synthase              137   2e-33   Prunus persica
gb|KFK31896.1|  hypothetical protein AALP_AA6G173200                    137   2e-33   
ref|XP_010435116.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    137   2e-33   
gb|ACX69843.1|  ACC synthase                                            136   2e-33   
ref|NP_001280199.1|  1-aminocyclopropane-1-carboxylate synthase 1       136   3e-33   
dbj|BAK19929.1|  1-aminocyclopropane-1-carboxylate synthase             136   3e-33   
ref|XP_009119698.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    136   4e-33   
gb|AEI84819.1|  1-aminocyclopropane-1-carboxylate synthase 2            135   4e-33   
gb|AAC63850.1|  ACC synthase                                            135   4e-33   
ref|XP_009108182.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    135   6e-33   
ref|XP_002892062.1|  1-amino-cyclopropane-1-carboxylate synthase 2      135   7e-33   
gb|AAC83146.1|  1-aminocyclopropane-1-carboxylate synthase              135   8e-33   
gb|AAM21683.1|AF500120_1  1-aminocyclopropane-1-carboxylate synth...    134   1e-32   
dbj|BAK09604.1|  1-aminocyclopropane-1-carboxylate synthase             134   1e-32   
ref|XP_006418427.1|  hypothetical protein EUTSA_v10007457mg             134   1e-32   
dbj|BAJ10405.1|  1-aminocyclopropane-1-carboxylate synthase             134   1e-32   
emb|CAA79477.1|  1-aminocyclopropane 1-carboxylate synthase             134   1e-32   
dbj|BAJ10403.1|  1-aminocyclopropane-1-carboxylate synthase             134   1e-32   
ref|NP_191710.1|  1-aminocyclopropane-1-carboxylate synthase            134   2e-32   
dbj|BAK19930.1|  1-aminocyclopropane-1-carboxylate synthase             134   2e-32   
sp|Q9MB95.1|1A11_PRUMU  RecName: Full=1-aminocyclopropane-1-carbo...    133   2e-32   
emb|CDY13251.1|  BnaC09g24050D                                          133   3e-32   
emb|CAA57724.1|  1-aminocyclopropane-1-carboxylate synthase             133   3e-32   
sp|P27486.1|1A1C_DIACA  RecName: Full=1-aminocyclopropane-1-carbo...    133   4e-32   
ref|XP_006402473.1|  hypothetical protein EUTSA_v10005927mg             133   4e-32   
gb|AAA81580.1|  1-aminocyclopropane-1-carboxylate synthase              132   5e-32   
gb|ABW03085.1|  1-aminocyclopropane 1-carboxylate synthase 4            132   5e-32   
ref|XP_006292599.1|  hypothetical protein CARUB_v10018840mg             132   9e-32   
gb|AAM21682.1|AF500119_1  1-aminocyclopropane-1-carboxylate synth...    132   1e-31   
gb|KFK35337.1|  hypothetical protein AALP_AA5G271900                    131   1e-31   
pdb|1IAX|A  Chain A, Crystal Structure Of Acc Synthase Complexed ...    131   1e-31   
emb|CAA57716.1|  1-aminocyclopropane-1-carboxylate synthase             130   1e-31   
ref|NP_001234280.1|  1-aminocyclopropane-1-carboxylate synthase 4       131   2e-31   
ref|NP_001233875.1|  1-aminocyclopropane 1-carboxylate synthase         131   2e-31   
emb|CAH56693.1|  1-aminocyclopropane-1-carboxylate synthase             131   2e-31   
emb|CAH56694.1|  1-aminocyclopropane-1-carboxylate synthase             131   2e-31   
ref|NP_849572.1|  1-aminocyclopropane-1-carboxylate synthase 2          130   2e-31   
ref|NP_171655.1|  1-aminocyclopropane-1-carboxylate synthase 2          130   3e-31   
gb|AAA97516.1|  1-aminocyclopropane-1-carboxylate synthase              130   3e-31   
ref|XP_010413389.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    130   5e-31   
ref|XP_010512498.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    129   5e-31   
dbj|BAB47124.1|  ACC synthase                                           129   6e-31   
ref|XP_004510689.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    129   8e-31   
ref|XP_006829176.1|  hypothetical protein AMTR_s00001p00270760          129   9e-31   
ref|XP_010512497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    129   1e-30   
ref|XP_010469085.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    128   1e-30   
gb|KDO38394.1|  hypothetical protein CISIN_1g044773mg                   125   2e-30   
ref|XP_006466414.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    127   5e-30   
gb|KDO78833.1|  hypothetical protein CISIN_1g043923mg                   127   6e-30   
emb|CDY69462.1|  BnaAnng30490D                                          126   7e-30   
ref|XP_009109390.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    126   7e-30   
emb|CBI23538.3|  unnamed protein product                                126   8e-30   
ref|XP_010679692.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    126   8e-30   
ref|XP_003635576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    126   9e-30   
ref|XP_010099412.1|  1-aminocyclopropane-1-carboxylate synthase         126   1e-29   
emb|CBI23525.3|  unnamed protein product                                125   1e-29   
ref|XP_002269780.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    125   1e-29   
ref|XP_010432032.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    125   2e-29   
ref|XP_010446626.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    125   2e-29   
ref|XP_009624213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    125   2e-29   
gb|KCW59599.1|  hypothetical protein EUGRSUZ_H02344                     125   2e-29   
ref|XP_010023345.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    125   2e-29   
ref|XP_003630647.1|  1-aminocyclopropane-1-carboxylate synthase         124   3e-29   
gb|EPS62904.1|  1-aminocyclopropane-1-carboxylate synthase              124   3e-29   
gb|KEH21318.1|  1-aminocyclopropane-1-carboxylate synthase              124   3e-29   
gb|AET05123.2|  1-aminocyclopropane-1-carboxylate synthase              124   3e-29   
ref|XP_011078426.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   3e-29   
gb|KFK30387.1|  hypothetical protein AALP_AA7G254400                    124   3e-29   
ref|XP_006426151.1|  hypothetical protein CICLE_v10027248mg             124   3e-29   
ref|XP_010463583.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   4e-29   
ref|XP_010444599.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   4e-29   
ref|XP_010484425.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   4e-29   
ref|XP_002530601.1|  acc synthase, putative                             124   5e-29   
ref|XP_010026543.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   6e-29   
ref|XP_010555438.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    123   8e-29   
gb|EMS62632.1|  1-aminocyclopropane-1-carboxylate synthase              123   8e-29   
dbj|BAC00822.1|  1-aminocyclopropane-1-carboxylate synthase             123   9e-29   
emb|CDX89520.1|  BnaC04g35390D                                          123   1e-28   
ref|NP_179866.1|  1-aminocyclopropane-1-carboxylate synthase            123   1e-28   
ref|XP_011078213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   1e-28   
ref|XP_002868965.1|  1-amino-cyclopropane-1-carboxylate synthase 8      123   1e-28   
ref|XP_006404746.1|  hypothetical protein EUTSA_v10000582mg             122   1e-28   
gb|ABL67952.2|  1-aminocyclopropane-1-carboxylate synthase              122   1e-28   
ref|XP_006345624.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   1e-28   
ref|XP_006362080.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   2e-28   
ref|XP_009116817.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   2e-28   
emb|CDY11360.1|  BnaA09g39260D                                          122   2e-28   
ref|XP_010547570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   2e-28   
gb|KDP32123.1|  hypothetical protein JCGZ_12584                         122   2e-28   
gb|AAF22111.1|AF119413_1  1-aminocyclopropane-1-carboxylate synth...    122   2e-28   
emb|CAA51227.1|  1-aminocyclopropane-1-carboxylate synthase             122   2e-28   
ref|XP_004288284.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   2e-28   
ref|XP_006411853.1|  hypothetical protein EUTSA_v10027155mg             122   2e-28   
gb|KFK32789.1|  hypothetical protein AALP_AA6G288500                    122   2e-28   
dbj|BAF44097.1|  1-aminocyclopropane-1-carboxylate synthase             122   2e-28   
ref|XP_002308289.1|  1-aminocyclopropene-1-carboxylate synthase 3...    122   3e-28   
gb|EYU41365.1|  hypothetical protein MIMGU_mgv1a025183mg                122   3e-28   
ref|NP_190539.1|  1-aminocyclopropane-1-carboxylate synthase 9          122   3e-28   
ref|XP_006282592.1|  hypothetical protein CARUB_v10004734mg             122   3e-28   
ref|XP_003611535.1|  1-aminocyclopropane-1-carboxylate synthase         121   3e-28   
ref|XP_009112200.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   3e-28   
ref|XP_009150670.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   3e-28   
ref|XP_002320015.1|  1-aminocyclopropane-1-carboxylic acid syntha...    121   3e-28   
dbj|BAA31137.1|  1-aminocyclopropane-1-carboxylate synthase             121   3e-28   
gb|KFK28459.1|  hypothetical protein AALP_AA8G517100                    121   3e-28   
ref|XP_002866689.1|  hypothetical protein ARALYDRAFT_332796             121   4e-28   
ref|NP_201381.1|  1-aminocyclopropane-1-carboxylate synthase 5          121   4e-28   
gb|KHM99840.1|  1-aminocyclopropane-1-carboxylate synthase 7            120   4e-28   
ref|XP_011004709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   4e-28   
gb|AGF95123.1|  1-aminocyclopropane-1-carboxylate synthase              115   4e-28   
ref|XP_007047625.1|  1-aminocyclopropane-1-carboxylate synthase         121   5e-28   
ref|XP_009802937.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   5e-28   
ref|XP_006580895.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   5e-28   
emb|CDY65356.1|  BnaC08g49010D                                          121   5e-28   
ref|XP_010999918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   5e-28   
gb|AHA06003.1|  1-aminocyclopropane-1-carboxylate synthase              121   6e-28   
ref|NP_001234160.1|  1-aminocyclopropane-1-carboxylate synthase 8       120   6e-28   
emb|CDX69326.1|  BnaC01g01270D                                          120   6e-28   
ref|XP_006293030.1|  hypothetical protein CARUB_v10019310mg             120   6e-28   
gb|AAQ13597.1|  1-aminocyclopropane-1-carboxylate synthase              120   6e-28   
ref|XP_008236043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   6e-28   
dbj|BAA35057.1|  1-aminocyclopropane-1-carboxylate synthase             120   6e-28   
ref|XP_009624090.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   6e-28   
ref|XP_009133375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   6e-28   
sp|P37821.2|1A1C_MALDO  RecName: Full=1-aminocyclopropane-1-carbo...    120   7e-28   
gb|AAA86471.1|  1-aminocyclopropane 1-carboxylate synthase              120   7e-28   
gb|AAG28795.1|  ACC synthase                                            120   7e-28   
gb|ABA03056.1|  ACC synthase                                            120   7e-28   
gb|AAC49154.1|  1-aminocyclopropane 1-carboxylate synthase              120   7e-28   
gb|KDP33744.1|  hypothetical protein JCGZ_07315                         120   7e-28   
gb|AAD53174.1|  1-aminocyclopropane-1-carboxylic acid synthase ACS2     120   7e-28   
gb|AAA03472.1|  1-aminocyclopropane-1-carboxylate (ACC) synthase        120   7e-28   
ref|NP_195491.1|  1-aminocyclopropane-1-carboxylate synthase 8          120   8e-28   
ref|NP_567330.1|  1-aminocyclopropane-1-carboxylate synthase 11         120   8e-28   
emb|CDP02644.1|  unnamed protein product                                120   8e-28   
ref|XP_006371987.1|  1-aminocyclopropene-1-carboxylate synthase 3...    120   9e-28   
emb|CDX75675.1|  BnaA01g00270D                                          120   9e-28   
dbj|BAA28860.1|  1-aminocyclopropane-1-carboxylate synthase             119   9e-28   
ref|XP_006393985.1|  hypothetical protein EUTSA_v10004145mg             120   1e-27   
ref|XP_010421733.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   1e-27   
ref|XP_008793196.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   1e-27   
gb|KEH31540.1|  1-aminocyclopropane-1-carboxylate synthase              120   1e-27   
ref|XP_010248312.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   1e-27   
ref|XP_010456771.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   1e-27   
ref|XP_006287707.1|  hypothetical protein CARUB_v10000914mg             119   2e-27   
ref|XP_007160245.1|  hypothetical protein PHAVU_002G305000g             119   2e-27   
ref|XP_010515330.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-27   
gb|AAC05145.1|  pollen-specific 1-aminocyclopropane-1-carboxylate...    119   2e-27   
ref|XP_010438639.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-27   
emb|CAA81749.1|  1-aminocyclopropane-1-carboxylate synthase             119   2e-27   
gb|KHN16675.1|  1-aminocyclopropane-1-carboxylate synthase 7            118   2e-27   
ref|XP_010426493.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-27   
ref|XP_010503635.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-27   
ref|XP_010666828.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-27   
ref|XP_011099419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-27   
gb|AFL91700.1|  1-aminocyclopropane-1-carboxylate synthase 3            118   2e-27   
ref|XP_009621053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-27   
ref|XP_010666827.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-27   
ref|XP_011013607.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-27   
ref|XP_006280412.1|  hypothetical protein CARUB_v10026345mg             119   3e-27   
gb|ABW97850.1|  ACS4                                                    117   3e-27   
gb|AGE15420.1|  1-aminocyclopropane-1-carboxylate synthase              119   3e-27   
gb|AAY89238.1|  1-aminocyclopropane-1-carboxylate synthase              119   3e-27   
ref|XP_009797702.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-27   
sp|Q42881.1|1A13_SOLLC  RecName: Full=1-aminocyclopropane-1-carbo...    119   3e-27   
emb|CAB65315.1|  1-aminocyclopropane-1-carboxylate synthase             117   3e-27   
ref|XP_011094001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-27   
ref|NP_001234026.1|  1-aminocyclopropane-1-carboxylate synthase 3       119   3e-27   
gb|ACZ54502.1|  1-aminocyclopropane-1-carboxylate                       119   3e-27   
ref|XP_010518692.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   3e-27   
dbj|BAF44094.1|  1-aminocyclopropane-1-carboxylate synthase             119   4e-27   
ref|XP_003530532.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   4e-27   
ref|XP_003517362.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   4e-27   
gb|KHN36321.1|  1-aminocyclopropane-1-carboxylate synthase              118   4e-27   
ref|XP_006404112.1|  hypothetical protein EUTSA_v10011085mg             118   4e-27   
ref|XP_007152930.1|  hypothetical protein PHAVU_004G172300g             118   4e-27   
ref|XP_010262213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   4e-27   
ref|XP_009630061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   4e-27   
ref|XP_010262212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   5e-27   
dbj|BAB33423.1|  ACC synthase                                           118   5e-27   
ref|XP_002877694.1|  hypothetical protein ARALYDRAFT_348080             118   5e-27   
ref|XP_010267362.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   5e-27   
ref|XP_009339376.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   5e-27   
gb|AGG19162.1|  ACC synthase                                            118   5e-27   
dbj|BAA76389.1|  1-aminocyclopropane-1-carboxylic acid synthase         118   5e-27   
emb|CDY23035.1|  BnaC07g31520D                                          118   5e-27   
ref|NP_001289205.1|  1-aminocyclopropane-1-carboxylate synthase         118   5e-27   
ref|XP_009130528.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   5e-27   
emb|CDY05953.1|  BnaC08g21300D                                          118   6e-27   
emb|CDY08163.1|  BnaA06g15630D                                          118   6e-27   
ref|XP_009149709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   6e-27   
gb|EYU44527.1|  hypothetical protein MIMGU_mgv1a019082mg                118   7e-27   
ref|XP_009771829.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   7e-27   
gb|AAD53173.1|  1-aminocyclopropane-1-carboxylic acid synthase ACS1     117   7e-27   
ref|XP_009136516.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   7e-27   
ref|XP_006345625.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   8e-27   
ref|XP_006364401.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   8e-27   
dbj|BAA19161.1|  1-aminocyclopropane-1-carboxylate synthase             117   9e-27   
gb|AAR38503.1|  1-aminocyclopropane-1-carboxylate synthase 2b           117   9e-27   
gb|KDP41571.1|  hypothetical protein JCGZ_15978                         117   9e-27   
ref|XP_002872369.1|  1-amino-cyclopropane-1-carboxylate synthase 11     117   1e-26   
ref|XP_011073663.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-26   
ref|XP_009589682.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-26   
emb|CAA81747.1|  Amino cyclopropane carboxylate acid synthase           117   1e-26   
emb|CAA81748.1|  1-aminocyclopropane-1-carboxylate synthase             117   1e-26   
gb|AAF22110.1|AF119412_1  1-aminocyclopropane-1-carboxylate synth...    115   1e-26   
ref|XP_004503531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-26   
gb|ABW03081.1|  1-aminocyclopropane 1-carboxylate synthase 1            117   1e-26   
ref|XP_009778720.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-26   
ref|XP_002310878.1|  1-aminocyclopropane-1-carboxylic acid syntha...    117   1e-26   
ref|XP_009629400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   1e-26   
ref|XP_009789938.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   2e-26   
ref|XP_007205128.1|  hypothetical protein PRUPE_ppa004987mg             117   2e-26   
emb|CAA60591.1|  1-aminocyclopropane-1-carboxylate synthase             117   2e-26   
gb|AAC70353.2|  ACC synthase 3                                          116   2e-26   
gb|KDP41572.1|  hypothetical protein JCGZ_15979                         116   2e-26   
gb|AAB96880.1|  1-aminocyclopropane-1-carboxylate synthase              116   2e-26   
dbj|BAK19926.1|  1-aminocyclopropane-1-carboxylate synthase             117   2e-26   
gb|AAR12136.1|  1-aminocyclopropene-1-carboxylate synthase 3a           116   2e-26   
emb|CBI27945.3|  unnamed protein product                                116   2e-26   
gb|AGZ61968.1|  1-aminocyclopropane-1-carboxylate synthase 3            116   2e-26   
ref|XP_007012906.1|  1-amino-cyclopropane-1-carboxylate synthase 7      117   2e-26   
gb|AAD33789.1|AF144746_1  1-aminocyclopropane-1-carboxylate synthase    115   2e-26   



>emb|CAA67118.1| ACC synthase [Nicotiana tabacum]
Length=483

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 110/139 (79%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GI TLKS AGLF WMDLRRLL+E T EAELELWRIII++VKLNVSPGCSFHC+
Sbjct  347  TRGLAQVGINTLKSNAGLFIWMDLRRLLKELTFEAELELWRIIINEVKLNVSPGCSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD+TMR+AL RI  FV QR G  G   K QCR   L+IS SF +  LD
Sbjct  407  EPGWFRVCFANMDDETMRIALRRINNFVIQRKGIEGGVKKLQCRRSKLEISLSFRK--LD  464

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SPHSP S  SP+VQA
Sbjct  465  DFMNSPHSPMS--SPLVQA  481



>ref|XP_009626021.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 110/139 (79%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GI TLKS AGLF WMDLRRLL+E T EAELELWRIII++VKLNVSPGCSFHC+
Sbjct  347  TRGLAQVGINTLKSNAGLFIWMDLRRLLKELTFEAELELWRIIINEVKLNVSPGCSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD+TMR+AL RI  FV QR G  G   K QCR   L+I+ SF +  LD
Sbjct  407  EPGWFRVCFANMDDETMRIALRRINNFVIQRKGIEGGVKKLQCRRSKLEINLSFRK--LD  464

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SPHSP S  SP+VQA
Sbjct  465  DFMNSPHSPMS--SPLVQA  481



>gb|AAR99391.1| ACC synthase ACS2 [Nicotiana attenuata]
Length=483

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 110/139 (79%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLF WMDLRRLL+E T E+ELELWRIII++VKLNVSPGCSFHC+
Sbjct  347  TKGLAQVGINTLKSNAGLFIWMDLRRLLKELTFESELELWRIIINEVKLNVSPGCSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD+TMRVAL RI  FV QR G  G   K QCR   L+IS SF +  LD
Sbjct  407  EPGWFRVCFANMDDETMRVALRRINNFVIQRKGIEGGVKKLQCRRSKLEISLSFRK--LD  464

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SPHSP S  SP+VQA
Sbjct  465  DFINSPHSPMS--SPLVQA  481



>ref|XP_009757887.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=483

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 111/146 (76%), Gaps = 6/146 (4%)
 Frame = -1

Query  798  RSWSYGGTRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSP  619
            R   Y   +GL  +GI TLKS AGLF WMDLRRLL+EPT E+EL+LWRIII++VKLN+SP
Sbjct  340  RKRHYMFIKGLEQVGINTLKSNAGLFIWMDLRRLLKEPTFESELQLWRIIINEVKLNISP  399

Query  618  GCSFHCAEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTS  445
            GCSFHC+EPGWFRVCFANMDD+TMR+AL RI  FV QR G  G   K QCR   L+IS S
Sbjct  400  GCSFHCSEPGWFRVCFANMDDETMRIALRRINNFVIQRKGIEGGVKKLQCRRSKLEISLS  459

Query  444  FSRIMLDDLLMSPHSPASAKSPMVQA  367
            F +  LDD + SPHSP S  SP+VQA
Sbjct  460  FRK--LDDFMNSPHSPMS--SPLVQA  481



>emb|CAA06288.1| 1-cyclopropane-1-carboxylate synthase [Nicotiana tabacum]
 emb|CAB65314.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana tabacum]
 gb|ABW97849.1| ACS2 [Nicotiana tabacum]
Length=484

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 112/141 (79%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+EPT+E+ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEPTLESELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR AL RIR FV Q    N  AA K+QC    LQIS SF R  +
Sbjct  408  EPGWFRVCFANMDDETMRTALRRIRNFVLQTKGLNNKAAVKKQCSRSKLQISLSFRR--M  465

Query  426  DDLLMSP-HSPASAKSPMVQA  367
            DD + SP HSP +  SP+V+ 
Sbjct  466  DDFMNSPVHSPMN--SPLVRT  484



>ref|XP_009590054.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 112/141 (79%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+EPT+E+ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEPTLESELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR AL RIR FV Q    N  AA K+QC    LQIS SF R  +
Sbjct  408  EPGWFRVCFANMDDETMRTALRRIRNFVLQTKGLNNKAAVKKQCSRSKLQISLSFRR--M  465

Query  426  DDLLMSP-HSPASAKSPMVQA  367
            DD + SP HSP +  SP+V+ 
Sbjct  466  DDFMNSPVHSPMN--SPLVRT  484



>gb|AAC83147.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana glutinosa]
Length=484

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 112/141 (79%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+EPT ++ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEPTFDSELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RIR FV Q    N  AA K+QC    LQIS SF R  +
Sbjct  408  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGLNNKAAVKKQCSRSKLQISLSFRR--M  465

Query  426  DDLLMSP-HSPASAKSPMVQA  367
            DD + SP HSP +  SP+V+ 
Sbjct  466  DDFMNSPVHSPMN--SPLVRT  484



>ref|XP_004253425.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like, partial 
[Solanum lycopersicum]
Length=278

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T + ELELWRIII++VKLNVSPGCSFHC+
Sbjct  143  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCS  202

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RIR FV Q    N  AA K+QC    LQIS SF R  L
Sbjct  203  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGLNNIAAIKKQCSRSKLQISLSFRR--L  260

Query  426  DDLLMSPHSPASAKSPMVQA  367
            DD     HSP +  SP+V+ 
Sbjct  261  DDFNSPAHSPMN--SPLVRT  278



>ref|XP_009626433.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=486

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 110/144 (76%), Gaps = 11/144 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS  GLFFWMDLRRLL+E T EAEL+LW III++VKLNVSPG SFHC+
Sbjct  345  TKGLAQVGISTLKSNGGLFFWMDLRRLLKESTFEAELDLWHIIINEVKLNVSPGVSFHCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD+TMRVAL RIR FV QR G    A K+QCR   L+IS SF R  LD
Sbjct  405  EPGWFRVCFANMDDETMRVALRRIRHFVLQRKGLIEVATKKQCRRSKLEISLSFRR--LD  462

Query  423  DLL-----MSPHSPASAKSPMVQA  367
            D +      SPHSP S  SPMVQA
Sbjct  463  DFMNSPFKNSPHSPMS--SPMVQA  484



>ref|XP_009791163.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=486

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 110/144 (76%), Gaps = 11/144 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS  GLFFWMDLRRLL+E T EAEL+LW III++VKLNVSPG SFHC+
Sbjct  345  TKGLAQVGICTLKSNGGLFFWMDLRRLLKESTFEAELDLWHIIINEVKLNVSPGVSFHCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD+TMRVAL RIR FV QR G    A K+QCR   L+IS SF R  LD
Sbjct  405  EPGWFRVCFANMDDETMRVALRRIRHFVLQRKGLIEVATKKQCRRSKLEISLSFRR--LD  462

Query  423  D-----LLMSPHSPASAKSPMVQA  367
            D      + SPHSP S  SPMVQA
Sbjct  463  DFMNSPFMNSPHSPMS--SPMVQA  484



>ref|XP_009776307.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T E+ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKESTFESELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RIR FV Q    N  +A K+QC    LQIS SF R  +
Sbjct  408  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGLNSKSAVKKQCSRSKLQISLSFRR--M  465

Query  426  DDLLMSP-HSPASAKSPMVQA  367
            DD + SP HSP +  SP+V+ 
Sbjct  466  DDFMNSPVHSPMN--SPLVRT  484



>ref|XP_004253426.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like, partial 
[Solanum lycopersicum]
Length=281

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T ++ELELWRIII++VKLNVSPGCSFHC+
Sbjct  144  TKGLAEVGISTLKSNAGLFFWMDLRRLLKEATFDSELELWRIIINEVKLNVSPGCSFHCS  203

