BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29787_g1_i1 len=841 path=[1:0-840]

Length=841
                                                                      Score     E

ref|XP_009792227.1|  PREDICTED: ethylene-responsive transcription...    121   5e-28   
ref|XP_009792228.1|  PREDICTED: ethylene-responsive transcription...    121   5e-28   
ref|XP_010314475.1|  PREDICTED: ethylene-responsive transcription...    119   7e-28   
ref|XP_004252593.1|  PREDICTED: ethylene-responsive transcription...    120   1e-27   
ref|XP_010314474.1|  PREDICTED: ethylene-responsive transcription...    120   1e-27   
gb|ABY57638.1|  RAP2.6-like protein                                     120   1e-27   
ref|XP_006361609.1|  PREDICTED: ethylene-responsive transcription...    115   5e-26   
ref|XP_006361610.1|  PREDICTED: ethylene-responsive transcription...    115   6e-26   
ref|XP_009606951.1|  PREDICTED: ethylene-responsive transcription...    113   3e-25   
ref|XP_009606952.1|  PREDICTED: ethylene-responsive transcription...    113   3e-25   
gb|AHA93910.1|  ethylene response factor 11                             111   5e-25   
gb|AHB33884.1|  ERF transcription factor 13                             110   7e-25   
emb|CDP11426.1|  unnamed protein product                                110   2e-24   
emb|CBI18230.3|  unnamed protein product                                110   3e-24   
ref|XP_010246270.1|  PREDICTED: ethylene-responsive transcription...    110   4e-24   
ref|XP_010246271.1|  PREDICTED: ethylene-responsive transcription...    110   4e-24   
ref|XP_002264797.2|  PREDICTED: ethylene-responsive transcription...    110   4e-24   Vitis vinifera
ref|XP_006363442.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
gb|KHG20074.1|  Ethylene-responsive transcription factor ABR1 -li...    105   7e-23   
ref|XP_010261002.1|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
ref|XP_007019566.1|  Integrase-type DNA-binding superfamily prote...    105   2e-22   
ref|XP_009606637.1|  PREDICTED: ethylene-responsive transcription...    103   1e-21   
ref|XP_011101230.1|  PREDICTED: ethylene-responsive transcription...    101   5e-21   
ref|XP_009777817.1|  PREDICTED: ethylene-responsive transcription...    100   5e-21   
ref|XP_009777818.1|  PREDICTED: ethylene-responsive transcription...    100   6e-21   
ref|XP_004165890.1|  PREDICTED: uncharacterized protein LOC101225711    100   8e-21   
ref|XP_004141007.1|  PREDICTED: uncharacterized protein LOC101213348    100   8e-21   
ref|XP_009777819.1|  PREDICTED: ethylene-responsive transcription...    100   8e-21   
ref|XP_009777816.1|  PREDICTED: ethylene-responsive transcription...    100   1e-20   
ref|XP_004290493.1|  PREDICTED: uncharacterized protein LOC101312...    100   1e-20   
ref|XP_008441501.1|  PREDICTED: ethylene-responsive transcription...  99.0    1e-20   
ref|XP_002306712.2|  AP2 domain-containing transcription factor f...    100   1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004290494.1|  PREDICTED: uncharacterized protein LOC101312...    100   2e-20   
ref|XP_002524310.1|  conserved hypothetical protein                   98.6    5e-20   Ricinus communis
ref|XP_004237817.1|  PREDICTED: ethylene-responsive transcription...  98.2    7e-20   
gb|ADZ28106.1|  ethylene response factor 3                            97.4    1e-19   
ref|XP_004489732.1|  PREDICTED: ethylene-responsive transcription...  94.4    6e-19   
ref|XP_007143561.1|  hypothetical protein PHAVU_007G082000g           92.8    1e-18   
ref|XP_009411924.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-18   
ref|XP_009408302.1|  PREDICTED: ethylene-responsive transcription...  91.3    3e-18   
ref|XP_010106868.1|  Ethylene-responsive transcription factor         94.0    3e-18   
ref|XP_011044262.1|  PREDICTED: ethylene-responsive transcription...  93.2    4e-18   
ref|XP_011044263.1|  PREDICTED: ethylene-responsive transcription...  93.2    4e-18   
ref|XP_008781454.1|  PREDICTED: ethylene-responsive transcription...  92.0    5e-18   
ref|XP_008784254.1|  PREDICTED: ethylene-responsive transcription...  92.0    6e-18   
ref|XP_009413556.1|  PREDICTED: ethylene-responsive transcription...  90.5    7e-18   
ref|XP_008372740.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  92.4    8e-18   
gb|ADW19888.1|  ethylene responsive factor                            92.4    9e-18   
ref|XP_008785849.1|  PREDICTED: ethylene-responsive transcription...  91.3    9e-18   
ref|XP_009420584.1|  PREDICTED: ethylene-responsive transcription...  90.5    9e-18   
gb|KDP36582.1|  hypothetical protein JCGZ_08349                       92.0    1e-17   
ref|XP_006606168.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-17   
gb|ADW19889.1|  ethylene responsive factor                            89.0    3e-17   
ref|XP_009393416.1|  PREDICTED: ethylene-responsive transcription...  89.7    3e-17   
ref|XP_010930947.1|  PREDICTED: ethylene-responsive transcription...  89.7    4e-17   
ref|XP_004498981.1|  PREDICTED: ethylene-responsive transcription...  89.0    4e-17   
ref|XP_004498983.1|  PREDICTED: ethylene-responsive transcription...  88.6    4e-17   
ref|XP_004498982.1|  PREDICTED: ethylene-responsive transcription...  88.6    5e-17   
gb|AID51426.1|  ethylene response factor 21                           88.2    9e-17   
ref|XP_007151985.1|  hypothetical protein PHAVU_004G092100g           87.4    3e-16   
ref|XP_010063839.1|  PREDICTED: ethylene-responsive transcription...  86.3    6e-16   
ref|XP_002278226.1|  PREDICTED: ethylene-responsive transcription...  85.9    6e-16   Vitis vinifera
gb|KEH25914.1|  AP2 domain class transcription factor                 86.3    6e-16   
ref|XP_002302164.1|  hypothetical protein POPTR_0002s06620g           86.7    6e-16   Populus trichocarpa [western balsam poplar]
dbj|BAG50064.1|  transcription factor AP2-EREBP                       86.3    8e-16   Lotus japonicus
gb|ADE41125.1|  AP2 domain class transcription factor                 86.3    9e-16   
ref|XP_011042884.1|  PREDICTED: ethylene-responsive transcription...  86.7    9e-16   
ref|XP_004496448.1|  PREDICTED: ethylene-responsive transcription...  85.1    9e-16   
ref|XP_011042883.1|  PREDICTED: ethylene-responsive transcription...  86.3    9e-16   
emb|CAN60132.1|  hypothetical protein VITISV_000884                   85.1    9e-16   Vitis vinifera
ref|XP_008237504.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  86.7    9e-16   
ref|XP_010912020.1|  PREDICTED: ethylene-responsive transcription...  85.9    1e-15   
ref|XP_003592075.1|  Ethylene-responsive transcription factor ERF110  84.7    1e-15   
ref|XP_007048189.1|  Integrase-type DNA-binding superfamily prote...  84.7    2e-15   
ref|XP_008381850.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  85.1    2e-15   
ref|XP_010530169.1|  PREDICTED: ethylene-responsive transcription...  84.3    3e-15   
gb|ADZ28109.1|  ethylene response factor 6                            84.3    4e-15   
dbj|BAG50063.1|  transcription factor AP2-EREBP                       82.0    4e-15   Lotus japonicus
ref|NP_001143036.1|  uncharacterized protein LOC100275504             82.0    4e-15   Zea mays [maize]
ref|XP_006599482.1|  PREDICTED: ethylene-responsive transcription...  84.3    4e-15   
ref|XP_003548975.2|  PREDICTED: ethylene-responsive transcription...  84.3    4e-15   
ref|XP_006599481.1|  PREDICTED: ethylene-responsive transcription...  84.3    4e-15   
ref|XP_007159794.1|  hypothetical protein PHAVU_002G267800g           82.8    5e-15   
ref|XP_009376561.1|  PREDICTED: ethylene-responsive transcription...  84.0    5e-15   
ref|XP_010096464.1|  Ethylene-responsive transcription factor         82.8    6e-15   
gb|EPS73412.1|  hypothetical protein M569_01357                       82.0    6e-15   
ref|XP_006473088.1|  PREDICTED: ethylene-responsive transcription...  83.6    7e-15   
ref|XP_011090449.1|  PREDICTED: ethylene-responsive transcription...  83.2    7e-15   
gb|KHN00748.1|  Ethylene-responsive transcription factor ERF112       82.0    1e-14   
gb|KHN34033.1|  Ethylene-responsive transcription factor ERF114       82.0    1e-14   
ref|XP_008244623.1|  PREDICTED: ethylene-responsive transcription...  82.4    1e-14   
gb|EYU36832.1|  hypothetical protein MIMGU_mgv1a024477mg              80.9    1e-14   
ref|XP_006589489.1|  PREDICTED: ethylene-responsive transcription...  80.9    1e-14   
ref|XP_003519981.2|  PREDICTED: ethylene-responsive transcription...  83.2    1e-14   
ref|XP_006574788.1|  PREDICTED: ethylene-responsive transcription...  83.2    1e-14   
gb|KDO57151.1|  hypothetical protein CISIN_1g039390mg                 80.5    1e-14   
gb|KHN41295.1|  Ethylene-responsive transcription factor ERF112       82.0    2e-14   
gb|KDO83784.1|  hypothetical protein CISIN_1g013225mg                 82.4    2e-14   
ref|XP_006847128.1|  hypothetical protein AMTR_s00017p00232330        82.0    2e-14   
ref|XP_006473085.1|  PREDICTED: ethylene-responsive transcription...  82.4    2e-14   
ref|XP_006473086.1|  PREDICTED: ethylene-responsive transcription...  82.4    2e-14   
ref|XP_006473087.1|  PREDICTED: ethylene-responsive transcription...  82.4    2e-14   
ref|XP_006434498.1|  hypothetical protein CICLE_v10001138mg           82.4    2e-14   
ref|XP_008353572.1|  PREDICTED: ethylene-responsive transcription...  82.0    2e-14   
ref|XP_006434497.1|  hypothetical protein CICLE_v10001138mg           82.4    2e-14   
ref|XP_008362283.1|  PREDICTED: ethylene-responsive transcription...  80.5    2e-14   
ref|XP_006282350.1|  hypothetical protein CARUB_v10028647mg           79.7    2e-14   
gb|KDO83783.1|  hypothetical protein CISIN_1g013225mg                 82.0    2e-14   
gb|KHN29138.1|  Ethylene-responsive transcription factor ERF114       80.5    2e-14   
ref|XP_006434499.1|  hypothetical protein CICLE_v10001138mg           82.0    2e-14   
ref|XP_009112156.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-14   
ref|XP_006427894.1|  hypothetical protein CICLE_v10026032mg           80.9    3e-14   
ref|XP_006464539.1|  PREDICTED: ethylene-responsive transcription...  80.9    3e-14   
ref|XP_006402191.1|  hypothetical protein EUTSA_v10014579mg           79.3    3e-14   
ref|XP_006464540.1|  PREDICTED: ethylene-responsive transcription...  80.9    3e-14   
emb|CDY14506.1|  BnaC03g49530D                                        81.3    3e-14   
ref|XP_010927404.1|  PREDICTED: AP2-like ethylene-responsive tran...  80.9    3e-14   
ref|XP_010462789.1|  PREDICTED: ethylene-responsive transcription...  81.3    4e-14   
gb|AFI57747.1|  ethylene-responsive transcription factor ABR1         80.9    4e-14   
ref|XP_009333767.1|  PREDICTED: ethylene-responsive transcription...  80.5    4e-14   
gb|KDO57153.1|  hypothetical protein CISIN_1g020801mg                 80.1    4e-14   
gb|KDO57152.1|  hypothetical protein CISIN_1g020801mg                 80.1    4e-14   
emb|CDY08853.1|  BnaA06g23710D                                        80.9    4e-14   
ref|XP_004142046.1|  PREDICTED: uncharacterized protein LOC101207587  80.5    4e-14   
ref|XP_010444422.1|  PREDICTED: ethylene-responsive transcription...  80.9    4e-14   
ref|XP_009150554.1|  PREDICTED: ethylene-responsive transcription...  80.9    4e-14   
ref|XP_006427893.1|  hypothetical protein CICLE_v10026052mg           80.1    5e-14   
ref|XP_010484270.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-14   
ref|XP_006357342.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-14   
ref|XP_007221228.1|  hypothetical protein PRUPE_ppa006595mg           80.9    5e-14   
emb|CDX81250.1|  BnaC09g06610D                                        80.9    5e-14   
ref|XP_008440983.1|  PREDICTED: ethylene-responsive transcription...  80.1    5e-14   
ref|XP_006346730.1|  PREDICTED: ethylene-responsive transcription...  80.1    5e-14   
ref|XP_010540431.1|  PREDICTED: ethylene-responsive transcription...  78.2    5e-14   
ref|XP_008368518.1|  PREDICTED: ethylene-responsive transcription...  80.1    5e-14   
ref|XP_006394116.1|  hypothetical protein EUTSA_v10004333mg           80.9    6e-14   
ref|XP_006464861.1|  PREDICTED: ethylene-responsive transcription...  80.5    6e-14   
emb|CDY31304.1|  BnaA02g34370D                                        80.5    6e-14   
ref|XP_009130472.1|  PREDICTED: ethylene-responsive transcription...  80.5    6e-14   
ref|XP_002864033.1|  DNA binding protein                              78.2    6e-14   
emb|CDY46821.1|  BnaC02g43290D                                        80.5    6e-14   
ref|XP_002864920.1|  hypothetical protein ARALYDRAFT_496690           80.5    7e-14   
ref|XP_010442489.1|  PREDICTED: ethylene-responsive transcription...  77.8    7e-14   
ref|XP_004235847.1|  PREDICTED: ethylene-responsive transcription...  78.6    7e-14   
ref|XP_010442488.1|  PREDICTED: ethylene-responsive transcription...  77.8    7e-14   
ref|NP_201280.1|  ethylene-responsive transcription factor ABR1       80.5    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280583.1|  hypothetical protein CARUB_v10026540mg           80.5    8e-14   
ref|XP_004288079.1|  PREDICTED: ethylene-responsive transcription...  80.1    8e-14   
dbj|BAJ94282.1|  predicted protein                                    78.6    8e-14   
ref|XP_004237144.1|  PREDICTED: ethylene-responsive transcription...  80.1    9e-14   
ref|XP_009342802.1|  PREDICTED: ethylene-responsive transcription...  80.1    9e-14   
dbj|BAB10294.1|  unnamed protein product                              77.8    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342801.1|  PREDICTED: ethylene-responsive transcription...  80.1    9e-14   
gb|AET34450.1|  ethylene response factor 110                          77.8    9e-14   
ref|XP_007137573.1|  hypothetical protein PHAVU_009G137900g           78.6    1e-13   
ref|XP_009405265.1|  PREDICTED: ethylene-responsive transcription...  78.6    1e-13   
gb|KFK28164.1|  hypothetical protein AALP_AA8G480800                  80.1    1e-13   
ref|XP_010441531.1|  PREDICTED: ethylene-responsive transcription...  77.4    1e-13   
ref|XP_010482313.1|  PREDICTED: ethylene-responsive transcription...  77.4    1e-13   
ref|XP_010482311.1|  PREDICTED: ethylene-responsive transcription...  77.4    1e-13   
ref|NP_199819.3|  ethylene-responsive transcription factor ERF110     77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630161.1|  Ethylene-responsive transcription factor         79.0    1e-13   
ref|XP_010441540.1|  PREDICTED: ethylene-responsive transcription...  77.4    1e-13   
ref|XP_006341471.1|  PREDICTED: ethylene-responsive transcription...  78.2    1e-13   
emb|CAE45640.1|  putative AP2 domain transcription factor             77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793923.1|  PREDICTED: ethylene-responsive transcription...  79.3    1e-13   
ref|XP_008793924.1|  PREDICTED: ethylene-responsive transcription...  79.3    1e-13   
ref|XP_010413824.1|  PREDICTED: ethylene-responsive transcription...  77.0    1e-13   
ref|XP_010485006.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|NP_001174445.1|  Os05g0437133                                     77.0    2e-13   
gb|AFK45569.1|  unknown                                               76.6    2e-13   
ref|XP_004162172.1|  PREDICTED: ethylene-responsive transcription...  78.2    2e-13   
gb|KDP35295.1|  hypothetical protein JCGZ_09454                       77.8    2e-13   
ref|XP_004138542.1|  PREDICTED: ethylene-responsive transcription...  78.2    2e-13   
gb|ACF84395.1|  unknown                                               77.0    2e-13   Zea mays [maize]
ref|XP_009587769.1|  PREDICTED: ethylene-responsive transcription...  77.0    2e-13   
ref|XP_010469440.1|  PREDICTED: ethylene-responsive transcription...  76.6    2e-13   
gb|KHN09568.1|  Ethylene-responsive transcription factor ERF114       78.2    2e-13   
ref|XP_009420504.1|  PREDICTED: ethylene-responsive transcription...  78.6    2e-13   
gb|ADJ67443.1|  ethylene response factor 14                           76.6    2e-13   
ref|XP_004242192.1|  PREDICTED: ethylene-responsive transcription...  77.4    2e-13   
ref|XP_008674780.1|  PREDICTED: ethylene-responsive transcription...  78.6    2e-13   
ref|XP_009587768.1|  PREDICTED: ethylene-responsive transcription...  77.8    2e-13   
ref|NP_001044918.1|  Os01g0868000                                     78.6    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004503061.1|  PREDICTED: ethylene-responsive transcription...  78.2    3e-13   
dbj|BAJ99457.1|  predicted protein                                    77.0    3e-13   
gb|AGE97364.1|  ethylene response factor 9                            79.3    3e-13   
ref|XP_006304255.1|  hypothetical protein CARUB_v10010478mg           75.5    3e-13   
gb|EYU21807.1|  hypothetical protein MIMGU_mgv1a020102mg              77.4    3e-13   
gb|KGN62103.1|  hypothetical protein Csa_2G297760                     77.4    3e-13   
ref|XP_006581744.1|  PREDICTED: ethylene-responsive transcription...  76.6    3e-13   
emb|CBI15759.3|  unnamed protein product                              74.7    3e-13   
ref|XP_010929690.1|  PREDICTED: ethylene-responsive transcription...  76.6    3e-13   
ref|XP_011025557.1|  PREDICTED: ethylene-responsive transcription...  77.8    3e-13   
gb|EMT21523.1|  Ethylene-responsive transcription factor ERF113       74.7    3e-13   
ref|XP_003602514.1|  Ethylene-responsive transcription factor ERF110  78.2    3e-13   
gb|EYU31118.1|  hypothetical protein MIMGU_mgv1a008130mg              78.6    3e-13   
dbj|BAJ97081.1|  predicted protein                                    78.2    3e-13   
ref|XP_002307142.2|  hypothetical protein POPTR_0005s08940g           77.4    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_003528031.1|  PREDICTED: ethylene-responsive transcription...  77.4    3e-13   
ref|XP_009780575.1|  PREDICTED: ethylene-responsive transcription...  77.0    3e-13   
ref|NP_175008.1|  ethylene-responsive transcription factor RAP2-6     75.5    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009407011.1|  PREDICTED: ethylene-responsive transcription...  76.3    4e-13   
emb|CBH32584.1|  F-box domain containing protein, expressed           77.8    4e-13   
gb|EPS64637.1|  hypothetical protein M569_10144                       75.9    4e-13   
dbj|BAJ97037.1|  predicted protein                                    78.2    4e-13   
ref|XP_010227136.1|  PREDICTED: ethylene-responsive transcription...  76.3    4e-13   
gb|AAC49772.1|  AP2 domain containing protein RAP2.6                  75.1    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520153.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-13   
ref|XP_010527318.1|  PREDICTED: ethylene-responsive transcription...  76.3    4e-13   
ref|XP_010546448.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-13   
ref|XP_004970712.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-13   
gb|AFW78172.1|  putative AP2/EREBP transcription factor superfami...  77.0    4e-13   
ref|XP_008457918.1|  PREDICTED: ethylene-responsive transcription...  76.6    4e-13   
gb|EAZ19774.1|  hypothetical protein OsJ_35354                        76.6    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629925.1|  PREDICTED: ethylene-responsive transcription...  77.8    4e-13   
ref|XP_010025536.1|  PREDICTED: ethylene-responsive transcription...  76.6    5e-13   
ref|XP_009390372.1|  PREDICTED: ethylene-responsive transcription...  75.5    5e-13   
gb|EAY98178.1|  hypothetical protein OsI_20095                        77.8    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009348875.1|  PREDICTED: ethylene-responsive transcription...  77.8    5e-13   
emb|CDP12852.1|  unnamed protein product                              77.8    5e-13   
ref|XP_008654680.1|  PREDICTED: uncharacterized protein LOC100275...  77.4    5e-13   
gb|ACO55953.1|  RAP2-like protein                                     75.5    5e-13   Juglans nigra
ref|XP_010681129.1|  PREDICTED: ethylene-responsive transcription...  78.2    5e-13   
ref|XP_011021971.1|  PREDICTED: ethylene-responsive transcription...  77.4    5e-13   
ref|XP_003523249.1|  PREDICTED: ethylene-responsive transcription...  76.3    5e-13   
ref|XP_011021970.1|  PREDICTED: ethylene-responsive transcription...  77.4    6e-13   
ref|XP_011021969.1|  PREDICTED: ethylene-responsive transcription...  77.4    6e-13   
emb|CDP18985.1|  unnamed protein product                              75.9    6e-13   
ref|XP_011086885.1|  PREDICTED: ethylene-responsive transcription...  75.5    6e-13   
ref|XP_007223939.1|  hypothetical protein PRUPE_ppa011097mg           75.5    6e-13   
ref|XP_009130180.1|  PREDICTED: ethylene-responsive transcription...  75.9    6e-13   
ref|XP_002532770.1|  DNA binding protein, putative                    77.4    6e-13   Ricinus communis
ref|XP_008463062.1|  PREDICTED: ethylene-responsive transcription...  76.6    7e-13   
ref|XP_008356833.1|  PREDICTED: ethylene-responsive transcription...  76.6    7e-13   
ref|XP_010663806.1|  PREDICTED: ethylene-responsive transcription...  76.6    7e-13   
ref|XP_008791015.1|  PREDICTED: ethylene-responsive transcription...  74.7    7e-13   
ref|XP_011086884.1|  PREDICTED: ethylene-responsive transcription...  75.5    7e-13   
ref|XP_003621630.1|  Ethylene-responsive transcription factor         74.3    7e-13   
ref|XP_010062103.1|  PREDICTED: ethylene-responsive transcription...  77.4    8e-13   
ref|XP_006394454.1|  hypothetical protein EUTSA_v10005416mg           75.5    8e-13   
ref|XP_008649697.1|  PREDICTED: ethylene-responsive transcription...  77.0    8e-13   
ref|XP_002310625.2|  hypothetical protein POPTR_0007s07090g           76.6    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011086886.1|  PREDICTED: ethylene-responsive transcription...  74.7    9e-13   
ref|XP_002881295.1|  AP2 domain-containing transcription factor f...  74.7    9e-13   
ref|XP_004237483.1|  PREDICTED: ethylene-responsive transcription...  76.3    9e-13   