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ---RNGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RI  FV Q    N  AA K+QC  R LQIS SF R  L
Sbjct  204  EPGWFRVCFANMDDETMRIALKRISYFVLQPKGLNNIAAIKKQCSRRKLQISLSFRR--L  261

Query  426  DDLLMSPHSPASAKSPMVQA  367
            D   M+  + +   SP+V+ 
Sbjct  262  DHEFMNSPAHSPMNSPLVRT  281



>gb|AAR99392.1| ACC synthase ACS3a [Nicotiana attenuata]
Length=484

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T E+ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKELTFESELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RIR FV Q    N  +A K+QC    LQIS SF R  +
Sbjct  408  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGLNSKSAVKKQCSRSKLQISLSFRR--M  465

Query  426  DDLLMSP-HSPASAKSPMVQA  367
            DD + SP HSP +  SP+V+ 
Sbjct  466  DDFMNSPVHSPMN--SPLVRT  484



>ref|XP_011073274.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Sesamum 
indicum]
Length=481

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 7/139 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            +RGLA +GIG+L S AGL+ WMDLRRLL+EPT EAE+ELWR+II++VKLNVSPG SFHC+
Sbjct  346  SRGLAQVGIGSLNSNAGLYCWMDLRRLLKEPTFEAEMELWRVIINEVKLNVSPGASFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG-AAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMDD+TMRVAL RI  FV Q+ GG A+++RQCR   L+IS SF R+   D
Sbjct  406  EPGWFRVCFANMDDETMRVALGRIHKFVAQKKGGEASSRRQCRRSKLEISLSFRRL---D  462

Query  420  LLMSP-HSPASAKSPMVQA  367
             +MSP HSP S  SPMV+A
Sbjct  463  EIMSPHHSPMS--SPMVRA  479



>gb|ABW97851.1| ACS5 [Nicotiana tabacum]
Length=474

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 106/139 (76%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRG A +G  TLKS   LF WMDLRRLL+E T EAELELWRIII++VKLNVSPGCSFHC+
Sbjct  338  TRGPAQVGNNTLKSNPALFIWMDLRRLLKELTFEAELELWRIIINEVKLNVSPGCSFHCS  397

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG--GAAAKRQCRGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD+TMR+AL RI  FV QR G  G   K QCR   L+IS SF +  LD
Sbjct  398  EPGWFRVCFANMDDETMRIALRRINNFVIQRKGIEGGVKKLQCRRSKLEISLSFRK--LD  455

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SPHSP S  SP+VQA
Sbjct  456  DFMNSPHSPMS--SPLVQA  472



>ref|XP_009590053.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            ++GLA +GI TLKS AGLFFWMDLRRLL+E T EAELELWRIII++VKLNVSPGCSFHC+
Sbjct  349  SKGLAQVGISTLKSNAGLFFWMDLRRLLKESTFEAELELWRIIINEVKLNVSPGCSFHCS  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG----GAAAKRQCRGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TMR+AL RIR FV Q  G     AA K+QC    LQIS SF R  
Sbjct  409  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGITNKVAAFKKQCSRSKLQISLSFRR--  466

Query  429  LDDLLMSPHSPASAKSPMVQA  367
            LDD     HSP +  SP+V+ 
Sbjct  467  LDDFNSPAHSPMN--SPLVRT  485



>dbj|BAG30909.1| ACC synthase [Capsicum chinense]
Length=485

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 109/142 (77%), Gaps = 9/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+EPT +AELELWRIIIH+VKLNVSPG SFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEPTFDAELELWRIIIHEVKLNVSPGVSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ----RNGGAAAKRQCRGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TMR AL RIR FV Q     N  A  K+QC    LQIS SF R  
Sbjct  408  EPGWFRVCFANMDDETMRTALRRIRNFVLQTKGLNNKVAVLKKQCSRSKLQISLSFRR--  465

Query  429  LDDLLMSP-HSPASAKSPMVQA  367
            LDD + SP +SP +  SP+V+ 
Sbjct  466  LDDFMNSPANSPMN--SPLVRT  485



>dbj|BAB89350.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki]
Length=486

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG+L+S AGLFFWMDLRRLL+EPT EAEL LW++I+H+VKLNVSPG SFHC+
Sbjct  350  TKGLAQVGIGSLESNAGLFFWMDLRRLLKEPTPEAELALWKVIVHEVKLNVSPGVSFHCS  409

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG-GAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMDDDTMRVAL RIR+FV +R      AKRQC    L+I+ SF R   DD
Sbjct  410  EPGWFRVCFANMDDDTMRVALRRIRSFVAKRKAMEGPAKRQCWRSNLRINLSFRR--KDD  467

Query  420  L-LMSPHSPASAKSPMVQA  367
            + +MSPHSP +  SP+V+A
Sbjct  468  IAMMSPHSPLT--SPLVRA  484



>gb|AAF97615.1|U18057_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T + ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RIR FV Q    N  AA K+QC    LQIS SF R  L
Sbjct  408  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGLNNIAAIKKQCSRSKLQISLSFRR--L  465

Query  426  DDLLMSPHSPASAKSPMVQA  367
            DD     HSP +  SP+V+ 
Sbjct  466  DDFNSPAHSPMN--SPLVRT  483



>ref|NP_001266271.1| 1-aminocyclopropane-1-carboxylate synthase-like [Solanum lycopersicum]
 gb|AAB17279.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T + ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RIR FV Q    N  AA K+QC    LQIS SF R  L
Sbjct  408  EPGWFRVCFANMDDETMRIALRRIRNFVLQTKGLNNIAAIKKQCSRSKLQISLSFRR--L  465

Query  426  DDLLMSPHSPASAKSPMVQA  367
            DD     HSP +  SP+V+ 
Sbjct  466  DDFNSPAHSPMN--SPLVRT  483



>gb|AAR99393.1| ACC synthase ACS3b [Nicotiana attenuata]
Length=485

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            ++GLA +GI TLKS AGLFFWMDLRRLL+E T EAELELWRIII++VKLNVSPGCSFHC+
Sbjct  349  SKGLAQVGISTLKSNAGLFFWMDLRRLLKESTFEAELELWRIIINEVKLNVSPGCSFHCS  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG----GAAAKRQCRGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TMR+A+ RIR FV Q  G     AA K+QC    LQIS SF R  
Sbjct  409  EPGWFRVCFANMDDETMRIAIRRIRNFVLQTKGITNKVAAFKKQCSRSKLQISLSFRR--  466

Query  429  LDDLLMSPHSPASAKSPMVQA  367
            LDD     HSP +  SP+V+ 
Sbjct  467  LDDFNSPVHSPMN--SPLVRT  485



>ref|XP_009771943.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            ++GLA +GI TLKS AGLFFWMDLRRLL++ T EAELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  SKGLAQVGISTLKSNAGLFFWMDLRRLLKDSTFEAELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG----GAAAKRQCRGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TMR+A+ RIR FV Q  G     AA K+QC    LQIS SF R  
Sbjct  408  EPGWFRVCFANMDDETMRIAIRRIRNFVLQTKGITNKVAAFKKQCSRSKLQISLSFRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQA  367
            LDD     HSP +  SP+V+ 
Sbjct  466  LDDFNSPAHSPMN--SPLVRT  484



>ref|XP_006343931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=484

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 106/140 (76%), Gaps = 7/140 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T + ELELWRIII++VKLNVSPGCSFHC+
Sbjct  349  TKGLAQVGISTLKSNAGLFFWMDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCS  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TM+ AL RIR FV Q    N  AA K+QC    LQIS SF R  L
Sbjct  409  EPGWFRVCFANMDDETMKTALRRIRNFVLQTKGLNNIAAIKKQCSRSKLQISLSFRR--L  466

Query  426  DDLLMSPHSPASAKSPMVQA  367
            DD     HSP +  SP+V+ 
Sbjct  467  DDFNSPAHSPMN--SPLVRT  484



>gb|ABM88785.1| 1-aminocyclopropane-1-carboxylate synthase [Camellia sinensis]
Length=477

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%), Gaps = 16/142 (11%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG+LKS AGLFFWMDLRRLL + T E+E+ LWR+I+HDVKLNVSPG SFHC+
Sbjct  345  TKGLAQVGIGSLKSNAGLFFWMDLRRLLEDSTFESEMALWRVIVHDVKLNVSPGSSFHCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+TMRVAL RIR+FV        AKRQC    L++S SF R  LDD+
Sbjct  405  EPGWFRVCFANMDDETMRVALRRIRSFV-------TAKRQCWQSNLKLSLSFRR--LDDI  455

Query  417  -----LMSPHSPASAKSPMVQA  367
                 +MSPHSP S  SP+V+A
Sbjct  456  GMAPHMMSPHSPIS--SPLVRA  475



>gb|AAF97614.1|U18056_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T ++ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAEVGISTLKSNAGLFFWMDLRRLLKEATFDSELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RI  FV Q    N  AA K+QC  R LQIS SF R+  
Sbjct  408  EPGWFRVCFANMDDETMRIALKRISYFVLQPKGLNNIAAIKKQCSRRKLQISLSFRRLDH  467

Query  426  DDLLMSPHSPASAKSPMVQA  367
            + +    HSP +  SP+V+ 
Sbjct  468  EFMNSPAHSPMN--SPLVRT  485



>ref|NP_001233922.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAB17278.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T ++ELELWRIII++VKLNVSPGCSFHC+
Sbjct  348  TKGLAEVGISTLKSNAGLFFWMDLRRLLKEATFDSELELWRIIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RI  FV Q    N  AA K+QC  R LQIS SF R+  
Sbjct  408  EPGWFRVCFANMDDETMRIALKRISYFVLQPKGLNNIAAIKKQCSRRKLQISLSFRRLDH  467

Query  426  DDLLMSPHSPASAKSPMVQA  367
            + +    HSP +  SP+V+ 
Sbjct  468  EFMNSPAHSPMN--SPLVRT  485



>emb|CDP12072.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 8/144 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GIGTLKS+AGL+FWMDLRRLLRE T EAE+ELWRIIIH+VKLNVSPG SFHC+
Sbjct  347  TRGLAQVGIGTLKSSAGLYFWMDLRRLLRESTFEAEMELWRIIIHEVKLNVSPGLSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG---AAAKRQCRGRALQISTSFSRI--  433
            EPGWFRVCFANMDD+++RVAL RI  FV  +         K +C    LQ+S SF R+  
Sbjct  407  EPGWFRVCFANMDDESVRVALRRIHKFVLVQGKATEPTTPKSRCGSSKLQLSLSFRRLDE  466

Query  432  -MLDDLLMSPHSPASAKSPMVQAT  364
             ++   +MSPHSP +  SP+V+AT
Sbjct  467  RVMGSHMMSPHSPMA--SPLVRAT  488



>ref|XP_006343930.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI TLKS AGLFFWMDLRRLL+E T + ELELWR+II++VKLNVSPGCSFHC+
Sbjct  348  TKGLAEVGISTLKSNAGLFFWMDLRRLLKEATFDGELELWRMIINEVKLNVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMR+AL RI  FV Q    N  AA  +QC  R LQIS SF R+  
Sbjct  408  EPGWFRVCFANMDDETMRIALKRISYFVLQPKGLNNKAAVNKQCSRRKLQISLSFRRLDH  467

Query  426  DDLLMSPHSPASAKSPMVQA  367
            + +    HSP +  SP+V+ 
Sbjct  468  EFMNSPAHSPMN--SPLVRT  485



>gb|AAC15777.1| ACC synthase [Nicotiana glutinosa]
Length=482

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GI +LKS +GLFFWMDLRRLL+E T EAEL+LW III++VKLNVSPG SFHC+
Sbjct  345  TKGLAQVGISSLKSNSGLFFWMDLRRLLKESTFEAELDLWHIIINEVKLNVSPGVSFHCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG---GAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+TMRVAL RI+ FV QR G    A  K+  R R  +IS SF R  L
Sbjct  405  EPGWFRVCFANMDDETMRVALRRIKHFVLQRKGLIEVATKKQCRRRRKREISLSFRR--L  462

Query  426  DDLLMSPHSPASAKSPMVQA  367
            DD + SPHSP S  SPMVQA
Sbjct  463  DDFMNSPHSPMS--SPMVQA  480



>ref|XP_011080907.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Sesamum 
indicum]
Length=485

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 109/143 (76%), Gaps = 12/143 (8%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GLA +GIG+LKS AGL+ WMDLRRLL+EPT EAELELW++II+DVKLNVSPG SFHC+EP
Sbjct  345  GLAQVGIGSLKSNAGLYCWMDLRRLLKEPTFEAELELWQVIINDVKLNVSPGASFHCSEP  404

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQRNGG--AAAKRQCRGRALQISTSFSRIMLDDL  418
            GWFRVCFANMD +TM VAL RI  FV Q+ G    + ++QCR   L+IS SF R  LD++
Sbjct  405  GWFRVCFANMDGETMMVALNRIHKFVTQKKGSDQESGRKQCRSSKLEISLSFRR--LDEM  462

Query  417  ------LMSPHSPASAKSPMVQA  367
                   MSPHSP S  SP+V+A
Sbjct  463  KMAAPHKMSPHSPMS--SPLVRA  483



>gb|ACX71871.1| ACC synthase 1 [Lithospermum erythrorhizon]
Length=480

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 112/141 (79%), Gaps = 11/141 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGL+ +GIG+L S AGL+FWMDLRRLL+E T + E+ELWR+II++VKLNVS G SFHC+
Sbjct  346  TRGLSQVGIGSLNSNAGLYFWMDLRRLLKEQTTDGEMELWRVIINEVKLNVSSGSSFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRA-LQISTSFSRIMLDD  421
            EPGWFRVCFANM+D+T+RVAL RIR FV Q    +AAK+QCR R+ L+IS SF R   DD
Sbjct  406  EPGWFRVCFANMNDETVRVALRRIRNFVLQ--DKSAAKKQCRRRSKLEISLSFRR--RDD  461

Query  420  LL----MSPHSPASAKSPMVQ  370
            ++    MSPHSP S  SP+VQ
Sbjct  462  IIMGNVMSPHSPMS--SPLVQ  480



>dbj|BAA25916.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 105/144 (73%), Gaps = 9/144 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI TLKS AGLF WMDLRR L   T + EL+LW III  VKLNVSPGCSFHC+
Sbjct  338  TKGLGQVGITTLKSNAGLFIWMDLRRFLENSTFDDELKLWHIIIDKVKLNVSPGCSFHCS  397

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVR-QRNGG---AAAKRQCRGRA-LQISTSFSRI  433
            EPGWFRVCFANMDD TM++AL RIR FV  Q N G   A  K+ CR R+ L+IS SF R 
Sbjct  398  EPGWFRVCFANMDDATMKIALRRIRHFVYLQPNKGVEVATKKQYCRTRSKLEISLSFRR-  456

Query  432  MLDDLLMSPHSPASAKSPMVQATN  361
             LDD + SPHSP S  SPMVQA N
Sbjct  457  -LDDFMNSPHSPMS--SPMVQARN  477



>ref|NP_001234164.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAK72433.1|AF179249_1 1-aminocyclopropane-1-carboxylate synthase 6 [Solanum lycopersicum]
 gb|AAQ17610.1|AF167428_1 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 105/144 (73%), Gaps = 9/144 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI TLKS AGLF WMDLRR L   T + EL+LW III  VKLNVSPGCSFHC+
Sbjct  338  TKGLGQVGITTLKSNAGLFIWMDLRRFLENSTFDDELKLWHIIIDKVKLNVSPGCSFHCS  397

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVR-QRNGG---AAAKRQCRGRA-LQISTSFSRI  433
            EPGWFRVCFANMDD TM++AL RIR FV  Q N G   A  K+ CR R+ L+IS SF R 
Sbjct  398  EPGWFRVCFANMDDATMKIALRRIRHFVYLQPNKGVEVATKKQYCRTRSKLEISLSFRR-  456

Query  432  MLDDLLMSPHSPASAKSPMVQATN  361
             LDD + SPHSP S  SPMVQA N
Sbjct  457  -LDDFMNSPHSPMS--SPMVQARN  477



>dbj|BAA34923.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 105/144 (73%), Gaps = 9/144 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI TLKS AGLF WMDLRR L   T + EL+LW III  VKLNVSPGCSFHC+
Sbjct  338  TKGLGQVGITTLKSNAGLFIWMDLRRFLENSTFDDELKLWHIIIDKVKLNVSPGCSFHCS  397

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVR-QRNGG---AAAKRQCRGRA-LQISTSFSRI  433
            EPGWFRVCFANMDD TM++AL RIR FV  Q N G   A  K+ CR R+ L+IS SF R 
Sbjct  398  EPGWFRVCFANMDDATMKIALRRIRHFVYLQPNKGVEVATKKQYCRTRSKLEISLSFRR-  456

Query  432  MLDDLLMSPHSPASAKSPMVQATN  361
             LDD + SPHSP S  SPMVQA N
Sbjct  457  -LDDFMNSPHSPMS--SPMVQARN  477



>ref|NP_001275367.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum tuberosum]
 dbj|BAB16433.1| ACC synthase [Solanum tuberosum]
Length=486

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 107/144 (74%), Gaps = 9/144 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI TLKS AGLF WMDLRR L + T + EL+LW III+ VKLNVSPGCSFHC+
Sbjct  347  TKGLGQVGITTLKSNAGLFIWMDLRRFLEKSTFDDELKLWHIIINKVKLNVSPGCSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVR-QRNGG---AAAKRQCRGRA-LQISTSFSRI  433
            EPGWFRVCFANMDD TM+VAL RIR FV  Q + G   A  K+ CR R+ L+IS SF R 
Sbjct  407  EPGWFRVCFANMDDATMQVALKRIRHFVYLQPSKGVEVATKKQYCRTRSKLEISLSFRR-  465

Query  432  MLDDLLMSPHSPASAKSPMVQATN  361
             LDD + SPHSP S  SPMVQA N
Sbjct  466  -LDDFMNSPHSPMS--SPMVQARN  486



>ref|XP_002278489.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Vitis 
vinifera]
 emb|CBI34388.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            +RGL+ +GIG LKS AGLFFWMDLRRLL+EPTVEAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  344  SRGLSQVGIGCLKSNAGLFFWMDLRRLLKEPTVEAEMALWRLIINEVKLNVSPGSSFHCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMDD+TM VAL RIR FV + +    +AKRQ     L++  SF R + + 
Sbjct  404  EPGWFRVCFANMDDETMEVALRRIRNFVLKAKEKEVSAKRQRWQNNLKVRLSF-RGLDEP  462

Query  420  LLMSPHSPASAKSPMVQA  367
             LMSPHSP   +SP+V+A
Sbjct  463  HLMSPHSPI-PQSPLVRA  479



>gb|ABB40579.2| 1-aminocyclopropane-1-carboxylate synthase [Ipomoea nil]
Length=488

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 110/146 (75%), Gaps = 10/146 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GI TLKS  GLF WM+LR LL+EPT  AELELW++II+++KLNVSPGCSFHC 
Sbjct  346  TRGLAQVGIETLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQ  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG-------GAAAKRQCRGRALQISTSFS  439
            E GWFRVCFANMDD+TMRVAL+RIR  V Q  G        A  ++QCR R L++S SF 
Sbjct  406  EAGWFRVCFANMDDETMRVALMRIRTSVLQWKGMEAAAAASAKKQKQCR-RNLKVSLSFR  464

Query  438  RIMLDDLLMSPHSPASAKSPMVQATN  361
            R + D ++ SPHSP +  SP+VQATN
Sbjct  465  RGLEDCMISSPHSPMN--SPLVQATN  488



>gb|KHN35042.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=430

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            RGLA +GI  L S AGLF WMDLRRLL++PT EAE+ELW++II  VK+N+SPG SFHC+E
Sbjct  299  RGLAQVGIKCLASNAGLFLWMDLRRLLKKPTFEAEMELWKVIIEQVKINISPGSSFHCSE  358

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDLL  415
            PGWFRVC+ANMDD T+ V+L R+R FV Q      AK+ C  R L++S SF +  +D+ L
Sbjct  359  PGWFRVCYANMDDRTVEVSLARMRTFVNQ---NTEAKKSCSQRNLRLSFSFRK--MDEYL  413

Query  414  MSPHSPASAKSPMVQAT  364
            +SPHSP   +SP+V+A+
Sbjct  414  VSPHSPF-PQSPLVKAS  429



>gb|ABQ51842.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=435

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GIG LKS AGL+FWMDLR+LL E T EAE+ LW++II++VKLNVSPG SFHC 
Sbjct  297  TKGLEELGIGCLKSNAGLYFWMDLRKLLEEETFEAEMVLWKVIINEVKLNVSPGSSFHCV  356

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD-  421
            EPGWFRVCFANMDD+T+ VAL RIRAFVR++  G   KR+     L +  SFS +  D+ 
Sbjct  357  EPGWFRVCFANMDDETVHVALKRIRAFVRKKEVG-PVKRKRFMDNLNLRLSFSSLRYDES  415

Query  420  LLMSPHSPASAKSPMVQA  367
            +++SPH   S  SP+V+A
Sbjct  416  VMLSPHIMVSPHSPLVRA  433



>ref|XP_003538294.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Glycine 
max]
Length=480

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            RGLA +GI  L S AGLF WMDLRRLL++PT EAE+ELW++II  VK+N+SPG SFHC+E
Sbjct  349  RGLAQVGIKCLASNAGLFLWMDLRRLLKKPTFEAEMELWKVIIEQVKINISPGSSFHCSE  408

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDLL  415
            PGWFRVC+ANMDD T+ V+L R+R FV Q      AK+ C  R L++S SF +  +D+ L
Sbjct  409  PGWFRVCYANMDDRTVEVSLARMRTFVNQ---NTEAKKSCSQRNLRLSFSFRK--MDEYL  463

Query  414  MSPHSPASAKSPMVQAT  364
            +SPHSP   +SP+V+A+
Sbjct  464  VSPHSPF-PQSPLVKAS  479



>emb|CAD21842.1| ACC synthase 1.1 [Fagus sylvatica]
Length=241

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA + IG LKS AGLF WMDLR LL+E T +AE+ELW++II+ VKLNVSPG SFHC+
Sbjct  100  TEGLAQVDIGCLKSNAGLFVWMDLRHLLKEQTFKAEMELWKVIINKVKLNVSPGSSFHCS  159

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSR---IM  430
             PGWFRVCFANMDD TM VAL RI AFV Q +      K++C    L++S S  R   IM
Sbjct  160  APGWFRVCFANMDDKTMDVALTRIVAFVHQNKETTVPMKKKCWQTNLRLSFSSRRVDDIM  219

Query  429  LDDLLMSPHSPASAKSPMVQATN  361
            +   +MSPHSP   +SP+V+A N
Sbjct  220  MAQCMMSPHSPL-PQSPLVRARN  241



>gb|AAC49153.1| 1-aminocyclopropane 1-carboxylate synthase [Pelargonium x hortorum]
Length=482

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GIG LKS AGL+FWMDLR+LL E T EAE+ LW++II++VKLNVSPG SFHC 
Sbjct  344  TKGLEELGIGCLKSNAGLYFWMDLRKLLEEETFEAEMVLWKVIINEVKLNVSPGSSFHCV  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD-  421
            EPGWFRVCFANMDD+T+ VAL RIRAFVR++  G   KR+     L +  SFS +  D+ 
Sbjct  404  EPGWFRVCFANMDDETVHVALKRIRAFVRKKEVG-PVKRKRFMDNLNLRLSFSSLRYDES  462

Query  420  LLMSPHSPASAKSPMVQA  367
            +++SPH   S  SP+V+A
Sbjct  463  VMLSPHIMVSTHSPLVRA  480



>gb|ABQ51839.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
 gb|ABQ51841.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=482

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GIG LKS AGL+FWMDLR+LL E T EAE+ LW++II++VKLNVSPG SFHC 
Sbjct  344  TKGLEELGIGCLKSNAGLYFWMDLRKLLEEETFEAEMVLWKVIINEVKLNVSPGSSFHCV  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD-  421
            EPGWFRVCFANMDD+T+ VAL RIRAFVR++  G   KR+     L +  SFS +  D+ 
Sbjct  404  EPGWFRVCFANMDDETVHVALKRIRAFVRKKEVG-PVKRKRFMDNLNLRLSFSSLRYDES  462

Query  420  LLMSPHSPASAKSPMVQA  367
            +++SPH   S  SP+V+A
Sbjct  463  VMLSPHIMVSPHSPLVRA  480



>gb|ABQ51840.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=490

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA + IG LKS  GLF WMDLRRLL+E T EAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  350  TRGLAQVNIGCLKSNGGLFIWMDLRRLLKEKTFEAEMALWRVIINEVKLNVSPGASFHCS  409

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA---AAKRQCRGRAL-QISTSFSRIM  430
            EPGWFRVCFANMDD TM+VAL RI  F  Q    A   A KRQC    L ++S SF R  
Sbjct  410  EPGWFRVCFANMDDLTMQVALRRIITFALQNKEAAVLPAIKRQCWQNNLGRLSLSFRR--  467

Query  429  LDDLLMSPHSPASA-KSPMVQAT  364
             DD  MSP SP S  +SP+V+AT
Sbjct  468  FDDFTMSPMSPHSPIQSPLVRAT  490



>gb|ABK95257.1| unknown [Populus trichocarpa]
Length=433

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            TRGL  +GI  LK S AGLF WMDL RLL+E T EAE+ELWR+IIH+VKLNVSPGCSFHC
Sbjct  296  TRGLDQVGIECLKTSNAGLFLWMDLSRLLKEQTFEAEMELWRVIIHEVKLNVSPGCSFHC  355

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
             +PGWFRVCFANMDD+TM+VAL RI+ FV +  G   +K+  R +      +  RI  DD
Sbjct  356  LKPGWFRVCFANMDDETMQVALSRIKTFVNKEAGTKKSKKNLRWQGSLKLLNSPRIY-DD  414