ref|NP_180927.1|  ethylene-responsive transcription factor ERF112     74.7    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150111.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|NP_001189669.1|  ethylene-responsive transcription factor ERF112  75.1    1e-12   
ref|XP_010513072.1|  PREDICTED: ethylene-responsive transcription...  76.3    1e-12   
ref|XP_002866459.1|  hypothetical protein ARALYDRAFT_919438           75.1    1e-12   
ref|XP_006844465.1|  hypothetical protein AMTR_s00016p00092590        74.3    1e-12   
ref|XP_004503984.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|XP_008222249.1|  PREDICTED: ethylene-responsive transcription...  75.1    1e-12   
ref|XP_008390209.1|  PREDICTED: ethylene-responsive transcription...  75.1    1e-12   
ref|XP_010231329.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|XP_002267814.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   Vitis vinifera
gb|EEC68921.1|  hypothetical protein OsI_37608                        76.3    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006279688.1|  hypothetical protein CARUB_v10027012mg           75.1    1e-12   
ref|XP_007151718.1|  hypothetical protein PHAVU_004G069900g           75.1    1e-12   
ref|XP_002304640.1|  AP2 domain-containing transcription factor f...  74.7    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007139323.1|  hypothetical protein PHAVU_008G019600g           74.7    1e-12   
ref|XP_006420792.1|  hypothetical protein CICLE_v10005787mg           74.7    1e-12   
ref|XP_002297877.1|  AP2 domain-containing transcription factor f...  74.7    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009383009.1|  PREDICTED: ethylene-responsive transcription...  75.1    1e-12   
ref|XP_006487554.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|XP_002512669.1|  AP2 domain transcription factor RAP2.3, puta...  74.7    1e-12   Ricinus communis
ref|XP_006296339.1|  hypothetical protein CARUB_v10025511mg           74.3    1e-12   
ref|XP_006420791.1|  hypothetical protein CICLE_v10005787mg           74.7    1e-12   
gb|AFD52632.1|  AP2/ERF transcription factor                          74.7    1e-12   
ref|XP_006487555.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|XP_001769698.1|  predicted protein                                72.8    1e-12   
ref|XP_009353514.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|XP_010444024.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
gb|EPS59400.1|  hypothetical protein M569_15408                       73.9    1e-12   
ref|NP_001066252.1|  Os12g0168100                                     76.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009767382.1|  PREDICTED: ethylene-responsive transcription...  76.3    1e-12   
ref|XP_011036184.1|  PREDICTED: ethylene-responsive transcription...  74.3    1e-12   
ref|XP_011020891.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
gb|AID51425.1|  ethylene response factor 20                           73.9    1e-12   
ref|XP_010457918.1|  PREDICTED: ethylene-responsive transcription...  74.7    1e-12   
ref|NP_001239988.1|  uncharacterized protein LOC100796480             74.3    2e-12   
gb|EEE60921.1|  hypothetical protein OsJ_14639                        74.3    2e-12   
ref|XP_010500096.1|  PREDICTED: ethylene-responsive transcription...  73.9    2e-12   
ref|XP_010556085.1|  PREDICTED: ethylene-responsive transcription...  74.3    2e-12   
ref|XP_010027737.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-12   
ref|XP_010500097.1|  PREDICTED: ethylene-responsive transcription...  73.9    2e-12   
ref|XP_009390834.1|  PREDICTED: ethylene-responsive transcription...  74.3    2e-12   
ref|XP_010027738.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-12   
emb|CDY53152.1|  BnaCnng24520D                                        73.9    2e-12   
ref|XP_010942395.1|  PREDICTED: ethylene-responsive transcription...  73.9    2e-12   
gb|AHA93913.1|  ethylene response factor 15                           72.8    2e-12   
gb|KHN13389.1|  Ethylene-responsive transcription factor ERF114       74.3    2e-12   
gb|KHN13818.1|  Ethylene-responsive transcription factor ERF113       74.3    2e-12   
ref|XP_006601759.1|  PREDICTED: uncharacterized protein LOC100500...  74.3    2e-12   
ref|XP_010483875.1|  PREDICTED: ethylene-responsive transcription...  74.3    2e-12   
ref|XP_010680295.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-12   
gb|KFK25568.1|  hypothetical protein AALP_AA8G131700                  73.9    2e-12   
ref|XP_006399824.1|  hypothetical protein EUTSA_v10014575mg           73.9    2e-12   
ref|XP_008369624.1|  PREDICTED: ethylene-responsive transcription...  74.3    2e-12   
ref|XP_003548033.1|  PREDICTED: ethylene-responsive transcription...  73.9    2e-12   
ref|XP_010027739.1|  PREDICTED: ethylene-responsive transcription...  75.5    2e-12   
gb|ACU19933.1|  unknown                                               74.3    2e-12   
ref|XP_010419908.1|  PREDICTED: ethylene-responsive transcription...  73.6    2e-12   
dbj|BAK03348.1|  predicted protein                                    73.6    2e-12   
ref|XP_009804195.1|  PREDICTED: ethylene-responsive transcription...  74.7    2e-12   
gb|KDO58152.1|  hypothetical protein CISIN_1g043184mg                 74.3    3e-12   
ref|XP_009131332.1|  PREDICTED: ethylene-responsive transcription...  73.6    3e-12   
ref|XP_010492081.1|  PREDICTED: ethylene-responsive transcription...  73.6    3e-12   
ref|XP_010250515.1|  PREDICTED: ethylene-responsive transcription...  73.9    3e-12   
gb|EYU28473.1|  hypothetical protein MIMGU_mgv1a024534mg              74.3    3e-12   
ref|NP_001052669.1|  Os04g0398000                                     74.3    3e-12   
ref|XP_010239814.1|  PREDICTED: ethylene-responsive transcription...  74.7    3e-12   
ref|XP_009359875.1|  PREDICTED: ethylene-responsive transcription...  73.9    3e-12   
gb|EAY86224.1|  hypothetical protein OsI_07596                        73.6    3e-12   
ref|XP_010036848.1|  PREDICTED: ethylene-responsive transcription...  74.3    3e-12   
ref|XP_010453397.1|  PREDICTED: ethylene-responsive transcription...  73.6    3e-12   
gb|EAY93947.1|  hypothetical protein OsI_15721                        74.3    3e-12   
ref|XP_010036849.1|  PREDICTED: ethylene-responsive transcription...  74.3    3e-12   
ref|XP_009394079.1|  PREDICTED: ethylene-responsive transcription...  75.9    3e-12   
ref|XP_009781057.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-12   
ref|NP_001173016.1|  Os02g0546800                                     73.6    3e-12   
ref|XP_010037501.1|  PREDICTED: ethylene-responsive transcription...  74.3    3e-12   
gb|KGN46410.1|  hypothetical protein Csa_6G091830                     73.2    3e-12   
ref|XP_010037500.1|  PREDICTED: ethylene-responsive transcription...  74.3    3e-12   
ref|NP_200995.1|  ethylene-responsive transcription factor ERF114     73.9    3e-12   
ref|XP_009125903.1|  PREDICTED: ethylene-responsive transcription...  73.9    3e-12   
ref|NP_196837.1|  ethylene-responsive transcription factor ERF113     73.2    3e-12   
gb|KEH21859.1|  ethylene response factor                              72.8    3e-12   
emb|CDX91131.1|  BnaC02g04660D                                        73.9    3e-12   
emb|CDX69647.1|  BnaA10g19960D                                        73.2    3e-12   
ref|XP_006288550.1|  hypothetical protein CARUB_v10001831mg           73.6    3e-12   
ref|XP_010100029.1|  Ethylene-responsive transcription factor         74.3    3e-12   
ref|XP_009421022.1|  PREDICTED: ethylene-responsive transcription...  73.6    3e-12   
ref|XP_004310141.1|  PREDICTED: ethylene-responsive transcription...  73.6    3e-12   
ref|XP_008669488.1|  PREDICTED: uncharacterized protein LOC103646542  75.9    3e-12   
tpg|DAA38048.1|  TPA: putative AP2/EREBP transcription factor sup...  75.9    3e-12   
ref|XP_010105601.1|  Ethylene-responsive transcription factor         73.9    3e-12   
ref|XP_010066464.1|  PREDICTED: ethylene-responsive transcription...  73.2    3e-12   
ref|XP_009121770.1|  PREDICTED: ethylene-responsive transcription...  73.2    4e-12   
ref|XP_002871562.1|  hypothetical protein ARALYDRAFT_488151           73.2    4e-12   
gb|EEE63846.1|  hypothetical protein OsJ_18670                        74.3    4e-12   
emb|CDX78517.1|  BnaA03g04290D                                        73.6    4e-12   
ref|XP_008811102.1|  PREDICTED: ethylene-responsive transcription...  72.8    4e-12   
ref|NP_001047081.1|  Os02g0546600                                     73.6    4e-12   
ref|XP_009597481.1|  PREDICTED: ethylene-responsive transcription...  73.6    4e-12   
ref|XP_010479000.1|  PREDICTED: ethylene-responsive transcription...  72.8    4e-12   
gb|AES77850.2|  ethylene response factor                              71.6    4e-12   
ref|XP_010478998.1|  PREDICTED: ethylene-responsive transcription...  72.8    4e-12   
ref|XP_006410514.1|  hypothetical protein EUTSA_v10017235mg           72.8    4e-12   
ref|XP_008340012.1|  PREDICTED: ethylene-responsive transcription...  72.4    4e-12   
ref|XP_010478999.1|  PREDICTED: ethylene-responsive transcription...  72.8    4e-12   
gb|ABK26999.1|  unknown                                               75.5    4e-12   
emb|CDX70498.1|  BnaC03g05820D                                        73.6    4e-12   
ref|XP_003602747.1|  Ethylene-responsive transcription factor RAP2-6  73.6    5e-12   
ref|XP_010044889.1|  PREDICTED: ethylene-responsive transcription...  73.2    5e-12   
ref|XP_010232613.1|  PREDICTED: ethylene-responsive transcription...  73.6    5e-12   
gb|KCW64343.1|  hypothetical protein EUGRSUZ_G01970                   72.0    5e-12   
gb|AFW58120.1|  putative AP2/EREBP transcription factor superfami...  75.1    5e-12   
emb|CDO98305.1|  unnamed protein product                              73.2    5e-12   
ref|XP_011073204.1|  PREDICTED: ethylene-responsive transcription...  73.6    5e-12   
gb|AFW56171.1|  putative AP2/EREBP transcription factor superfami...  74.7    5e-12   
ref|XP_003621632.1|  Ethylene-responsive transcription factor         72.8    6e-12   
emb|CDY09787.1|  BnaC09g43740D                                        72.8    6e-12   
ref|XP_006346662.1|  PREDICTED: ethylene-responsive transcription...  74.7    6e-12   
ref|XP_009405112.1|  PREDICTED: ethylene-responsive transcription...  74.7    6e-12   
ref|XP_004978318.1|  PREDICTED: ethylene-responsive transcription...  73.9    6e-12   
ref|XP_008663827.1|  PREDICTED: ethylene-responsive transcription...  74.3    6e-12   
ref|XP_004492035.1|  PREDICTED: ethylene-responsive transcription...  73.2    6e-12   
ref|XP_003567310.1|  PREDICTED: ethylene-responsive transcription...  74.7    6e-12   
ref|XP_003530479.2|  PREDICTED: ethylene-responsive transcription...  73.6    6e-12   
ref|XP_010530814.1|  PREDICTED: ethylene-responsive transcription...  73.2    6e-12   
ref|XP_010546103.1|  PREDICTED: ethylene-responsive transcription...  72.8    6e-12   
gb|KFK31025.1|  hypothetical protein AALP_AA6G058200                  72.0    7e-12   
ref|XP_009589948.1|  PREDICTED: ethylene-responsive transcription...  74.7    7e-12   
emb|CDY27952.1|  BnaCnng05370D                                        72.4    7e-12   
ref|XP_007043782.1|  AP2 6l, putative                                 74.3    7e-12   
ref|XP_010249458.1|  PREDICTED: ethylene-responsive transcription...  73.9    7e-12   
ref|XP_004954977.1|  PREDICTED: ethylene-responsive transcription...  73.2    7e-12   
ref|XP_010527715.1|  PREDICTED: ethylene-responsive transcription...  72.8    8e-12   
ref|XP_010527717.1|  PREDICTED: ethylene-responsive transcription...  72.8    8e-12   
ref|XP_002452171.1|  hypothetical protein SORBIDRAFT_04g021160        72.8    8e-12   
ref|XP_006469112.1|  PREDICTED: ethylene-responsive transcription...  73.9    8e-12   
emb|CDY17191.1|  BnaA05g09970D                                        72.0    8e-12   
ref|XP_008351719.1|  PREDICTED: ethylene-responsive transcription...  73.6    9e-12   
ref|XP_008460191.1|  PREDICTED: ethylene-responsive transcription...  72.4    9e-12   
ref|XP_009359874.1|  PREDICTED: ethylene-responsive transcription...  73.2    9e-12   
ref|XP_003528089.1|  PREDICTED: ethylene-responsive transcription...  72.8    9e-12   
ref|XP_004140654.1|  PREDICTED: uncharacterized protein LOC101205898  72.8    9e-12   
ref|XP_006446923.1|  hypothetical protein CICLE_v10018158mg           73.6    9e-12   
ref|XP_004501759.1|  PREDICTED: ethylene-responsive transcription...  72.4    9e-12   
emb|CDY14051.1|  BnaC02g01680D                                        72.8    9e-12   
ref|XP_004252471.2|  PREDICTED: ethylene-responsive transcription...  73.2    9e-12   
ref|XP_009339054.1|  PREDICTED: ethylene-responsive transcription...  72.8    1e-11   
ref|XP_009143835.1|  PREDICTED: ethylene-responsive transcription...  72.0    1e-11   
gb|KHN31248.1|  Ethylene-responsive transcription factor ERF114       72.4    1e-11   
ref|XP_003522453.1|  PREDICTED: ethylene-responsive transcription...  72.4    1e-11   
ref|NP_196348.1|  ethylene-responsive transcription factor ERF115     72.4    1e-11   
gb|ABK28684.1|  unknown                                               72.4    1e-11   
ref|XP_002442881.1|  hypothetical protein SORBIDRAFT_08g004260        73.9    1e-11   
ref|XP_009339034.1|  PREDICTED: ethylene-responsive transcription...  72.4    1e-11   
gb|ADN33698.1|  AP2 domain transcription factor RAP2                  72.4    1e-11   
ref|XP_003548854.1|  PREDICTED: ethylene-responsive transcription...  72.4    1e-11   
ref|XP_002439864.1|  hypothetical protein SORBIDRAFT_09g021540        70.9    1e-11   
ref|XP_002450359.1|  hypothetical protein SORBIDRAFT_05g004170        73.6    1e-11   
ref|XP_006436961.1|  hypothetical protein CICLE_v10032575mg           72.0    1e-11   
ref|XP_008392694.1|  PREDICTED: ethylene-responsive transcription...  72.4    1e-11   
ref|NP_001065846.1|  Os11g0168500                                     73.2    1e-11   
gb|AFW65641.1|  putative AP2/EREBP transcription factor superfami...  73.2    1e-11   
gb|EAY80091.1|  hypothetical protein OsI_35260                        73.2    1e-11   
gb|AFW65640.1|  putative AP2/EREBP transcription factor superfami...  73.2    1e-11   
ref|XP_009417035.1|  PREDICTED: ethylene-responsive transcription...  72.0    2e-11   
gb|KCW54328.1|  hypothetical protein EUGRSUZ_I00292                   70.5    2e-11   
gb|KDP41861.1|  hypothetical protein JCGZ_26879                       72.4    2e-11   
ref|XP_002453961.1|  hypothetical protein SORBIDRAFT_04g022245        72.0    2e-11   
gb|ABC40568.1|  putative AP2/EREBP transcription factor               70.1    2e-11   
gb|KDO51250.1|  hypothetical protein CISIN_1g036963mg                 70.9    2e-11   
ref|XP_010911409.1|  PREDICTED: ethylene-responsive transcription...  70.5    2e-11   
ref|XP_007161612.1|  hypothetical protein PHAVU_001G084000g           72.4    2e-11   
ref|XP_007159952.1|  hypothetical protein PHAVU_002G281300g           70.9    2e-11   
gb|KHN31250.1|  Ethylene-responsive transcription factor ERF114       71.2    3e-11   
ref|XP_007032031.1|  AP2/ERF domain-containing transcription fact...  71.6    3e-11   
ref|XP_009339033.1|  PREDICTED: ethylene-responsive transcription...  71.2    3e-11   
ref|XP_002318176.2|  hypothetical protein POPTR_0012s11030g           71.2    3e-11   
ref|XP_009586804.1|  PREDICTED: ethylene-responsive transcription...  72.4    3e-11   
ref|XP_008664166.1|  PREDICTED: ethylene-responsive transcription...  71.2    3e-11   
ref|XP_007211200.1|  hypothetical protein PRUPE_ppa008772mg           72.4    3e-11   
emb|CAH66405.1|  OSIGBa0093L02.1                                      71.2    3e-11   
ref|XP_009367028.1|  PREDICTED: ethylene-responsive transcription...  70.5    3e-11   
ref|XP_010667007.1|  PREDICTED: ethylene-responsive transcription...  72.0    3e-11   
ref|XP_009373652.1|  PREDICTED: ethylene-responsive transcription...  71.6    3e-11   
ref|XP_004298522.1|  PREDICTED: uncharacterized protein LOC101309928  71.6    3e-11   
tpg|DAA48287.1|  TPA: putative AP2/EREBP transcription factor sup...  69.3    3e-11   
ref|XP_004954975.1|  PREDICTED: ethylene-responsive transcription...  70.1    3e-11   
ref|XP_009759799.1|  PREDICTED: ethylene-responsive transcription...  71.2    3e-11   
ref|XP_008647050.1|  PREDICTED: ethylene-responsive transcription...  72.8    3e-11   
ref|XP_010927797.1|  PREDICTED: ethylene-responsive transcription...  70.5    4e-11   
ref|XP_009125683.1|  PREDICTED: ethylene-responsive transcription...  70.9    4e-11   
emb|CDY55173.1|  BnaAnng13660D                                        70.9    4e-11   
ref|XP_002512829.1|  DNA binding protein, putative                    70.1    4e-11   
ref|XP_007032032.1|  AP2/ERF domain-containing transcription fact...  71.2    4e-11   
ref|XP_009141338.1|  PREDICTED: ethylene-responsive transcription...  70.5    4e-11   
gb|EAY86070.1|  hypothetical protein OsI_07439                        70.9    4e-11   
ref|XP_002275870.2|  PREDICTED: ethylene-responsive transcription...  70.9    4e-11   
ref|XP_008464362.1|  PREDICTED: ethylene-responsive transcription...  68.6    4e-11   
ref|XP_009375704.1|  PREDICTED: ethylene-responsive transcription...  70.9    4e-11   
emb|CDY37698.1|  BnaA04g19700D                                        69.3    4e-11   
ref|XP_008375519.1|  PREDICTED: ethylene-responsive transcription...  71.6    4e-11   
gb|EEE57097.1|  hypothetical protein OsJ_06940                        72.4    4e-11   
ref|XP_004954976.1|  PREDICTED: ethylene-responsive transcription...  70.1    4e-11   
ref|XP_011043029.1|  PREDICTED: ethylene-responsive transcription...  71.2    5e-11   
ref|XP_002511085.1|  DNA binding protein, putative                    70.1    6e-11   
ref|XP_004138017.1|  PREDICTED: ethylene-responsive transcription...  68.2    6e-11   
emb|CDY53788.1|  BnaC04g44080D                                        69.3    6e-11   
gb|KDO46348.1|  hypothetical protein CISIN_1g005229mg                 72.4    6e-11   
ref|XP_006471819.1|  PREDICTED: paramyosin-like isoform X1            72.4    6e-11   
ref|XP_007038155.1|  Integrase-type DNA-binding superfamily prote...  70.9    6e-11   
gb|KHN46843.1|  Ethylene-responsive transcription factor ERF114       70.5    7e-11   
ref|XP_006485171.1|  PREDICTED: ethylene-responsive transcription...  71.6    7e-11   
emb|CDX78288.1|  BnaA03g02000D                                        70.1    7e-11   
ref|XP_004298521.1|  PREDICTED: uncharacterized protein LOC101309634  71.2    7e-11   
dbj|BAJ93265.1|  predicted protein                                    70.9    7e-11   
emb|CDX70027.1|  BnaA10g23760D                                        70.1    7e-11   
ref|XP_009132220.1|  PREDICTED: ethylene-responsive transcription...  70.1    8e-11   
emb|CDX98982.1|  BnaC09g48530D                                        70.1    8e-11   
ref|XP_006580881.1|  PREDICTED: ethylene-responsive transcription...  69.7    8e-11   
ref|XP_009122352.1|  PREDICTED: ethylene-responsive transcription...  70.1    8e-11   
emb|CAN81030.1|  hypothetical protein VITISV_011003                   71.6    8e-11   
ref|XP_001779530.1|  predicted protein                                66.2    8e-11   
ref|XP_008666509.1|  PREDICTED: ethylene-responsive transcription...  70.5    8e-11   
dbj|BAJ53126.1|  JHL07K02.16                                          69.7    8e-11   
ref|XP_006399213.1|  hypothetical protein EUTSA_v10015583mg           70.1    8e-11   
gb|KDP22531.1|  hypothetical protein JCGZ_26362                       69.7    8e-11   
ref|XP_010682635.1|  PREDICTED: ethylene-responsive transcription...  70.5    9e-11   
ref|XP_002871264.1|  hypothetical protein ARALYDRAFT_487556           70.1    9e-11   
ref|XP_010682636.1|  PREDICTED: ethylene-responsive transcription...  70.5    9e-11   
ref|XP_006289257.1|  hypothetical protein CARUB_v10002723mg           70.1    9e-11   
ref|XP_010491335.1|  PREDICTED: ethylene-responsive transcription...  69.7    1e-10   
ref|XP_007137849.1|  hypothetical protein PHAVU_009G161000g           69.7    1e-10   
gb|EPS68061.1|  hypothetical protein M569_06713                       67.8    1e-10   
ref|XP_002990228.1|  hypothetical protein SELMODRAFT_131245           66.6    1e-10   
ref|NP_001147321.1|  DNA binding protein                              70.9    1e-10   
ref|XP_010423229.1|  PREDICTED: ethylene-responsive transcription...  69.7    1e-10   
ref|XP_010452687.1|  PREDICTED: ethylene-responsive transcription...  69.7    1e-10   
gb|KGN63431.1|  hypothetical protein Csa_1G000550                     68.9    1e-10   
ref|XP_001758105.1|  predicted protein                                66.6    1e-10   
gb|EPS64992.1|  hypothetical protein M569_09787                       68.9    1e-10   
gb|KFK25131.1|  hypothetical protein AALP_AA8G070000                  69.7    1e-10   
ref|XP_010105603.1|  Ethylene-responsive transcription factor         69.7    1e-10   
emb|CAC12822.1|  AP2 domain-containing transcription factor           68.9    1e-10   
ref|XP_010238677.1|  PREDICTED: ethylene-responsive transcription...  70.1    1e-10   
ref|XP_006433144.1|  hypothetical protein CICLE_v10003903mg           68.6    2e-10   
ref|XP_008454945.1|  PREDICTED: ethylene-responsive transcription...  69.3    2e-10   
ref|XP_004515403.1|  PREDICTED: ethylene-responsive transcription...  68.6    2e-10   
gb|ADP37420.1|  ethylene-responsive-element-binding factor 5          69.3    2e-10   
ref|XP_002447841.1|  hypothetical protein SORBIDRAFT_06g016710        68.6    2e-10   
ref|XP_003522452.1|  PREDICTED: ethylene-responsive transcription...  68.9    2e-10   
gb|ABB51575.1|  putative ethylene responsive element binding protein  67.4    2e-10   
ref|XP_011000462.1|  PREDICTED: ethylene-responsive transcription...  69.3    2e-10   
gb|AEQ58795.1|  ethylene response factor                              70.1    2e-10   