Query  420  LLMSPHSPASAKSPMVQATN  361
             + SPHSP   +SP+V+A N
Sbjct  415  FINSPHSPI-PQSPLVRARN  433



>gb|AAB70885.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
 gb|ABQ51844.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=489

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA + IG LKS  GLF WMDLRRLL+E T EAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  349  TRGLAQVNIGCLKSNGGLFIWMDLRRLLKEKTFEAEMALWRVIINEVKLNVSPGASFHCS  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA---AAKRQCRGRAL-QISTSFSRIM  430
            EPGWFRVCFANMDD TM+VAL RI  F  Q    A   A KRQC    L ++S SF R  
Sbjct  409  EPGWFRVCFANMDDLTMQVALRRIITFALQNKEAAVLPAIKRQCWQNNLGRLSLSFRR--  466

Query  429  LDDLLMSPHSPASA-KSPMVQAT  364
             DD  MSP SP S  +SP+V+AT
Sbjct  467  FDDFTMSPMSPHSPIQSPLVRAT  489



>gb|ABJ99502.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+LKS AGLF WMDLR+LL+E T +AE++LWR+II++VKLNVSPG SFHC 
Sbjct  337  TLSLSQVGIGSLKSNAGLFIWMDLRKLLKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCD  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+TM VALLRI  F+ + N     ++ CR  +L++S S  R   DD 
Sbjct  397  EPGWFRVCFANMDDNTMEVALLRITTFMHKHNEAMVPRKLCRRASLKLSLSRRR---DDF  453

Query  417  ----LMSPHSPASAKSPMVQA  367
                +MSPHSP   +SP+V+A
Sbjct  454  MSPNIMSPHSPI-PQSPLVRA  473



>gb|ABA01475.2| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
 gb|AER35094.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+LKS AGLF WMDLR+LL+E T +AE++LWR+II++VKLNVSPG SFHC 
Sbjct  337  TLSLSQVGIGSLKSNAGLFIWMDLRKLLKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCD  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+TM VALLRI  F+ + N     ++ CR  +L++S S  R   DD 
Sbjct  397  EPGWFRVCFANMDDNTMEVALLRITTFMHKHNEAMVPRKLCRRASLKLSLSRRR---DDF  453

Query  417  ----LMSPHSPASAKSPMVQA  367
                +MSPHSP   +SP+V+A
Sbjct  454  MSQNMMSPHSPI-PQSPLVRA  473



>gb|ABC75833.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%), Gaps = 8/141 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+LKS AGLF WMDLR+LL+E T +AE++LWR+II++VKLNVSPG SFHC 
Sbjct  337  TLSLSQVGIGSLKSNAGLFIWMDLRKLLKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCD  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+TM VALLRI  F+ + N     ++ CR  +L++S S  R   DD 
Sbjct  397  EPGWFRVCFANMDDNTMEVALLRITTFMHKHNEAMVPRKLCRRASLKLSLSRRR---DDF  453

Query  417  ----LMSPHSPASAKSPMVQA  367
                +MSPHSP   +SP+V+A
Sbjct  454  MSPNMMSPHSPI-PQSPLVRA  473



>ref|XP_002298013.1| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE82818.1| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=481

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            TRGL  +GI  LK S AGLF WMDL RLL+E T EAE+ELWR+IIH+VKLNVSPGCSFHC
Sbjct  344  TRGLDQVGIECLKTSNAGLFLWMDLSRLLKEQTFEAEMELWRVIIHEVKLNVSPGCSFHC  403

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
             +PGWFRVCFANMDD+TM+VAL RI+ FV +  G   +K+  R +      +  RI  DD
Sbjct  404  LKPGWFRVCFANMDDETMQVALSRIKTFVNKEAGTKKSKKNLRWQGSLKLLNSPRIY-DD  462

Query  420  LLMSPHSPASAKSPMVQATN  361
             + SPHSP   +SP+V+A N
Sbjct  463  FINSPHSPI-PQSPLVRARN  481



>gb|KHG22476.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=475

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 106/140 (76%), Gaps = 6/140 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+LKS AGLF WMDLR+LL+E T +AE++LWR+II++VKLNVSPG SFHC 
Sbjct  337  TLSLSQVGIGSLKSNAGLFIWMDLRKLLKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCD  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+TM VALLRI  F+ + N     ++ CR  +L++  S SR M D +
Sbjct  397  EPGWFRVCFANMDDNTMEVALLRITTFMHKHNEAMVPRKLCRRASLKL--SLSRRMDDFM  454

Query  417  ---LMSPHSPASAKSPMVQA  367
               +MSPHSP   +SP+V+A
Sbjct  455  SQNMMSPHSPI-PQSPLVRA  473



>ref|XP_007160107.1| hypothetical protein PHAVU_002G293000g [Phaseolus vulgaris]
 gb|ESW32101.1| hypothetical protein PHAVU_002G293000g [Phaseolus vulgaris]
Length=484

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR LL+ PT+++E+ELW++IIH+VK+NVSPG SFHC 
Sbjct  348  TGGLAKVGIKCLQSNAGLFVWMDLRHLLKTPTLDSEMELWKVIIHEVKINVSPGSSFHCT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ-CRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q      +K++ C    L++S    R   DD
Sbjct  408  EPGWFRVCYANMDDMAVQIALQRIRTFVLQNKEVVVSKKKLCWHSNLRLSLKTRR--FDD  465

Query  420  LLMSPHSPASAKSPMVQATN  361
            ++MSPHSP   +SPMV+ATN
Sbjct  466  IMMSPHSPL-PQSPMVKATN  484



>ref|NP_001236141.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
 gb|ABB70230.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
Length=484

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR+LL++PT+++E+ELWR+IIH+VK+NVSPG SFHC 
Sbjct  348  TSGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIHEVKINVSPGSSFHCT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q +      K+ C    L++S    R   DD
Sbjct  408  EPGWFRVCYANMDDMAVQIALQRIRTFVLQNKEVMVPNKKHCWHSNLRLSLKTXR--FDD  465

Query  420  LLMSPHSPASAKSPMVQAT  364
            ++MSPHSP   +SP+V+AT
Sbjct  466  IMMSPHSPI-PQSPLVKAT  483



>ref|XP_010089045.1| 1-aminocyclopropane-1-carboxylate synthase [Morus notabilis]
 gb|EXB37292.1| 1-aminocyclopropane-1-carboxylate synthase [Morus notabilis]
Length=486

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 100/140 (71%), Gaps = 5/140 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GI  LKS AGLF WMDL RLL+E T+EAE+ LW++IIH+VKLNVSPG SFHC 
Sbjct  347  TRGLAQVGISCLKSNAGLFLWMDLHRLLKEQTLEAEMALWKVIIHEVKLNVSPGSSFHCP  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA--KRQCRGRALQISTSFSRIMLD  424
            EPGWFRVC ANMDD TM VAL RIR+FV Q+        K++C  +   +  SFS    D
Sbjct  407  EPGWFRVCIANMDDHTMEVALKRIRSFVLQKKEPVVVPNKKKC-WQDHNLRLSFSARRFD  465

Query  423  DLLM-SPHSPASAKSPMVQA  367
            D LM SPHSP    SP+VQA
Sbjct  466  DFLMASPHSPI-PHSPLVQA  484



>gb|AAZ74655.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|AAZ74657.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|AAZ74658.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|AAZ74660.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|AAZ74661.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
 gb|AAZ74662.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=274

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  136  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  195

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  196  EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  253

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  254  LED-IMSPHSPL-PQSPMLRAT  273



>ref|XP_011029354.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Populus 
euphratica]
Length=481

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            TRGL  +GI  LK S AGLF WMDL RLL+E T+EAE+ELWR+IIH+VKLNVSPGCSFHC
Sbjct  344  TRGLHQVGIECLKTSNAGLFLWMDLSRLLKEQTLEAEMELWRVIIHEVKLNVSPGCSFHC  403

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
              PGWFRVCFANMDDDTM+VAL RI+ FV +       K+  R +      +  RI  DD
Sbjct  404  LNPGWFRVCFANMDDDTMQVALSRIKTFVNKEVDTKKPKKNLRWQGSLKLLNSPRIY-DD  462

Query  420  LLMSPHSPASAKSPMVQA  367
             + SPHSP   +SP+V+A
Sbjct  463  FINSPHSPI-PQSPLVRA  479



>emb|CAA77688.1| 1-aminocyclopropane 1-carboxylate synthase [Vigna radiata var. 
radiata]
Length=484

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 103/140 (74%), Gaps = 4/140 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR+LL++PT ++E ELW++IIH+VK+NVSPG SFHC 
Sbjct  348  TGGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTFDSETELWKVIIHEVKINVSPGYSFHCT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q +    + K+ C    L++S    R   DD
Sbjct  408  EPGWFRVCYANMDDMAVQIALQRIRNFVLQNKEVVVSNKKHCWHSNLRLSLKTRR--FDD  465

Query  420  LLMSPHSPASAKSPMVQATN  361
            + MSPHSP   +SPMV+ATN
Sbjct  466  ITMSPHSPL-PQSPMVKATN  484



>ref|XP_004503673.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Cicer 
arietinum]
Length=487

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 7/142 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL++PT E+ELELWR+IIH+VK+NVSPGCSFHC+
Sbjct  348  TGGLVKVGIKCLQSNGGLFVWMDLRDLLKKPTFESELELWRVIIHEVKINVSPGCSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA----KRQCRGRALQISTSFSRIM  430
            E GWFRVC+ANMDD  +++AL RIR+FV Q+N          + C    L++S    R  
Sbjct  408  EAGWFRVCYANMDDRALQIALQRIRSFVLQKNKEVMVSDKNSKPCWHSNLRLSLKSRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
             DD++MSPHSP   +SP+V+AT
Sbjct  466  FDDIMMSPHSPI-PQSPLVKAT  486



>gb|AAZ74656.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=274

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  136  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  195

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TM +++ RIR FV Q +      K+Q  C R  +L++  S SR +
Sbjct  196  EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLS-SRGL  254

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
             D  +MSPHSP   +SPM++AT
Sbjct  255  ED--IMSPHSPL-PQSPMLRAT  273



>gb|KCW44153.1| hypothetical protein EUGRSUZ_L02436 [Eucalyptus grandis]
Length=208

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR II++ KLNVSPG SFHC+
Sbjct  68   TDGLHQVGIKCLSGNAGLFLWMDLRELLMESTVEAETALWRGIINEFKLNVSPGSSFHCS  127

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++TM+VAL RIR FVR+       K +CR   L++  SF R  +DD+
Sbjct  128  EPGWFRVCIANMNEETMKVALARIREFVRRNGDKLNRKEKCRQSDLRLRLSFRR--MDDV  185

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+VQA
Sbjct  186  LRSPCIMSPHSPI-PQSPLVQA  206



>emb|CAN77934.1| hypothetical protein VITISV_021265 [Vitis vinifera]
Length=456

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            +RGL+ +GIG LKS AGLFFWMDLRRLL+EPTVEAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  319  SRGLSQVGIGCLKSNAGLFFWMDLRRLLKEPTVEAEMALWRLIINEVKLNVSPGSSFHCS  378

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQISTSF  442
            EPGWFRVCFANMDD+TM VAL RIR FV + +    +AKRQ     L++  SF
Sbjct  379  EPGWFRVCFANMDDETMEVALRRIRNFVLKAKEKEVSAKRQRWQNNLKVRLSF  431



>ref|XP_010041706.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like, partial 
[Eucalyptus grandis]
Length=250

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR II++ KLNVSPG SFHC+
Sbjct  110  TDGLHQVGIKCLSGNAGLFLWMDLRELLMESTVEAETALWRGIINEFKLNVSPGSSFHCS  169

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++TM+VAL RIR FVR+       K +CR   L++  SF R  +DD+
Sbjct  170  EPGWFRVCIANMNEETMKVALARIREFVRRNGDKLNRKEKCRQSDLRLRLSFRR--MDDV  227

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+VQA
Sbjct  228  LRSPCIMSPHSPI-PQSPLVQA  248



>ref|XP_002276774.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Vitis vinifera]
Length=474

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  + I  LKS AGLF WMDLR LL+EPT+E E+ LWR+II DVKLNVSPG SF C+
Sbjct  336  TEGLVNVNINCLKSNAGLFVWMDLRHLLKEPTLEGEIALWRVIIKDVKLNVSPGSSFQCS  395

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMD+DT+ VAL RIR FV + +    A  +  R +   +  SFS  + D+
Sbjct  396  EPGWFRVCFANMDEDTVEVALKRIRTFVGKGQEEAEAPTKAKRWKNSTLRLSFSSRIYDE  455

Query  420  LLMSPHSPASAKSPMVQA  367
             +MSPHSP    SP+V+A
Sbjct  456  AVMSPHSPM-PHSPLVRA  472



>gb|AAZ74659.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=274

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 106/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNV PG SFHC+
Sbjct  136  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVLPGSSFHCS  195

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  196  EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  253

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  254  LED-IMSPHSPL-PQSPMLRAT  273



>gb|AAL35745.1| 1-aminocyclopropanecarboxylic acid synthase [Medicago truncatula]
Length=487

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 7/142 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL+E T+E+ELELWR+IIH+VK+NVSPG SFHC+
Sbjct  348  TSGLTKVGINCLQSNGGLFVWMDLRGLLKEATLESELELWRVIIHEVKINVSPGVSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ----CRGRALQISTSFSRIM  430
            EPGWFRVC+ANMDD  +++AL RIR+FV Q N       +    C    L++S    R  
Sbjct  408  EPGWFRVCYANMDDRDVQIALQRIRSFVVQNNKEVMVSEKNTKPCWHSNLRLSLKTRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
             DD++MSPHSP   +SP+V+AT
Sbjct  466  FDDIVMSPHSPF-PQSPLVKAT  486



>gb|KHN16788.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=484

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR+LL++PT+++E+ELWR+II +VK+NVSPG SFHC 
Sbjct  348  TSGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q +      K+ C    L++S    R   DD
Sbjct  408  EPGWFRVCYANMDDMAVQIALQRIRTFVLQNKEVMVPNKKHCWHSNLRLSLKTRR--FDD  465

Query  420  LLMSPHSPASAKSPMVQAT  364
            ++MSPHSP   +SP+V+AT
Sbjct  466  IMMSPHSPI-PQSPLVKAT  483



>gb|KEH21137.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=487

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 100/142 (70%), Gaps = 7/142 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL+E T E+ELELWR+IIH+VK+NVSPG SFHC+
Sbjct  348  TSGLTKVGINCLQSNGGLFVWMDLRGLLKEATFESELELWRVIIHEVKINVSPGVSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ----CRGRALQISTSFSRIM  430
            EPGWFRVC+ANMDD  +++AL RIR+FV Q N       +    C    L++S    R  
Sbjct  408  EPGWFRVCYANMDDRDVQIALQRIRSFVVQNNKEVMVSEKNTKPCWHSNLRLSLKTRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
             DD++MSPHSP   +SP+V+AT
Sbjct  466  FDDIVMSPHSPF-PQSPLVKAT  486



>gb|AFM93771.1| ACC synthetase [Boehmeria nivea]
Length=489

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 98/142 (69%), Gaps = 6/142 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GI  LKS AGLF WMDL RLL+E + EAE+ LWR+II++VKLNVSPG SFHC 
Sbjct  347  TRGLAQVGITCLKSNAGLFMWMDLHRLLKEQSFEAEMALWRVIINEVKLNVSPGVSFHCP  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA--KRQCRGRALQISTSFSRI---  433
            EPGWFRVC ANMDD TM VAL RIR+FV +         K++C      +  SF  +   
Sbjct  407  EPGWFRVCIANMDDHTMEVALKRIRSFVMKNKEVVVVPNKKKCWQDHSHLRLSFPAMRGG  466

Query  432  MLDDLLMSPHSPASAKSPMVQA  367
              DD LMSPHSP   +SP+VQA
Sbjct  467  RFDDFLMSPHSPM-PQSPLVQA  487



>gb|KDP25384.1| hypothetical protein JCGZ_20540 [Jatropha curcas]
Length=484

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 99/138 (72%), Gaps = 6/138 (4%)
 Frame = -1

Query  771  GLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            GLA  GI  LK S AGLF WMDLRRLL++ TVE E  LWRIII+DVKLNVSPG SFHC E
Sbjct  350  GLAQAGIKCLKTSNAGLFVWMDLRRLLKDQTVEGETALWRIIINDVKLNVSPGSSFHCTE  409

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ-CRGRALQISTSFSRIMLDDL  418
            PGWFRVCFANMD+ TM VAL RIR FV Q       K++ C   +L++  SFS  + DD 
Sbjct  410  PGWFRVCFANMDNHTMDVALSRIRTFVLQNKEAMKPKKKLCWQGSLKL--SFSSRIYDDF  467

Query  417  LMSPHSPASAKSPMVQAT  364
            +MSPHS    +SPMV+AT
Sbjct  468  IMSPHS--RPQSPMVRAT  483



>gb|KHM99945.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=481

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR+LL++PT+++E+ELWR+II +VK+NVSPG SFHC 
Sbjct  345  TGGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCT  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q +      K+ C    L++S    R   DD
Sbjct  405  EPGWFRVCYANMDDMAVQIALQRIRNFVLQNKEIMVPNKKHCWHSNLRLSLKTRR--FDD  462

Query  420  LLMSPHSPASAKSPMVQAT  364
            ++MSPHSP   +SP+V+AT
Sbjct  463  IMMSPHSPI-PQSPLVKAT  480



>ref|NP_001236858.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
 sp|P31531.1|1A1C_SOYBN RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Glycine max]
 emb|CAA47474.1| 1-aminocyclopropane 1-carboxylate synthase [Glycine max]
 prf||2019442A aminocyclopropane carboxylate synthase
Length=484

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR+LL++PT+++E+ELWR+II +VK+NVSPG SFHC 
Sbjct  348  TGGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q +      K+ C    L++S    R   DD
Sbjct  408  EPGWFRVCYANMDDMAVQIALQRIRNFVLQNKEIMVPNKKHCWHSNLRLSLKTRR--FDD  465

Query  420  LLMSPHSPASAKSPMVQAT  364
            ++MSPHSP   +SP+V+AT
Sbjct  466  IMMSPHSPI-PQSPLVKAT  483



>gb|AAL66205.1|AF386523_1 1-aminocyclopropane 1-carboxylate synthase 5 [Pyrus communis]
Length=487

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 99/143 (69%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +G   LKS  GLF WMDLRRLL+E T EAE+ELWR IIH+VKLNVSPG SFHC 
Sbjct  346  TMELAQVGTSCLKSNGGLFVWMDLRRLLKEQTFEAEMELWRTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSF-SRIMLDD  421
            EPGWFRVCFANMDD TM VAL RIR FV Q       ++  R     + ++F SR M D+
Sbjct  406  EPGWFRVCFANMDDKTMEVALTRIRTFVLQDKEAIVPRKSNRLWKATLGSAFQSRRMDDN  465

Query  420  L----LMSPHSPASAKSPMVQAT  364
            +    +MSPH+P   +SP+V+AT
Sbjct  466  MMSPCMMSPHTPI-PQSPLVRAT  487



>dbj|BAA94599.1| 1-aminocyclopropane-1-carboxylate synthase [Populus euphratica]
Length=481

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            TRGL  +GI  LK S AGLF WMDL RLL++ T +AE+ELWR+IIH+VKLNVSPGCSFHC
Sbjct  344  TRGLDQVGIECLKTSNAGLFLWMDLSRLLKQQTFKAEMELWRVIIHEVKLNVSPGCSFHC  403

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
             +PGWFRVCFANMDD+TM+VAL RI+ FV +      +++  R +      +  RI  DD
Sbjct  404  LKPGWFRVCFANMDDETMQVALSRIKTFVNKEADTKKSRKNLRWQGSLKLLNSPRIY-DD  462

Query  420  LLMSPHSPASAKSPMVQATN  361
             + SPHSP   +SP+V+A N
Sbjct  463  FINSPHSPI-PQSPLVRARN  481



>ref|XP_009363394.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=487

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 94/143 (66%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +G   LKS  GLF WMDLRRLL+E T EAE+ LWR IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVGTSCLKSNGGLFVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD-  421
            EPGWFRVCFANMDD TM VAL RIR FV Q       ++  R     +  SF     DD 
Sbjct  406  EPGWFRVCFANMDDKTMEVALTRIRTFVLQDKEAIEPRKSNRSWQRNLRLSFQSRRTDDN  465

Query  420  ----LLMSPHSPASAKSPMVQAT  364
                 +MSPH+P   +SP+V+AT
Sbjct  466  MMSPCMMSPHTPI-PQSPLVRAT  487



>gb|AAQ14268.1|AF248737_1 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG L+ + GLF WMDLR LL+E T+EAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  347  TKGLAQVGIGYLQGSGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ--C-RGRALQISTSFSRIML  427
            EPGWFRVCFANMDD TM +++ RIR FV Q       K+   C R  +L++  S  R  L
Sbjct  407  EPGWFRVCFANMDDKTMDISITRIRTFVLQNKEATKIKKHKFCWRQSSLELRLSSRR--L  464

Query  426  DDLLMSPHSPASAKSPMVQAT  364
            +D +MSPHSP   +SPM++AT
Sbjct  465  ED-IMSPHSPL-PQSPMLRAT  483



>gb|ACK43795.1| 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG L+ + GLF WMDLR LL+E T+EAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  347  TKGLAQVGIGYLQGSGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ--C-RGRALQISTSFSRIML  427
            EPGWFRVCFANMDD TM +++ RIR FV Q       K+   C R  +L++  S  R  L
Sbjct  407  EPGWFRVCFANMDDKTMDISITRIRTFVLQNKEATKIKKHKFCWRQSSLELRLSSRR--L  464

Query  426  DDLLMSPHSPASAKSPMVQAT  364
            +D +MSPHSP   +SPM++AT
Sbjct  465  ED-IMSPHSPL-PQSPMLRAT  483



>gb|AAQ14266.1|AF248735_1 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG L+ + GLF WMDLR LL+E T+EAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  347  TKGLAQVGIGYLQGSGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ--C-RGRALQISTSFSRIML  427
            EPGWFRVCFANMDD TM +++ RIR FV Q       K+   C R  +L++  S  R  L
Sbjct  407  EPGWFRVCFANMDDKTMDISITRIRTFVLQNKEATKIKKHKFCWRQSSLELRLSSRR--L  464

Query  426  DDLLMSPHSPASAKSPMVQAT  364
            +D +MSPHSP   +SPM++AT
Sbjct  465  ED-IMSPHSPL-PQSPMLRAT  483



>ref|XP_009343873.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=487

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 94/143 (66%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +G   LKS  GLF WMDLRRLL+E T EAE+ LWR IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVGTSCLKSNGGLFVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD-  421
            EPGWFRVCFANMDD TM +AL RIR FV Q       ++  R     +  SF     DD 
Sbjct  406  EPGWFRVCFANMDDKTMEIALTRIRTFVLQDKEAIVPRKSNRSWQRNLRLSFQSRRTDDN  465

Query  420  ----LLMSPHSPASAKSPMVQAT  364
                 +MSPH+P   +SP+V+AT
Sbjct  466  MMSPCMMSPHTPI-PQSPLVRAT  487



>emb|CBI40404.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  + I  LKS AGLF WMDLR LL+EPT+E E+ LWR+II DVKLNVSPG SF C+
Sbjct  295  TEGLVNVNINCLKSNAGLFVWMDLRHLLKEPTLEGEIALWRVIIKDVKLNVSPGSSFQCS  354

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMD+DT+ VAL RIR FV + +    A  +  R +   +  SFS  + D+
Sbjct  355  EPGWFRVCFANMDEDTVEVALKRIRTFVGKGQEEAEAPTKAKRWKNSTLRLSFSSRIYDE  414

Query  420  LLMSPHSP  397
             +MSPHSP
Sbjct  415  AVMSPHSP  422



>gb|KCW44151.1| hypothetical protein EUGRSUZ_L024352, partial [Eucalyptus grandis]
Length=331

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L S AGLF WMDL+  LRE TVEAE  LWR+II+DVKLNVSPG SFHC+
Sbjct  191  TDGLRQVGIKCLNSNAGLFLWMDLKGFLRESTVEAETALWRVIINDVKLNVSPGSSFHCS  250

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA-KRQCRGRALQISTSFSRIMLDD  421
            EPGWFR+C ANM+++TM+VAL RI+ FV QRNG     K +C    L++  SF R  +DD
Sbjct  251  EPGWFRICIANMNEETMKVALARIQKFV-QRNGDKLNRKEKCWQSDLRLRLSFRR--MDD  307

Query  420  LL-----MSPHSPASAKSPMVQA  367
            +L     MSPHSP   +SP+V+A
Sbjct  308  VLRSPCSMSPHSPI-PQSPLVRA  329



>gb|ABO76785.1| 1-aminocyclopropane-1-carboxylate synthase [Citrullus colocynthis 
x Citrullus lanatus var. lanatus]
Length=486

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  348  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  408  EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTKIKKQKFCWRQSSLELRLSSRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  466  LED-IMSPHSPL-PQSPMLRAT  485



>ref|XP_006444953.1| hypothetical protein CICLE_v10019970mg [Citrus clementina]
 ref|XP_006491186.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Citrus sinensis]
 gb|ESR58193.1| hypothetical protein CICLE_v10019970mg [Citrus clementina]
 gb|KDO86308.1| hypothetical protein CISIN_1g011801mg [Citrus sinensis]
Length=477