>ref|XP_009792227.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Nicotiana sylvestris]
Length=443

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 117/179 (65%), Gaps = 20/179 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV--------  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENV        
Sbjct  232  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVSRLLPQLQ  291

Query  158  ------RslpppqaaaisasqlpanaPSQPS--YQAHLQPSQGSPAVAGDYLAYSQLLQN  313
                  R      + + S+        SQP+  +Q H QP Q S  +  DY  YSQLLQN
Sbjct  292  ASQPTTRLAISSSSTSASSQLQFMAPISQPTAFFQPHQQPIQSSD-MTRDYWEYSQLLQN  350

Query  314  PGDVHG-QRPNSLLEQMFRSSSMAVfhshsfpssspsITAPSGPFPLMTFSGQQSSYFR  487
            PGD    Q+P+ LLEQMF +SS AV HS++  S   S  A S  +PL+ FSGQQSSY+R
Sbjct  351  PGDFFDQQQPSGLLEQMFFASSRAVLHSNTTSSLGNS-AASSPSYPLL-FSGQQSSYYR  407



>ref|XP_009792228.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Nicotiana sylvestris]
Length=442

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 117/179 (65%), Gaps = 20/179 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV--------  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENV        
Sbjct  231  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVSRLLPQLQ  290

Query  158  ------RslpppqaaaisasqlpanaPSQPS--YQAHLQPSQGSPAVAGDYLAYSQLLQN  313
                  R      + + S+        SQP+  +Q H QP Q S  +  DY  YSQLLQN
Sbjct  291  ASQPTTRLAISSSSTSASSQLQFMAPISQPTAFFQPHQQPIQSSD-MTRDYWEYSQLLQN  349

Query  314  PGDVHG-QRPNSLLEQMFRSSSMAVfhshsfpssspsITAPSGPFPLMTFSGQQSSYFR  487
            PGD    Q+P+ LLEQMF +SS AV HS++  S   S  A S  +PL+ FSGQQSSY+R
Sbjct  350  PGDFFDQQQPSGLLEQMFFASSRAVLHSNTTSSLGNS-AASSPSYPLL-FSGQQSSYYR  406



>ref|XP_010314475.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X3 [Solanum lycopersicum]
Length=322

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN R    PQ 
Sbjct  124  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENARLSSLPQT  183

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
                 S +   +P      + L P Q S     DY  YSQLLQNPGD   Q+P++LLEQM
Sbjct  184  QNTVTSTISNPSPLIAQPTSFLNPIQSSDTTR-DYWEYSQLLQNPGDFTDQQPSNLLEQM  242

Query  362  FRSSSMAV  385
            F +SSMA+
Sbjct  243  FVASSMAM  250



>ref|XP_004252593.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Solanum lycopersicum]
Length=417

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 95/130 (73%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN R    PQ 
Sbjct  219  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENARLSSLPQT  278

Query  182  aaisasqlpanaP--SQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLE  355
                 S +   +P  +QP+  + L P Q S     DY  YSQLLQNPGD   Q+P++LLE
Sbjct  279  QNTVTSTISNPSPLIAQPT--SFLNPIQSSDTTR-DYWEYSQLLQNPGDFTDQQPSNLLE  335

Query  356  QMFRSSSMAV  385
            QMF +SSMA+
Sbjct  336  QMFVASSMAM  345



>ref|XP_010314474.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Solanum lycopersicum]
Length=416

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 95/130 (73%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN R    PQ 
Sbjct  218  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENARLSSLPQT  277

Query  182  aaisasqlpanaP--SQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLE  355
                 S +   +P  +QP+  + L P Q S     DY  YSQLLQNPGD   Q+P++LLE
Sbjct  278  QNTVTSTISNPSPLIAQPT--SFLNPIQSSDTTR-DYWEYSQLLQNPGDFTDQQPSNLLE  334

Query  356  QMFRSSSMAV  385
            QMF +SSMA+
Sbjct  335  QMFVASSMAM  344



>gb|ABY57638.1| RAP2.6-like protein [Solanum lycopersicum]
Length=366

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN R    PQ 
Sbjct  168  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENARLSSLPQT  227

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
                 S +   +P      + L P Q S     DY  YSQLLQNPGD   Q+P++LLEQM
Sbjct  228  QNTVTSTISNPSPLIAQPTSFLNPIQSSDTTR-DYWEYSQLLQNPGDFTDQQPSNLLEQM  286

Query  362  FRSSSMAV  385
            F +SSMA+
Sbjct  287  FVASSMAM  294



>ref|XP_006361609.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Solanum tuberosum]
Length=395

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 92/136 (68%), Gaps = 14/136 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN R   P   
Sbjct  197  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENARLSLPQIQ  256

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSP--------AVAGDYLAYSQLLQNPGDVHGQR  337
                ++       S PS+Q     +Q +P            DY  YSQLLQNPGD   Q+
Sbjct  257  NTTISTI------SNPSHQFMAPVTQPTPFFNPMQSSDTTRDYWEYSQLLQNPGDFSDQQ  310

Query  338  PNSLLEQMFRSSSMAV  385
            P++LLEQMF +SSMA+
Sbjct  311  PSNLLEQMFVASSMAM  326



>ref|XP_006361610.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Solanum tuberosum]
Length=394

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 92/136 (68%), Gaps = 14/136 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN R   P   
Sbjct  196  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENARLSLPQIQ  255

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSP--------AVAGDYLAYSQLLQNPGDVHGQR  337
                ++       S PS+Q     +Q +P            DY  YSQLLQNPGD   Q+
Sbjct  256  NTTISTI------SNPSHQFMAPVTQPTPFFNPMQSSDTTRDYWEYSQLLQNPGDFSDQQ  309

Query  338  PNSLLEQMFRSSSMAV  385
            P++LLEQMF +SSMA+
Sbjct  310  PSNLLEQMFVASSMAM  325



>ref|XP_009606951.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=447

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 124/182 (68%), Gaps = 22/182 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  QA
Sbjct  232  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPQIQA  291

Query  182  aaisasqlpanaP------------SQPS--YQ---AHLQPSQGSPAVAGDYLAYSQLLQ  310
            +  +     +++             SQP+  +Q    H QP Q S  +  DY  YSQLLQ
Sbjct  292  SQPTTRLAISSSSTSASQFSFMAPISQPTPFFQPPHHHQQPIQSSD-MTRDYWEYSQLLQ  350

Query  311  NPGDVHG-QRPNSLLEQMFRSSSMAVfhshsfps--sspsITAPSGPFPLMTFSGQQSSY  481
            NP D    Q+P+SL+EQMF +SS AV HS++  S  +S + +  S  +PL+ FSGQQSSY
Sbjct  351  NPADFFDQQQPSSLVEQMFFASSRAVLHSNTTSSLGNSAASSTSSPSYPLL-FSGQQSSY  409

Query  482  FR  487
            +R
Sbjct  410  YR  411



>ref|XP_009606952.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Nicotiana tomentosiformis]
Length=446

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 124/182 (68%), Gaps = 22/182 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  QA
Sbjct  231  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPQIQA  290

Query  182  aaisasqlpanaP------------SQPS--YQ---AHLQPSQGSPAVAGDYLAYSQLLQ  310
            +  +     +++             SQP+  +Q    H QP Q S  +  DY  YSQLLQ
Sbjct  291  SQPTTRLAISSSSTSASQFSFMAPISQPTPFFQPPHHHQQPIQSSD-MTRDYWEYSQLLQ  349

Query  311  NPGDVHG-QRPNSLLEQMFRSSSMAVfhshsfps--sspsITAPSGPFPLMTFSGQQSSY  481
            NP D    Q+P+SL+EQMF +SS AV HS++  S  +S + +  S  +PL+ FSGQQSSY
Sbjct  350  NPADFFDQQQPSSLVEQMFFASSRAVLHSNTTSSLGNSAASSTSSPSYPLL-FSGQQSSY  408

Query  482  FR  487
            +R
Sbjct  409  YR  410



>gb|AHA93910.1| ethylene response factor 11, partial [Coffea arabica]
Length=282

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 12/139 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LPP QA
Sbjct  85   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPPLQA  144

Query  182  aaisasqlpanaP--------SQPSYQAHL---QPSQGSPAVAGDYLAYSQLLQNPGDVH  328
            ++ SA     ++         + PS QA +   QP Q S  +A DY  YSQLL++ GD  
Sbjct  145  SSQSAQLHAVSSTPPATILPVTTPSPQARMFQPQPIQSSD-IARDYWEYSQLLRSSGDFQ  203

Query  329  GQRPNSLLEQMFRSSSMAV  385
            GQ+P  LLEQM+ +SS+A+
Sbjct  204  GQQPAGLLEQMYYASSLAL  222



>gb|AHB33884.1| ERF transcription factor 13 [Coffea arabica]
Length=256

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 12/139 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LPP QA
Sbjct  50   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPPLQA  109

Query  182  aaisasqlpanaP--------SQPSYQAHL---QPSQGSPAVAGDYLAYSQLLQNPGDVH  328
            ++ SA     ++         + PS QA +   QP Q S  +A DY  YSQLL++ GD  
Sbjct  110  SSQSAQLHAVSSTPPATILPVTTPSPQARMFQPQPIQSS-DIARDYWEYSQLLRSSGDFQ  168

Query  329  GQRPNSLLEQMFRSSSMAV  385
            GQ+P  LLEQM+ +SS+A+
Sbjct  169  GQQPAGLLEQMYYASSLAL  187



>emb|CDP11426.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 12/139 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LPP QA
Sbjct  119  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPPLQA  178

Query  182  aaisasqlpanaP--------SQPSYQAHL---QPSQGSPAVAGDYLAYSQLLQNPGDVH  328
            ++ SA     ++         + PS QA +   QP Q S  +A DY  YSQLL++ GD  
Sbjct  179  SSQSAQLHAVSSTPPATILPVTTPSPQARMFQPQPIQSS-DIARDYWEYSQLLRSSGDFQ  237

Query  329  GQRPNSLLEQMFRSSSMAV  385
            GQ+P  LLEQM+ +SS+A+
Sbjct  238  GQQPAGLLEQMYYASSLAL  256



>emb|CBI18230.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR +PP Q 
Sbjct  262  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLMPPLQV  321

Query  182  aaisasqlpanaPSQ--------PSYQAH-LQPSQGSPAVAGDYLAYSQLLQNPGDVHGQ  334
            +  +   +     +Q        P +Q   LQ    +P +  DY  YSQLLQ+ GD HGQ
Sbjct  322  SPATQLSISGPPATQLPVSSSPPPFFQGQALQ----NPDIVRDYWEYSQLLQSSGDFHGQ  377

Query  335  RPNSLLEQMF  364
            +P SLLEQMF
Sbjct  378  QPTSLLEQMF  387



>ref|XP_010246270.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Nelumbo nucifera]
Length=413

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 10/136 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  201  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLRPSLCN  260