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 4/140 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLFFWMDLR LL+E T+E E+ LWR I++DVKLNVSPG SF C 
Sbjct  337  TKGLEQVGINCLKSNAGLFFWMDLRHLLKEKTLEGEIALWRTIVNDVKLNVSPGSSFQCT  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTS---FSRIML  427
            EPGWFRVCFANMDDDT++VAL RI AFV+Q        ++   + L++S S   + + ++
Sbjct  397  EPGWFRVCFANMDDDTLQVALNRIAAFVQQDKESEKPTKKRWQQNLRVSFSSRIYEQGVM  456

Query  426  DDLLMSPHSPASAKSPMVQA  367
               +MSPHSP   +SP+V+A
Sbjct  457  SPHMMSPHSPI-PQSPLVRA  475



>emb|CAB60831.1| ACC synthase [Citrus sinensis]
Length=477

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 4/140 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLFFWMDLR LL+E T+E E+ LWR I++DVKLNVSPG SF C 
Sbjct  337  TKGLEQVGINCLKSNAGLFFWMDLRHLLKEKTLEGEIALWRTIVNDVKLNVSPGSSFQCT  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTS---FSRIML  427
            EPGWFRVCFANMDDDT++VAL RI AFV+Q        ++   + L++S S   + + ++
Sbjct  397  EPGWFRVCFANMDDDTLQVALNRIAAFVQQDKESEKPTKKRWQQNLRVSFSSRIYEQGVM  456

Query  426  DDLLMSPHSPASAKSPMVQA  367
               +MSPHSP   +SP+V+A
Sbjct  457  SPHMMSPHSPI-PQSPLVRA  475



>ref|XP_004160953.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Cucumis 
sativus]
 gb|KGN53353.1| hypothetical protein Csa_4G049610 [Cucumis sativus]
Length=489

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  351  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  410

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  411  EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  468

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  469  LED-IMSPHSPL-PQSPMLRAT  488



>gb|ACT54524.2| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
 gb|ACZ63266.1| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
Length=487

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 98/143 (69%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +G   LKS  GLF WMDLRRLL++ T EAE+ LWR IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVGTSCLKSNGGLFVWMDLRRLLKDQTFEAEMVLWRTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSF-SRIMLDD  421
            EPGWFRVCFANMDD TM VAL RIR FV Q       ++  R     +  SF SR M D+
Sbjct  406  EPGWFRVCFANMDDKTMEVALTRIRTFVLQDKEAIVPRKSNRLWQSNLRLSFQSRRMDDN  465

Query  420  L----LMSPHSPASAKSPMVQAT  364
            +    +MSPH+P   +SP+V+AT
Sbjct  466  MMSPCMMSPHTPI-PQSPLVRAT  487



>ref|NP_001280870.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
 dbj|BAA92351.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
Length=487

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 94/143 (66%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +    LKS  GLF WMDLRRLL+E T EAE+ LWR IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVSTNCLKSNGGLFVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM VAL RIR FV Q       ++  R     +  SF    +DD 
Sbjct  406  EPGWFRVCFANMDDKTMEVALTRIRTFVLQNKEAIVPRKSNRLWHSNLRLSFQSRRMDDT  465

Query  417  -----LMSPHSPASAKSPMVQAT  364
                 +MSPH+P   +SP+V+AT
Sbjct  466  MMSPCMMSPHTPI-PQSPLVRAT  487



>dbj|BAB18464.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=490

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  352  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  411

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  412  EPGWFRVCFANMDDSTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  469

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  470  LED-IMSPHSPL-PQSPMLRAT  489



>ref|XP_008452008.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Cucumis 
melo]
Length=490

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  352  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  411

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  412  EPGWFRVCFANMDDSTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  469

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  470  LED-IMSPHSPL-PQSPMLRAT  489



>ref|XP_002509858.1| acc synthase, putative [Ricinus communis]
 gb|EEF51245.1| acc synthase, putative [Ricinus communis]
 gb|AGB96761.1| 1-aminocyclopropane-1-carboxylate synthase [Ricinus communis]
Length=480

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T+GLA +GI  LK S AGLF WMDLRRLL++ +VE E+ LWR+II+DVKLNVSPG SFHC
Sbjct  343  TKGLAQVGIRCLKTSNAGLFLWMDLRRLLKDQSVEGEMALWRVIINDVKLNVSPGSSFHC  402

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
             E GWFRVCFANMDD TM VAL RIR FV Q        ++   ++  +  SFS  + DD
Sbjct  403  TEAGWFRVCFANMDDKTMEVALSRIRTFVLQNKEAMKPMKKLLWQS-SLKLSFSSRIYDD  461

Query  420  LLMSPHSPASAKSPMVQATN  361
             +MSP SP   +SP+V+A N
Sbjct  462  FIMSPRSPI-PQSPLVRARN  480



>gb|ABM66813.1| ACC synthase [Gossypium hirsutum]
Length=493

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 106/149 (71%), Gaps = 13/149 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI T+KS AGLFFWMD+R+LL+E T +AE+ELWR+II+ VKLNVSPG SF C+
Sbjct  344  TKGLEEVGISTIKSNAGLFFWMDMRQLLKEQTTKAEIELWRVIINKVKLNVSPGSSFQCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ--------RNGGAAAKRQCRGRALQISTSF  442
            EPGWFRVCFANMDD T+ VAL RIR FV Q         +   A  ++ R + L++S S 
Sbjct  404  EPGWFRVCFANMDDKTVEVALDRIREFVLQGKEETKLEADKSQAQAQRWRKQNLRLSFSS  463

Query  441  SRIMLDDLLMSPH--SPAS--AKSPMVQA  367
            SR + D+ LMSPH  SP S    SP+V+A
Sbjct  464  SR-LYDESLMSPHMISPHSPIPHSPLVRA  491



>dbj|BAA93713.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=490

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  352  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  411

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  412  EPGWFRVCFANMDDSTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  469

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM++AT
Sbjct  470  LED-VMSPHSPL-PQSPMLRAT  489



>ref|XP_007210019.1| hypothetical protein PRUPE_ppa016458mg [Prunus persica]
 gb|EMJ11218.1| hypothetical protein PRUPE_ppa016458mg [Prunus persica]
Length=483

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +G   LKS  GLF WMDL +LL+E T EAE+ LW  IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVGTSCLKSNGGLFVWMDLHKLLKEQTFEAEMALWHTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM +AL RIR FV Q N   A ++  R     +  SF    ++D+
Sbjct  406  EPGWFRVCFANMDDKTMEIALTRIRTFVLQDNEAVAPRKNNRFWQSNLRLSFQSRRMEDI  465

Query  417  LMSPHSPASAKSPMVQA  367
            +MSP    S +SP+V+A
Sbjct  466  MMSP-CIMSPQSPLVRA  481



>ref|NP_001053637.1| Os04g0578000 [Oryza sativa Japonica Group]
 emb|CAE03249.1| OSJNBa0011J08.4 [Oryza sativa Japonica Group]
 dbj|BAF15551.1| Os04g0578000 [Oryza sativa Japonica Group]
 dbj|BAG89048.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GIG L+  AGLF WMDLRR+LRE T EAELELWR+I+H VKLNVSPG SFHC 
Sbjct  344  TSGLREVGIGCLRGNAGLFSWMDLRRMLREKTAEAELELWRVIVHQVKLNVSPGTSFHCR  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG-GAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC ANMDD+TM VAL RI  FVRQ       A+R    R L++S      +   
Sbjct  404  EPGWFRVCHANMDDETMEVALGRIHDFVRQHQQRRVKAERWAANRQLRLSLPHHHHLSPA  463

Query  420  LLMSPHSPASAKSPMVQATN  361
             L SP +  S +SPMV+AT+
Sbjct  464  HLSSPLALLSPQSPMVRATS  483



>ref|NP_001267589.1| 1-aminocyclopropane-1-carboxylate synthase-like [Cucumis sativus]
 dbj|BAA33375.1| ACC synthase [Cucumis sativus]
 dbj|BAA93715.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=489

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 106/142 (75%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GLA +GIG LK + GLF WMDLR LL+E T+EAE+ LW++II++VKLNVSPG SFHC+
Sbjct  351  TKGLAQVGIGYLKGSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCS  410

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQ--C-RGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+TM +++ RIR FV Q +      K+Q  C R  +L++  S  R  
Sbjct  411  EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTKVKKQKFCWRQSSLELRLSSRR--  468

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            L+D +MSPHSP   +SPM +AT
Sbjct  469  LED-IMSPHSPL-PQSPMHRAT  488



>emb|CAH66732.1| H0404F02.8 [Oryza sativa Indica Group]
 gb|EAY95255.1| hypothetical protein OsI_17075 [Oryza sativa Indica Group]
Length=483

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GIG L+  AGLF WMDLRR+LRE T EAELELWR+I+H VKLNVSPG SFHC 
Sbjct  344  TSGLREVGIGCLRGNAGLFSWMDLRRMLREKTAEAELELWRVIVHQVKLNVSPGTSFHCR  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG-GAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC ANMDD+TM VAL RI  FVRQ       A+R    R L++S      +   
Sbjct  404  EPGWFRVCHANMDDETMEVALGRIHDFVRQHQQRRVKAERWAANRQLRLSLPHHHHLSPA  463

Query  420  LLMSPHSPASAKSPMVQATN  361
             L SP +  S +SPMV+AT+
Sbjct  464  HLSSPLALLSPQSPMVRATS  483



>ref|XP_007040350.1| 1-aminocyclopropane-1-carboxylate synthase isoform 2 [Theobroma 
cacao]
 gb|EOY24851.1| 1-aminocyclopropane-1-carboxylate synthase isoform 2 [Theobroma 
cacao]
Length=424

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 10/143 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+L+S AGLF WMDLR+LL+E T +AE++LW++II +VKLNVSPG SFHC 
Sbjct  284  TWSLSQVGIGSLQSNAGLFIWMDLRKLLKEKTFKAEMDLWQVIIKEVKLNVSPGSSFHCQ  343

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ-CRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMDD+T+ VAL+RIR F+ + N     + + CR  +L++S S  +   DD
Sbjct  344  EPGWFRVCFANMDDNTVEVALMRIRTFMLKNNEAMVPRSKLCRRSSLKLSLSRRK---DD  400

Query  420  L-----LMSPHSPASAKSPMVQA  367
                  +MSPHSP    SP+V+A
Sbjct  401  FITSPGIMSPHSPLPT-SPLVRA  422



>gb|EYU32170.1| hypothetical protein MIMGU_mgv1a025862mg [Erythranthe guttata]
Length=464

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 99/140 (71%), Gaps = 6/140 (4%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            +GL  M I  LKS AGLF WMDLR LL+EPT E E+ LWR+II DVKLNVSPG SFHC E
Sbjct  325  KGLDKMDIQCLKSNAGLFCWMDLRPLLKEPTFEGEMGLWRMIISDVKLNVSPGSSFHCHE  384

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFV--RQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            PGWFRVCFANMDD+T+ +AL RIR FV   ++    A K+  R R L++S S S I+ DD
Sbjct  385  PGWFRVCFANMDDETLEIALRRIRMFVGKHKQVEEQAKKKSWRERNLKLSFS-SLILYDD  443

Query  420  LLM--SPHSPASAKSPMVQA  367
              M  SPHSP   +SP+V A
Sbjct  444  QTMTPSPHSPI-PQSPLVSA  462



>ref|XP_008238953.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Prunus 
mume]
Length=483

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +G   LKS  GLF WMDL +LL+E T EAE+ LW  IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVGTSCLKSNGGLFVWMDLHKLLKEQTFEAEMALWHTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM +AL RIR FV Q     A +++ R     +  SF    +DD+
Sbjct  406  EPGWFRVCFANMDDKTMEIALTRIRTFVLQDKEAVAPRKKNRFWQSNLRLSFQSRRMDDI  465

Query  417  LMSPHSPASAKSPMVQA  367
            +MSP    S +SP+V+A
Sbjct  466  MMSP-CMMSPQSPLVRA  481



>ref|XP_010041705.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=432

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L S AGLF WMDL+  LRE TVEAE  LWR+II+DVKLNVSPG SFHC+
Sbjct  292  TDGLRQVGIKCLNSNAGLFLWMDLKGFLRESTVEAETALWRVIINDVKLNVSPGSSFHCS  351

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA-KRQCRGRALQISTSFSRIMLDD  421
            EPGWFR+C ANM+++TM+VAL RI+ FV QRNG     K +C    L++  SF R  +DD
Sbjct  352  EPGWFRICIANMNEETMKVALARIQKFV-QRNGDKLNRKEKCWQSDLRLRLSFRR--MDD  408

Query  420  LL-----MSPHSPASAKSPMVQA  367
            +L     MSPHSP   +SP+V+A
Sbjct  409  VLRSPCSMSPHSPI-PQSPLVRA  430



>ref|XP_010055081.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=486

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 97/143 (68%), Gaps = 9/143 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
              GL   GI  L+  AGLF WMDLR LL+EPT +AE+ELWR+II DVKLNVSPG SFHC 
Sbjct  345  VEGLKQEGINCLEGNAGLFLWMDLRHLLKEPTPDAEMELWRVIIKDVKLNVSPGSSFHCP  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPG+FRVCFANMDD T+ VAL RIR FV + N     K+  R R L++  SF+    D+ 
Sbjct  405  EPGFFRVCFANMDDHTVEVALQRIREFVSKGNKNGDDKKHWRKRDLRL--SFTSRKCDES  462

Query  417  L------MSPHSPASAKSPMVQA  367
            L      MSPHSP   +SP+V+A
Sbjct  463  LISPRQIMSPHSPV-PQSPLVRA  484



>ref|XP_007040349.1| 1-aminocyclopropane-1-carboxylate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY24850.1| 1-aminocyclopropane-1-carboxylate synthase isoform 1 [Theobroma 
cacao]
Length=478

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 10/143 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+L+S AGLF WMDLR+LL+E T +AE++LW++II +VKLNVSPG SFHC 
Sbjct  338  TWSLSQVGIGSLQSNAGLFIWMDLRKLLKEKTFKAEMDLWQVIIKEVKLNVSPGSSFHCQ  397

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ-CRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMDD+T+ VAL+RIR F+ + N     + + CR  +L++S S  +   DD
Sbjct  398  EPGWFRVCFANMDDNTVEVALMRIRTFMLKNNEAMVPRSKLCRRSSLKLSLSRRK---DD  454

Query  420  L-----LMSPHSPASAKSPMVQA  367
                  +MSPHSP    SP+V+A
Sbjct  455  FITSPGIMSPHSPLPT-SPLVRA  476



>gb|KHG05668.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=480

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG+LKS  GLF WMDLR+LL+E T +AE++LWR+II++VKLNVSPG SFHC 
Sbjct  337  TWSLSQVGIGSLKSNGGLFIWMDLRKLLKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCH  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQC-RGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMDD+TM VAL RIR+F+ + N     ++ C R       +      +DD
Sbjct  397  EPGWFRVCFANMDDNTMEVALSRIRSFILKNNESIVPRKLCRRSSLKLSLSRSLSRRMDD  456

Query  420  L-----LMSPHSPASAKSPMVQA  367
                  +MSPHSP   +SP+V+A
Sbjct  457  FMSPAGIMSPHSPL-PQSPLVRA  478



>gb|ACD87813.1| putative ACC synthase [Vicia faba]
Length=487

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL+  T E+ELELWR+IIH+VK+NVSPG SFHC+
Sbjct  348  TSGLIKVGIKCLQSNGGLFVWMDLRGLLKNATFESELELWRVIIHEVKINVSPGVSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA----KRQCRGRALQISTSFSRIM  430
            EPGWFRVC+AN DD  +++AL RIR+FV Q N  A       + C    L++S    R  
Sbjct  408  EPGWFRVCYANKDDRDVQIALQRIRSFVTQNNKEAMVSDKNSKPCWHSNLRLSLKSRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQA  367
             DD++MSPHSP   +SP+V+A
Sbjct  466  FDDIMMSPHSPI-PQSPLVKA  485



>ref|XP_010053217.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
 gb|KCW77478.1| hypothetical protein EUGRSUZ_D01817 [Eucalyptus grandis]
Length=486

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L S AGLF WMDL+  LRE TVEAE  LWR+II+DVKLNVSPG SFHC+
Sbjct  346  TDGLRQVGIKCLNSNAGLFLWMDLKGFLRESTVEAETALWRVIINDVKLNVSPGSSFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA-KRQCRGRALQISTSFSRIMLDD  421
            EPGWFR+C ANM+++TM+VAL RI+ FV QRNG     K +C    L++  SF R  +DD
Sbjct  406  EPGWFRICIANMNEETMKVALARIQKFV-QRNGDKLNRKEKCWQSDLRLRLSFRR--MDD  462

Query  420  LL-----MSPHSPASAKSPMVQA  367
            +L     MSPHSP   +SP+V+A
Sbjct  463  VLRSPCSMSPHSPI-PQSPLVRA  484



>gb|AAD04199.1| 1-aminocyclopropane-1-carboxylate synthase [Pisum sativum]
Length=487

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 99/142 (70%), Gaps = 7/142 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL+  T E+E+ELWR+IIH+VK+NVSPG SFHC+
Sbjct  348  TGGLIKVGIKCLQSNGGLFVWMDLRGLLKNATFESEIELWRVIIHEVKINVSPGVSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRN----GGAAAKRQCRGRALQISTSFSRIM  430
            EPGWFRVC+ANMDD  +++AL RIR+FV Q N    G     +      L++S    R  
Sbjct  408  EPGWFRVCYANMDDRDVQIALQRIRSFVTQNNKEAMGSDKNSKPYWHSNLRLSLKPRR--  465

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
             DD++MSPHSP   +SP+V+AT
Sbjct  466  FDDIMMSPHSPI-PQSPLVKAT  486



>ref|XP_007158530.1| hypothetical protein PHAVU_002G159800g, partial [Phaseolus vulgaris]
 gb|ESW30524.1| hypothetical protein PHAVU_002G159800g, partial [Phaseolus vulgaris]
Length=424

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 98/136 (72%), Gaps = 5/136 (4%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            RGL  +GI  L S+ GLF WMDLR LL++ T EAE+ELWR+I+  VK+N+SPG SFHC+E
Sbjct  292  RGLGQVGIKCLASSGGLFLWMDLRGLLKKATFEAEMELWRVIVQQVKINISPGSSFHCSE  351

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDLL  415
            PGWFRVC+ANMD   + V+L R+R FV Q     A K+ C  R L++  SFS   LD+ L
Sbjct  352  PGWFRVCYANMDARAVEVSLARMRIFVHQNT--EARKKSCSYRKLRL--SFSSRRLDEFL  407

Query  414  MSPHSPASAKSPMVQA  367
            +SPHSP S +SP+V+A
Sbjct  408  VSPHSPFS-QSPLVKA  422



>gb|AAC98809.1| ACC synthase [Carica papaya]
Length=487

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 101/141 (72%), Gaps = 5/141 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ LA +GI  LKS AGLF WMDLRRLL+E T EAE+ LWR+II+++KLNVSPG SFHC+
Sbjct  346  TQRLAQVGINCLKSNAGLFVWMDLRRLLKEQTFEAEMVLWRVIINEIKLNVSPGSSFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQ-CRGRALQISTS--FSRIM-  430
            EPGWFRVCFANMDD TM +AL RI+ F+ Q       K++ C   +L++S S  +  IM 
Sbjct  406  EPGWFRVCFANMDDKTMEIALSRIKTFMLQHKEAMVPKKKLCWQTSLRLSFSSRYEDIME  465

Query  429  LDDLLMSPHSPASAKSPMVQA  367
                 MSPHSP   +SP+V+A
Sbjct  466  TPGSFMSPHSPI-PQSPLVRA  485



>dbj|BAJ65574.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus pyrifolia var. 
culta]
Length=487

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 95/143 (66%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +G   LKS  GLF WMDLRRLL+E T +AE+ LW  IIH+VKLNVSPG SFHC 
Sbjct  346  TMELAQVGTSCLKSNGGLFVWMDLRRLLKEQTFDAEMVLWHKIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM +AL RIR FV Q     A ++  R     +  SF    +DD+
Sbjct  406  EPGWFRVCFANMDDKTMEIALSRIRNFVAQFKEPIAPRKNNRYWKSNLRLSFQSRRMDDI  465

Query  417  -----LMSPHSPASAKSPMVQAT  364
                 +MSPHSP   +SP+V+AT
Sbjct  466  MMSPCMMSPHSPI-PQSPLVRAT  487



>emb|CAN69483.1| hypothetical protein VITISV_035777 [Vitis vinifera]
Length=481

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  + I  LKS AGLF WMDLR LL+EPT+E E+ LWR+II DVKLNVSPG SF C+
Sbjct  336  TEGLVNVNINCLKSNAGLFVWMDLRHLLKEPTLEGEIALWRVIIKDVKLNVSPGSSFQCS  395

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVCFANMD+DT+ VAL RIR FV + +    A  +  R +   +  SFS  + D+
Sbjct  396  EPGWFRVCFANMDEDTVEVALKRIRTFVGKGQEEAEAPTKAKRWKNSTLRLSFSSRIYDE  455

Query  420  LL-------MSPHSPASAKSPMVQA  367
             +       MSPHSP    SP+V+A
Sbjct  456  AVMTPLTMSMSPHSPM-PHSPLVRA  479



>gb|AFT92042.2| 1-aminocyclopropane-1-carboxylate synthase [Paeonia lactiflora]
Length=492

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 97/147 (66%), Gaps = 11/147 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GI  LKS AGLF WMDL  LL+E TVE EL LWR+II++VKLNVSPG SFHC+
Sbjct  347  TRGLAQVGINFLKSNAGLFLWMDLSSLLKEKTVEEELTLWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM VAL RIR F  +       +++   +   +  SF     DD+
Sbjct  407  EPGWFRVCFANMDDATMEVALRRIRTFALKAKEADVPRKKQSWQNNNLRFSFKSGKYDDV  466

Query  417  LM----------SPHSPASAKSPMVQA  367
            L+          SPHSP   +SP+V+A
Sbjct  467  LLSPRMMSPCMRSPHSPI-PQSPLVRA  492



>ref|NP_001280768.1| 1-aminocyclopropane-1-carboxylate synthase-like [Malus domestica]
 dbj|BAA92350.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
Length=487

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 93/143 (65%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L  +G   L S  GLF WMDLRRLL+E T EAE+ LW  IIH+VKLNVSPG SFHC 
Sbjct  346  TMELDQVGTSCLNSNGGLFVWMDLRRLLKEQTFEAEMVLWHTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM +AL RIR FV Q     A ++  R     +  SF    +DD+
Sbjct  406  EPGWFRVCFANMDDKTMEIALTRIRNFVAQYKEPIAPRKNNRYWQSNLRLSFQSRRMDDI  465

Query  417  -----LMSPHSPASAKSPMVQAT  364
                 +MSPHSP   +SP+V+AT
Sbjct  466  MMSPCMMSPHSPI-PQSPLVRAT  487



>ref|XP_007135134.1| hypothetical protein PHAVU_010G103900g [Phaseolus vulgaris]
 gb|ESW07128.1| hypothetical protein PHAVU_010G103900g [Phaseolus vulgaris]
Length=478

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 99/139 (71%), Gaps = 9/139 (6%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            +GL  + I    S AGLFFWM+L+ LL+E T EAEL+LWR+IIH+VKLNVSPG SF+C+E
Sbjct  347  KGLEEVNITWFPSNAGLFFWMNLKSLLKEATFEAELKLWRVIIHEVKLNVSPGSSFNCSE  406

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ--ISTSFSRIMLDD  421
            PGWFRVCFANMDD+T+ VAL RIR  V     G   K+    ++ Q  +  SF+  M D+
Sbjct  407  PGWFRVCFANMDDETVDVALNRIRELV-----GKETKKPVGMKSWQPNLRLSFNSRMFDE  461

Query  420  LLMSPHSPASAKSPMVQAT  364
             +MSPHSP +  SP+VQAT
Sbjct  462  SVMSPHSPIT--SPLVQAT  478



>ref|XP_010053213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X2 [Eucalyptus grandis]
Length=458

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR II++ KLNVSPG SFHC+
Sbjct  318  TDGLHQVGIKCLNGNAGLFLWMDLRELLMESTVEAETALWRGIINEFKLNVSPGSSFHCS  377

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++TM+VAL RIR FVR+       K +CR   L++  SF R  +DD+
Sbjct  378  EPGWFRVCIANMNEETMKVALARIREFVRRNGDKLNRKEKCRQSDLRLRLSFRR--MDDV  435

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  436  LRSPCIMSPHSPI-PQSPLVRT  456



>ref|XP_010669851.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Beta 
vulgaris subsp. vulgaris]
Length=497

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 97/146 (66%), Gaps = 9/146 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GI  L S AGLF WMDLR LL E T+ AEL+LWR+II+DVK+NVSPG SFHC+
Sbjct  350  TSELAQVGIKCLNSNAGLFVWMDLRHLLEEATMAAELKLWRVIINDVKINVSPGSSFHCS  409

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIS---TSFSRIML  427
            EPGWFRVCFANMDDDT+ VAL RIR FV         K   + R  Q+     SF+    
Sbjct  410  EPGWFRVCFANMDDDTVEVALQRIRTFVSHGKMEERPKHTLKKRKEQMKLGRLSFNNRRF  469

Query  426  DDLLMSPH----SPAS--AKSPMVQA  367
            ++ LMSPH    SP S   +SP+V+A
Sbjct  470  EESLMSPHNNLVSPHSPIPQSPLVKA  495



>ref|XP_003552421.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
 gb|KHN40434.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=480

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+LR LL+E T E E+ LWR+II++VKLNVSPG +F+C+
Sbjct  345  TKGLEKVNITCLPSNAGLFFWMNLRGLLKEKTFEGEMMLWRVIINEVKLNVSPGSAFNCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGW+RVCFANMDD+T+ VAL+RIRAFV +  G    + +     L++S S SR   D+ 
Sbjct  405  EPGWYRVCFANMDDETVDVALMRIRAFVGKETGKPPKELKRWKSNLRLSFSNSR-RFDEN  463