Query  161  -slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQR  337
             +      +    +    +  SQP  Q+H+Q    S     DY  YSQLLQ+ G    ++
Sbjct  261  PATTQLTISGSPNTLSTTSQMSQPFVQSHIQQQHSSDLR--DYYEYSQLLQSSGRDFSRQ  318

Query  338  PNSLLEQMFRSSSMAV  385
            P SLLEQM+ SSS+A 
Sbjct  319  PTSLLEQMYYSSSLAA  334



>ref|XP_010246271.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Nelumbo nucifera]
Length=412

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 10/136 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  200  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLRPSLCN  259

Query  161  -slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQR  337
             +      +    +    +  SQP  Q+H+Q    S     DY  YSQLLQ+ G    ++
Sbjct  260  PATTQLTISGSPNTLSTTSQMSQPFVQSHIQQQHSSDLR--DYYEYSQLLQSSGRDFSRQ  317

Query  338  PNSLLEQMFRSSSMAV  385
            P SLLEQM+ SSS+A 
Sbjct  318  PTSLLEQMYYSSSLAA  333



>ref|XP_002264797.2| PREDICTED: ethylene-responsive transcription factor ABR1 [Vitis 
vinifera]
 emb|CAN66025.1| hypothetical protein VITISV_028773 [Vitis vinifera]
Length=421

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR +PP Q 
Sbjct  210  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLMPPLQV  269

Query  182  aaisasqlpanaPSQ--------PSYQAH-LQPSQGSPAVAGDYLAYSQLLQNPGDVHGQ  334
            +  +   +     +Q        P +Q   LQ    +P +  DY  YSQLLQ+ GD HGQ
Sbjct  270  SPATQLSISGPPATQLPVSSSPPPFFQGQALQ----NPDIVRDYWEYSQLLQSSGDFHGQ  325

Query  335  RPNSLLEQMF  364
            +P SLLEQMF
Sbjct  326  QPTSLLEQMF  335



>ref|XP_006363442.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Solanum tuberosum]
Length=441

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 95/152 (63%), Gaps = 24/152 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAA+AYD+AALRFRGNRAKLNFPENVR LP  Q 
Sbjct  216  WGKWAAEIRDPHKAARVWLGTFDTAEAAAKAYDDAALRFRGNRAKLNFPENVRLLPQQQP  275

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPA-----------------------VAGDYLA  292
                A    A AP+   +Q     S  SP+                       +A DY  
Sbjct  276  TTRLAISTTAPAPAASRFQLMSAASMRSPSPFFQSHNQPPHQPQQQQLFQSSDMARDYWE  335

Query  293  YSQLLQNPGDVH-GQRPNSLLEQMFRSSSMAV  385
            YSQLLQNP D H GQ+ +SLLEQM  +SS+ V
Sbjct  336  YSQLLQNPIDFHGGQQSSSLLEQMLLASSLGV  367



>gb|KHG20074.1| Ethylene-responsive transcription factor ABR1 -like protein [Gossypium 
arboreum]
Length=326

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 82/129 (64%), Gaps = 7/129 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  129  WGKWAAEIRDPNKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR----VVV  184

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAG---DYLAYSQLLQNPGDVHGQRPNSLL  352
                 +      P   S   H  P   SP  A    DY  YSQLLQ+  D H Q+  SLL
Sbjct  185  PQPMQNFPTTQTPVSSSQTTHFPPYYQSPPTADMLRDYWQYSQLLQSCNDFHEQQATSLL  244

Query  353  EQMFRSSSM  379
             QM +SS +
Sbjct  245  NQMIQSSQL  253



>ref|XP_010261002.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Nelumbo nucifera]
Length=423

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 88/135 (65%), Gaps = 9/135 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  215  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLSQSLSN  274

Query  182  aaisasqlpan--------aPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQR  337
             A +   +  +          S+P      Q    S  +A DY  YSQLLQ+ G+   Q 
Sbjct  275  PAATQLTISHSPATLLPVPQISEPFMPPQTQQQLQSSDIARDYYEYSQLLQSSGEFQRQ-  333

Query  338  PNSLLEQMFRSSSMA  382
            P SLLEQMF SSS+A
Sbjct  334  PTSLLEQMFYSSSLA  348



>ref|XP_007019566.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY16791.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=439

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 90/142 (63%), Gaps = 20/142 (14%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYD+AALRFRGNRAKLNFPENVR +P P  
Sbjct  226  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDDAALRFRGNRAKLNFPENVRLVPQPMQ  285

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPA---------------VAGDYLAYSQLLQNP  316
               +     ++     S   H  PS  +P                +  DY  YSQLLQ+ 
Sbjct  286  NFPATQTSVSS-----SLTTHFPPSHSTPMPSYYQSQPLQSSNVDMLRDYWQYSQLLQSS  340

Query  317  GDVHGQRPNSLLEQMFRSSSMA  382
             D HGQ+  SLLEQM +S+ +A
Sbjct  341  TDFHGQQTTSLLEQMIQSTQLA  362



>ref|XP_009606637.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Nicotiana tomentosiformis]
Length=450

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 97/149 (65%), Gaps = 21/149 (14%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  Q 
Sbjct  230  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRILPQQQQ  289

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPA-------------------VAGDYLAYSQL  304
                A+   A + S  + Q  L  +  +P+                   +  DY  YSQL
Sbjct  290  QQPQATTRSAISSSSAASQFPLMAAATTPSPFFQTYQPQQQQQPFQSSEMVRDYWEYSQL  349

Query  305  LQNPGDVH-GQRPNSLLEQM-FRSSSMAV  385
            LQNPG+ H  Q+P++LLEQM F SSSM +
Sbjct  350  LQNPGEFHLQQQPSALLEQMLFASSSMGL  378



>ref|XP_011101230.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Sesamum indicum]
Length=417

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 89/125 (71%), Gaps = 6/125 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LPPPQ 
Sbjct  221  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRILPPPQP  280

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
            AA SA    +  P      +  Q      + A DY  YSQLLQ+ GD H Q+  +L EQM
Sbjct  281  AAQSAQVAVSPPPPPNPSSSFFQ------STARDYWEYSQLLQSTGDYHPQQSTTLFEQM  334

Query  362  FRSSS  376
              +SS
Sbjct  335  LYASS  339



>ref|XP_009777817.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Nicotiana sylvestris]
Length=366

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 94/150 (63%), Gaps = 22/150 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  Q 
Sbjct  145  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPQQQQ  204

Query  182  aaisasqlpanaPSQ----PSYQAHLQPS----------------QGSPAVAGDYLAYSQ  301
                 ++   ++ S     P   A   PS                  S  +  DY  YSQ
Sbjct  205  QYQPTTRSAISSSSAASQFPLMAAATTPSPFFQTYQPQQQQQQPPFQSSEMVRDYWEYSQ  264

Query  302  LLQNPGDVHGQR-PNSLLEQM-FRSSSMAV  385
            LLQNPGD H Q+  +SLLEQM F SSSM +
Sbjct  265  LLQNPGDFHAQQSSSSLLEQMLFASSSMGL  294



>ref|XP_009777818.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X3 [Nicotiana sylvestris]
Length=365

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 94/150 (63%), Gaps = 22/150 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  Q 
Sbjct  144  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPQQQQ  203

Query  182  aaisasqlpanaPSQ----PSYQAHLQPS----------------QGSPAVAGDYLAYSQ  301
                 ++   ++ S     P   A   PS                  S  +  DY  YSQ
Sbjct  204  QYQPTTRSAISSSSAASQFPLMAAATTPSPFFQTYQPQQQQQQPPFQSSEMVRDYWEYSQ  263

Query  302  LLQNPGDVHGQR-PNSLLEQM-FRSSSMAV  385
            LLQNPGD H Q+  +SLLEQM F SSSM +
Sbjct  264  LLQNPGDFHAQQSSSSLLEQMLFASSSMGL  293



>ref|XP_004165890.1| PREDICTED: uncharacterized protein LOC101225711 [Cucumis sativus]
Length=404

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 90/126 (71%), Gaps = 11/126 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR + PPQ 
Sbjct  221  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLIHPPQH  280

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
               +A+   A   +      + +          DY+ YS LLQNPGD+ GQ P+SLL+QM
Sbjct  281  IPAAAAPQIAPQQTATFQSQNYR----------DYIEYSNLLQNPGDILGQ-PSSLLQQM  329

Query  362  FRSSSM  379
            F ++ +
Sbjct  330  FYNAHL  335



>ref|XP_004141007.1| PREDICTED: uncharacterized protein LOC101213348 [Cucumis sativus]
 gb|KGN46124.1| hypothetical protein Csa_6G055940 [Cucumis sativus]
Length=404

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 90/126 (71%), Gaps = 11/126 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR + PPQ 
Sbjct  221  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLIHPPQH  280

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
               +A+   A   +      + +          DY+ YS LLQNPGD+ GQ P+SLL+QM
Sbjct  281  IPAAAAPQIAPQQTATFQSQNYR----------DYIEYSNLLQNPGDILGQ-PSSLLQQM  329

Query  362  FRSSSM  379
            F ++ +
Sbjct  330  FYNAHL  335



>ref|XP_009777819.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X4 [Nicotiana sylvestris]
Length=364

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 94/150 (63%), Gaps = 22/150 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  Q 
Sbjct  143  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPQQQQ  202

Query  182  aaisasqlpanaPSQ----PSYQAHLQPS----------------QGSPAVAGDYLAYSQ  301
                 ++   ++ S     P   A   PS                  S  +  DY  YSQ
Sbjct  203  QYQPTTRSAISSSSAASQFPLMAAATTPSPFFQTYQPQQQQQQPPFQSSEMVRDYWEYSQ  262

Query  302  LLQNPGDVHGQR-PNSLLEQM-FRSSSMAV  385
            LLQNPGD H Q+  +SLLEQM F SSSM +
Sbjct  263  LLQNPGDFHAQQSSSSLLEQMLFASSSMGL  292



>ref|XP_009777816.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Nicotiana sylvestris]
Length=428

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 94/150 (63%), Gaps = 22/150 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP  Q 
Sbjct  207  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPQQQQ  266

Query  182  aaisasqlpanaPSQ----PSYQAHLQPS----------------QGSPAVAGDYLAYSQ  301
                 ++   ++ S     P   A   PS                  S  +  DY  YSQ
Sbjct  267  QYQPTTRSAISSSSAASQFPLMAAATTPSPFFQTYQPQQQQQQPPFQSSEMVRDYWEYSQ  326

Query  302  LLQNPGDVHGQR-PNSLLEQM-FRSSSMAV  385
            LLQNPGD H Q+  +SLLEQM F SSSM +
Sbjct  327  LLQNPGDFHAQQSSSSLLEQMLFASSSMGL  356



>ref|XP_004290493.1| PREDICTED: uncharacterized protein LOC101312215 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=464

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 95/150 (63%), Gaps = 23/150 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-----  166
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENVR +     
Sbjct  241  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENVRLIPPQQP  300

Query  167  pppqaaaisasqlpanaPSQPSYQA---------------HLQPSQGSPAVAGDYLAYSQ  301
                A +I+++  PA     PS +                  Q  QGSP    DY+ YS 
Sbjct  301  LQSYAQSINSNSAPARLAPNPSVRPLQPPPQPLQQQQPLYQTQSFQGSPDFLRDYMDYSH  360

Query  302  LLQNPGDVHGQ---RPNSLLEQMFRSSSMA  382
            LLQ+  DVH Q   +P +LLEQM+ +S +A
Sbjct  361  LLQSSIDVHSQQQPQPTNLLEQMYYNSQLA  390



>ref|XP_008441501.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Cucumis melo]
Length=284

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 86/138 (62%), Gaps = 33/138 (24%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  99   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR-------  151

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA------------GDYLAYSQLLQNPGDV  325
                        P QP+      PS   P +A             DY+ YS LLQN GD+
Sbjct  152  ---------LIHPPQPA----AVPSAALPQIAPQPTAAFQSQNYRDYIEYSNLLQNSGDI  198

Query  326  HGQRPNSLLEQMFRSSSM  379
              Q P+SLL+QMF ++ +
Sbjct  199  LRQ-PSSLLQQMFYNAQL  215



>ref|XP_002306712.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|EEE93708.2| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=498

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 85/140 (61%), Gaps = 19/140 (14%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRs--lppp  175
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPEN R       
Sbjct  273  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPENARLLPAQMQ  332

Query  176  qaaaisasqlpanaPSQPSYQAHLQPS--------------QGSPAVAGDYLAYSQLLQN  313
               A       +  PS    Q+   P               Q  P +  DY  YSQLLQ+
Sbjct  333  NVTASQVPISRSQLPSHHQLQSISSPRQQAQRPQVPAPALFQSQPDIIRDYWEYSQLLQS  392

Query  314  PGDVHGQR---PNSLLEQMF  364
             GD HGQ+   P++LLEQMF
Sbjct  393  SGDFHGQQQPPPSNLLEQMF  412



>ref|XP_004290494.1| PREDICTED: uncharacterized protein LOC101312215 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=452

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 95/150 (63%), Gaps = 23/150 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-----  166
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENVR +     
Sbjct  229  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENVRLIPPQQP  288

Query  167  pppqaaaisasqlpanaPSQPSYQA---------------HLQPSQGSPAVAGDYLAYSQ  301
                A +I+++  PA     PS +                  Q  QGSP    DY+ YS 
Sbjct  289  LQSYAQSINSNSAPARLAPNPSVRPLQPPPQPLQQQQPLYQTQSFQGSPDFLRDYMDYSH  348

Query  302  LLQNPGDVHGQ---RPNSLLEQMFRSSSMA  382
            LLQ+  DVH Q   +P +LLEQM+ +S +A
Sbjct  349  LLQSSIDVHSQQQPQPTNLLEQMYYNSQLA  378



>ref|XP_002524310.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38050.1| conserved hypothetical protein [Ricinus communis]
Length=448

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 88/138 (64%), Gaps = 15/138 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRs------  163
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  231  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRILPPPIQ  290

Query  164  ----lpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHG  331
                +     +     Q P+    Q     HLQ          DY  YSQLLQ+ GD HG
Sbjct  291  TTIPVSQIPMSRPPPPQPPSQQQQQQQSLFHLQTDN----PLRDYWEYSQLLQSSGDFHG  346

Query  332  -QRPNSLLEQMFRSSSMA  382
             Q+P+SLLEQMF +  +A
Sbjct  347  VQQPSSLLEQMFYNQQLA  364



>ref|XP_004237817.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Solanum lycopersicum]
Length=452

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 96/162 (59%), Gaps = 34/162 (21%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAA+AYD+AALRFRGNRAKLNFPENVR LP  Q 
Sbjct  218  WGKWAAEIRDPHKAARVWLGTFDTAEAAAKAYDDAALRFRGNRAKLNFPENVRLLPQQQQ  277

Query  182  aaisasq-lpanaPSQPSYQAHLQPSQGSPA-----------------------------  271
               +      +++ + P +Q     S  SP+                             
Sbjct  278  QPTTRLAISTSSSTAAPRFQLMSAASTRSPSPSPFFFQSYNQPPRQSDQQHQNQQQQLFQ  337

Query  272  ---VAGDYLAYSQLLQNPGDVH-GQRPNSLLEQMFRSSSMAV  385
               +A DY  YSQLLQNP D H GQ+ +SLLEQM  +SS+ V
Sbjct  338  SSDMARDYWEYSQLLQNPIDFHGGQQSSSLLEQMLLASSLGV  379



>gb|ADZ28106.1| ethylene response factor 3 [Malus domestica]
Length=472

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 93/151 (62%), Gaps = 27/151 (18%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR + PP  
Sbjct  238  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLVQPPPP  297

Query  182  aaisasqlpanaPSQ-------------------PSYQAHLQPSQGSPAVAGDYLAYSQL  304
                 +    + P+Q                    S Q  +QPS     +  DY  YSQL
Sbjct  298  PPTLQTFNSNSRPTQYAQPLQPPPLPQPPQQQLYHSQQLFIQPSSD---LLRDYFDYSQL  354

Query  305  LQNPGDVH-----GQRPNSLLEQMFRSSSMA  382
            LQ+  D H      Q+P+SLL++M+ +S +A
Sbjct  355  LQSSADFHPQQQRQQQPSSLLQKMYYNSQLA  385



>ref|XP_004489732.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Cicer arietinum]
Length=359

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAA AYDEAALRFRG+RAKLNFPENVR++P P  
Sbjct  157  WGKWAAEIRDPHKAARVWLGTFDTAEAAAIAYDEAALRFRGSRAKLNFPENVRAIPTPTL  216

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGD  322
               +  Q         S+     P  G P +  DYL YSQ+LQ+ GD
Sbjct  217  TTTTTPQPQLR-----SHSTAFSPFNGQPDLVRDYLEYSQILQSSGD  258



>ref|XP_007143561.1| hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris]
 ref|XP_007143562.1| hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris]
 gb|ESW15555.1| hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris]
 gb|ESW15556.1| hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris]
Length=268

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 98/167 (59%), Gaps = 14/167 (8%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslp--pp  175
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENV ++     
Sbjct  74   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVTAVRPPHL  133

Query  176  qaaaisasqlpanaPSQPSYQAHLQ---PSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNS  346
                 +A    ++ P+   Y   +    P Q S  +  DY  YS LL++ GD HG     
Sbjct  134  PNFPATALAGSSDVPAVTGYSPAVMQGAPFQSSSDLLRDYWGYSLLLRSTGDFHG-----  188

Query  347  LLEQMFRSSSMAVfhshsfpssspsITAPSGPFPLMTFSGQQSSYFR  487
             LEQ F  S MA   S S P       + S  FPL  FS QQ   FR
Sbjct  189  -LEQWFYDSQMAALQSSSSPLPPAYAPS-SASFPL--FSSQQMGVFR  231



>ref|XP_009411924.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 78/130 (60%), Gaps = 27/130 (21%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAE AARAYDEAALRFRG+RAKLNFPENVR       
Sbjct  203  WGKWAAEIRDPYKAARVWLGTFETAEEAARAYDEAALRFRGSRAKLNFPENVRL------  256

Query  182  aaisasqlpanaPSQPSYQAHLQ---PSQGSPAVA----GDYLAYSQLLQNPGDVHGQRP  340
                          QPS+   L    P   SPA +     DYLAYS+LLQ   +     P
Sbjct  257  --------------QPSHSVALAAQVPPSNSPATSSGAVSDYLAYSRLLQGASEYQRLPP  302

Query  341  NSLLEQMFRS  370
             SLL+    S
Sbjct  303  ASLLDPFVHS  312



>ref|XP_009408302.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Musa acuminata subsp. malaccensis]
Length=225

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 77/129 (60%), Gaps = 18/129 (14%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAE AARAYDEAALRFRG+RAKLNFPENVR       
Sbjct  36   WGKWAAEIRDPHKAARVWLGTFETAEQAARAYDEAALRFRGSRAKLNFPENVR-------  88

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSP-----AVAGDYLAYSQLLQNPGDVHGQRPNS  346
                        P  P+ Q  +  S  +P     +   DYL YS+LLQ  G+       S
Sbjct  89   ------LHQPPPPVSPTTQLTVSCSVAAPPWDAQSSTADYLEYSRLLQGAGEYQRLPATS  142

Query  347  LLEQMFRSS  373
            L + +  SS
Sbjct  143  LFDSVMYSS  151



>ref|XP_010106868.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXC12328.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=484

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR++P P+ 
Sbjct  233  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRTIPAPRP  292

Query  182  aaisasqlpana---PSQPSY--QAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHG  331
             A +A +  A     P QP++        S    A+  DY  YSQLLQ+ GD  G
Sbjct  293  IAAAAGESSATTLLPPVQPNFFQTTPFHDSSSDAALLRDYFQYSQLLQSSGDFSG  347



>ref|XP_011044262.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Populus euphratica]
Length=458

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 83/143 (58%), Gaps = 22/143 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRs--lppp  175
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPEN R       
Sbjct  227  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPENARLLPAQMQ  286

Query  176  qaaaisasqlpanaPSQPSYQAHLQPS--------------QGSPAVAGDYLAYSQLLQN  313
               A       +  PS    Q+   P               Q  P +  DY  YSQLLQ+
Sbjct  287  NVTASQVPVSISQLPSHHQLQSISSPRQQAQRPQVPAPALFQSQPHIIRDYWEYSQLLQS  346

Query  314  PGDVHG------QRPNSLLEQMF  364
             GD HG        P++LL+QMF
Sbjct  347  SGDFHGQQQQQQPPPSNLLDQMF  369



>ref|XP_011044263.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Populus euphratica]
Length=443

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 86/149 (58%), Gaps = 22/149 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRs--lppp  175
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPEN R       
Sbjct  212  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPENARLLPAQMQ  271

Query  176  qaaaisasqlpanaPSQPSYQAHLQPS--------------QGSPAVAGDYLAYSQLLQN  313
               A       +  PS    Q+   P               Q  P +  DY  YSQLLQ+
Sbjct  272  NVTASQVPVSISQLPSHHQLQSISSPRQQAQRPQVPAPALFQSQPHIIRDYWEYSQLLQS  331

Query  314  PGDVHG------QRPNSLLEQMFRSSSMA  382
             GD HG        P++LL+QMF +  +A
Sbjct  332  SGDFHGQQQQQQPPPSNLLDQMFYNPQLA  360



>ref|XP_008781454.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Phoenix dactylifera]
Length=391

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 79/124 (64%), Gaps = 11/124 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENV   P    
Sbjct  184  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENVHLGPAAPI  243

Query  182  aaisasqlpanaP-----SQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNS  346
            +       P+  P     SQP   A LQ S  S     DYL YS LLQ  G      P +
Sbjct  244  SPAPQPPAPSTQPATLLESQPF--ALLQASSAS----RDYLEYSSLLQGTGQYRTLPPTA  297

Query  347  LLEQ  358
            LLEQ
Sbjct  298  LLEQ  301



>ref|XP_008784254.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Phoenix dactylifera]
Length=379

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 82/130 (63%), Gaps = 8/130 (6%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGNRAKLNFPE+V   P    
Sbjct  174  WGKWAAEIRDPHKAARVWLGTFDTAEDAARAYDEAALRFRGNRAKLNFPEDVHLRPAAPI  233

Query  182  aaisasqlpanaPSQPSYQAHLQPSQG-----SPAVAGDYLAYSQLLQNPGDVHGQRPNS  346
            +  +   +P     QP+     QP  G     + + + DYL YS+LLQ  G+     P +
Sbjct  234  SPATQLPVPGP---QPATLLESQPFSGLSGLQASSASSDYLEYSRLLQGTGEYQRIPPTA  290

Query  347  LLEQMFRSSS  376
            L  QM  S S
Sbjct  291  LWHQMMYSGS  300



>ref|XP_009413556.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Musa acuminata subsp. malaccensis]
Length=272

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 75/126 (60%), Gaps = 34/126 (27%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP +AARVWLGTF+T+EAAARAYDEAALRFRG+RAKLNFPE          
Sbjct  122  WGKWAAEIRDPHRAARVWLGTFDTSEAAARAYDEAALRFRGSRAKLNFPE----------  171

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSP------AVAGDYLAYSQLLQNPGDVHGQRPN  343
                              +AHLQP  G P      AVA DYL YS LL+  G+     P 
Sbjct  172  ------------------EAHLQPFGGHPSSDAAVAVASDYLPYSTLLKGGGEYQRMTPT  213

Query  344  SLLEQM  361
             L++Q 
Sbjct  214  PLVDQT  219



>ref|XP_008372740.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ABR1-like [Malus domestica]
Length=471

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 79/124 (64%), Gaps = 15/124 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR + PP  
Sbjct  238  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLVQPPPP  297

Query  182  aaisasqlpanaPSQPSYQA--------------HLQPS-QGSPAVAGDYLAYSQLLQNP  316
                 +    + P+Q +                 H QP+ Q S  +  DY  YSQLLQ+ 
Sbjct  298  PPTLQTFNSNSRPTQYAQPLQPPPLPQPPQQQLYHSQPAFQPSSDLLRDYFDYSQLLQSS  357

Query  317  GDVH  328
             D H
Sbjct  358  ADFH  361



>gb|ADW19888.1| ethylene responsive factor [Bruguiera gymnorhiza]
Length=475

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 90/152 (59%), Gaps = 25/152 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYD+AALRFRG+RAKLNFPENVR +PPP +
Sbjct  250  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDDAALRFRGSRAKLNFPENVRLMPPPTS  309

Query  182  aaisasqlpanaPSQPSYQA----HL--------------QPS------QGSPAVAGDYL  289
                A        S+P        HL              QPS      Q    +  DY 
Sbjct  310  MQNVAVGSQMAMASRPPPPPLPSHHLQAFSSLAAQTSRFPQPSTSPSTFQSQADMVRDYW  369

Query  290  AYSQLLQNPGDVHGQ-RPNSLLEQMFRSSSMA  382
             Y Q LQN G+ HGQ +P+SL EQ   SS + 
Sbjct  370  GYGQFLQNTGEFHGQSQPSSLAEQFLHSSQLG  401



>ref|XP_008785849.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Phoenix dactylifera]
Length=360

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 77/124 (62%), Gaps = 15/124 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+VR       
Sbjct  169  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDVR-------  221

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
                      + P          P+  S   + DYL YS+LLQ  GD     P SLL+Q 
Sbjct  222  --------LYSTPPPAPLPISNSPATLSSDASRDYLEYSRLLQGVGDYQRLPPTSLLDQF  273

Query  362  FRSS  373
              S+
Sbjct  274  MYSN  277



>ref|XP_009420584.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Musa acuminata subsp. malaccensis]
Length=309

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 80/128 (63%), Gaps = 7/128 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPE          
Sbjct  134  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPEEA------GL  187

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
                A    A+  SQP +  H      +   A DY+ YS+LL+  G+     P +LL+QM
Sbjct  188  RKAPAVTPEAHMESQP-FGRHGASGSTAAVAARDYMEYSRLLRGEGEYQRMPPTALLDQM  246

Query  362  FRSSSMAV  385
              S + A 
Sbjct  247  MYSGASAA  254



>gb|KDP36582.1| hypothetical protein JCGZ_08349 [Jatropha curcas]
Length=473

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 87/135 (64%), Gaps = 14/135 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAAL+FRGNRAKLNFPE+VR       
Sbjct  266  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALKFRGNRAKLNFPEHVRVLPPPPI  325

Query  161  -slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQR  337
             ++  P +     +     AP+      H Q          DY  YSQLLQ+ GD H Q 
Sbjct  326  QTVAVPYSHQPQPTPPQQTAPAPAPPYFHFQGDN-----IRDYWEYSQLLQSTGDFHVQ-  379

Query  338  PNSLLEQMFRSSSMA  382
            P+SLLEQMF +  +A
Sbjct  380  PSSLLEQMFYNQQLA  394



>ref|XP_006606168.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Glycine max]
 ref|XP_006606169.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Glycine max]
 ref|XP_006606170.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X3 [Glycine max]
 ref|XP_006606171.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X4 [Glycine max]
 ref|XP_006606172.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X5 [Glycine max]
Length=279

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 86/138 (62%), Gaps = 16/138 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENV  +PPP  
Sbjct  73   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVVPVPPPPP  132

Query  182  aaisasqlpanaPSQPSYQAHL----------QPSQGSPAVAGDYLAYSQLLQNPGDVHG  331
                 +   A + S     + +           P QGS A   DY  YSQLL++ GD HG
Sbjct  133  VPDLPASAVAGSDSISGSGSVVAGFSPTLMQGAPFQGSSAFLRDYWGYSQLLRSTGDFHG  192

Query  332  QRPNSLLEQMFRSSSMAV  385
                  L+Q F  S MA 
Sbjct  193  ------LDQWFFDSQMAA  204



>gb|ADW19889.1| ethylene responsive factor [Kandelia candel]
Length=290

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 124/232 (53%), Gaps = 50/232 (22%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRs------  163
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPENVR       
Sbjct  63   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPENVRLMVPPPP  122

Query  164  -lpppqaaaisasqlpanaPSQ-PSYQAHLQPSQGSPAVAG-------------------  280
                  AA    +      PS  PS+  HL   Q  PA+A                    
Sbjct  123  PSMQNVAAGSQITIASRPPPSTLPSH--HL---QAIPALAAAQTSRFTLPPTSEPMFQSR  177

Query  281  -----DYLAYSQLLQNPGDVHGQ-RPNSLLEQMFRSSSMA----------Vfhshsfpss  412
                 DY  Y Q LQ+ G+ H Q +P+SL+EQ F SS +A             + S   S
Sbjct  178  ADSVRDYWEYGQFLQSTGEFHRQPQPSSLVEQSFHSSQLASLQSNLSLPSSALASSHAGS  237

Query  413  spsITAPSGPFPLMTFSGQQSSYFRpqssqspttgssfqspYWTNSGSQYPP  568
            S S ++ S  FPL+  +GQQ  YFR   + +  T S F  P W++S S YPP
Sbjct  238  SVSSSSASASFPLL-LAGQQLGYFRQPQNPNEATDSDFHVPPWSHS-SHYPP  287



>ref|XP_009393416.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Musa acuminata subsp. malaccensis]
Length=368

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 79/129 (61%), Gaps = 27/129 (21%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAE AARAYD AALRFRG RAKLNFPENVR       
Sbjct  189  WGKWAAEIRDPHKAARVWLGTFETAEEAARAYDAAALRFRGRRAKLNFPENVRL------  242

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAG----DYLAYSQLLQNPGDVHGQR-PNS  346
                          QPS    L  S  SPA       DYLAY++LLQ  G+ H +  P S
Sbjct  243  --------------QPSLSVPLATSN-SPATTSDTITDYLAYTRLLQG-GEEHPRIPPTS  286

Query  347  LLEQMFRSS  373
            LL+Q   S+
Sbjct  287  LLDQYMYSN  295



>ref|XP_010930947.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Elaeis 
guineensis]
Length=392

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 78/124 (63%), Gaps = 11/124 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRs-----l  166
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENV       +
Sbjct  183  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENVHLRPVAPI  242

Query  167  pppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNS  346
             P                SQP   A LQ S  S     DY+ YS+LLQ  G+     P +
Sbjct  243  SPAPQLPAPTPPPVTLLESQPF--ARLQASGAS----RDYVEYSRLLQGTGEYRTFSPTA  296

Query  347  LLEQ  358
            LLEQ
Sbjct  297  LLEQ  300



>ref|XP_004498981.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Cicer arietinum]
Length=338

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAAL+FRG+RAKLNFPENV +   P  
Sbjct  140  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALKFRGSRAKLNFPENVTTTISPTF  199

Query  182  aaisasqlpanaPSQPSYQAHLQPS-------QGSPAVAGDYLAYSQLLQNPGDVHGQRP  340
               ++S +  N  +  S    LQ         QGS  +  DY  YSQ+L+   D  G   
Sbjct  200  PPNTSSTVSVNPATHYSPPPPLQMQQPPFTQFQGSSDLLTDYYQYSQILKGSADFQG---  256

Query  341  NSLLEQMFRSSSMAVfhshsfpssspsITAP-----SGPFPLMTFSGQQSSYFR  487
               LEQ F  S MA  HS S      +  +P     S   PL  F GQQ  +FR
Sbjct  257  ---LEQWFYESQMAAIHSSSSMLLPSTAFSPATQLSSASLPL--FPGQQIEFFR  305



>ref|XP_004498983.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X3 [Cicer arietinum]
Length=298

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAAL+FRG+RAKLNFPENV +   P  
Sbjct  100  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALKFRGSRAKLNFPENVTTTISPTF  159

Query  182  aaisasqlpanaPSQPSYQAHLQPS-------QGSPAVAGDYLAYSQLLQNPGDVHGQRP  340
               ++S +  N  +  S    LQ         QGS  +  DY  YSQ+L+   D  G   
Sbjct  160  PPNTSSTVSVNPATHYSPPPPLQMQQPPFTQFQGSSDLLTDYYQYSQILKGSADFQG---  216

Query  341  NSLLEQMFRSSSMAVfhshsfpssspsITAP-----SGPFPLMTFSGQQSSYFR  487
               LEQ F  S MA  HS S      +  +P     S   PL  F GQQ  +FR
Sbjct  217  ---LEQWFYESQMAAIHSSSSMLLPSTAFSPATQLSSASLPL--FPGQQIEFFR  265



>ref|XP_004498982.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Cicer arietinum]
Length=333

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAAL+FRG+RAKLNFPENV +   P  
Sbjct  135  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALKFRGSRAKLNFPENVTTTISPTF  194

Query  182  aaisasqlpanaPSQPSYQAHLQPS-------QGSPAVAGDYLAYSQLLQNPGDVHGQRP  340
               ++S +  N  +  S    LQ         QGS  +  DY  YSQ+L+   D  G   
Sbjct  195  PPNTSSTVSVNPATHYSPPPPLQMQQPPFTQFQGSSDLLTDYYQYSQILKGSADFQG---  251

Query  341  NSLLEQMFRSSSMAVfhshsfpssspsITAP-----SGPFPLMTFSGQQSSYFR  487
               LEQ F  S MA  HS S      +  +P     S   PL  F GQQ  +FR
Sbjct  252  ---LEQWFYESQMAAIHSSSSMLLPSTAFSPATQLSSASLPL--FPGQQIEFFR  300



>gb|AID51426.1| ethylene response factor 21 [Diospyros kaki]
Length=366

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 85/130 (65%), Gaps = 14/130 (11%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENVR  P P  
Sbjct  174  WGKWAAEIRDPYKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVRIRPSPPG  233

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLA---YSQLLQNPGDVHGQRPNSLL  352
               +         +  +     QP   S +   +Y+    Y+QLL N  ++  Q P SLL
Sbjct  234  PPPA---------THLAVSTSTQPIVHSQSHDTNYMNNYYYAQLLGNSNELQNQ-PTSLL  283

Query  353  EQMFRSSSMA  382
            +QM  S+SMA
Sbjct  284  DQML-SNSMA  292



>ref|XP_007151985.1| hypothetical protein PHAVU_004G092100g [Phaseolus vulgaris]
 gb|ESW23979.1| hypothetical protein PHAVU_004G092100g [Phaseolus vulgaris]
Length=435

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 106/185 (57%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  224  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPLQP  283

Query  161  --slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNP-----G  319
              +      +  S SQ      + P +    Q  QGS  +  DYL YSQLLQ        
Sbjct  284  FQAATRLTVSDSSTSQFRPLTVAAPPFVQQPQ-MQGSSDLIRDYLQYSQLLQTDFQHQHQ  342

Query  320  DVHGQRPNSLLEQMFRSSSMAVfhshsfpssspsITAP---------SGPFPLMTFSGQQ  472
              H Q+P++ L+Q++ ++ +A   S SF SS      P         S  FP+  FS QQ
Sbjct  343  HQHQQQPSNFLQQLYYNAQLASLQSPSFSSSVSPTPLPLFSTSAQFSSASFPM--FSSQQ  400

Query  473  SSYFR  487
             SYF+
Sbjct  401  MSYFQ  405



>ref|XP_010063839.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Eucalyptus grandis]
 gb|KCW71104.1| hypothetical protein EUGRSUZ_F04203 [Eucalyptus grandis]
Length=387

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 82/151 (54%), Gaps = 49/151 (32%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDPQKAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  156  WGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR-------  208

Query  182  aaisasqlpanaPSQPSYQA------HLQPSQGSPAVA----------------------  277
                        P+ P+Y +       L      PA+A                      
Sbjct  209  ---------VIPPNVPTYGSPAAAAATLAAGSAPPAIAAGQLAPPYAGAVPLYPRGSEGF  259

Query  278  --GDYLAYSQLLQNPGDVHGQRPNSLLEQMF  364
              GDY  YSQLLQ     H  +P SL+EQM 
Sbjct  260  NLGDYWEYSQLLQG---HHHHQPASLMEQMM  287



>ref|XP_002278226.1| PREDICTED: ethylene-responsive transcription factor ERF110 [Vitis 
vinifera]
 emb|CBI21548.3| unnamed protein product [Vitis vinifera]
Length=352

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 85/128 (66%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP +AARVWLGTF++AEAAARAYDEAALRFRGN+AKLNFPENV+  P P  
Sbjct  164  WGKWAAEIRDPYRAARVWLGTFDSAEAAARAYDEAALRFRGNKAKLNFPENVQLRPSPSG  223

Query  182  aaisasqlpanaP---SQPSYQAHLQPSQ-----GSPAVAGDYLAYSQLLQNPGDVHGQR  337
            +  +   +  +     S PSY   +  SQ      S  + GDY  YSQ+  +  D   ++
Sbjct  224  SQATQLAISDSPETLFSVPSYTNPIVQSQPLHRSRSSELPGDYFNYSQMGSSSSDYFPRQ  283

Query  338  PNSLLEQM  361
            P +LL+QM
Sbjct  284  PMNLLDQM  291



>gb|KEH25914.1| AP2 domain class transcription factor [Medicago truncatula]
Length=405

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPENVRS+ PP  
Sbjct  188  WGKWAAEIRDPHKAQRVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPENVRSIMPPPP  247

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGD  322
                  Q      + PS     +P QG+  +  DYL YS +LQ+ GD
Sbjct  248  QQQPQLQSFPAT-AVPSGTPQ-RPVQGTSDMIRDYLEYSHILQSSGD  292



>ref|XP_002302164.1| hypothetical protein POPTR_0002s06620g [Populus trichocarpa]
 gb|EEE81437.1| hypothetical protein POPTR_0002s06620g [Populus trichocarpa]
Length=457

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 90/153 (59%), Gaps = 28/153 (18%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYD+AALRFRGNRAKLNFPENVR LP    
Sbjct  227  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDDAALRFRGNRAKLNFPENVRLLPAQTQ  286

Query  182  aaisasqlpanaPSQPSYQAHLQPS------------------QGSPAVAGDYLAYSQLL  307
               ++    ++  SQ S    LQP                   Q    +  DY  YSQLL
Sbjct  287  NVTASQVPISH--SQLSSHLQLQPISSPRQQAQRPQAPAPALFQSQADIIRDYWEYSQLL  344

Query  308  QNPGDV--------HGQRPNSLLEQMFRSSSMA  382
            Q+ G+           Q+P+SLL+ MF +  +A
Sbjct  345  QSSGEFHHHQQQQQQQQQPSSLLQPMFYNPQVA  377



>dbj|BAG50064.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=422

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPEN------VRs  163
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPEN         
Sbjct  203  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRAVPPRPP  262

Query  164  lpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGD  322
             P  Q  A  A++L    P  P    +  P QG P +  DYL YSQLLQN G+
Sbjct  263  PPQQQFQAFPATRLAIPDPLPPPQLQNPPPFQGQPELMRDYLEYSQLLQNYGE  315