Query  417  LMSPHSPASAKSPMVQAT  364
            +MSPHSP    SP+V+AT
Sbjct  464  VMSPHSPM-PHSPLVRAT  480



>gb|ABW03086.1| 1-aminocyclopropane 1-carboxylate synthase 5 [Prunus salicina]
Length=483

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +G   LKS  GLF WMDL +LL+E T EAE+ LW  IIH+VKLNVSPG SFHC 
Sbjct  346  TMGLAQVGTSCLKSNGGLFLWMDLHKLLKEQTFEAEMALWHTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM +AL RIR FV Q     A ++  R     +  SF     DD+
Sbjct  406  EPGWFRVCFANMDDMTMEIALTRIRTFVLQDKEAVAPRKNNRFWQSSLRLSFQSRRKDDI  465

Query  417  LMSPHSPASAKSPMVQA  367
            +MSP    S +SP+V+A
Sbjct  466  MMSP-CMMSPQSPLVRA  481



>gb|ABB70229.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
Length=476

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GLA +GI  L+S AGLF WMDLR+LL++PT+++E+ELWR+II +VK+NVSPG SFHC 
Sbjct  347  TGGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCT  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC+ANMDD  +++AL RIR FV Q +      K+ C    L++S    R   DD
Sbjct  407  EPGWFRVCYANMDDMAVQIALQRIRNFVLQNKEIMVPNKKHCWHSNLRLSLKTRR--FDD  464

Query  420  LLMSPHSP  397
            ++MSPHSP
Sbjct  465  IMMSPHSP  472



>gb|EYU23427.1| hypothetical protein MIMGU_mgv1a005590mg [Erythranthe guttata]
Length=478

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 4/122 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGLA +GIG+LKS AGLF WMDLRRLL+E T EAE ELWR+II DVK+NVSPG  FHC+
Sbjct  340  TRGLAQVGIGSLKSNAGLFCWMDLRRLLKEATFEAEAELWRMIIEDVKINVSPGAPFHCS  399

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+ +RVA+ RI  FV         +R  R   L++S SF R  LD++
Sbjct  400  EPGWFRVCFANMDDEAVRVAINRIHEFVMIVQ--TKKQRYIRRGKLEVSLSFRR--LDEI  455

Query  417  LM  412
            +M
Sbjct  456  MM  457



>gb|AAC05377.1| 1-aminocyclopropane-1-carboxylate synthase 2 [Dianthus caryophyllus]
Length=154

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 12/133 (9%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL+ +GI TLKS+ GLF WMDLR +L++PTVE EL LWR+II++VK+NVSPG SFHC EP
Sbjct  13   GLSQVGIQTLKSSVGLFVWMDLRHMLQDPTVEGELTLWRVIINEVKINVSPGSSFHCTEP  72

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQ-----RNGGAAAKRQCRGRALQISTSFSRIML  427
            GWFRVC ANM +DTM VAL RIR+FV +     +   A+ KR+C    LQ+  S  R  L
Sbjct  73   GWFRVCIANMSNDTMEVALRRIRSFVLRIKDVAKPVVASTKRKCWQTNLQLRLSNKR--L  130

Query  426  DDLL-----MSPH  403
            DD +      SPH
Sbjct  131  DDFMGISQIESPH  143



>ref|XP_010053212.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW77476.1| hypothetical protein EUGRSUZ_D01814 [Eucalyptus grandis]
Length=486

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR II++ KLNVSPG SFHC+
Sbjct  346  TDGLHQVGIKCLNGNAGLFLWMDLRELLMESTVEAETALWRGIINEFKLNVSPGSSFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++TM+VAL RIR FVR+       K +CR   L++  SF R  +DD+
Sbjct  406  EPGWFRVCIANMNEETMKVALARIREFVRRNGDKLNRKEKCRQSDLRLRLSFRR--MDDV  463

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  464  LRSPCIMSPHSPI-PQSPLVRT  484



>gb|KHG06607.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=478

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 99/139 (71%), Gaps = 3/139 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG LK  +GLF WMDLR+LL+E T  AE+ELWR+II++VKLNVSPG SFHC 
Sbjct  339  TWSLSQVGIGCLKGNSGLFIWMDLRKLLKEKTFAAEMELWRVIINEVKLNVSPGSSFHCE  398

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQC--RGRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD TM+VALLRIR FV + N      + C      L +S S SR M  
Sbjct  399  EPGWFRVCFANMDDHTMKVALLRIRTFVLKNNEAMVPLKLCRPSSLKLSLSRSLSRRMEA  458

Query  423  DLLMSPHSPASAKSPMVQA  367
              +MSPHSP   +SP+V+A
Sbjct  459  PGIMSPHSPL-PQSPLVRA  476



>gb|AAD22099.2| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=485

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD  M++AL RI  FV + N  A   +  R     +  S  R   D  
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIENFVYRENDAAVQAKNKRKWDETLRLSLPRRFEDPT  467

Query  417  LMSPHSPASAKSPMVQA  367
            +M+PH   S  SP+VQA
Sbjct  468  IMTPHL-MSPHSPLVQA  483



>emb|CAD44267.2| putative aminocyclopropane carboxylic acid synthase [Musa AAB 
Group]
Length=485

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD  M++AL RI  FV + N  A   +  R     +  S  R   D  
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIENFVYRENDAAVQAKNKRKWDETLRLSLPRRFEDPT  467

Query  417  LMSPHSPASAKSPMVQA  367
            +M+PH   S  SP+VQA
Sbjct  468  IMTPHL-MSPHSPLVQA  483



>ref|XP_010279043.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nelumbo 
nucifera]
Length=482

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GI  LKS AGLFFWMDLR LL+EPT EAE+ELWR+II+DVKLNVSPG SFHC 
Sbjct  345  TTKLAQVGIDCLKSNAGLFFWMDLRGLLKEPTAEAEMELWRVIINDVKLNVSPGSSFHCT  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMD + M VAL RI+ FV          +        +  S S    +++
Sbjct  405  EPGWFRVCFANMDSEIMEVALRRIQNFVLHPKEANVPVKNKSWLKNNLRLSLSSRRYEEV  464

Query  417  LMSPHSPASAKSPMVQA  367
            +MSPH   S  SP+V A
Sbjct  465  VMSPHL-ISPHSPLVSA  480



>ref|XP_002304518.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE79497.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=480

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GLA + I  L  S AGLF WMDL  LL E T EAE+ LWR+IIH+VKLNVSPGCSFHC
Sbjct  344  TYGLAQVSIKCLTTSNAGLFLWMDLSGLLEEKTFEAEMALWRVIIHEVKLNVSPGCSFHC  403

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGR-ALQISTSFSRIMLD  424
             EPGWFRVCFANMDD TM+VAL RIR FV +       K+  R + +L+++   S  + D
Sbjct  404  TEPGWFRVCFANMDDQTMQVALSRIRTFVNKDVDTKKPKKTLRWQGSLKLN---SPRIYD  460

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SPHSP   +SP+V+A
Sbjct  461  DFINSPHSPI-PQSPLVRA  478



>ref|XP_004492797.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Cicer arietinum]
Length=483

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+L+ LL+E T E E+ LWR+II++VKLNVSPG SF+C+
Sbjct  345  TKGLEKVNITCLPSNAGLFFWMNLKSLLKEKTFEGEMMLWRLIINEVKLNVSPGSSFNCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQIST-SFSRIMLD  424
            EPGW+RVCFANMDD+T+ +AL+RIRAFV RQ+      KR      L  S+  F   ++ 
Sbjct  405  EPGWYRVCFANMDDETVEIALMRIRAFVGRQKGKTVEIKRWNSNLRLSFSSRRFEENVMS  464

Query  423  DLLMSPHSPASAKSPMVQAT  364
              +MSPHSP    SP+V+AT
Sbjct  465  PHMMSPHSPM-PHSPLVRAT  483



>ref|XP_006360739.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI TL+S AGLF WMDLR LL+E T E+E+ELWR+II+DVKLNVSPGCSFHC 
Sbjct  347  TKGLENIGINTLESNAGLFCWMDLRSLLKENTFESEIELWRMIINDVKLNVSPGCSFHCC  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNG  499
            EPGWFRVCFANMDDDTMR+AL RI  F+ Q  G
Sbjct  407  EPGWFRVCFANMDDDTMRIALRRIEIFMVQYKG  439



>gb|AAP14019.1|AF380836_1 putative ACC synthase 1 [Lactuca sativa]
Length=484

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TR LA +GI +LKS AGLFFWMDLRR L++ T E+E+  WRIII+++KLNVSPG SFHC+
Sbjct  347  TRELAQVGISSLKSNAGLFFWMDLRRFLKDATFESEMTFWRIIINEIKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR---NGGAAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD+T+ +A+ RI++FV +         +K+QC    L +  S  R  L
Sbjct  407  EPGWFRVCFANMDDETVTIAVRRIKSFVLKNKLFEIKTKSKKQCWQNNLHLKLSSRR--L  464

Query  426  DDLLMSPHSPASAKSPMVQA  367
            +D++   +SP +  SP+V+A
Sbjct  465  EDIMSPQYSPLN--SPLVRA  482



>ref|XP_011022618.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Populus 
euphratica]
Length=480

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLK-STAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GLA + I  L  S AGLF WMDL  LL E T EAE+ LWR+IIH+VKLNVSPGCSFHC
Sbjct  344  TYGLAQVSIKCLTTSNAGLFLWMDLSGLLEEKTFEAEMALWRVIIHEVKLNVSPGCSFHC  403

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGR-ALQISTSFSRIMLD  424
             EPGWFRVCFANMDD TM+VAL RIR FV +       K+  R + +L+++   S  + D
Sbjct  404  PEPGWFRVCFANMDDQTMQVALSRIRTFVNKDVDTKKPKKTLRWQGSLKLN---SPRIYD  460

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SPHSP   +SP+V+A
Sbjct  461  DFINSPHSPI-PQSPLVRA  478



>ref|XP_011092964.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Sesamum 
indicum]
Length=477

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLF WMDLR LL+EPT E E+ LW++II DVKLNVSPG SFHC 
Sbjct  341  TKGLDQVGIKCLKSNAGLFCWMDLRHLLKEPTFEGEMGLWKVIISDVKLNVSPGSSFHCH  400

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+T+ VAL RIR FV +        ++   R L++  SF  +M D+ 
Sbjct  401  EPGWFRVCFANMDDETVEVALRRIRVFVGKYKEVEVQVKKSWQRNLRL--SFPTLMYDEN  458

Query  417  LMSPHSPASAKSPMVQA  367
            + S     S +SP+V+A
Sbjct  459  MASSPRMMSPQSPLVRA  475



>gb|AEO92026.1| 1-aminocyclopropane-1-carboxylic acid synthase [Eriobotrya japonica]
Length=406

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 100/154 (65%), Gaps = 20/154 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  256  TKGLEEVGISCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  315

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRA----------LQIST  448
            EPGWFRVCFANMDDDT+ VAL RIRA V Q   G  A+ Q + ++          L  S+
Sbjct  316  EPGWFRVCFANMDDDTVEVALKRIRALVGQ---GKKAQEQAQVKSTKKRWQSNLRLSFSS  372

Query  447  SFSRI------MLDDLLMSPHSPASAKSPMVQAT  364
            S  R       ++   +MSPHSP    SP VQAT
Sbjct  373  STRRFEQEGVSVMSPHMMSPHSPM-PHSPFVQAT  405



>ref|XP_004298832.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 96/143 (67%), Gaps = 7/143 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL   G   LKS  GLF WMDL + L+E T EAE+ LWR II++VKLNVSPG SFHC 
Sbjct  347  TEGLEEQGTTCLKSNGGLFVWMDLHKHLKEQTFEAEMALWRTIIYEVKLNVSPGVSFHCP  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA----KRQCRGRALQISTSFSRI-  433
            +PGWFRVCFANMDD TM VAL RIR FV Q    A      K+ C  ++ ++S SF+   
Sbjct  407  QPGWFRVCFANMDDQTMDVALERIRNFVLQDKEAAVVAMKKKKNC-WQSKKLSLSFNNYR  465

Query  432  MLDDLLMSPHSPASAKSPMVQAT  364
              D++ MSPHSP   +SP+V+AT
Sbjct  466  RFDEVNMSPHSPI-PQSPLVRAT  487



>ref|XP_010053215.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X2 [Eucalyptus grandis]
Length=458

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR+II+DVKLNVSPG SFHC+
Sbjct  318  TDGLRQVGIKCLNGNAGLFLWMDLRGLLMESTVEAETALWRVIINDVKLNVSPGSSFHCS  377

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++T +VAL RIR FV +       K +C    L++  SF RI  DD+
Sbjct  378  EPGWFRVCIANMNEETTKVALARIREFVLRNGNKPNRKEKCWQSDLRLRLSFRRI--DDV  435

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  436  LRSPCIMSPHSPI-PQSPLVRT  456



>ref|XP_006339629.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum 
tuberosum]
Length=486

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 97/139 (70%), Gaps = 3/139 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LK+ AGLF WMDLR LLRE T ++E+ LWR+II+DVKLNVSPG SF C 
Sbjct  348  TNGLEEVGIKCLKNNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQ  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG---AAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD T+ +AL RIR FVR    G   +A +++ + +   +  SFS+ M 
Sbjct  408  EPGWFRVCFANMDDGTVDIALARIRRFVRVEKSGDESSAMEKKQQWKKNNLRLSFSKRMY  467

Query  426  DDLLMSPHSPASAKSPMVQ  370
            D+ ++SP S     SP+V+
Sbjct  468  DESVLSPLSSPIPASPLVR  486



>ref|XP_008364813.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Malus domestica]
Length=503

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 100/153 (65%), Gaps = 20/153 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TKGLEEVGISCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRA----------LQIST  448
            EPGWFRVCFANMDDDT+ VAL RIRA V Q   G  A+ Q + ++          L  S+
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRALVGQ---GKKAQEQAQVKSTKKRWQSNLRLSFSS  461

Query  447  SFSRI------MLDDLLMSPHSPASAKSPMVQA  367
            S  R       +L   +MSPHSP S  SP VQA
Sbjct  462  STRRFEQEGVSVLSPHMMSPHSPMS-HSPFVQA  493



>ref|XP_010053214.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X1 [Eucalyptus grandis]
Length=486

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR+II+DVKLNVSPG SFHC+
Sbjct  346  TDGLRQVGIKCLNGNAGLFLWMDLRGLLMESTVEAETALWRVIINDVKLNVSPGSSFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++T +VAL RIR FV +       K +C    L++  SF RI  DD+
Sbjct  406  EPGWFRVCIANMNEETTKVALARIREFVLRNGNKPNRKEKCWQSDLRLRLSFRRI--DDV  463

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  464  LRSPCIMSPHSPI-PQSPLVRT  484



>gb|ACV33064.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=483

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  345  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  405  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  463

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  464  PTIMTPHL-MSPHSPLVQA  481



>gb|KCW44817.1| hypothetical protein EUGRSUZ_L016171, partial [Eucalyptus grandis]
Length=331

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL + TVEAE  LW++II+DVKLNVSPG SFHC+
Sbjct  191  TDGLRQVGIKCLNGNAGLFLWMDLRGLLIDSTVEAETALWQMIINDVKLNVSPGSSFHCS  250

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++T +VAL RIR FV +       K +C    L++  SF RI  DD+
Sbjct  251  EPGWFRVCIANMNEETTKVALARIREFVLRNGNKPNRKEKCGQSDLRLRLSFRRI--DDV  308

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  309  LRSPCIMSPHSPI-PQSPLVRT  329



>gb|AAU09672.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>gb|ACV30003.1| ACC synthase family protein [Musa acuminata AAA Group]
Length=483

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  345  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  405  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  463

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  464  PTIMTPHL-MSPHSPLVQA  481



>gb|KHG14845.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=477

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -1

Query  768  LAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEPG  589
            L+ +GI +LKS AGLF WMDLR+LL+E T EAE++LWR+II +VKLNVSPG SFHC EPG
Sbjct  340  LSQIGICSLKSNAGLFIWMDLRKLLKEKTFEAEMDLWRVIIDEVKLNVSPGSSFHCHEPG  399

Query  588  WFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQC---RGRALQISTSFSRIMLDDL  418
            WFRVCFANMDD TM +AL RIR F+ + N      R     R       +      +DD 
Sbjct  400  WFRVCFANMDDYTMEIALSRIRNFMVKNNETMVPPRNKLLRRTSLKLSLSRSLSRKMDDF  459

Query  417  LMSPHSPASAKSPMVQA  367
            +MSP S  S +SP+VQA
Sbjct  460  IMSP-SIMSPQSPLVQA  475



>ref|XP_004252649.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
lycopersicum]
Length=473

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI TL+S AGLF WMDLR LL + T E+E++LWR+II+DVKLNVSPGCSFHC 
Sbjct  348  TKGLENIGINTLESNAGLFCWMDLRSLLEKNTFESEIKLWRMIINDVKLNVSPGCSFHCC  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIS  451
            EPGWFRVCFANMDDDTMR+AL RI  FV Q  G      +  G +L I+
Sbjct  408  EPGWFRVCFANMDDDTMRIALRRIEIFVVQYKGINNIIEEGIGESLPIT  456



>gb|AAO91942.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>gb|AAD28181.1|AF109927_1 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>gb|AAC31571.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAQ13437.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAR00512.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>ref|XP_009397633.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
 gb|AAQ13436.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAR00513.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>emb|CAE53271.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>emb|CAA75749.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAD00350.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TVGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRVCFANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVCFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>gb|KCW77477.1| hypothetical protein EUGRSUZ_D01815 [Eucalyptus grandis]
Length=564

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL E TVEAE  LWR+II+DVKLNVSPG SFHC+
Sbjct  424  TDGLRQVGIKCLNGNAGLFLWMDLRGLLMESTVEAETALWRVIINDVKLNVSPGSSFHCS  483

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++T +VAL RIR FV +       K +C    L++  SF RI  DD+
Sbjct  484  EPGWFRVCIANMNEETTKVALARIREFVLRNGNKPNRKEKCWQSDLRLRLSFRRI--DDV  541

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  542  LRSPCIMSPHSPI-PQSPLVRT  562



>gb|ABD16181.1| 1-aminocyclopropane-1-carboxylate synthase [Cicer arietinum]
Length=436

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL++PT E+ELELWR+IIH+VK+NVSPGCSFHC+
Sbjct  297  TGGLVKVGIKCLQSNGGLFVWMDLRDLLKKPTFESELELWRVIIHEVKINVSPGCSFHCS  356

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA----KRQCRGRALQISTSFSRIM  430
            E GWFRVC+ANMDD  +++AL RIR+FV Q+N          + C    L++S    R  
Sbjct  357  EAGWFRVCYANMDDRALQIALQRIRSFVLQKNKEVMVSDKNSKPCWHSNLKLSLKSRR--  414

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
             +D++MS       +SP+VQAT
Sbjct  415  FEDIMMSL-ILQFLQSPLVQAT  435



>gb|ACT54523.3| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
Length=487

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 93/143 (65%), Gaps = 6/143 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +    L    GLF WMDLRRLL+E T EAE+ LW+ IIH+VKLNVSPG SFHC 
Sbjct  346  TMELAQVRTSCLNGNGGLFVWMDLRRLLKEQTFEAEMVLWQTIIHEVKLNVSPGSSFHCP  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD TM +AL RIR F+ Q     A ++  R     +  SF    +DD+
Sbjct  406  EPGWFRVCFANMDDKTMEIALTRIRNFMAQYKEPIAPRKNNRYWQSNLRLSFQSRRMDDV  465

Query  417  -----LMSPHSPASAKSPMVQAT  364
                 +MSPHSP   +SP+V+AT
Sbjct  466  MMPPCMMSPHSPI-PQSPLVRAT  487



>ref|XP_010919415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Elaeis 
guineensis]
Length=492

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 5/132 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GI  L+S AGLF WMDLRRLL+E TVE ELELWR+II+DVKLNVSPG SFHC 
Sbjct  350  TSRLAKVGIQCLESNAGLFCWMDLRRLLKEFTVEGELELWRVIINDVKLNVSPGSSFHCH  409

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKR---QCRGRALQISTSFSRI-  433
            EPGWFRVCFANMDD+TM VAL RI +FV R +     AK+   +  G  L +   F  + 
Sbjct  410  EPGWFRVCFANMDDETMDVALGRIESFVLRTKEAAVQAKKKKWKQDGLRLSLPRRFEDMA  469

Query  432  MLDDLLMSPHSP  397
             +   LMSPHSP
Sbjct  470  TMTSSLMSPHSP  481



>ref|XP_003534540.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Glycine 
max]
Length=485

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 5/142 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+L+ LL+E T E E+ LWR+II++VKLNVSPG +F+C 
Sbjct  345  TKGLEKVNITCLPSNAGLFFWMNLKGLLKEKTFEGEMMLWRVIINEVKLNVSPGSAFNCP  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGW+RVCFANMDD+T+ VAL+RIRAFV +  G    + +     L++S S SR   ++L
Sbjct  405  EPGWYRVCFANMDDETVDVALMRIRAFVGKETGKPPKELKRWKSNLRLSFSNSRRFDENL  464

Query  417  ----LMSPHSPASAKSPMVQAT  364
                +MSPHSP    SP+V+AT
Sbjct  465  MSPHMMSPHSPM-PHSPLVRAT  485



>ref|XP_003529924.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
Length=581

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            +GL  + I    S AGLF WM+L+ LL EPT EAEL+LWR+IIH+VKLNVSPG SF+C+E
Sbjct  449  KGLEEVNITRFPSNAGLFCWMNLKCLLEEPTFEAELKLWRVIIHEVKLNVSPGSSFNCSE  508

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ--ISTSFSRIMLDD  421
            PGWFRVCFANMDD+T+ VAL RIRAFV     G   K+    +  Q  +  SFS  M ++
Sbjct  509  PGWFRVCFANMDDETVDVALNRIRAFV-----GKETKKPVGFKRWQPNLRLSFSSRMFEE  563

Query  420  LLMSPHSPASAKSPMVQAT  364
             +MSPHSP    SP++ AT
Sbjct  564  SVMSPHSPIPT-SPLIGAT  581



>gb|KHN29314.1| 1-aminocyclopropane-1-carboxylate synthase CMW33 [Glycine soja]
Length=485

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 5/142 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+L+ LL+E T E E+ LWR+II++VKLNVSPG +F+C 
Sbjct  345  TKGLEKVNITCLPSNAGLFFWMNLKGLLKEKTFEGEMMLWRVIINEVKLNVSPGSAFNCP  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGW+RVCFANMDD+T+ VAL+RIRAFV +  G    + +     L++S S SR   ++L
Sbjct  405  EPGWYRVCFANMDDETVDVALMRIRAFVGKETGKPPKELKRWKSNLRLSFSNSRRFDENL  464

Query  417  ----LMSPHSPASAKSPMVQAT  364
                +MSPHSP    SP+V+AT
Sbjct  465  MSPHMMSPHSPM-PHSPLVRAT  485



>gb|AES80303.2| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=379

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 99/141 (70%), Gaps = 4/141 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+LR LL+E T E E++LWR+II++VKLNVSPG +F+C+
Sbjct  240  TKGLEKVNITCLPSNAGLFFWMNLRGLLKEKTFEGEMKLWRLIINEVKLNVSPGSAFNCS  299

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTS---FSRIML  427
            EPGW+RVCFANMD +T+ +AL RIRAFV  R  G   + +     L++S S   F   ++
Sbjct  300  EPGWYRVCFANMDHETVEIALRRIRAFVNGREKGKTVEIKRWKSNLRLSFSSRRFDENVM  359

Query  426  DDLLMSPHSPASAKSPMVQAT  364
               +MSPHSP    SP+V+AT
Sbjct  360  SPHMMSPHSPM-PHSPLVRAT  379



>ref|NP_001275831.1| 1-aminocyclopropane-1-carboxylate synthase-like [Citrus sinensis]
 ref|XP_006439472.1| hypothetical protein CICLE_v10019920mg [Citrus clementina]
 emb|CAB60721.1| ACC synthase [Citrus sinensis]
 emb|CAB60722.1| ACC synthase [Citrus sinensis]
 gb|ESR52712.1| hypothetical protein CICLE_v10019920mg [Citrus clementina]
Length=483

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL+ +GIG LKS AGLF WMDL  LL+E T EAE+ LWR+II++VKLNVSPG SFHC 
Sbjct  347  TWGLSQVGIGCLKSNAGLFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCP  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAA--AKRQCRGRALQISTSFSRIMLD  424
             PGWFRVCFANMDD TM +AL RI +F+ +         K+ C  R+L++S S  R  +D
Sbjct  407  NPGWFRVCFANMDDRTMEIALSRITSFMLKNVEAKVPNKKKLCWQRSLRLSMSSRR--MD  464

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SP    S +SP+VQA
Sbjct  465  DFMASPC--MSPQSPLVQA  481



>ref|XP_006598931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
 gb|KHN18815.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=474

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 96/139 (69%), Gaps = 8/139 (6%)
 Frame = -1

Query  774  RGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAE  595
            +GL  + I    S AGLF WM+L+ LL EP+ EAEL+LWR+IIH+VKLNVSPG SF+C+E
Sbjct  342  KGLEEVNITRFPSNAGLFCWMNLKSLLEEPSFEAELKLWRVIIHEVKLNVSPGSSFNCSE  401

Query  594  PGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ--ISTSFSRIMLDD  421
            PGWFRVCFANMDD+T+ VAL RIRAFV     G   K+    +  Q  +  SFS  + D+
Sbjct  402  PGWFRVCFANMDDETVDVALNRIRAFV-----GKETKKSVGFKRWQPNLRLSFSSRIFDE  456