>gb|ADE41125.1| AP2 domain class transcription factor [Malus domestica]
Length=443

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 85/141 (60%), Gaps = 22/141 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR     Q 
Sbjct  240  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR---LIQP  296

Query  182  aaisasqlpanaPSQPSYQA------------HLQPS-QGSPAVAGDYLAYSQLLQNPGD  322
             A   +    + P+Q +               H Q +   S  +  DY  YSQLLQN  D
Sbjct  297  PAAVQTFNSNSRPTQSAQPLQPPPQPPQQQLYHSQQAFHPSSDLIRDYFDYSQLLQNSAD  356

Query  323  VHGQRPNSLLEQMFRSSSMAV  385
                  ++LLE M+  +S  V
Sbjct  357  ------SNLLEHMYYYNSQLV  371



>ref|XP_011042884.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Populus euphratica]
Length=462

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 77/125 (62%), Gaps = 20/125 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP    
Sbjct  227  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPAQTQ  286

Query  182  aaisasqlpanaPSQPSYQAHLQPS------------------QGSPAVAGDYLAYSQLL  307
               ++    ++  SQ S    LQP                   Q    +  DY  YSQLL
Sbjct  287  NVTASQVPISH--SQLSSHLQLQPISSPRQQAQRPQAPAPALFQSQADIIRDYWEYSQLL  344

Query  308  QNPGD  322
            Q+ GD
Sbjct  345  QSSGD  349



>ref|XP_004496448.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Cicer arietinum]
Length=348

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 83/135 (61%), Gaps = 13/135 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAAL+FRG+RAKLNFPENV +   P  
Sbjct  135  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALKFRGSRAKLNFPENVTTTISPTF  194

Query  182  aaisasqlpanaPSQPSYQAHLQPS-------QGSPAVAGDYLAYSQLLQNPGDVHGQRP  340
               ++S +  N  +  S    LQ         QGS  +  DY  YSQ+L+   D  G   
Sbjct  195  PPNTSSTVSVNPATHYSPAPPLQMQQPPFTQFQGSSDLLRDYYQYSQILKGSADFQG---  251

Query  341  NSLLEQMFRSSSMAV  385
               LEQ F  S MA 
Sbjct  252  ---LEQWFYESQMAA  263



>ref|XP_011042883.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Populus euphratica]
Length=463

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 77/125 (62%), Gaps = 20/125 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR LP    
Sbjct  228  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLLPAQTQ  287

Query  182  aaisasqlpanaPSQPSYQAHLQPS------------------QGSPAVAGDYLAYSQLL  307
               ++    ++  SQ S    LQP                   Q    +  DY  YSQLL
Sbjct  288  NVTASQVPISH--SQLSSHLQLQPISSPRQQAQRPQAPAPALFQSQADIIRDYWEYSQLL  345

Query  308  QNPGD  322
            Q+ GD
Sbjct  346  QSSGD  350



>emb|CAN60132.1| hypothetical protein VITISV_000884 [Vitis vinifera]
Length=352

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 85/128 (66%), Gaps = 8/128 (6%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP +AARVWLGTF++AEAAARAYDEAALRFRGN+AKLNFPENV+  P P  
Sbjct  164  WGKWAAEIRDPYRAARVWLGTFDSAEAAARAYDEAALRFRGNKAKLNFPENVQLRPSPSG  223

Query  182  aaisasqlpanaP---SQPSYQAHLQPSQ-----GSPAVAGDYLAYSQLLQNPGDVHGQR  337
            +  +   +  +     S PSY   +  SQ      S  + GDY  YSQ+  +  D   ++
Sbjct  224  SQATQLAISDSPETLFSVPSYTNPIVQSQPLHRSRSSELPGDYXNYSQMGSSSSDYFPRQ  283

Query  338  PNSLLEQM  361
            P +LL+QM
Sbjct  284  PMNLLDQM  291



>ref|XP_008237504.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ABR1-like [Prunus mume]
Length=478

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 89/155 (57%), Gaps = 34/155 (22%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR + P   
Sbjct  242  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRLVHPQPQ  301

Query  182  aaisasqlpanaPSQPSYQAHLQPS----------------------QGSPAVAGDYLAY  295
            A    +       +  S + +L P                        GS     DY  Y
Sbjct  302  APNLQNF------NSDSARTNLAPILSAQPLQPPPQPPQQLYQPQPFHGSSDFLRDYFDY  355

Query  296  SQLLQNPGDVHG------QRPNSLLEQMFRSSSMA  382
            SQLLQ+  + H       Q+P +LL+QM+ +S +A
Sbjct  356  SQLLQSSTNFHAQQQQQQQQPTNLLQQMYYNSQLA  390



>ref|XP_010912020.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Elaeis guineensis]
Length=434

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 77/123 (63%), Gaps = 15/123 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+V        
Sbjct  244  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDVH-------  296

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
                   L    P  P   ++  P+  S   + DY+ YS+LLQ  G      P SLL+Q 
Sbjct  297  -------LHLAPPPAPLATSN-SPATPSSDASRDYIEYSRLLQGVGPYQRLPPTSLLDQY  348

Query  362  FRS  370
              S
Sbjct  349  MSS  351



>ref|XP_003592075.1| Ethylene-responsive transcription factor ERF110 [Medicago truncatula]
 gb|AES62326.1| AP2 domain class transcription factor [Medicago truncatula]
Length=362

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 81/142 (57%), Gaps = 26/142 (18%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENV       A
Sbjct  147  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGNRAKLNFPENV------PA  200

Query  182  aaisasqlpanaPSQPSYQAHLQPSQG--------------SPAVAGDYLAYSQLLQNPG  319
            +A   +     + S  S   H  P+                S  +  DY  YSQLL+  G
Sbjct  201  SATRPTFPVNTSTSSVSPATHYSPAPPQIQPQQQQFPQFQTSSDMLRDYYQYSQLLKGSG  260

Query  320  DVHGQRPNSLLEQMFRSSSMAV  385
            D  G      LEQ F  S MA 
Sbjct  261  DFQG------LEQWFYESQMAA  276



>ref|XP_007048189.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOX92346.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=386

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 83/139 (60%), Gaps = 12/139 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslp----  169
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+       
Sbjct  189  WGKWAAEIRDPIKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVKLKSPPSS  248

Query  170  --ppqaaaisasqlpanaPSQPSYQAHLQPS--QGSPAVAGDYLAYSQLLQNPGDV----  325
                Q     ++    + P+      H Q +    SP V+G YL YSQ    P +     
Sbjct  249  PATTQFITSDSATTLMSIPTSTEPIVHSQSNYLVQSPQVSGGYLDYSQFFLGPSNDFPKQ  308

Query  326  HGQRPNSLLEQMFRSSSMA  382
              ++P  L EQ   S+S+ 
Sbjct  309  QQEQPLKLYEQRVLSTSVG  327



>ref|XP_008381850.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ABR1-like [Malus domestica]
Length=446

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 85/144 (59%), Gaps = 25/144 (17%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR     Q 
Sbjct  240  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR---LIQP  296

Query  182  aaisasqlpanaPSQPSYQA---------------HLQPS-QGSPAVAGDYLAYSQLLQN  313
             A   +    + P+Q +                  H Q +   S  +  DY  YSQLLQN
Sbjct  297  PAAVQTFNSNSRPTQSAQPLQPPPPPPQPPQQQLYHSQQAFHPSSDLIRDYFDYSQLLQN  356

Query  314  PGDVHGQRPNSLLEQMFRSSSMAV  385
              D      ++LLE M+  +S  V
Sbjct  357  SAD------SNLLEHMYYYNSQLV  374



>ref|XP_010530169.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Tarenaya hassleriana]
Length=393

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 66/109 (61%), Gaps = 17/109 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+ AE+AA AYD AALRFRGN+AKLNFPENVR       
Sbjct  210  WGKWAAEIRDPHKAARVWLGTFDPAESAAMAYDAAALRFRGNKAKLNFPENVR-------  262

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVH  328
                        P  P + A   P         DY  YSQLLQ+ GD +
Sbjct  263  ---------ILPPPLPPHSAS-PPQAPVDKALTDYWRYSQLLQSSGDFY  301



>gb|ADZ28109.1| ethylene response factor 6, partial [Malus domestica]
Length=405

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 84/141 (60%), Gaps = 22/141 (16%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRF GNRAKLNFPENVR     Q 
Sbjct  240  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFSGNRAKLNFPENVR---LIQP  296

Query  182  aaisasqlpanaPSQPSYQA------------HLQPS-QGSPAVAGDYLAYSQLLQNPGD  322
             A   +    + P+Q +               H Q +   S  +  DY  YSQLLQN  D
Sbjct  297  PAAVQTFNSNSRPTQSAQPLQPPPQPPQQQLYHSQQAFHPSSDLIRDYFDYSQLLQNSAD  356

Query  323  VHGQRPNSLLEQMFRSSSMAV  385
                  ++LLE M+  +S  V
Sbjct  357  ------SNLLEHMYYYNSQLV  371



>dbj|BAG50063.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=233

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF TAE AARAYD+A+LRFRGN+AKLNFPENVR
Sbjct  65   WGKWAAEIRDPFKAARVWLGTFNTAEEAARAYDQASLRFRGNKAKLNFPENVR  117



>ref|NP_001143036.1| uncharacterized protein LOC100275504 [Zea mays]
 gb|ACG28485.1| hypothetical protein [Zea mays]
Length=237

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+ R    P A
Sbjct  28   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDARLTTAPSA  87

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLL  307
            A   A+          S     Q    + AV+ DYL Y  +L
Sbjct  88   AVAPAAAGSTTMAVAASAGGSYQQEASAAAVSADYLQYQMML  129



>ref|XP_006599482.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X3 [Glycine max]
Length=454

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 73/112 (65%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-----  166
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR++     
Sbjct  219  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  278

Query  167  -pppqaaaisasqlpanaPSQPSYQAHLQ--PSQGSPAVAGDYLAYSQLLQN  313
                    +S S      P        +Q    QGS  +  DYL YSQLLQ+
Sbjct  279  FQATTRLTVSDSTTSQFRPLSAVAPPFIQQPQIQGSSDLIRDYLQYSQLLQS  330



>ref|XP_003548975.2| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Glycine max]
Length=460

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 77/112 (69%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-pppq  178
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR++ P   
Sbjct  219  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  278

Query  179  aaaisasqlpanaPSQPSYQAHLQP-------SQGSPAVAGDYLAYSQLLQN  313
              A +   +  +  SQ    + + P        QGS  +  DYL YSQLLQ+
Sbjct  279  FQATTRLTVSDSTTSQFRPLSAVAPPFIQQPQIQGSSDLIRDYLQYSQLLQS  330



>ref|XP_006599481.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Glycine max]
Length=458

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 77/112 (69%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-pppq  178
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR++ P   
Sbjct  219  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  278

Query  179  aaaisasqlpanaPSQPSYQAHLQP-------SQGSPAVAGDYLAYSQLLQN  313
              A +   +  +  SQ    + + P        QGS  +  DYL YSQLLQ+
Sbjct  279  FQATTRLTVSDSTTSQFRPLSAVAPPFIQQPQIQGSSDLIRDYLQYSQLLQS  330



>ref|XP_007159794.1| hypothetical protein PHAVU_002G267800g [Phaseolus vulgaris]
 gb|ESW31788.1| hypothetical protein PHAVU_002G267800g [Phaseolus vulgaris]
Length=318

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEA+LRFRGN+AKLNFPENVR
Sbjct  149  WGKWAAEIRDPFKAARVWLGTFQTAEDAARAYDEASLRFRGNKAKLNFPENVR  201



>ref|XP_009376561.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Pyrus x bretschneideri]
Length=446

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 80/137 (58%), Gaps = 25/137 (18%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR     Q 
Sbjct  240  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR---LIQP  296

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAG----------------DYLAYSQLLQN  313
             A   +    + P+Q +      P    P                    DY  YSQLLQN
Sbjct  297  PAAVQTFNSNSRPTQSAQPLQPPPPPPQPPQQQLYHPQQAFHPSSDPIRDYFDYSQLLQN  356

Query  314  PGDVHGQRPNSLLEQMF  364
              D      ++LLEQM+
Sbjct  357  SAD------SNLLEQMY  367



>ref|XP_010096464.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXB64474.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=335

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE+AARAYDEAALRFRGN+AKLNFPENVR
Sbjct  167  WGKWAAEIRDPFKAARVWLGTFDTAESAARAYDEAALRFRGNKAKLNFPENVR  219



>gb|EPS73412.1| hypothetical protein M569_01357 [Genlisea aurea]
Length=276

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDPQKAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPE+VR
Sbjct  158  WGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPESVR  210



>ref|XP_006473088.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X4 [Citrus sinensis]
Length=433

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 81/146 (55%), Gaps = 31/146 (21%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR +PP Q 
Sbjct  206  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVRIVPPLQP  265

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA------------------------GDYL  289
                  Q   +     +      P+  + A                           DY 
Sbjct  266  QPQPQPQPQQHQQVLQNIPTRQTPNFATVATNFHQQQQQRQLQTATMPPFFMSQGYQDYF  325

Query  290  AYSQLLQNPGDVHGQRPNSLLEQMFR  367
             YSQLLQN       +P SLLEQM +
Sbjct  326  DYSQLLQN-------QPTSLLEQMLQ  344



>ref|XP_011090449.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Sesamum indicum]
Length=377

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENVR
Sbjct  187  WGKWAAEIRDPYKAARVWLGTFDTAEEAARAYDEAALRFRGNKAKLNFPENVR  239



>gb|KHN00748.1| Ethylene-responsive transcription factor ERF112 [Glycine soja]
Length=357

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR       
Sbjct  141  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  200

Query  161  --slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLL  307
              +      +  + SQ        P +    Q  QGS  +  DYL YSQLL
Sbjct  201  FQATTRLTVSDSTTSQFRPLVTETPPFIQQPQ-IQGSSDLIRDYLQYSQLL  250



>gb|KHN34033.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=345

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 74/123 (60%), Gaps = 3/123 (2%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KA RVWLGTFETAE AARAYD+A+LRFRGN+AKLNFPENVR     + 
Sbjct  174  WGKWAAEIRDPFKATRVWLGTFETAEDAARAYDQASLRFRGNKAKLNFPENVRLRQQQEP  233

Query  182  aaisasqlpanaP--SQPSYQAHLQPSQGSPAVAGDY-LAYSQLLQNPGDVHGQRPNSLL  352
                    P +    S PS   H +  QGS   +  Y  +YS L + P  ++ Q   S  
Sbjct  234  PLNLNPPPPNHGAILSIPSTTVHTEALQGSLGSSNFYEHSYSHLHEFPVSLYDQIAESTS  293

Query  353  EQM  361
              M
Sbjct  294  TTM  296



>ref|XP_008244623.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Prunus mume]
Length=404

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYDEAALRFRGN+AKLNFPENVR   P   
Sbjct  202  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDEAALRFRGNKAKLNFPENVRLRTPIAD  261

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA----GDYLAYSQLLQ--NPGDVHGQRPN  343
            +  +   + A + +  S     +P   S A        + A   LL    P DV  Q+P 
Sbjct  262  SPATQLTISAPSNTLLSVATSTEPIVHSQAFQSMQHSSHEASRNLLSYCKPVDVQRQQPM  321

Query  344  SLLEQMF  364
            SL +QM 
Sbjct  322  SLYDQML  328



>gb|EYU36832.1| hypothetical protein MIMGU_mgv1a024477mg [Erythranthe guttata]
Length=278

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF TAEAAARAYDEAALRFRG+RAKLNFPENVR
Sbjct  111  WGKWAAEIRDPHKAARVWLGTFSTAEAAARAYDEAALRFRGSRAKLNFPENVR  163



>ref|XP_006589489.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Glycine max]
Length=273

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 82/135 (61%), Gaps = 14/135 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENV  + PP  
Sbjct  70   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVVQVQPPPP  129

Query  182  aaisasqlpanaPSQPSYQAHLQPS-------QGSPAVAGDYLAYSQLLQNPGDVHGQRP  340
                 +   A + S  S      P+       Q S     DY  YSQLL++ G+ HG   
Sbjct  130  LPNLPASAVAGSGSG-SVVTGFAPTVMQGTRFQDSSDFLRDYWGYSQLLRSTGEFHG---  185

Query  341  NSLLEQMFRSSSMAV  385
               L+  F  S MA 
Sbjct  186  ---LDHWFFDSQMAA  197



>ref|XP_003519981.2| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Glycine max]
Length=508

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-----  166
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR++     
Sbjct  279  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  338

Query  167  -pppqaaaisasqlpanaPSQPSYQAHLQ--PSQGSPAVAGDYLAYSQLL  307
                    +S S      P        +Q    QGS  +  DYL YSQLL
Sbjct  339  FQATTRLTVSDSTTSQFRPLVTETPPFIQQPQIQGSSDLIRDYLQYSQLL  388



>ref|XP_006574788.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Glycine max]
Length=507

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-----  166
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR++     
Sbjct  279  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  338

Query  167  -pppqaaaisasqlpanaPSQPSYQAHLQ--PSQGSPAVAGDYLAYSQLL  307
                    +S S      P        +Q    QGS  +  DYL YSQLL
Sbjct  339  FQATTRLTVSDSTTSQFRPLVTETPPFIQQPQIQGSSDLIRDYLQYSQLL  388



>gb|KDO57151.1| hypothetical protein CISIN_1g039390mg, partial [Citrus sinensis]
Length=263

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  164  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  216



>gb|KHN41295.1| Ethylene-responsive transcription factor ERF112 [Glycine soja]
Length=381

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 75/110 (68%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRsl-pppq  178
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRGNRAKLNFPENVR++ P   
Sbjct  162  WGKWAAEIRDPHKAARVWLGTFDTEEAAARAYDEAALRFRGNRAKLNFPENVRAVPPIQP  221

Query  179  aaaisasqlpanaPSQPSYQAHLQP-------SQGSPAVAGDYLAYSQLL  307
              A +   +  +  SQ    + + P        QGS  +  DYL YSQLL
Sbjct  222  FQATTRLTVSDSTTSQFRPLSAVAPPFIQQPQIQGSSDLIRDYLQYSQLL  271



>gb|KDO83784.1| hypothetical protein CISIN_1g013225mg [Citrus sinensis]
Length=430

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  206  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  258



>ref|XP_006847128.1| hypothetical protein AMTR_s00017p00232330 [Amborella trichopoda]
 gb|ERN08709.1| hypothetical protein AMTR_s00017p00232330 [Amborella trichopoda]
Length=371

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 79/135 (59%), Gaps = 11/135 (8%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+TAE+AARAYDEAALRFRG RAKLNFPENV+       
Sbjct  190  WGKWAAEIRDPHKAARVWLGTFDTAESAARAYDEAALRFRGTRAKLNFPENVQLRPPINP  249

Query  161  ---slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHG  331
                      +        + +P +P  Q   Q S     +  DY+ YSQLLQ+   +  
Sbjct  250  NPSVSLSTIPSLSPLPTSSSYSPYRPDVQGG-QSSFSFSHLPHDYIQYSQLLQSHQGLPR  308

Query  332  QRPNSLLEQMFRSSS  376
                SLL+Q F   S
Sbjct  309  PPAQSLLDQCFNVGS  323



>ref|XP_006473085.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Citrus sinensis]
Length=450

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  223  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  275



>ref|XP_006473086.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Citrus sinensis]
 gb|KDO83782.1| hypothetical protein CISIN_1g013225mg [Citrus sinensis]
Length=447

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  223  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  275



>ref|XP_006473087.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X3 [Citrus sinensis]
Length=445

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  218  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  270



>ref|XP_006434498.1| hypothetical protein CICLE_v10001138mg [Citrus clementina]
 gb|ESR47738.1| hypothetical protein CICLE_v10001138mg [Citrus clementina]
Length=431

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  207  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  259



>ref|XP_008353572.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Malus domestica]
Length=391

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAA++YD+AALRFRGN+AKLNFPENVR
Sbjct  199  WGKWAAEIRDPFKAARVWLGTFETAEAAAQSYDQAALRFRGNKAKLNFPENVR  251



>ref|XP_006434497.1| hypothetical protein CICLE_v10001138mg [Citrus clementina]
 gb|ESR47737.1| hypothetical protein CICLE_v10001138mg [Citrus clementina]
Length=448

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  224  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  276



>ref|XP_008362283.1| PREDICTED: ethylene-responsive transcription factor ABR1-like, 
partial [Malus domestica]
Length=291

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYD+AALRFRGN+AKLNFPENVR
Sbjct  160  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDQAALRFRGNKAKLNFPENVR  212



>ref|XP_006282350.1| hypothetical protein CARUB_v10028647mg [Capsella rubella]
 gb|EOA15248.1| hypothetical protein CARUB_v10028647mg [Capsella rubella]
Length=222

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  85   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  137



>gb|KDO83783.1| hypothetical protein CISIN_1g013225mg [Citrus sinensis]
Length=442

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  218  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  270



>gb|KHN29138.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=296

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTFETAE AARAYD+A+LRFRGN+AKLNFPENVR
Sbjct  168  WGKWAAEIRDPLKARRVWLGTFETAEDAARAYDQASLRFRGNKAKLNFPENVR  220



>ref|XP_006434499.1| hypothetical protein CICLE_v10001138mg [Citrus clementina]
 gb|ESR47739.1| hypothetical protein CICLE_v10001138mg [Citrus clementina]
Length=443

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPENVR
Sbjct  219  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPENVR  271



>ref|XP_009112156.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Brassica rapa]
Length=381

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF++AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  185  WGKWAAEIRDPFKAARVWLGTFDSAESAARAYDEAALRFRGNKAKLNFPENVK  237



>ref|XP_006427894.1| hypothetical protein CICLE_v10026032mg [Citrus clementina]
 gb|ESR41134.1| hypothetical protein CICLE_v10026032mg [Citrus clementina]
Length=334

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  164  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  216



>ref|XP_006464539.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Citrus sinensis]
Length=356

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  165  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  217



>ref|XP_006402191.1| hypothetical protein EUTSA_v10014579mg [Eutrema salsugineum]
 gb|ESQ43644.1| hypothetical protein EUTSA_v10014579mg [Eutrema salsugineum]
Length=229

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  91   WGKWAAEIRDPHKAVRVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  143



>ref|XP_006464540.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Citrus sinensis]
Length=355

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  164  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  216



>emb|CDY14506.1| BnaC03g49530D [Brassica napus]
Length=392

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  194  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  246



>ref|XP_010927404.1| PREDICTED: AP2-like ethylene-responsive transcription factor 
PLT2 [Elaeis guineensis]
Length=361

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 74/121 (61%), Gaps = 17/121 (14%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WG+WAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+ R    P +
Sbjct  184  WGRWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDARLPSMPPS  243

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
            +  + S                     S   + DYL YS+LLQ  G      P SLL++ 
Sbjct  244  SPPANSNATL-----------------SSDASRDYLEYSRLLQGDGKYQRLPPTSLLDRF  286

Query  362  F  364
             
Sbjct  287  M  287



>ref|XP_010462789.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Camelina sativa]
Length=404

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  206  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  258



>gb|AFI57747.1| ethylene-responsive transcription factor ABR1 [Brassica juncea]
 gb|AGS47186.1| AP2/EREBP protein [Brassica juncea]
Length=381

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  185  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  237



>ref|XP_009333767.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Pyrus x bretschneideri]
Length=331

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYD+AALRFRGN+AKLNFPENVR
Sbjct  139  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDQAALRFRGNKAKLNFPENVR  191



>gb|KDO57153.1| hypothetical protein CISIN_1g020801mg [Citrus sinensis]
Length=320

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  143  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  195



>gb|KDO57152.1| hypothetical protein CISIN_1g020801mg [Citrus sinensis]
Length=321

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  144  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  196



>emb|CDY08853.1| BnaA06g23710D [Brassica napus]
Length=395

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  197  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  249



>ref|XP_004142046.1| PREDICTED: uncharacterized protein LOC101207587 [Cucumis sativus]
 ref|XP_004160502.1| PREDICTED: uncharacterized LOC101207587 [Cucumis sativus]
 gb|KGN48406.1| hypothetical protein Csa_6G486790 [Cucumis sativus]
Length=338

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE+AARAYDEAALRFRG++AKLNFPENVR
Sbjct  142  WGKWAAEIRDPYKAARVWLGTFDTAESAARAYDEAALRFRGSKAKLNFPENVR  194



>ref|XP_010444422.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Camelina sativa]
Length=401

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  197  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  249



>ref|XP_009150554.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Brassica 
rapa]
Length=395

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  197  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  249



>ref|XP_006427893.1| hypothetical protein CICLE_v10026052mg [Citrus clementina]
 gb|ESR41133.1| hypothetical protein CICLE_v10026052mg [Citrus clementina]
Length=331

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  154  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  206



>ref|XP_010484270.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Camelina sativa]
Length=404

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  199  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  251



>ref|XP_006357342.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Solanum tuberosum]
Length=396

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRG++AKLNFPENVR
Sbjct  165  WGKWAAEIRDPYKAARVWLGTFDTAEGAARAYDEAALRFRGSKAKLNFPENVR  217



>ref|XP_007221228.1| hypothetical protein PRUPE_ppa006595mg [Prunus persica]
 gb|EMJ22427.1| hypothetical protein PRUPE_ppa006595mg [Prunus persica]
Length=404

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 78/127 (61%), Gaps = 6/127 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYDEAALRFRGN+AKLNFPENVR   P   
Sbjct  202  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDEAALRFRGNKAKLNFPENVRLRTPIAD  261

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA----GDYLAYSQLL--QNPGDVHGQRPN  343
            + ++     A   +  S     +P   S A        + A   LL    P DV  Q+P 
Sbjct  262  SPVTQLTNSAPPNTLLSVATSTEPIVHSQAFQSMQHSSHEASRNLLGYCKPVDVQRQQPM  321

Query  344  SLLEQMF  364
            SL +QM 
Sbjct  322  SLYDQML  328



>emb|CDX81250.1| BnaC09g06610D [Brassica napus]
Length=403

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  205  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  257



>ref|XP_008440983.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Cucumis 
melo]
Length=339

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE+AARAYDEAALRFRG++AKLNFPENVR
Sbjct  142  WGKWAAEIRDPYKAARVWLGTFDTAESAARAYDEAALRFRGSKAKLNFPENVR  194



>ref|XP_006346730.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Solanum tuberosum]
Length=350

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDE AL+FRG++AKLNFPENVR
Sbjct  125  WGKWAAEIRDPYKAARVWLGTFDTAEDAARAYDETALKFRGSKAKLNFPENVR  177



>ref|XP_010540431.1| PREDICTED: ethylene-responsive transcription factor ERF112 [Tarenaya 
hassleriana]
Length=198

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA RFRGNRAKLNFPE +
Sbjct  93   WGKWAAEIRDPNKAARVWLGTFDTAEEAASAYDKAAFRFRGNRAKLNFPERI  144



>ref|XP_008368518.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Malus domestica]
Length=333

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYD+AALRFRGN+AKLNFPENVR
Sbjct  202  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDQAALRFRGNKAKLNFPENVR  254



>ref|XP_006394116.1| hypothetical protein EUTSA_v10004333mg [Eutrema salsugineum]
 gb|ESQ31402.1| hypothetical protein EUTSA_v10004333mg [Eutrema salsugineum]
Length=405

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  199  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  251



>ref|XP_006464861.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Citrus sinensis]
Length=360

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  183  WGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFPENVK  235



>emb|CDY31304.1| BnaA02g34370D [Brassica napus]
Length=381

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  191  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  243



>ref|XP_009130472.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Brassica rapa]
Length=379

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  190  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  242



>ref|XP_002864033.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40292.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=216

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  85   WGKWAAEIRDPHRAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  137



>emb|CDY46821.1| BnaC02g43290D [Brassica napus]
Length=382

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  192  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  244



>ref|XP_002864920.1| hypothetical protein ARALYDRAFT_496690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41179.1| hypothetical protein ARALYDRAFT_496690 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  194  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  246



>ref|XP_010442489.1| PREDICTED: ethylene-responsive transcription factor ERF110 isoform 
X2 [Camelina sativa]
Length=207

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  73   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  125



>ref|XP_004235847.1| PREDICTED: ethylene-responsive transcription factor ERF114 [Solanum 
lycopersicum]
Length=244

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAE AA AYDEAALRF+GN+AKLNFPE V+
Sbjct  90   WGKWAAEIRDPKKAARVWLGTFETAEGAALAYDEAALRFKGNKAKLNFPERVQ  142



>ref|XP_010442488.1| PREDICTED: ethylene-responsive transcription factor ERF110 isoform 
X1 [Camelina sativa]
Length=208

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  74   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  126



>ref|NP_201280.1| ethylene-responsive transcription factor ABR1 [Arabidopsis thaliana]
 sp|Q9FGF8.1|ABR1_ARATH RecName: Full=Ethylene-responsive transcription factor ABR1; 
AltName: Full=Protein ABA REPRESSOR 1 [Arabidopsis thaliana]
 dbj|BAB10308.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM98233.1| putative protein [Arabidopsis thaliana]
 gb|AAP37839.1| At5g64750 [Arabidopsis thaliana]
 gb|AED97946.1| ethylene-responsive transcription factor ABR1 [Arabidopsis thaliana]
Length=391

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  193  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  245



>ref|XP_006280583.1| hypothetical protein CARUB_v10026540mg [Capsella rubella]
 gb|EOA13481.1| hypothetical protein CARUB_v10026540mg [Capsella rubella]
Length=398

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  193  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  245



>ref|XP_004288079.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Fragaria vesca subsp. vesca]
Length=387

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAA+AYD AALRFRGN+AKLNFPENVR
Sbjct  199  WGKWAAEIRDPFKAARVWLGTFDTAEAAAQAYDTAALRFRGNKAKLNFPENVR  251



>dbj|BAJ94282.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=261

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 74/111 (67%), Gaps = 9/111 (8%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYD+AALRFRG+RAKLNFPE+ R  PP  A
Sbjct  46   WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDDAALRFRGSRAKLNFPEDARLHPPTVA  105

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQ  334
             A +     + +P+  +  A         + A DYL Y  LLQ+ G    Q
Sbjct  106  PAAAPIAAGSASPAVYTAGA---------SQASDYLRYQMLLQSRGAAANQ  147



>ref|XP_004237144.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Solanum lycopersicum]
Length=398

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDE AL+FRG++AKLNFPENVR
Sbjct  165  WGKWAAEIRDPYKAARVWLGTFDTAEDAARAYDETALKFRGSKAKLNFPENVR  217



>ref|XP_009342802.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Pyrus x bretschneideri]
Length=395

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYD+AALRFRGN+AKLNFPENVR
Sbjct  203  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDQAALRFRGNKAKLNFPENVR  255



>dbj|BAB10294.1| unnamed protein product [Arabidopsis thaliana]
Length=220

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  85   WGKWAAEIRDPHRAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  137



>ref|XP_009342801.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Pyrus x bretschneideri]
Length=396

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAA+AYD+AALRFRGN+AKLNFPENVR
Sbjct  204  WGKWAAEIRDPFKAARVWLGTFETAEAAAQAYDQAALRFRGNKAKLNFPENVR  256



>gb|AET34450.1| ethylene response factor 110 [Arabidopsis thaliana]
Length=229

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  94   WGKWAAEIRDPHRAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  146



>ref|XP_007137573.1| hypothetical protein PHAVU_009G137900g [Phaseolus vulgaris]
 gb|ESW09567.1| hypothetical protein PHAVU_009G137900g [Phaseolus vulgaris]
Length=296

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  134  WGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENV  185



>ref|XP_009405265.1| PREDICTED: ethylene-responsive transcription factor ERF037-like, 
partial [Musa acuminata subsp. malaccensis]
Length=304

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 76/121 (63%), Gaps = 14/121 (12%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAE+AARAYDEAALRFRGNRAKLNFPE+         
Sbjct  142  WGKWAAEIRDPHKAARVWLGTFDTAESAARAYDEAALRFRGNRAKLNFPEDA--------  193

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLLEQM  361
                     A A +  +  A L  S+   A+  DY  YS+LLQ   D  G  P +LL++ 
Sbjct  194  -----GVRQAPAAAPSAAPAALLESRPFDAMR-DYWEYSRLLQGAEDGRGMPPPALLDET  247

Query  362  F  364
             
Sbjct  248  V  248



>gb|KFK28164.1| hypothetical protein AALP_AA8G480800 [Arabis alpina]
Length=408

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+ AE+AARAYDEAALRFRGN+AKLNFPENV+
Sbjct  209  WGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNFPENVK  261



>ref|XP_010441531.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Camelina sativa]
Length=215

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  82   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  134



>ref|XP_010482313.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Camelina sativa]
Length=221

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  83   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  135



>ref|XP_010482311.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Camelina sativa]
Length=222

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  84   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  136



>ref|NP_199819.3| ethylene-responsive transcription factor ERF110 [Arabidopsis 
thaliana]
 sp|Q70II3.2|EF110_ARATH RecName: Full=Ethylene-responsive transcription factor ERF110 
[Arabidopsis thaliana]
 gb|AED95893.1| ethylene-responsive transcription factor ERF110 [Arabidopsis 
thaliana]
Length=220

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  85   WGKWAAEIRDPHRAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  137



>ref|XP_003630161.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AET04637.1| DNA-binding domain protein [Medicago truncatula]
Length=313

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTFETAE AA+AYD+A+LRFRGN+AKLNFPENV+
Sbjct  153  WGKWAAEIRDPFKATRVWLGTFETAEDAAKAYDQASLRFRGNKAKLNFPENVK  205



>ref|XP_010441540.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Camelina sativa]
Length=214

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  81   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  133



>ref|XP_006341471.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Solanum tuberosum]
Length=276

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAE AA AYDEAALRF+GN+AKLNFPE V+
Sbjct  98   WGKWAAEIRDPKKAARVWLGTFETAEGAALAYDEAALRFKGNKAKLNFPERVQ  150



>emb|CAE45640.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
Length=220

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPE+VR
Sbjct  85   WGKWAAEIRDPHRAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPEDVR  137



>ref|XP_008793923.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
isoform X1 [Phoenix dactylifera]
Length=368

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 74/126 (59%), Gaps = 21/126 (17%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WG+WAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+ R       
Sbjct  185  WGRWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDAR-------  237

Query  182  aaisasqlpanaPSQPSYQAHLQ---PSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLL  352
                        PS P   A      P+  S   + DYL YS L Q  G+     P SL 
Sbjct  238  -----------LPSTPPSAAPANSNSPATLSSDASRDYLEYSWLPQGLGEYRTLPPTSLS  286

Query  353  EQMFRS  370
            ++   S
Sbjct  287  DRSMYS  292



>ref|XP_008793924.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
isoform X2 [Phoenix dactylifera]
Length=366

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 74/126 (59%), Gaps = 21/126 (17%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WG+WAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+ R       
Sbjct  183  WGRWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDAR-------  235

Query  182  aaisasqlpanaPSQPSYQAHLQ---PSQGSPAVAGDYLAYSQLLQNPGDVHGQRPNSLL  352
                        PS P   A      P+  S   + DYL YS L Q  G+     P SL 
Sbjct  236  -----------LPSTPPSAAPANSNSPATLSSDASRDYLEYSWLPQGLGEYRTLPPTSLS  284

Query  353  EQMFRS  370
            ++   S
Sbjct  285  DRSMYS  290



>ref|XP_010413824.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Camelina sativa]
Length=216

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPEN+R
Sbjct  78   WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPENIR  130



>ref|XP_010485006.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Camelina sativa]
Length=169

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPE+VR
Sbjct  31   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPEDVR  83



>ref|NP_001174445.1| Os05g0437133 [Oryza sativa Japonica Group]
 dbj|BAH93173.1| Os05g0437133 [Oryza sativa Japonica Group]
Length=228

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  36   WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  88



>gb|AFK45569.1| unknown [Lotus japonicus]
Length=202

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAE AA AYD+AAL+FRG +AKLNFPE ++
Sbjct  61   WGKWAAEIRDPKKAARVWLGTFETAEDAATAYDKAALKFRGTKAKLNFPERIQ  113



>ref|XP_004162172.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Cucumis sativus]
Length=309

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 69/117 (59%), Gaps = 25/117 (21%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDPQKAARVWLGTF+TAEAAARAYD AALRFRG++AKLNFPE V        
Sbjct  142  WGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDGAALRFRGSKAKLNFPEFV--------  193

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA------GDYLAYSQLLQNPGDVHGQ  334
                        PS      HL     SP V       G+YL YS+LL N  +   Q
Sbjct  194  --------SVFPPSSLPSATHL---ASSPVVVPPQDAIGNYLQYSRLLPNSRETSSQ  239



>gb|KDP35295.1| hypothetical protein JCGZ_09454 [Jatropha curcas]
Length=284

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPENVR
Sbjct  102  WGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPENVR  154



>ref|XP_004138542.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Cucumis sativus]
 gb|KGN45887.1| hypothetical protein Csa_6G017030 [Cucumis sativus]
Length=310

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 69/117 (59%), Gaps = 25/117 (21%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDPQKAARVWLGTF+TAEAAARAYD AALRFRG++AKLNFPE V        
Sbjct  143  WGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDGAALRFRGSKAKLNFPEFV--------  194

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA------GDYLAYSQLLQNPGDVHGQ  334
                        PS      HL     SP V       G+YL YS+LL N  +   Q
Sbjct  195  --------SVFPPSSLPSATHL---ASSPVVVPPQDAIGNYLQYSRLLPNSRETSSQ  240



>gb|ACF84395.1| unknown [Zea mays]
 gb|AFU81612.1| AP2-EREBP-type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW81823.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=235

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  28   WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDAR  80



>ref|XP_009587769.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
isoform X2 [Nicotiana tomentosiformis]
Length=217

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP+KAARVWLGTFETAEAAA AYDEAALRF+GN+AKLNFPE V
Sbjct  104  WGKWAAEIRDPKKAARVWLGTFETAEAAAIAYDEAALRFKGNKAKLNFPERV  155



>ref|XP_010469440.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Camelina sativa]
Length=216

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPEN+R
Sbjct  78   WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPENIR  130



>gb|KHN09568.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=322

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  145  WGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENV  196



>ref|XP_009420504.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Musa acuminata subsp. malaccensis]
Length=339

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYD AALRFRG+RAKLNFPENV
Sbjct  189  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDAAALRFRGSRAKLNFPENV  240



>gb|ADJ67443.1| ethylene response factor 14 [Actinidia deliciosa]
Length=235

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAE AA AYDEAALRF+G +AKLNFPE V+
Sbjct  44   WGKWAAEIRDPKKAARVWLGTFETAEDAALAYDEAALRFKGTKAKLNFPEKVQ  96