Query  420  LLMSPHSPASAKSPMVQAT  364
             +MSPHSP    SP+V A 
Sbjct  457  SVMSPHSPIPT-SPLVGAN  474



>dbj|BAB89349.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki]
Length=488

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  + I  L+  AGLF WMDLR LL+E T EAE ELW++II+ VKLNVSPG SFHC+
Sbjct  348  TEGLKEVEIKCLEGNAGLFCWMDLRPLLKEATFEAETELWKVIINQVKLNVSPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA----KRQCRGRALQISTSFSRIM  430
            EPGWFRVCFANMDD+T++VAL RIR FV ++ G   A    K++   R L++S S  RI 
Sbjct  408  EPGWFRVCFANMDDETVQVALQRIRTFVDEKKGAGKAAPEKKKKQWQRNLRLSFSSGRIY  467

Query  429  LDDLL----MSPHSP  397
             D  L    +SPHSP
Sbjct  468  EDGCLSPHVLSPHSP  482



>gb|KDO76335.1| hypothetical protein CISIN_1g011570mg [Citrus sinensis]
Length=483

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL+ +GIG LKS AGLF WMDL  LL+E T EAE+ LWR+II++VKLNVSPG SFHC 
Sbjct  347  TWGLSQVGIGCLKSNAGLFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCP  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAA--AKRQCRGRALQISTSFSRIMLD  424
             PGWFRVCFANMDD TM +AL RI +F+ +         K+ C  R+L++S S  R  +D
Sbjct  407  NPGWFRVCFANMDDRTMEIALSRITSFMLKNVEAKVPNKKKLCWQRSLRLSMSSRR--MD  464

Query  423  DLLMSPHSPASAKSPMVQA  367
            D + SP    S +SP+VQA
Sbjct  465  DFMASP--CMSPQSPLVQA  481



>gb|AAB96658.1| 1-aminocyclopropane-1-carboxylate synthase [Rumex palustris]
Length=489

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 100/145 (69%), Gaps = 12/145 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL+ +GI +LKS  GLF WMDLRRLL+EPTVEAEL LWR+II++VKLNVSPG SFHC+
Sbjct  347  TWGLSMVGISSLKSNGGLFLWMDLRRLLQEPTVEAELSLWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA--------KRQCRGRALQISTSF  442
            E GWFR  FANMDD T+ VAL RIR+F+ +    AA         K++C    LQ+  S 
Sbjct  407  EAGWFRFAFANMDDKTVDVALRRIRSFMVKGEEAAAGDKPTVVAKKKKCWQMDLQLRLSA  466

Query  441  SRIMLDDLLMSPHSPASAKSPMVQA  367
             R+   + +MSPHSP    SP+V+ 
Sbjct  467  RRL---EEVMSPHSPLPL-SPLVRT  487



>gb|ACL53889.1| unknown [Zea mays]
 gb|AFW59127.1| hypothetical protein ZEAMMB73_638837 [Zea mays]
Length=386

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 11/143 (8%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL  +GI  L   AGLF WMDLR +LRE T +AELELWR+I+H VKLNVSPG SFHC EP
Sbjct  248  GLREVGIACLPGNAGLFSWMDLRGMLREKTHDAELELWRVIVHRVKLNVSPGTSFHCNEP  307

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQIS------TSFSRI  433
            GWFRVC+ANMDDDTM VAL RIR FVRQ ++  A A+R    R L++S      T+ S +
Sbjct  308  GWFRVCYANMDDDTMEVALDRIRRFVRQHQHSKAKAERWAATRPLRLSLPRRGATTASHL  367

Query  432  MLDDLLMSPHSPASAKSPMVQAT  364
             +     SP +  S +SPMV A+
Sbjct  368  AIS----SPLALLSPQSPMVHAS  386



>ref|XP_010676415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 104/150 (69%), Gaps = 14/150 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLL-REPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL+ +GI  LKS AGLF WMDLR+L+ ++PTVE EL LWR+II++VK+NVSPG SFHC
Sbjct  339  TWGLSQVGIQCLKSNAGLFVWMDLRQLIDQDPTVEGELALWRVIINEVKINVSPGSSFHC  398

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA-----AAKRQCRGRALQISTSFSR  436
             E GWFRVC ANMDDDTM++AL RIR+F  Q+   A     + KR+C    LQ+  S  R
Sbjct  399  HEAGWFRVCIANMDDDTMQIALRRIRSFAAQKVAKAKPVVTSTKRKCWQTNLQLRLSSRR  458

Query  435  IMLDDL-----LMSPHSPASAKSPMVQATN  361
              L+DL     + SPHSP    SP+V+A +
Sbjct  459  --LEDLMGVSQIGSPHSPLPT-SPLVRAQH  485



>ref|XP_010261352.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nelumbo 
nucifera]
Length=492

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L  +GI  LKS AGLF WMDLR LL+E TVEAE+ LWR+II +VKLNVSPG SFHC 
Sbjct  350  TAKLLEVGITCLKSNAGLFCWMDLRPLLKESTVEAEMALWRVIIDEVKLNVSPGSSFHCT  409

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRAL--QISTSFSRI---  433
            EPGWFRVCFANMD +TM VAL RI++FVR+    A      + + L   +  SF+R    
Sbjct  410  EPGWFRVCFANMDSETMEVALQRIQSFVRKPKEAAEVPVAVKAKPLRNNLRLSFTRTRSR  469

Query  432  MLDDLLMSPHSPASAKSPMVQA  367
              ++ +MSPH   S  SP+V A
Sbjct  470  RFEEFVMSPHL-ISPHSPLVSA  490



>ref|XP_002511916.1| acc synthase, putative [Ricinus communis]
 gb|EEF50585.1| acc synthase, putative [Ricinus communis]
Length=482

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLF WMDL  LL E T + E+ LWR+II++VKLNVSPG SFHC 
Sbjct  340  TKGLEQVGITCLKSNAGLFVWMDLHHLLEEQTFDGEMALWRVIINEVKLNVSPGSSFHCK  399

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-----RQRNGGAAAKRQCRGRALQIS-TSFSR  436
            EPGWFRVCFANMDD+T+  AL RIRAFV      Q      +KR  +   L  S   F  
Sbjct  400  EPGWFRVCFANMDDETVATALKRIRAFVGKGKEEQEKSTKTSKRWQKNLRLSFSGRRFEE  459

Query  435  IMLDDLLMSPHSPASAKSPMVQA  367
             ++   +MSPHSP  A SP+V+A
Sbjct  460  GVMSPRIMSPHSPI-AHSPLVRA  481



>ref|XP_003580370.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Brachypodium 
distachyon]
Length=485

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 95/142 (67%), Gaps = 3/142 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLL--REPTVEAELELWRIIIHDVKLNVSPGCSFH  604
            T GL  +GIG L+S AGLF WMDLR +L  ++ T EAELELWR+I+H+VKLNVSPG SFH
Sbjct  344  TEGLREVGIGCLRSNAGLFSWMDLRGMLGNKKSTAEAELELWRVIVHEVKLNVSPGTSFH  403

Query  603  CAEPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQISTSFSRIML  427
            C EPGWFRVC ANMDD+TM VAL RIR FV R +   A A+R      L++S      M 
Sbjct  404  CGEPGWFRVCHANMDDETMEVALDRIRLFVRRHQQQKAKAQRWAAKGQLRLSLPRHGAMA  463

Query  426  DDLLMSPHSPASAKSPMVQATN  361
               L SP    S +SP+V A +
Sbjct  464  SQYLNSPMGLLSPQSPLVHAAS  485



>gb|AES80302.2| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=484

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 99/141 (70%), Gaps = 4/141 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+LR LL+E T E E++LWR+II++VKLNVSPG +F+C+
Sbjct  345  TKGLEKVNITCLPSNAGLFFWMNLRGLLKEKTFEGEMKLWRLIINEVKLNVSPGSAFNCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTS---FSRIML  427
            EPGW+RVCFANMD +T+ +AL RIRAFV  R  G   + +     L++S S   F   ++
Sbjct  405  EPGWYRVCFANMDHETVEIALRRIRAFVNGREKGKTVEIKRWKSNLRLSFSSRRFDENVM  464

Query  426  DDLLMSPHSPASAKSPMVQAT  364
               +MSPHSP    SP+V+AT
Sbjct  465  SPHMMSPHSPM-PHSPLVRAT  484



>dbj|BAC66952.1| ACC synthase [Striga hermonthica]
Length=424

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  L+S AGLF WMDLR LL+EPT E E+ LWR+II +VKLNVSPG  FHC 
Sbjct  288  TKGLEEVGITCLESNAGLFCWMDLRHLLKEPTFEGEMGLWRVIITEVKLNVSPGMPFHCH  347

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+T++VAL RIR FV +  G     +  +   + +  SFS  + D+ 
Sbjct  348  EPGWFRVCFANMDDETLKVALTRIRVFVAK--GSEVDAKVKKPWQMNLRLSFSSRIYDET  405

Query  417  L------MSPHSP  397
            +      MSPHSP
Sbjct  406  MASSPRVMSPHSP  418



>ref|NP_001146401.1| 1-aminocyclopropane-1-carboxylate synthase7 [Zea mays]
 gb|ACL53723.1| unknown [Zea mays]
Length=486

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 11/143 (8%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL  +GI  L   AGLF WMDLR +LRE T +AELELWR+I+H VKLNVSPG SFHC EP
Sbjct  348  GLREVGIACLPGNAGLFSWMDLRGMLREKTHDAELELWRVIVHRVKLNVSPGTSFHCNEP  407

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQIS------TSFSRI  433
            GWFRVC+ANMDDDTM VAL RIR FVRQ ++  A A+R    R L++S      T+ S +
Sbjct  408  GWFRVCYANMDDDTMEVALDRIRRFVRQHQHSKAKAERWAATRPLRLSLPRRGATTASHL  467

Query  432  MLDDLLMSPHSPASAKSPMVQAT  364
             +     SP +  S +SPMV A+
Sbjct  468  AIS----SPLALLSPQSPMVHAS  486



>gb|AAR25559.1| acc synthase [Zea mays]
 gb|AFW59128.1| acc synthase [Zea mays]
Length=486

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 11/143 (8%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL  +GI  L   AGLF WMDLR +LRE T +AELELWR+I+H VKLNVSPG SFHC EP
Sbjct  348  GLREVGIACLPGNAGLFSWMDLRGMLREKTHDAELELWRVIVHRVKLNVSPGTSFHCNEP  407

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQIS------TSFSRI  433
            GWFRVC+ANMDDDTM VAL RIR FVRQ ++  A A+R    R L++S      T+ S +
Sbjct  408  GWFRVCYANMDDDTMEVALDRIRRFVRQHQHSKAKAERWAATRPLRLSLPRRGATTASHL  467

Query  432  MLDDLLMSPHSPASAKSPMVQAT  364
             +     SP +  S +SPMV A+
Sbjct  468  AIS----SPLALLSPQSPMVHAS  486



>emb|CDP08761.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 93/138 (67%), Gaps = 9/138 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L S AGLF WMDLR LL+EPT EAE+ LWR+IIH VKLNVSPG SFHC 
Sbjct  295  TSGLEEVGIKCLNSNAGLFCWMDLRALLKEPTFEAEMVLWRLIIHKVKLNVSPGFSFHCV  354

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVR---QRNGGAAAKRQCRGRALQISTS------  445
            EPGWFRVCFANMDD T+ +AL RIR F++   +++   A K +   + L++S S      
Sbjct  355  EPGWFRVCFANMDDATLEIALKRIRIFIQATVKKSDVPAKKSKQWQKNLRLSFSGGSRCE  414

Query  444  FSRIMLDDLLMSPHSPAS  391
            +   +    +MSPHSP S
Sbjct  415  YEESLKSPSVMSPHSPMS  432



>ref|XP_010040891.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=486

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL + TVEAE  LW++II+DVKLNVSPG SFHC+
Sbjct  346  TDGLRQVGIKCLNGNAGLFLWMDLRGLLIDSTVEAETALWQMIINDVKLNVSPGSSFHCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVC ANM+++T +VAL RIR FV +       K +C    L++  SF RI  DD+
Sbjct  406  EPGWFRVCIANMNEETTKVALARIREFVLRNGNKPNRKEKCGQSDLRLRLSFRRI--DDV  463

Query  417  L-----MSPHSPASAKSPMVQA  367
            L     MSPHSP   +SP+V+ 
Sbjct  464  LRSPCIMSPHSPI-PQSPLVRT  484



>ref|XP_006652680.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Oryza 
brachyantha]
Length=480

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+  AGLF WMDLR +LRE T E E+ELWR+IIH VKLNVSPG SFHC 
Sbjct  344  TTGLREVGISCLRGNAGLFSWMDLRHMLREKTTEGEVELWRVIIHKVKLNVSPGASFHCR  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ----RNGGAAAKRQCR-GRALQISTSFSRI  433
            EPGWFRVC ANMDD+TM VAL RIRAFVRQ    +    AA  Q R    L+ ST  +  
Sbjct  404  EPGWFRVCHANMDDETMEVALGRIRAFVRQHRQRKVKAWAANEQLRLSLPLRASTYLA--  461

Query  432  MLDDLLMSPHSPASAKSPMVQATN  361
                 L SP +  S +SPMV A +
Sbjct  462  -----LSSPMALLSPQSPMVHAAS  480



>dbj|BAG30910.1| ACC synthase [Capsicum chinense]
Length=486

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 97/139 (70%), Gaps = 3/139 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LK+ AGLF WMDLR+LLR+ T ++E+ LWR+II+DVKLNVSPG SF C 
Sbjct  348  TDGLEEVGITCLKNNAGLFCWMDLRKLLRDSTFDSEMSLWRVIINDVKLNVSPGSSFDCQ  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG---AAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD T+ +AL RIR FV  +  G    A +++ + +   +  SFS+ M 
Sbjct  408  EPGWFRVCFANMDDGTVDIALARIRRFVGVKKSGDESNAMEKKQQWKKNNLRLSFSKRMY  467

Query  426  DDLLMSPHSPASAKSPMVQ  370
            D+ ++SP S     SP+V+
Sbjct  468  DESVLSPLSSPIPHSPLVR  486



>dbj|BAA94600.1| 1-aminocyclopropane-1-carboxylate synthase [Populus x canadensis]
Length=486

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 96/140 (69%), Gaps = 14/140 (10%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  L+S AGLF WM+LR LL+E T + E+ELWR+I++DVKLNVSPG SFHC 
Sbjct  342  TKGLEQIGISCLESKAGLFVWMNLRHLLKEQTNDGEMELWRVIVNDVKLNVSPGSSFHCV  401

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ---------RNGGAAAKRQCRGRALQISTS  445
            EPGWFRVCFANMDD+T+ VAL RI AFV +         +     +K +C  + L++S S
Sbjct  402  EPGWFRVCFANMDDETLEVALKRIHAFVGEQKERETLSTKTKDMPSKTKCWKKNLRLSFS  461

Query  444  FSRIMLD----DLLMSPHSP  397
             SRI  +     + MSPHSP
Sbjct  462  -SRIFEEGIGSPIAMSPHSP  480



>ref|XP_009366562.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Pyrus x bretschneideri]
Length=495

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 97/151 (64%), Gaps = 14/151 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLF WMDLRRLL++ T++ E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TKGLEEVGISYLKSNAGLFCWMDLRRLLKDQTLDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG-------AAAKRQCRGRALQISTSFS  439
            EPGWFRVCFANMDDDT+ VAL RIRA V Q           +  KR      L  S+S  
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRALVGQEKKAQEQAQVKSTKKRWQSNLRLSFSSSTR  464

Query  438  RIMLDDL------LMSPHSPASAKSPMVQAT  364
            R   + +      +MSPHSP    +P V+AT
Sbjct  465  RFEQEGVSVKSPHMMSPHSPM-PHTPFVRAT  494



>gb|AAM80888.1| 1-aminocyclopropane-1-carboxylate synthase [Betula pendula]
Length=485

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 96/140 (69%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GI  LKS AGLF WMDLR LL+  T EAE+ELW++II +VKLNVSPG SFHC+
Sbjct  348  TFPLAQVGINCLKSNAGLFLWMDLRHLLKNQTPEAEMELWKVIIDEVKLNVSPGDSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRIMLDD  421
            EPGWFRVC A       RVAL RIR FV Q +      KR+C    L++S S  R+  D+
Sbjct  408  EPGWFRVCLAQKGQSRRRVALTRIRTFVHQNKEVKNRLKRKCWNSNLRLSFSSLRVDHDN  467

Query  420  LLMSPHSPASAKSPMVQATN  361
             +MSPHSP  A+SP+V+A N
Sbjct  468  -MMSPHSPM-AQSPLVRAMN  485



>emb|CAA72191.1| 1-aminocyclopropane-1-carboxylate synthase [Carica papaya]
Length=488

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = -1

Query  789  SYGGTRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCS  610
            S+   R L  +GI  LKS AGLF WMDLRRLL+E T EAE+ LWR+II+++KLNVSPG S
Sbjct  343  SFFTQRTLHQVGINCLKSNAGLFVWMDLRRLLKEQTFEAEMVLWRVIINEMKLNVSPGSS  402

Query  609  FHCAEPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTS--FS  439
            F+C+EPGWFRVCFANMDD TM +AL RI+ F+ Q R      K+ C   +L++S S  + 
Sbjct  403  FNCSEPGWFRVCFANMDDKTMEIALSRIKTFMLQHREAMVPKKKLCWQTSLRLSFSSRYE  462

Query  438  RIM-LDDLLMSPHSPASAKSPMVQ  370
             IM      MSPHSP    +P+V+
Sbjct  463  DIMKTPGSFMSPHSPI-PHTPLVR  485



>gb|ACN78835.1| 1-aminocyclopropane-1-carboxylate synthase [Paeonia suffruticosa]
Length=492

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 96/147 (65%), Gaps = 11/147 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGL+ +GI  LKS AGLF WMDL  LL+E TVEAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  347  TRGLSQVGINFLKSNAGLFLWMDLSSLLKEKTVEAEITLWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFAN+DD TM +AL RI  F  +       +++   +   +  SF     DD+
Sbjct  407  EPGWFRVCFANIDDATMDIALRRILTFALKAKEADVPRKKQSWQNNNLRLSFKSGKYDDV  466

Query  417  ----------LMSPHSPASAKSPMVQA  367
                      + SPHSP   +SP+V+A
Sbjct  467  KLSPRMMSPCMRSPHSPI-PQSPLVRA  492



>gb|AAA33111.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=493

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 9/147 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L S AG+F WMDLRRLL++ T +AE+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TKELDKMGITCLNSNAGVFVWMDLRRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-----RQRNGGA-AAKRQCRGRALQISTSFSR  436
            EPGWFRVCFANMDD+T+ VAL RI +FV     ++ N  A  +K + R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALNRIHSFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSG  467

Query  435  IMLDD--LLMSPHSPASAKSPMVQATN  361
               D+  +L SPH+  S  SP+V A N
Sbjct  468  RRYDEGNVLNSPHT-MSPHSPLVIAKN  493



>gb|ABC69166.2| 1-aminocyclopropane-1-carboxylate synthase [Paeonia suffruticosa]
Length=492

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 96/147 (65%), Gaps = 11/147 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGL+ +GI  LKS AGLF WMDL  LL+E TVEAE+ LWR+II++VKLNVSPG SFHC+
Sbjct  347  TRGLSQVGINFLKSNAGLFLWMDLSSLLKEKTVEAEITLWRVIINEVKLNVSPGSSFHCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFAN+DD TM +AL RI  F  +       +++   +   +  SF     DD+
Sbjct  407  EPGWFRVCFANIDDATMDIALRRILTFALKAKEADVPRKKQSWQNNNLRLSFKSGKYDDV  466

Query  417  ----------LMSPHSPASAKSPMVQA  367
                      + SPHSP   +SP+V+A
Sbjct  467  KLSPRMMSPCMRSPHSPI-PQSPLVRA  492



>dbj|BAA84945.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L   AGLF WMDLR LL+E TVEAEL LWR+II+DVKLN+SPG SFHC+
Sbjct  348  TDGLKRVGIHCLDGNAGLFCWMDLRPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCS  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR--GRALQISTSFSRIMLD  424
            EPGWFRV FANMDD  M++AL RI +FV + N  A   +  R    AL++S    R   D
Sbjct  408  EPGWFRVSFANMDDTAMKIALRRIESFVYRENDAAVQAKNKRRWDEALRLSLPRRRFE-D  466

Query  423  DLLMSPHSPASAKSPMVQA  367
              +M+PH   S  SP+VQA
Sbjct  467  PTIMTPHL-MSPHSPLVQA  484



>gb|KDP28564.1| hypothetical protein JCGZ_14335 [Jatropha curcas]
Length=485

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 97/146 (66%), Gaps = 10/146 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GIG LKS AGLF WMDLR LL+E T + E+ LWR+II++VKLNVSPG SFHC 
Sbjct  340  TKGLEQVGIGCLKSNAGLFVWMDLRHLLKEKTFDGEMALWRVIINEVKLNVSPGSSFHCK  399

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV---RQRNGGAAAKRQCRGR---ALQISTSFSR  436
            EPGW+RVCFANMDD+T+  AL RIR FV   ++ N           R    L++S S  R
Sbjct  400  EPGWYRVCFANMDDETVEAALKRIREFVVRGKEENQELPTNTNSNKRWQKNLRLSFSARR  459

Query  435  I---MLDDLLMSPHSPASAKSPMVQA  367
                ++   +MSPHSP    SP+V+A
Sbjct  460  CEEAVMSPHIMSPHSPM-PHSPLVRA  484



>sp|P23279.1|1A11_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase 1; Short=ACC 
synthase 1; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Cucurbita pepo]
 gb|AAA33113.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=493

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 9/147 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L S AG+F WMDLRRLL++ T +AE+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TKELDKMGITCLNSNAGVFVWMDLRRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV-----RQRNGGA-AAKRQCRGRALQISTSFSR  436
            EPGWFRVCFANMDD+T+ VAL RI +FV     ++ N  A  +K + R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALNRIHSFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSG  467

Query  435  IMLDD--LLMSPHSPASAKSPMVQATN  361
               D+  +L SPH+  S  SP+V A N
Sbjct  468  RRYDEGNVLNSPHT-MSPHSPLVIAKN  493



>gb|ACN31344.1| unknown [Zea mays]
Length=485

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 11/143 (8%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL  +GI  L   AGLF WMDLR +LRE T +AELELWR+I+H VKLNVSPG SFHC EP
Sbjct  347  GLREVGIACLPGNAGLFSWMDLRGMLRERTHDAELELWRVIVHRVKLNVSPGTSFHCNEP  406

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQIS------TSFSRI  433
            GWFRVC+ANMDDDTM VAL RIR FVRQ ++  A A+R    R L++S      T+ S +
Sbjct  407  GWFRVCYANMDDDTMEVALDRIRRFVRQHQHSKAKAERWAATRPLRLSLPRRGATTASHL  466

Query  432  MLDDLLMSPHSPASAKSPMVQAT  364
             +     SP +  S +SPMV A+
Sbjct  467  AIP----SPLALLSPQSPMVHAS  485



>ref|XP_006305031.1| hypothetical protein CARUB_v10009396mg [Capsella rubella]
 gb|EOA37929.1| hypothetical protein CARUB_v10009396mg [Capsella rubella]
Length=390

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 92/145 (63%), Gaps = 18/145 (12%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLRE-PTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL    I  L S+AGLF WMDLR LLR+  + E+E+ELWRIIIH VKLNVSPG SFHC
Sbjct  242  TIGLKKADITCLTSSAGLFVWMDLRHLLRDRNSFESEIELWRIIIHKVKLNVSPGSSFHC  301

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAK-------------RQCRGRAL  460
             EPGWFRVCFANMDDDT+ VAL RI+ FV + N    AK             ++ + R  
Sbjct  302  TEPGWFRVCFANMDDDTLHVALRRIQDFVSKSNNKTIAKASDKDQVSQNNNAKKQKWRQS  361

Query  459  QISTSFSRIMLDDL----LMSPHSP  397
             +  SF R+  D L    +MSPHSP
Sbjct  362  NLRLSFRRLYEDGLSSPGIMSPHSP  386



>emb|CAA79478.1| 1-aminocyclopropane-1-carboxylate synthase [Petunia x hybrida]
 gb|AAB06724.1| 1-aminocyclopropane-1-carboxylate synthase [Petunia x hybrida]
Length=490

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LKS +GLF WMDLR LL   T+++E+ LWR+II+DV+LNVSPG SF C 
Sbjct  347  TNGLEQVGIKCLKSNSGLFCWMDLRHLLENSTLDSEMSLWRVIINDVRLNVSPGSSFDCQ  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV---RQRNGGAA--AKRQCRGRALQISTSFSRI  433
            EPGWFRVCFANMDD+T+ VAL RIR FV    + NG      K + + +   +  SFS+ 
Sbjct  407  EPGWFRVCFANMDDETVEVALARIRRFVGVGVKENGEETKPVKNKEQWKKSNLRVSFSKR  466

Query  432  MLDDLLMSPHSPASAKSPMVQA  367
            M D+ ++SP S     SP+V+A
Sbjct  467  MYDESVLSPLSSPIPHSPLVRA  488



>sp|Q00379.1|1A12_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase 2; Short=ACC 
synthase 2; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Cucurbita pepo]
Length=494

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 102/145 (70%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L S AG+F WMDLRRLL++ T +AE+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TKELDKMGITCLNSNAGVFVWMDLRRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGAA--AKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ +   A  +K + R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALNRIHSFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSG  467

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH+  S  SP+V+A
Sbjct  468  RRYDKGNVLNSPHT-MSPHSPLVRA  491



>ref|XP_003624085.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=411

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 98/140 (70%), Gaps = 4/140 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+LR LL+E T E E++LWR+II++VKLNVSPG +F+C+
Sbjct  223  TKGLEKVNITCLPSNAGLFFWMNLRGLLKEKTFEGEMKLWRLIINEVKLNVSPGSAFNCS  282

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTS---FSRIML  427
            EPGW+RVCFANMD +T+ +AL RIRAFV  R  G   + +     L++S S   F   ++
Sbjct  283  EPGWYRVCFANMDHETVEIALRRIRAFVNGREKGKTVEIKRWKSNLRLSFSSRRFDENVM  342

Query  426  DDLLMSPHSPASAKSPMVQA  367
               +MSPHSP    SP+V++
Sbjct  343  SPHMMSPHSPM-PHSPLVRS  361



>gb|AAA33112.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=495

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 102/145 (70%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L S AG+F WMDLRRLL++ T +AE+ELWR+II++VKLNVSPG SFH  
Sbjct  349  TKELDKMGITCLNSNAGVFVWMDLRRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVT  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGAA--AKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ +   A  +K + R   L++S SFS 
Sbjct  409  EPGWFRVCFANMDDNTVDVALNRIHSFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSG  468

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH+  S  SP+V+A
Sbjct  469  RRYDKGNVLNSPHT-MSPHSPLVRA  492



>sp|P23599.1|1A11_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase CMW33; 
Short=ACC synthase; AltName: Full=S-adenosyl-L-methionine 
methylthioadenosine-lyase [Cucurbita maxima]
 dbj|BAA00838.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita maxima]
 prf||1710321A aminocyclopropane carboxylate synthase
 prf||1916421A aminocyclopropane carboxylate synthase:ISOTYPE=wound-induced
Length=493

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 9/147 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L S AG+F WMDLRRLL++ T +AE+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TKELDKMGITCLNSNAGVFVWMDLRRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGAAAKRQCRGRA--LQISTSFSR  436
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ +   A   + R R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALNRIHSFVENIDKKEDNTVAMPSKTRRRENKLRLSFSFSG  467

Query  435  IMLDD--LLMSPHSPASAKSPMVQATN  361
               D+  +L SPH+  S  SP+V A N
Sbjct  468  RRYDEGNVLNSPHT-MSPHSPLVIAKN  493



>ref|NP_001275873.1| 1-aminocyclopropane-1-carboxylate synthase 1-like [Citrus sinensis]
 emb|CAA09477.1| ACC synthase [Citrus sinensis]
Length=459

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLFFWMDLR LL+E T+E E+ LWR I++DVKLNVSPG SF C 
Sbjct  337  TKGLEQVGINCLKSNAGLFFWMDLRHLLKEKTLEGEIALWRTIVNDVKLNVSPGSSFQCT  396

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQC  475
            EPGWFRVCFANMDDDT++VAL RI AFV+Q +      K++C
Sbjct  397  EPGWFRVCFANMDDDTLQVALNRIAAFVQQDKESEKPTKKRC  438



>gb|ABK97620.1| 1-aminocyclopropane-1-carboxylic acid synthase [Durio zibethinus]
Length=490

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLFFWMD+R LL+E TV+ E+ELWR+II +VKLNVSPG SF C+
Sbjct  345  TKGLEQVGISCLKSNAGLFFWMDMRPLLKEQTVKGEMELWRVIIDEVKLNVSPGSSFQCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ----RNGGAAAKRQCRGRALQISTSFSRIM  430
            EPGWFRVCFANMD +T+ VAL RIR FV Q     +      ++ + + L++S S SR +
Sbjct  405  EPGWFRVCFANMDGETVEVALDRIRKFVLQGKEEDHAAPETSKRWQKKNLRLSFSSSR-L  463

Query  429  LDDLLMSPH--SPAS--AKSPMVQA  367
             D+  MSP   SP S    SP+V A
Sbjct  464  YDESTMSPPMISPHSRIPHSPLVPA  488



>ref|XP_010422075.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
Length=495

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 93/147 (63%), Gaps = 12/147 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL G+GIG LK+ AGLF WMDLR LL+  T ++E ELWR+I+H VKLNVSPG SFHC 
Sbjct  349  TTGLDGLGIGWLKAEAGLFLWMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCH  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAA----------AKRQCRGRALQIST  448
            EPGWFRVCFANMD  TM  AL RIR F  Q                 K++C    L++S 
Sbjct  409  EPGWFRVCFANMDHKTMETALERIRVFTSQLEEETKPVAAATMMAKKKKKCWQSNLRLSF  468

Query  447  SFSRIMLDDLLMSPHSPASAKSPMVQA  367
            S  R   DD   SPHSP +  SP+V+A
Sbjct  469  SDKR-RFDDGFFSPHSPVTP-SPLVRA  493



>ref|XP_010455533.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
 ref|XP_010455534.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
Length=495

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 94/147 (64%), Gaps = 12/147 (8%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL G+GIG LK+ AGLF WMDLR LL+  T ++E ELWR+I+H VKLNVSPG SFHC 
Sbjct  349  TTGLDGLGIGWLKAEAGLFLWMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCH  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ----------RNGGAAAKRQCRGRALQIST  448
            EPGWFRVCFANMD  TM  AL RIR F  Q              A  K++C    L++S 
Sbjct  409  EPGWFRVCFANMDHKTMETALERIRVFTSQLEEETKPMAAATMMAKKKKKCWQSNLRLSF  468

Query  447  SFSRIMLDDLLMSPHSPASAKSPMVQA  367
            S  R   DD   SPHSP +  SP+V+A
Sbjct  469  SDKR-RFDDGFFSPHSPVTP-SPLVRA  493



>gb|AAC05376.1| 1-aminocyclopropane-1-carboxylate synthase 3 [Dianthus caryophyllus]
Length=421

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 6/125 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL+ +GI  L+S AGLF WMDLR  L++PT+E EL LWR+II++VK+NVSPG SFHC+
Sbjct  277  TWGLSQVGIKCLRSNAGLFVWMDLRHPLQDPTIEGELALWRVIINEVKINVSPGSSFHCS  336

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA----AAKRQCRGRALQISTSFSRIM  430
            EPGWFRVC ANM+D+TM VAL RIR+FV Q+   A    ++KR+C    LQ+  S  R  
Sbjct  337  EPGWFRVCIANMNDETMEVALRRIRSFVLQKKDAATCVTSSKRKCWQTNLQLRLSNRR--  394

Query  429  LDDLL  415
            L+D +
Sbjct  395  LEDFI  399



>ref|XP_011023276.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Populus euphratica]
Length=486

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 96/140 (69%), Gaps = 14/140 (10%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  L+S AGLF WM+LR LL+E T + E+ LWR+I++DVKLNVSPG SFHC 
Sbjct  342  TKGLEQIGISCLESKAGLFVWMNLRHLLKEQTNDGEMALWRVIVNDVKLNVSPGSSFHCV  401

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAA---------AKRQCRGRALQISTS  445
            EPGWFRVCFANMDD+T+ VAL RI AFV ++    A         +K +C  + L++S S
Sbjct  402  EPGWFRVCFANMDDETLEVALKRIHAFVGEQKEREALSTKTKDMPSKTKCWKKNLRLSFS  461

Query  444  FSRIMLD----DLLMSPHSP  397
             SRI  +     + MSPHSP
Sbjct  462  -SRIFEEGIGSPIAMSPHSP  480



>ref|XP_003624084.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=533

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 98/140 (70%), Gaps = 4/140 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I  L S AGLFFWM+LR LL+E T E E++LWR+II++VKLNVSPG +F+C+
Sbjct  345  TKGLEKVNITCLPSNAGLFFWMNLRGLLKEKTFEGEMKLWRLIINEVKLNVSPGSAFNCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTS---FSRIML  427
            EPGW+RVCFANMD +T+ +AL RIRAFV  R  G   + +     L++S S   F   ++
Sbjct  405  EPGWYRVCFANMDHETVEIALRRIRAFVNGREKGKTVEIKRWKSNLRLSFSSRRFDENVM  464

Query  426  DDLLMSPHSPASAKSPMVQA  367
               +MSPHSP    SP+V++
Sbjct  465  SPHMMSPHSPM-PHSPLVRS  483



>ref|XP_008669001.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Zea 
mays]
 gb|AAR25558.1| acc synthase [Zea mays]
 tpg|DAA36361.1| TPA: acc synthase [Zea mays]
Length=485

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL  +GI  L   AGLF WMDLR +LR+ T +AELELWR+I+H VKLNVSPG SFHC EP
Sbjct  348  GLREVGIACLPGNAGLFSWMDLRGMLRDKTHDAELELWRVIVHKVKLNVSPGTSFHCNEP  407

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIS------TSFSRIM  430
            GWFRVC ANMDD+TM VAL RIR FVRQ    A A+R    R +++S       + S + 
Sbjct  408  GWFRVCHANMDDETMEVALDRIRRFVRQHQHKAKAERWAATRPMRLSLPRRGGATASHLP  467

Query  429  LDDLLMSPHSPASAKSPMVQAT  364
            +     SP +  S +SPMV A+
Sbjct  468  IS----SPMALLSPQSPMVHAS  485



>ref|XP_009591161.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Nicotiana 
tomentosiformis]
Length=489

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 97/141 (69%), Gaps = 4/141 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S AGLF WMDLR LL E T +AE+ LWR+II+DVKLNVSPG SF C 
Sbjct  347  TNGLEEVGIKCLRSNAGLFCWMDLRPLLEESTFDAEMSLWRVIINDVKLNVSPGSSFDCQ  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG---AAAKRQCRGRALQISTSFSRIML  427
            EPG+FRVCFANMDD+T+ +AL RIR FV  +  G    A ++Q + +   +  SFS+ M 
Sbjct  407  EPGFFRVCFANMDDETVDIALARIRRFVGVKKSGDESTAMEKQQQWKKSNLRLSFSKRMF  466

Query  426  DDLL-MSPHSPASAKSPMVQA  367
            D+ + +SP S     SP+V+A
Sbjct  467  DESVNLSPLSSPIPHSPLVRA  487



>ref|XP_002302608.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE81881.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=474

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  L+S AGLF WM+LR LL+E T + E+ LWR+I++DVKLNVSPG SFHC 
Sbjct  330  TKGLEQIGISCLESKAGLFVWMNLRHLLKEQTNDGEMALWRVIVNDVKLNVSPGSSFHCV  389

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ---------RNGGAAAKRQCRGRALQISTS  445
            EPGWFRVCFANMDD+T+ VAL RI AFV +         +     +K +C  + L++S S
Sbjct  390  EPGWFRVCFANMDDETLEVALKRINAFVGEQKERDTLSTKTKDMPSKTKCWKKNLRLSFS  449

Query  444  ---FSRIMLDDLLMSPHSP  397
               F   +   + MSPHSP
Sbjct  450  SRIFEEGIGSPIAMSPHSP  468



>ref|NP_001284464.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Cucumis melo]
 dbj|BAA06464.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
 dbj|BAA83618.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=493

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L  MGI  L S AGLF WMDLR+LL++ + E+E+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TEELEKMGITCLNSNAGLFVWMDLRKLLKDQSFESEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGA--AAKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ N       K++ R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVGVALDRIHSFVGKIDKKENSTIPMPPKKKHRENKLRLSFSFSG  467

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH   S  SP+V+A
Sbjct  468  RRYEEGNVLKSPHM-MSPHSPLVRA  491



>dbj|BAA93712.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=493

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L  MGI  L S AGLF WMDLR+LL++ + E+E+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TEELEKMGITCLNSNAGLFVWMDLRKLLKDQSFESEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGA--AAKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ N       K++ R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVGVALDRIHSFVGKIDKKENSTIPMPPKKKHRENKLRLSFSFSG  467

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH   S  SP+V+A
Sbjct  468  RRYEEGNVLKSPHM-MSPHSPLVRA  491



>ref|XP_010474747.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Camelina 
sativa]
Length=497

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 92/147 (63%), Gaps = 21/147 (14%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLRE-PTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL    I  L S+ GLF WMDLR LLR+  + E+E+ELWRIIIH VKLNVSPG SFHC
Sbjct  348  TTGLKKADITCLTSSGGLFVWMDLRHLLRDRNSFESEIELWRIIIHKVKLNVSPGSSFHC  407

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA---------------AAKRQCRGR  466
             EPGWFRVCFANMDDDT+RVAL RI+ FV + N                   AK+Q + R
Sbjct  408  TEPGWFRVCFANMDDDTLRVALRRIQDFVSKNNNNKIVEKATDKDQVIQNNNAKKQ-KWR  466

Query  465  ALQISTSFSRIMLDDL----LMSPHSP  397
               +  SF R+  D L    +MSPHSP
Sbjct  467  QSNLRLSFRRLYEDGLSSPGIMSPHSP  493



>ref|XP_007139782.1| hypothetical protein PHAVU_008G058400g [Phaseolus vulgaris]
 gb|ESW11776.1| hypothetical protein PHAVU_008G058400g [Phaseolus vulgaris]
Length=483

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 97/142 (68%), Gaps = 7/142 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  + I  L S AGLFFWM+LR LL+E T E E+ LW +II++VKLNVSPG +F+C+
Sbjct  345  TKELEKVNITCLPSNAGLFFWMNLRGLLKEKTFEGEMMLWHVIINEVKLNVSPGSAFNCS  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGW+RVCFANMDD+T+ VAL RIRAFV +  G     ++ +     +  SFS    D+ 
Sbjct  405  EPGWYRVCFANMDDETVEVALKRIRAFVGKETGKPVELKRWKS---NLRLSFSSRRFDEN  461

Query  417  LMSPH--SPAS--AKSPMVQAT  364
            +MSPH  SP S    SP+V+AT
Sbjct  462  VMSPHMLSPHSPMPHSPLVRAT  483



>gb|AEY82446.1| 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=495

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 92/145 (63%), Gaps = 18/145 (12%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TR L  MGI  L S AGLF WMDLR+LL+E + EAE+ELWR+II +VKLNVSPG SFH  
Sbjct  347  TRELEKMGITCLNSNAGLFVWMDLRQLLKEQSFEAEMELWRVIIDEVKLNVSPGSSFHVT  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA-----------AAKRQCRGRALQIS  451
            EPGWFRVCFANMDD+T+ VAL RI+ FV + N                K + R   L++S
Sbjct  407  EPGWFRVCFANMDDNTVNVALNRIQCFVGKNNKKEDDVAVTVAVVAPTKPKRRESKLRLS  466

Query  450  TSFSRIMLDD-------LLMSPHSP  397
             SFS    +D        +MSPHSP
Sbjct  467  FSFSGRRYEDGGVLNSPHMMSPHSP  491



>ref|NP_001289261.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Pyrus x bretschneideri]
 dbj|BAF44096.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus x bretschneideri]
Length=495

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 20/154 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TDGLEEVGINCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ-------------  457
            EPGWFRVCFANMDDDT+ VAL RIRAFV Q   G  A+ Q + ++ +             
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRAFVGQ---GKKAQEQVQVKSPKKRWQSNLRLSFSS  461

Query  456  ---ISTSFSRIMLDDLLMSPHSPASAKSPMVQAT  364
                       ++   +MSPHSP    SP+++AT
Sbjct  462  SSRRFEQEGVSVMSPRMMSPHSPM-PHSPLLRAT  494



>ref|XP_009398061.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL G+GI  L+S AGLF WM L+ LL++ T E E+ELWR+I+++VKLN+SPG SFHC 
Sbjct  344  TAGLEGVGIRCLQSNAGLFCWMSLKPLLKDATAEGEVELWRVIVNEVKLNISPGSSFHCT  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFR CFANMD++TM  AL RIR FVR+ N  A A +  +     +  S  R   +  
Sbjct  404  EPGWFRACFANMDEETMETALRRIRTFVRRANDAATAAKTKKRWDTSLRLSLPRRFEEMT  463

Query  417  LMSPHSPASAKSPMVQA  367
            +++P    S +SP+VQA
Sbjct  464  VLTPRL-MSPRSPLVQA  479



>gb|AAF22109.1|AF119411_1 1-aminocyclopropane-1-carboxylate synthase 1 [Lupinus albus]
Length=487

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            ++ L  + I    S AGLF WM+L+ LL+E T EAE+ LW +II++VKLNVSPG SF+C+
Sbjct  346  SKVLEEVNITKFPSNAGLFCWMNLKSLLKEQTFEAEMMLWHMIINEVKLNVSPGSSFNCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFANMDD+T+ VAL RIR F+ +       + +   R LQ+S S  R  + + 
Sbjct  406  EPGWFRVCFANMDDETVEVALTRIRTFIGKETKKPEMQVKSWQRNLQLSFSSIRRFVHET  465

Query  417  LMSPH--SPAS--AKSPMVQAT  364
            +MSPH  SP S   +SP+V+AT
Sbjct  466  IMSPHMMSPHSPIPQSPLVKAT  487



>dbj|BAA78333.1| 1-aminocyclopropane-1-carboxylic acid synthase [Pyrus pyrifolia]
 gb|ABQ45958.1| ACC synthase [Pyrus pyrifolia]
 gb|AGG19161.1| aminocyclopropane-1-carboxylic acid synthase [Pyrus pyrifolia]
Length=495

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 20/154 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TDGLEEVGINCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ-------------  457
            EPGWFRVCFANMDDDT+ VAL RIRAFV Q   G  A+ Q + ++ +             
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRAFVGQ---GKKAQEQAQVKSPKKRWQSNLRLSFSS  461

Query  456  ---ISTSFSRIMLDDLLMSPHSPASAKSPMVQAT  364
                       ++   +MSPHSP    SP+++AT
Sbjct  462  SSRRFEQEGVSVMSPRMMSPHSPM-PHSPLLRAT  494



>gb|AER35096.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=456

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  L+ +GIG LK  AGLF WMDLR+LL+E T  AE+ELWR+I ++VKLNVSPG SFHC 
Sbjct  339  TWSLSQVGIGCLKGNAGLFIWMDLRKLLKEETFAAEMELWRVITNEVKLNVSPGSSFHCQ  398

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQC  475
            EPGWFRVCFANMDD TM+VALLRIR F+ + N      + C
Sbjct  399  EPGWFRVCFANMDDYTMKVALLRIRTFMLKNNEAMVPLKLC  439



>sp|Q07262.1|1A1C_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Nicotiana tabacum]
 emb|CAA46797.1| 1-aminocyclopropane 1-carboxylate synthase [Nicotiana tabacum]
 prf||1909369A aminocyclopropane carboxylate synthase
Length=491

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 10/145 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S AGLF WMDLR LL+E T ++E+ LWR+II+DVKLNVSPG SF C 
Sbjct  347  TNGLEEVGIKCLRSNAGLFCWMDLRPLLKESTFDSEMSLWRVIINDVKLNVSPGSSFDCQ  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA-------KRQCRGRALQISTSFS  439
            EPG+FRVCFANMDD+T+ +AL RIR+FV  +  G  +       K+Q +   L++  SFS
Sbjct  407  EPGFFRVCFANMDDETVDIALARIRSFVGVKKSGDESTPILMEKKQQWKKNNLRL--SFS  464

Query  438  RIMLDDLL-MSPHSPASAKSPMVQA  367
            + M D+ + +SP S     SP+V+A
Sbjct  465  KRMYDESVNLSPLSSPIPHSPLVRA  489



>ref|XP_008345341.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Malus 
domestica]
Length=495

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 20/154 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TDGLEEVGINCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ-------------  457
            EPGWFRVCFANMDDDT+ VAL RIRAFV Q   G  A+ Q + ++ +             
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRAFVGQ---GKKAQEQAQVKSPKKRWQSNLRLSFSS  461

Query  456  ---ISTSFSRIMLDDLLMSPHSPASAKSPMVQAT  364
                       ++   +MSPHSP    SP+++AT
Sbjct  462  SSRRFEQEGVSVMSPRMMSPHSPM-PHSPLLRAT  494



>ref|XP_009786813.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Nicotiana 
sylvestris]
Length=491

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 10/145 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S AGLF WMDLR LL+E T ++E+ LWR+II+DVKLNVSPG SF C 
Sbjct  347  TNGLEEVGIKCLRSNAGLFCWMDLRPLLKESTFDSEMSLWRVIINDVKLNVSPGSSFDCQ  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA-------KRQCRGRALQISTSFS  439
            EPG+FRVCFANMDD+T+ +AL RIR+FV  +  G  +       K+Q +   L++  SFS
Sbjct  407  EPGFFRVCFANMDDETVDIALARIRSFVGVKKSGDESTPILMEKKQQWKKNNLRL--SFS  464

Query  438  RIMLDDLL-MSPHSPASAKSPMVQA  367
            + M D+ + +SP S     SP+V+A
Sbjct  465  KRMYDESVNLSPLSSPIPHSPLVRA  489



>ref|XP_003622479.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
 gb|KEH18801.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=480

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 99/142 (70%), Gaps = 9/142 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  + I    S AGLF WM+L++LL+E T+E EL+LW +II++VKLNVSPG SF+C+
Sbjct  344  TKGLEEVEISRFPSNAGLFCWMNLKKLLKEETIEEELKLWHVIINEVKLNVSPGSSFNCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQ--ISTSFSRIMLD  424
            E GWFRVCFAN+DD+T+ +AL RIRAFV     G   K++   +  Q  +S SF+    D
Sbjct  404  EVGWFRVCFANIDDETVEIALQRIRAFV-----GKETKKKIEVKRWQPNLSLSFTSTRFD  458

Query  423  DLLMSPHSP--ASAKSPMVQAT  364
            + ++SPH+    S  SP+V+AT
Sbjct  459  ENVLSPHNHIIISPHSPLVRAT  480



>dbj|BAF33503.1| ACC synthase [Orobanche minor]
Length=497

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 92/144 (64%), Gaps = 18/144 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  L+S AGLF WMDLR LL EPT E E++LWR+II+DVKLNVSPG SFHC 
Sbjct  349  TKGLEQVGIRCLESNAGLFCWMDLRTLLEEPTFEEEMKLWRVIINDVKLNVSPGSSFHCH  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAA------KRQCRGRALQISTSFSR  436
            EPGWFRVCFANMDD TM VAL RIR FV +    +        +++   R L    S S 
Sbjct  409  EPGWFRVCFANMDDLTMEVALRRIRMFVEKGKEDSTEVIIVRKEKKAWQRRLG-RLSLST  467

Query  435  IMLDD-----------LLMSPHSP  397
            +M D+            +MSPHSP
Sbjct  468  LMYDENILTTSQFSSPHMMSPHSP  491



>gb|AAL66200.1|AF386518_1 1-aminocyclopropane 1-carboxylate synthase 4 [Pyrus communis]
Length=495

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 97/151 (64%), Gaps = 14/151 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LKS AGLF WMDLRRLLR+ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TDGLEEVGINCLKSNAGLFCWMDLRRLLRDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQISTSFSRI----  433
            EPGWFRVCFANMDDDT+ VAL RIRAFV Q +     A+ +   +  Q +   S      
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRAFVGQAKKAQEQAQVKSPKKRWQSNLRLSFSSSSR  464

Query  432  --------MLDDLLMSPHSPASAKSPMVQAT  364
                    ++   +MSPHSP    SP+++AT
Sbjct  465  RFEQEGVSVMSPRMMSPHSPM-PHSPLLRAT  494



>ref|XP_008779569.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Phoenix 
dactylifera]
Length=483

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 10/140 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA  GI  L+S AGLF WM+L+ LL+E TVE ELELWR II D+KLNVSPG SFHC+
Sbjct  349  TSRLAQEGIQCLESNAGLFCWMNLKMLLKESTVEGELELWRRIIDDMKLNVSPGSSFHCS  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFRVCFAN+DD+TM VAL R ++F+RQ    A  KR   G  L    SF R      
Sbjct  409  EPGWFRVCFANIDDETMEVALQRFKSFMRQ----AKKKRWQNGLRL----SFPRRFEGMT  460

Query  417  LMSPHSPA--SAKSPMVQAT  364
             M+P +P+  S  SP+V+AT
Sbjct  461  TMTPMTPSLLSPHSPVVRAT  480



>gb|ADZ96243.1| ACC synthase 1 [Saccharum hybrid cultivar SP80-3280]
Length=487

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 95/143 (66%), Gaps = 11/143 (8%)
 Frame = -1

Query  771  GLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEP  592
            GL  +GI  L   AGLF WMDLR +LR+ T +AELELWR+IIH VKLNVSPG SFHC EP
Sbjct  349  GLREVGIACLPGNAGLFSWMDLRGMLRDKTHDAELELWRVIIHKVKLNVSPGTSFHCNEP  408

Query  591  GWFRVCFANMDDDTMRVALLRIRAFVRQ-RNGGAAAKRQCRGRALQIS------TSFSRI  433
            GWFRVC ANMDD+TM VAL RIR FVRQ +   A A+R    R L++S       + S +
Sbjct  409  GWFRVCHANMDDETMEVALDRIRCFVRQHQQSKAKAERWAATRPLRLSLPRRGGATPSHL  468

Query  432  MLDDLLMSPHSPASAKSPMVQAT  364
             +     SP +  S +SPMV A+
Sbjct  469  AIP----SPLALLSPQSPMVHAS  487



>ref|XP_007051710.1| 1-aminocyclopropane-1-carboxylate synthase [Theobroma cacao]
 gb|EOX95867.1| 1-aminocyclopropane-1-carboxylate synthase [Theobroma cacao]
Length=483

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 89/134 (66%), Gaps = 7/134 (5%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLFFWM++R LL+E T + ELELWR II +VKLNVSPG SF C+
Sbjct  344  TKGLEQVGISCLKSNAGLFFWMNMRPLLKEQTAQGELELWRAIISEVKLNVSPGSSFQCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCR-------GRALQISTSFS  439
            EPGWFRVCFANMDD+T+ VAL RIRAFV Q     A  ++ +         +   S  + 
Sbjct  404  EPGWFRVCFANMDDETVEVALERIRAFVLQGKEEDAPDQKSQRWHKKSLRLSFSSSRLYD  463

Query  438  RIMLDDLLMSPHSP  397
               +   ++SPHSP
Sbjct  464  ESPMSPRMLSPHSP  477



>gb|AGF95122.1| 1-aminocyclopropane-1-carboxylate synthase, partial [Prunus persica]
Length=182

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 7/110 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++V LNVSPG SF C 
Sbjct  79   TKGLEEVGINCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVGLNVSPGSSFKCV  138

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIST  448
            EPGWFRVCFANMDD+T+ VAL RIR FVRQ   G  A+ Q    A+Q+ +
Sbjct  139  EPGWFRVCFANMDDETVEVALKRIRTFVRQ---GKKAQDQ----AVQVKS  181



>ref|XP_004976571.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Setaria 
italica]
Length=484

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GIG L   AGLF WMDLR +LR+ T EAELELWR+IIH VKLNVSPG SFHC 
Sbjct  345  TSGLRDVGIGCLPGNAGLFSWMDLRGMLRDKTPEAELELWRVIIHKVKLNVSPGTSFHCG  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKR-QCRGR-ALQISTSFSRIMLD  424
            EPGWFRVC ANMDD+TM VAL RIR+FV+Q+   A AK    RGR  L +      +   
Sbjct  405  EPGWFRVCHANMDDETMEVALGRIRSFVQQQKQKAKAKSWAARGRLHLSLPRRGGAVASH  464

Query  423  DLLMSPHSPASAKSPMVQAT  364
              L SP +  S +SPMV A+
Sbjct  465  LALSSPLALMSPQSPMVHAS  484



>emb|CDY15174.1| BnaC05g00530D [Brassica napus]
Length=496

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLR-EPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL   GI  L STAGLF WMDLR LLR   + E+E+ELW III  VKLNVSPG SF C
Sbjct  348  TLGLKKAGINCLISTAGLFVWMDLRHLLRVRNSFESEIELWHIIIDKVKLNVSPGSSFQC  407

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIST---------  448
             EPGWFRVCFANMDDDT+ VALLRI+ FV + +   A K     + +Q +          
Sbjct  408  TEPGWFRVCFANMDDDTLHVALLRIQDFVSKNSNKTAEKASDNDQVIQNNNAKKQKWKQS  467

Query  447  ----SFSRIMLDDL----LMSPHSP  397
                SF R+  D L    +MSPHSP
Sbjct  468  NLRLSFRRLYEDGLSSPGIMSPHSP  492



>gb|AAC41663.1| 1-aminocyclopropane-1-carboxylate synthase, partial [Solanum 
tuberosum]
Length=455

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LK+ AGLF WMDLR LLRE T ++E+ LWR+II+DVKLNVSPG SF C 
Sbjct  317  TNGLEEVGIKCLKNNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQ  376

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG---AAAKRQCRGRALQISTSFSRIML  427
            EPGWFRVCFANMDD T+ +AL RIR FVR    G   +A +++ + +   +  SFS+ M 
Sbjct  377  EPGWFRVCFANMDDGTVDIALARIRRFVRVEKSGDESSAMEKKQQWKKNNLRLSFSKRMY  436

Query  426  DD  421
            D+
Sbjct  437  DE  438



>ref|XP_006396926.1| hypothetical protein EUTSA_v10028605mg [Eutrema salsugineum]
 gb|ESQ38379.1| hypothetical protein EUTSA_v10028605mg [Eutrema salsugineum]
Length=493

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 85/127 (67%), Gaps = 9/127 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL G+GIG LK+ AGLF WMDLR LL+  T ++E ELWR+I+H VKLNVSPG SFHC 
Sbjct  348  TTGLDGLGIGWLKAEAGLFLWMDLRNLLKTATFDSETELWRVIVHKVKLNVSPGGSFHCH  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQ---------RNGGAAAKRQCRGRALQISTS  445
            EPGWFRVCFANMD  TM  AL RIR F RQ         +   A  K++C   +L++S +
Sbjct  408  EPGWFRVCFANMDHKTMETALERIRVFTRQLEQENLNRTKPMAATKKKKCWQSSLRLSFN  467

Query  444  FSRIMLD  424
             +R   D
Sbjct  468  DTRRFED  474



>ref|XP_010092578.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Morus notabilis]
 gb|EXB51626.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Morus notabilis]
Length=496

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 102/150 (68%), Gaps = 14/150 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+GL  +GI  LKS AGLFFWM+L+RLL+E T E E+ LW +II++VKLNVSPG SF C+
Sbjct  346  TKGLEEVGITCLKSNAGLFFWMNLQRLLKEQTFEGEMALWLVIINEVKLNVSPGSSFQCS  405

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAA------AKRQCRGRA-LQISTSFS  439
            EPGWFRVCFANM+++T+ VAL RIR+FV +    AA      AKR  R    L++S +  
Sbjct  406  EPGWFRVCFANMEEETVNVALERIRSFVGKEAKQAAVPPVAKAKRNWRNNGNLRLSFNSR  465

Query  438  R------IMLDDLLMSPHSPASAKSPMVQA  367
            R       M    ++SPHSP   +SP+++A
Sbjct  466  RHEQEGGFMSAAHMLSPHSPM-PQSPLLRA  494



>ref|XP_004306735.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Fragaria vesca subsp. vesca]
Length=493

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 103/161 (64%), Gaps = 19/161 (12%)
 Frame = -1

Query  798  RSWSYGGTRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSP  619
            R W +  T GL  +GI  LK  AGLF WMDLR+LL++ T EAE+ LWR+II+DVKLNVSP
Sbjct  336  RHWIF--TTGLEKVGINCLKGNAGLFCWMDLRKLLKDKTFEAEMVLWRMIINDVKLNVSP  393

Query  618  GCSFHCAEPGWFRVCFANMDDDTMRVALLRIRAFV-------RQRNGGAA---AKRQCR-  472
            G SF C EPGWFRVCFANMD+ T+ VAL RIRAFV       ++RN       + R+ R 
Sbjct  394  GSSFRCVEPGWFRVCFANMDEHTVEVALKRIRAFVGVEFEGNKKRNNAEVFVNSPRKNRW  453

Query  471  ---GRALQISTSFSRI--MLDDLLMSPHSPASAKSPMVQAT  364
               G  L   ++  R   ++   +MSPHSP    SP+++A+
Sbjct  454  GKDGLRLSFGSATRRYEEVMSPRMMSPHSPM-PHSPLLRAS  493



>ref|XP_006345579.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 4-like 
[Solanum tuberosum]
Length=496

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 101/147 (69%), Gaps = 9/147 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGL  +GI  L+S AG++ WMDLR LL+EPT++AE+ LW++II+ VKLNVSPG SF+C+
Sbjct  351  TRGLEEIGIKCLESNAGVYCWMDLRLLLKEPTLDAEMSLWKLIINVVKLNVSPGSSFNCS  410

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVR-----QRNGGAAAKRQCRGRALQISTS---F  442
            E GWFRVCFAN+DD TM +AL RIR F+        NG    K Q +   L+++ S   +
Sbjct  411  EVGWFRVCFANIDDQTMEIALARIRMFMDANNNVDENGILKNKLQWKRNNLRLNFSNGEY  470

Query  441  SRIMLDDLLMSPHSPASAKSPMVQATN  361
               ++   +MSP+SP   +SP+V+A N
Sbjct  471  DENVMSLNMMSPNSPI-PRSPLVRARN  496



>gb|ABO76787.1| 1-aminocyclopropane-1-carboxylate synthase [Citrullus colocynthis 
x Citrullus lanatus var. lanatus]
Length=494

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L   AGLF WMDLR+LL++ + ++E+ELWR+II++VKLNVSPG SFH  
Sbjct  348  TKELEKMGITCLNGNAGLFVWMDLRKLLKDQSFKSEMELWRVIINEVKLNVSPGSSFHVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGA-------AAKRQCRGRALQISTSFS  439
            EPGWFRVCFANMDD+T+ VAL RI +FV + +            K + R   L+++ SFS
Sbjct  408  EPGWFRVCFANMDDNTVDVALDRIHSFVGKNDKKEDNITLTMPPKTKRRENKLRLNFSFS  467

Query  438  --RIMLDDLLMSPHSPASAKSPMVQATN  361
              R    ++L SPH   S  SP+V+A N
Sbjct  468  GGRYEEGNVLNSPHM-MSPHSPLVRAHN  494



>ref|XP_010480237.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2-like 
[Camelina sativa]
Length=497

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 90/146 (62%), Gaps = 19/146 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLRE-PTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL    I  L S+ GLF WMDLR LLR+  + E+E+ELWRIIIH VKLNVSPG SFHC
Sbjct  348  TTGLKKADITCLTSSGGLFVWMDLRHLLRDRNSFESEIELWRIIIHKVKLNVSPGSSFHC  407

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQIST--------  448
             EPGWFRVCFANMDDDT+ VAL RI+ FV +  N     K   + + +Q +         
Sbjct  408  TEPGWFRVCFANMDDDTLHVALRRIQDFVSKNSNNKIVEKATDKDQVIQNNNAKKQKWRQ  467

Query  447  -----SFSRIMLDDL----LMSPHSP  397
                 SF R+  D L    +MSPHSP
Sbjct  468  SNLRLSFRRLYEDGLSSPGIMSPHSP  493



>ref|XP_010457119.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2-like 
[Camelina sativa]
Length=497

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 90/146 (62%), Gaps = 19/146 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLRE-PTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL    I  L S+ GLF WMDLR LLR+  + E+E+ELWRIIIH VKLNVSPG SFHC
Sbjct  348  TTGLKKADITCLTSSGGLFVWMDLRHLLRDRNSFESEIELWRIIIHKVKLNVSPGSSFHC  407

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFV-RQRNGGAAAKRQCRGRALQIST--------  448
             EPGWFRVCFANMDDDT+ VAL RI+ FV +  N     K   + + +Q +         
Sbjct  408  TEPGWFRVCFANMDDDTLHVALRRIQDFVSKNSNNKIVEKATDKDQVIQNNNAKKQKWRQ  467

Query  447  -----SFSRIMLDDL----LMSPHSP  397
                 SF R+  D L    +MSPHSP
Sbjct  468  SNLRLSFRRLYEDGLSSPGIMSPHSP  493



>dbj|BAA33374.1| ACC synthase [Cucumis sativus]
 dbj|BAA93714.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=493

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L   AGLF WMDLR+LL++ + E+E+ELWR+II++VKLNVSPG SF   
Sbjct  348  TKELEKMGITCLNGNAGLFVWMDLRKLLKDQSFESEMELWRVIINEVKLNVSPGSSFRVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGA--AAKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ N       K++ R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALGRIHSFVGKIDKKENNTIPMPPKKKPRENKLRLSFSFSG  467

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH   S  SP+V+A
Sbjct  468  RRYEEGNVLKSPHM-MSPHSPLVRA  491



>ref|XP_004159772.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMW33-like 
[Cucumis sativus]
Length=493

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L   AGLF WMDLR+LL++ + E+E+ELWR+II++VKLNVSPG SF   
Sbjct  348  TKELEKMGITCLNGNAGLFVWMDLRKLLKDQSFESEMELWRVIINEVKLNVSPGSSFRVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGA--AAKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ N       K++ R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALGRIHSFVGKIDKKENNTIPMPPKKKPRENKLRLSFSFSG  467

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH   S  SP+V+A
Sbjct  468  RRYEEGNVLKSPHM-MSPHSPLVRA  491



>gb|ACZ54911.3| 1-aminocyclopropane-1-carboxylic acid synthase [Narcissus tazetta 
var. chinensis]
Length=490

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 3/140 (2%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  MGI  L+S AGLF WMDL   L+E T E E++LW  II+ VKLNVSPG SF C 
Sbjct  349  TSGLDKMGIRCLESNAGLFCWMDLSXRLKEKTSEEEIKLWXXIINXVKLNVSPGASFXCT  408

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIST---SFSRIML  427
            EPGWFRVCFANMDD+TM +AL RI++F+   +   A + Q + +  Q ++   S +R   
Sbjct  409  EPGWFRVCFANMDDETMEIALRRIKSFIGGSDNNIAIRVQAKKKNWQATSLRLSLNRRFE  468

Query  426  DDLLMSPHSPASAKSPMVQA  367
            D  ++SPH   S  SP+V A
Sbjct  469  DMAIVSPHIVMSPHSPLVHA  488



>gb|KGN45694.1| hypothetical protein Csa_6G006800 [Cucumis sativus]
Length=493

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 9/145 (6%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T+ L  MGI  L   AGLF WMDLR+LL++ + E+E+ELWR+II++VKLNVSPG SF   
Sbjct  348  TKELEKMGITCLNGNAGLFVWMDLRKLLKDQSFESEMELWRVIINEVKLNVSPGSSFRVT  407

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV----RQRNGGA--AAKRQCRGRALQISTSFS-  439
            EPGWFRVCFANMDD+T+ VAL RI +FV    ++ N       K++ R   L++S SFS 
Sbjct  408  EPGWFRVCFANMDDNTVDVALGRIHSFVGKIDKKENNTIPMPPKKKPRENKLRLSFSFSG  467

Query  438  -RIMLDDLLMSPHSPASAKSPMVQA  367
             R    ++L SPH   S  SP+V+A
Sbjct  468  RRYEEGNVLKSPHM-MSPHSPLVRA  491



>gb|KFK42535.1| hypothetical protein AALP_AA1G007100 [Arabis alpina]
Length=497

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 93/146 (64%), Gaps = 19/146 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLRE-PTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL  +GI  L S AGLF WMDLR LLR+  + E+E+ELWRIII+ VKLNVSPG SF+C
Sbjct  348  TLGLKKVGITCLSSDAGLFVWMDLRHLLRDRNSFESEIELWRIIINVVKLNVSPGSSFNC  407

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAK--------------RQCRGRA  463
             EPGWFRVCFANMDDDT+ VAL RI+ FV + N   + K              ++ + R 
Sbjct  408  TEPGWFRVCFANMDDDTLHVALGRIQDFVSKNNNKISEKAMDNNDQVIQNNNAKKQKWRQ  467

Query  462  LQISTSFSRIMLDDL----LMSPHSP  397
              +  SF R+  D L    +MSPHSP
Sbjct  468  SNLRLSFRRLYEDGLSSPGIMSPHSP  493



>dbj|BAK19925.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=507

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 97/153 (63%), Gaps = 20/153 (13%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GIG L+  A LF WMDLR LL E TVE EL+LWR+II++VK+NVSPG SF C+
Sbjct  347  TSELAKIGIGCLQGNAALFVWMDLRHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCS  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV---RQRNGGAAAK---------------RQCR  472
            EPGWFRVCFANMD+ T+ VAL RIR+FV   R  N                     ++ R
Sbjct  407  EPGWFRVCFANMDNATLDVALNRIRSFVTRGRVDNSTMTTTAATTTTTTTTTTTTIKKKR  466

Query  471  GRALQISTSFSRIMLDDLLMSPH-SPASAKSPM  376
            G+ +++  SF+    +D LMSPH SP S  SPM
Sbjct  467  GQ-MELRLSFNNRRFEDGLMSPHSSPLSPHSPM  498



>ref|XP_003620110.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=586

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S  GLF WMDLR LL+E T E+ELELWR+IIH+VK+NVSPG SFHC+
Sbjct  62   TSGLTKVGINCLQSNGGLFVWMDLRGLLKEATFESELELWRVIIHEVKINVSPGVSFHCS  121

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR  505
            EPGWFRVC+ANMDD  ++++L RIR+FV ++
Sbjct  122  EPGWFRVCYANMDDRNVKISLQRIRSFVVKK  152



>ref|XP_010559100.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 [Tarenaya hassleriana]
Length=487

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 9/132 (7%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            TRGL   GI  LKS AGLF WMDLR +L++ + E+E++LWR+II+ VK+NVSPG SFHC+
Sbjct  356  TRGLEQTGISCLKSNAGLFVWMDLRPMLKDQSFESEMDLWRVIINKVKINVSPGSSFHCS  415

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRIMLDDL  418
            EPGWFR CFANMD++T+ V L RI+ FV     G +  +   G    +  SFS  M D+ 
Sbjct  416  EPGWFRACFANMDEETLEVGLRRIQEFVV----GNSKSKTRGGWQKNLRLSFSSRMYDEH  471

Query  417  -----LMSPHSP  397
                 LMSPHSP
Sbjct  472  AMSPRLMSPHSP  483



>ref|XP_008362641.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Malus domestica]
Length=491

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  LKS AGLF WMDLRRLL++ T + E+ LWR+I+++VKLNVSPG SF C 
Sbjct  345  TDGLEEVGINCLKSNAGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCV  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRA  463
            EPGWFRVCFANMDDDT+ VAL RIRAFV Q   G  A+ Q + ++
Sbjct  405  EPGWFRVCFANMDDDTVEVALKRIRAFVGQ---GKKAQEQAQVKS  446



>gb|AAR99390.1| ACC synthase ACS1 [Nicotiana attenuata]
Length=490

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GI  L+S AGLF WMDLR LL++   +AE+ LW++II+DVKLNVSPG SF C 
Sbjct  347  TNGLEEVGIKCLRSNAGLFCWMDLRPLLKQSNFDAEMSLWKVIINDVKLNVSPGSSFDCQ  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGG---AAAKRQCRGRALQISTSFSRIML  427
            EPG+FRVCFANMDD+T+ +AL RIR FV  +  G    A +++ + +   +  SF + M 
Sbjct  407  EPGFFRVCFANMDDETVDIALARIRRFVGVKESGDETTAMEKKQQWKKNNLRLSFPKRMY  466

Query  426  DDLL--MSPHSPASAKSPMVQATN  361
            D+ +  +SP S     SP+V+A N
Sbjct  467  DESVNNLSPLSSPIPHSPLVRARN  490



>gb|AFO63004.1| ACC synthase [Hordeum vulgare]
Length=487

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GIG L   AGLF WMDLR +LRE T EAELELWR+II  VKLNVSPG SF C 
Sbjct  345  TSGLREVGIGCLGGNAGLFTWMDLRGMLREKTAEAELELWRVIIRKVKLNVSPGTSFRCR  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRI-MLDD  421
            EPGWFRVC ANMDD+TM VAL RIR FVRQ     A  R+   R  Q+  S  R   +  
Sbjct  405  EPGWFRVCHANMDDETMGVALDRIRLFVRQHQQQKAKARRWAARG-QLHLSLQRHGAMPS  463

Query  420  LLMSPHSPASA----KSPMVQATN  361
               +  SP +A    +SP+V A +
Sbjct  464  QYHALSSPMAALLSPQSPLVHAAS  487



>dbj|BAJ10410.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 99/153 (65%), Gaps = 16/153 (10%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GIG L+  A LF WMDLR LL E TVE EL+LWR+II++VK+NVSPG SF C+
Sbjct  344  TSELAKIGIGCLQGNAALFVWMDLRHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV---RQRNGGAAAK-----------RQCRGRAL  460
            EPGWFRVCFANMD+ T+ VAL RIR+FV   R  N                 ++ RG+ +
Sbjct  404  EPGWFRVCFANMDNATLDVALNRIRSFVTRGRVDNSTMTTTAATTTTTTTTIKKKRGQ-M  462

Query  459  QISTSFSRIMLDDLLMSPHSP-ASAKSPMVQAT  364
            ++  SF+    +D L+SPHS   S  SPM Q++
Sbjct  463  ELRLSFNNRRFEDGLISPHSSLLSPHSPMPQSS  495



>emb|CDX90035.1| BnaA10g00470D [Brassica napus]
Length=447

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 88/145 (61%), Gaps = 18/145 (12%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLR-EPTVEAELELWRIIIHDVKLNVSPGCSFHC  601
            T GL   GI  L STAGLF WMDLR LLR   + E+E+ELW III  VKLNVSPG SF C
Sbjct  299  TLGLKKAGINCLISTAGLFVWMDLRHLLRVRNSFESEIELWHIIIDKVKLNVSPGSSFQC  358

Query  600  AEPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQIST---------  448
             EPGWFRVCFANMDDDT+ VAL RI+ FV + +   A K     + +Q +          
Sbjct  359  TEPGWFRVCFANMDDDTLHVALRRIQDFVSKNSNKTAEKASDNDQLIQSNNAKKQKWKQS  418

Query  447  ----SFSRIMLDDL----LMSPHSP  397
                SF R+  D L    +MSPHSP
Sbjct  419  NLRLSFRRLYEDGLSSPGIMSPHSP  443



>dbj|BAJ95898.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GIG L   AGLF WMDLR +LRE T EAELELWR+II  VKLNVSPG SF C 
Sbjct  345  TSGLREVGIGCLGGNAGLFTWMDLRGMLREKTAEAELELWRVIIRKVKLNVSPGTSFRCR  404

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAKRQCRGRALQISTSFSRI-MLDD  421
            EPGWFRVC ANMDD+TM VAL RIR FVRQ     A  R+   R  Q+  S  R   +  
Sbjct  405  EPGWFRVCHANMDDETMGVALDRIRLFVRQHQQQKAKARRWAARG-QLHLSLQRHGAMPS  463

Query  420  LLMSPHSPASA----KSPMVQATN  361
               +  SP +A    +SP+V A +
Sbjct  464  QYHALSSPMAALLSPQSPLVHAAS  487



>dbj|BAJ10416.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=500

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 98/151 (65%), Gaps = 15/151 (10%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GIG L+  A LF WMDLR LL E TVE EL+LWR+II++VK+NVSPG SF C+
Sbjct  344  TSELAKIGIGCLQGNAALFVWMDLRHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV---RQRNGGAAAK----------RQCRGRALQ  457
            EPGWFRVCFANMD+ T+ VAL RIR+FV   R  N                ++ RG+ ++
Sbjct  404  EPGWFRVCFANMDNATLDVALNRIRSFVTRGRVDNSTMTTTAATTTTTTTIKKKRGQ-ME  462

Query  456  ISTSFSRIMLDDLLMSPHSP-ASAKSPMVQA  367
            +  SF+    +D L+SPHS   S  SPM Q+
Sbjct  463  LRLSFNNRRFEDGLISPHSSLLSPHSPMPQS  493



>ref|XP_010919134.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
synthase-like [Elaeis guineensis]
Length=405

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -1

Query  768  LAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCAEPG  589
            LA +GI  L+S AGLF WMDLRRLL+E TVE ELELWR++++DVKLNVSPG  FHC+EPG
Sbjct  299  LAEVGIQCLESNAGLFCWMDLRRLLKEFTVEGELELWRVMVNDVKLNVSPGSWFHCSEPG  358

Query  588  WFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAK  484
            WFR CFANMDD+TM VAL RI +FVR+    AA +
Sbjct  359  WFRACFANMDDETMEVALGRIESFVRRTKEIAAVQ  393



>dbj|BAJ10412.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=500

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 98/151 (65%), Gaps = 15/151 (10%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T  LA +GIG L+  A LF WMDLR LL E TVE EL+LWR+II++VK+NVSPG SF C+
Sbjct  344  TSELAKIGIGCLQGNAALFVWMDLRHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCS  403

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFV---RQRNGGAAAK----------RQCRGRALQ  457
            EPGWFRVCFANMD+ T+ VAL RIR+FV   R  N                ++ RG+ ++
Sbjct  404  EPGWFRVCFANMDNATLDVALNRIRSFVTRGRVDNSTMTTTAATTTTTTTIKKKRGQ-ME  462

Query  456  ISTSFSRIMLDDLLMSPHSP-ASAKSPMVQA  367
            +  SF+    +D L+SPHS   S  SPM Q+
Sbjct  463  LRLSFNNRRFEDGLISPHSSLLSPHSPMPQS  493



>ref|XP_010541198.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6 [Tarenaya 
hassleriana]
Length=496

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  +GIG LK  AGLF WMDLR LL   T EAE ELWR+I+H VKLNVSPG SFHC 
Sbjct  347  TTGLKDLGIGCLKGNAGLFLWMDLRNLLESSTFEAETELWRVIVHKVKLNVSPGGSFHCT  406

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQR  505
            EPGWFRVCFANM  +TM +AL RIR F+R R
Sbjct  407  EPGWFRVCFANMSHETMEIALERIRTFMRLR  437



>ref|XP_010556574.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Tarenaya 
hassleriana]
Length=483

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 92/150 (61%), Gaps = 13/150 (9%)
 Frame = -1

Query  777  TRGLAGMGIGTLKSTAGLFFWMDLRRLLREPTVEAELELWRIIIHDVKLNVSPGCSFHCA  598
            T GL  + I  L S AGLF WMDLR LLR+ + E+E+ LWRIII  VKLNVSPG SFHC 
Sbjct  334  TLGLKKVEITCLPSNAGLFVWMDLRHLLRDNSFESEIVLWRIIIDKVKLNVSPGSSFHCT  393

Query  597  EPGWFRVCFANMDDDTMRVALLRIRAFVRQRNGGAAAK-------------RQCRGRALQ  457
            EPGWFRVCFANMDD+T  VAL RI+ FV +       K             ++ + R + 
Sbjct  394  EPGWFRVCFANMDDETFHVALRRIQDFVSRNKAKVVEKSTEVNDQSSSDNVKKQKWREIN  453

Query  456  ISTSFSRIMLDDLLMSPHSPASAKSPMVQA  367
            +  SFS  + +D +MS     S +SP+++A
Sbjct  454  LRLSFSSRVYEDRIMSSPRIMSPQSPLLRA  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1475250502080