>ref|XP_004242192.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Solanum lycopersicum]
Length=289

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTF TAE AA AYDEAAL+F+GN+AKLNFPE V+
Sbjct  108  WGKWAAEIRDPEKAARVWLGTFHTAEDAAIAYDEAALKFKGNKAKLNFPERVQ  160



>ref|XP_008674780.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Zea mays]
 tpg|DAA56652.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=357

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  153  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  205



>ref|XP_009587768.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
isoform X1 [Nicotiana tomentosiformis]
Length=309

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAEAAA AYDEAALRF+GN+AKLNFPE V+
Sbjct  104  WGKWAAEIRDPKKAARVWLGTFETAEAAAIAYDEAALRFKGNKAKLNFPERVQ  156



>ref|NP_001044918.1| Os01g0868000 [Oryza sativa Japonica Group]
 dbj|BAD81992.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF06832.1| Os01g0868000 [Oryza sativa Japonica Group]
 gb|EAY76621.1| hypothetical protein OsI_04572 [Oryza sativa Indica Group]
Length=351

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  138  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  190



>ref|XP_004503061.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Cicer arietinum]
Length=335

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  167  WGKWAAEIRDPFKAARVWLGTFETAEAAARAYDEAALRFRGNKAKLNFPENV  218



>dbj|BAJ99457.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 70/122 (57%), Gaps = 18/122 (15%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G +AKLNFPE V+       
Sbjct  57   WGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFPERVQ------G  110

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVA------------GDYLAYSQLLQNPGDV  325
                   +    P +   Q H   + G+PA+              D L Y+QLLQ  G  
Sbjct  111  RTDLGFVVTRGIPDRLQQQQHYPAAVGAPAMRPPLHQQQAVVPYPDLLRYAQLLQGAGSA  170

Query  326  HG  331
             G
Sbjct  171  GG  172



>gb|AGE97364.1| ethylene response factor 9 [Tamarix hispida]
Length=592

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPE+V
Sbjct  319  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPEDV  370



>ref|XP_006304255.1| hypothetical protein CARUB_v10010478mg [Capsella rubella]
 gb|EOA37153.1| hypothetical protein CARUB_v10010478mg [Capsella rubella]
Length=169

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KA RVWLGTFETAEAAARAYD AALRFRG++AKLNFPENV
Sbjct  68   WGKWAAEIRDPHKAMRVWLGTFETAEAAARAYDAAALRFRGSKAKLNFPENV  119



>gb|EYU21807.1| hypothetical protein MIMGU_mgv1a020102mg [Erythranthe guttata]
Length=290

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP+KAARVWLGTF++AE AA AYDEAALRF+GN+AKLNFPE V
Sbjct  96   WGKWAAEIRDPKKAARVWLGTFDSAEGAALAYDEAALRFKGNKAKLNFPERV  147



>gb|KGN62103.1| hypothetical protein Csa_2G297760 [Cucumis sativus]
Length=285

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +A RVWLGTF+TAEAAA AYDEAALRFRGN+AKLNFPENVR
Sbjct  155  WGKWAAEIRDPFRAVRVWLGTFDTAEAAAEAYDEAALRFRGNKAKLNFPENVR  207



>ref|XP_006581744.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Glycine max]
Length=254

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  77   WGKWAAEIRDPVEAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENV  128



>emb|CBI15759.3| unnamed protein product [Vitis vinifera]
Length=134

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYDEAALRF+GN+AKLNFPE V
Sbjct  65   WGKWAAEIRDPNKAARVWLGTFDTAEDAALAYDEAALRFKGNKAKLNFPERV  116



>ref|XP_010929690.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Elaeis 
guineensis]
Length=234

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G +AKLNFPE V+       
Sbjct  74   WGKWAAEIRDPKKAARVWLGTFDTAEQAAIAYDEAALRFKGTKAKLNFPERVQGRTDLGF  133

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQN  313
                        P  PS          + A   D L Y+QLLQ+
Sbjct  134  LLSRGIPERQPEPITPS----------AAATYPDLLQYAQLLQS  167



>ref|XP_011025557.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Populus euphratica]
Length=322

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRG++AKLNFPENV+
Sbjct  133  WGKWAAEIRDPMKAARVWLGTFDTPEAAARAYDEAALRFRGSKAKLNFPENVK  185



>gb|EMT21523.1| Ethylene-responsive transcription factor ERF113 [Aegilops tauschii]
Length=135

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G +AKLNFPE V
Sbjct  61   WGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFPERV  112



>ref|XP_003602514.1| Ethylene-responsive transcription factor ERF110 [Medicago truncatula]
 gb|AES72765.1| AP2 domain class transcription factor [Medicago truncatula]
Length=357

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  178  WGKWAAEIRDPFKAARVWLGTFETAEAAARAYDEAALRFRGNKAKLNFPENV  229



>gb|EYU31118.1| hypothetical protein MIMGU_mgv1a008130mg [Erythranthe guttata]
Length=384

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAA AYDEAALRFRGN+AKLNFPENV+
Sbjct  196  WGKWAAEIRDPYKAARVWLGTFDTAEAAAAAYDEAALRFRGNKAKLNFPENVK  248



>dbj|BAJ97081.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 73/106 (69%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYD+AALRFRG+RAKLNFPE+ R  PP  A
Sbjct  156  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDDAALRFRGSRAKLNFPEDARLHPPTVA  215

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPG  319
             A +     + +P+  +  A         + A DYL Y  LLQ+ G
Sbjct  216  PAAAPIAAGSASPAVYTAGA---------SQASDYLRYQMLLQSRG  252



>ref|XP_002307142.2| hypothetical protein POPTR_0005s08940g [Populus trichocarpa]
 gb|EEE94138.2| hypothetical protein POPTR_0005s08940g [Populus trichocarpa]
Length=322

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+
Sbjct  131  WGKWAAEIRDPFKACRVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVK  183



>ref|XP_003528031.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Glycine max]
Length=322

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP +AARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  145  WGKWAAEIRDPVEAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENV  196



>ref|XP_009780575.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Nicotiana 
sylvestris]
Length=290

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAEAAA AYDEAALRF+GN+AKLNFPE V+
Sbjct  102  WGKWAAEIRDPKKAARVWLGTFETAEAAAVAYDEAALRFKGNKAKLNFPEKVQ  154



>ref|NP_175008.1| ethylene-responsive transcription factor RAP2-6 [Arabidopsis 
thaliana]
 sp|Q7G1L2.2|RAP26_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-6; 
AltName: Full=Protein RELATED TO APETALA2 6 [Arabidopsis thaliana]
 gb|AAC36019.1| RAP2.6 [Arabidopsis thaliana]
 gb|AAL32925.1| RAP2.6 [Arabidopsis thaliana]
 gb|AAM47901.1| RAP2.6 [Arabidopsis thaliana]
 gb|AEE31950.1| ethylene-responsive transcription factor RAP2-6 [Arabidopsis 
thaliana]
Length=192

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KA RVWLGTFETAEAAARAYD AALRFRG++AKLNFPENV
Sbjct  69   WGKWAAEIRDPHKATRVWLGTFETAEAAARAYDAAALRFRGSKAKLNFPENV  120



>ref|XP_009407011.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Musa acuminata subsp. malaccensis]
Length=243

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF TAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  111  WGKWAAEIRDPHKAARVWLGTFTTAEAAARAYDEAALRFRGSRAKLNFPEDAR  163



>emb|CBH32584.1| F-box domain containing protein, expressed [Triticum aestivum]
Length=353

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYD+AALRFRG+RAKLNFPE+ R
Sbjct  127  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDDAALRFRGSRAKLNFPEDAR  179



>gb|EPS64637.1| hypothetical protein M569_10144 [Genlisea aurea]
Length=220

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAA AYD AALRFRG++AKLNFPENV+
Sbjct  93   WGKWAAEIRDPYKAARVWLGTFDTAEAAAMAYDVAALRFRGSKAKLNFPENVK  145



>dbj|BAJ97037.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 73/106 (69%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYD+AALRFRG+RAKLNFPE+ R  PP  A
Sbjct  156  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDDAALRFRGSRAKLNFPEDARLHPPTVA  215

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPG  319
             A +     + +P+  +  A         + A DYL Y  LLQ+ G
Sbjct  216  PAAAPIAAGSASPAVYTAGA---------SQASDYLRYQMLLQSRG  252



>ref|XP_010227136.1| PREDICTED: ethylene-responsive transcription factor ERF110 [Brachypodium 
distachyon]
Length=232

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDPQKAARVWLGTF TAE AARAYD AALRFRG+RAKLNFPE+ 
Sbjct  92   WGKWAAEIRDPQKAARVWLGTFATAEDAARAYDAAALRFRGSRAKLNFPEDA  143



>gb|AAC49772.1| AP2 domain containing protein RAP2.6 [Arabidopsis thaliana]
Length=164

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KA RVWLGTFETAEAAARAYD AALRFRG++AKLNFPENV
Sbjct  41   WGKWAAEIRDPHKATRVWLGTFETAEAAARAYDAAALRFRGSKAKLNFPENV  92



>ref|XP_010520153.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Tarenaya 
hassleriana]
Length=404

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+
Sbjct  187  WGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVK  239



>ref|XP_010527318.1| PREDICTED: ethylene-responsive transcription factor ERF110 [Tarenaya 
hassleriana]
Length=241

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYD AALRFRG +AKLNFPENV
Sbjct  101  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDSAALRFRGCKAKLNFPENV  152



>ref|XP_010546448.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Tarenaya hassleriana]
Length=377

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+
Sbjct  175  WGKWAAEIRDPFKAVRVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVK  227



>ref|XP_004970712.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Setaria italica]
Length=389

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  171  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  223



>gb|AFW78172.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05359.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=297

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  101  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  153



>ref|XP_008457918.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Cucumis melo]
Length=284

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP +A RVWLGTF+TAEAAA AYDEAALRFRGN+AKLNFPENVR
Sbjct  156  WGKWAAEIRDPFRAVRVWLGTFDTAEAAAEAYDEAALRFRGNKAKLNFPENVR  208



>gb|EAZ19774.1| hypothetical protein OsJ_35354 [Oryza sativa Japonica Group]
Length=286

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYD AALRFRG+RAKLNFPE+         
Sbjct  109  WGKWAAEIRDPHKAARVWLGTFDTAEDAARAYDGAALRFRGSRAKLNFPEHA----TLPP  164

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGD--YLAYSQLLQNPGDVHGQ  334
               + +      P  P   A L+  + SP   G   Y  Y++ LQ  G   G+
Sbjct  165  PPTTTTAAAHRCPPPPRTDALLESQELSPGAGGGDPYSQYARFLQGSGGDGGE  217



>ref|XP_009629925.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Nicotiana tomentosiformis]
Length=363

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYDEAAL+FRG++AKLNFPENV+
Sbjct  154  WGKWAAEIRDPYKAARVWLGTFDTAEDAAIAYDEAALKFRGSKAKLNFPENVK  206



>ref|XP_010025536.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Eucalyptus grandis]
 gb|KCW62231.1| hypothetical protein EUGRSUZ_H04892 [Eucalyptus grandis]
Length=282

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTFETAE AA+AYD AAL++RGN+AKLNFPENV
Sbjct  140  WGKWAAEIRDPVKAARVWLGTFETAEGAAQAYDVAALKYRGNKAKLNFPENV  191



>ref|XP_009390372.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Musa 
acuminata subsp. malaccensis]
Length=213

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTF+ AE AA AYDEAALRF+G +AKLNFPE V+
Sbjct  61   WGKWAAEIRDPKKAARVWLGTFDRAEDAAMAYDEAALRFKGTKAKLNFPERVQ  113



>gb|EAY98178.1| hypothetical protein OsI_20095 [Oryza sativa Indica Group]
Length=364

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  172  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  224



>ref|XP_009348875.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Pyrus x bretschneideri]
Length=366

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLG FETAEAAA+AYD+AALRFRGN+AKLNFPENVR
Sbjct  203  WGKWAAEIRDPFKAARVWLGPFETAEAAAQAYDQAALRFRGNKAKLNFPENVR  255



>emb|CDP12852.1| unnamed protein product [Coffea canephora]
Length=405

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV
Sbjct  190  WGKWAAEIRDPYKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENV  241



>ref|XP_008654680.1| PREDICTED: uncharacterized protein LOC100275504 isoform X1 [Zea 
mays]
Length=357

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  150  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGSRAKLNFPEDAR  202



>gb|ACO55953.1| RAP2-like protein [Juglans nigra]
Length=226

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAE AA AYD AALRF+G +AKLNFPE V+
Sbjct  66   WGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALRFKGTKAKLNFPERVQ  118



>ref|XP_010681129.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Beta vulgaris subsp. vulgaris]
Length=457

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE+AARAYDEAALRFRGNRAKLNFPE V+
Sbjct  229  WGKWAAEIRDPHKAARVWLGTFDTAESAARAYDEAALRFRGNRAKLNFPEFVQ  281



>ref|XP_011021971.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X3 [Populus euphratica]
Length=347

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+
Sbjct  157  WGKWAAEIRDPFKACRVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVK  209



>ref|XP_003523249.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Glycine 
max]
Length=281

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG++AKLNFPENV
Sbjct  144  WGKWAAEIRDPFKAARVWLGTFETAEAAARAYDEAALRFRGSKAKLNFPENV  195



>ref|XP_011021970.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Populus euphratica]
Length=349

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+
Sbjct  159  WGKWAAEIRDPFKACRVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVK  211



>ref|XP_011021969.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Populus euphratica]
Length=349

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KA RVWLGTF+TAEAAARAYDEAALRFRGN+AKLNFPENV+
Sbjct  159  WGKWAAEIRDPFKACRVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENVK  211



>emb|CDP18985.1| unnamed protein product [Coffea canephora]
Length=241

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP+KAARVWLGTF+ AE AA AYDEAALRF+G +AKLNFPE V
Sbjct  45   WGKWAAEIRDPKKAARVWLGTFDMAEDAALAYDEAALRFKGTKAKLNFPERV  96



>ref|XP_011086885.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X2 [Sesamum indicum]
Length=229

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G++AKLNFPE V+
Sbjct  44   WGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALRFKGSKAKLNFPERVQ  96



>ref|XP_007223939.1| hypothetical protein PRUPE_ppa011097mg [Prunus persica]
 gb|EMJ25138.1| hypothetical protein PRUPE_ppa011097mg [Prunus persica]
Length=224

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAE AA AYD AALRF+G +AKLNFPE V+
Sbjct  65   WGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALRFKGTKAKLNFPERVQ  117



>ref|XP_009130180.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Brassica rapa]
Length=254

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDPQKAARVWLGTFETAE+AA AYDEAAL+F+G++AKLNFPE V+
Sbjct  94   WGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSKAKLNFPERVQ  146



>ref|XP_002532770.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29609.1| DNA binding protein, putative [Ricinus communis]
Length=373

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRG++AKLNFPENV+
Sbjct  162  WGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFPENVK  214



>ref|XP_008463062.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Cucumis melo]
Length=313

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 73/132 (55%), Gaps = 25/132 (19%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDPQKAARVWLGTF+TAEAAARAYD AALRFRG++AKLNFPE V        
Sbjct  146  WGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDGAALRFRGSKAKLNFPELV--------  197

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAV------AGDYLAYSQLLQNPGDVHGQRPN  343
                        PS      HL     SP V       G+YL YS +  N  +   Q   
Sbjct  198  --------SVFPPSSLQSATHL---ASSPVVVPPQDAVGNYLQYSHMFPNSRETSSQAVP  246

Query  344  SLLEQMFRSSSM  379
            +    +  S+S+
Sbjct  247  AFERMLCNSTSV  258



>ref|XP_008356833.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Malus domestica]
Length=312

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTFETAEAAA +YDEAALRF+G++AKLNFPE V+
Sbjct  127  WGKWAAEIRDPKKAARVWLGTFETAEAAAISYDEAALRFKGSKAKLNFPERVQ  179



>ref|XP_010663806.1| PREDICTED: ethylene-responsive transcription factor ERF114, partial 
[Vitis vinifera]
Length=306

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYDEAALRF+GN+AKLNFPE V+
Sbjct  125  WGKWAAEIRDPNKAARVWLGTFDTAEDAALAYDEAALRFKGNKAKLNFPERVQ  177



>ref|XP_008791015.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Phoenix dactylifera]
Length=196

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVRslpppqa  181
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G +AKLNFPE V+       
Sbjct  36   WGKWAAEIRDPKKAARVWLGTFDTAEQAAIAYDEAALRFKGTKAKLNFPERVQGRTDLGF  95

Query  182  aaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQN  313
                        P  PS  A             D L Y+QLLQ+
Sbjct  96   LVSRGIPERPPEPITPSAAASYP----------DLLQYAQLLQS  129



>ref|XP_011086884.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X1 [Sesamum indicum]
Length=255

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G++AKLNFPE V+
Sbjct  70   WGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALRFKGSKAKLNFPERVQ  122



>ref|XP_003621630.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES77848.1| ethylene response factor [Medicago truncatula]
 gb|AFK38363.1| unknown [Medicago truncatula]
Length=176

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYD+AAL+F+G +AKLNFPE V
Sbjct  59   WGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAALKFKGTKAKLNFPERV  110



>ref|XP_010062103.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Eucalyptus grandis]
 gb|KCW69160.1| hypothetical protein EUGRSUZ_F02691 [Eucalyptus grandis]
Length=407

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 83/135 (61%), Gaps = 17/135 (13%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR-------  160
            WGKWAAEIRDP KAARVWLGTF+TAEAAARAYDEAALRFRGNRAKLNFPE  R       
Sbjct  170  WGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKLNFPELARLVQPMPQ  229

Query  161  --slpppqaaaisasqlpanaPSQPSYQAHLQPSQGSPAVAGDYLAYSQLLQNPGDVHGQ  334
              +         +A+ LP      P  Q    P QG+  V  DY  YS+LLQ        
Sbjct  230  GVTGLAAAIPRAAAAPLPPPRQPPPPPQGSYPPVQGT-DVFRDYWEYSRLLQG-------  281

Query  335  RPNSLLEQMFRSSSM  379
            +P++LLEQM  +S +
Sbjct  282  QPSNLLEQMMYTSQL  296



>ref|XP_006394454.1| hypothetical protein EUTSA_v10005416mg [Eutrema salsugineum]
 gb|ESQ31740.1| hypothetical protein EUTSA_v10005416mg [Eutrema salsugineum]
Length=246

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDPQKAARVWLGTFETAE+AA AYDEAAL+F+G++AKLNFPE V+
Sbjct  90   WGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSKAKLNFPERVQ  142



>ref|XP_008649697.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Zea mays]
Length=350

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTFETAEAAARAYDEAALRFRG+RAKLNFPE+ R
Sbjct  154  WGKWAAEIRDPHKAARVWLGTFETAEAAARAYDEAALRFRGSRAKLNFPEDAR  206



>ref|XP_002310625.2| hypothetical protein POPTR_0007s07090g [Populus trichocarpa]
 gb|EEE91075.2| hypothetical protein POPTR_0007s07090g [Populus trichocarpa]
Length=322

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+T EAAARAYDEAALRFRG++AKLNFPENV+
Sbjct  133  WGKWAAEIRDPIKAARVWLGTFDTPEAAARAYDEAALRFRGSKAKLNFPENVK  185



>ref|XP_011086886.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X3 [Sesamum indicum]
Length=215

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP+KAARVWLGTF+TAE AA AYDEAALRF+G++AKLNFPE V+
Sbjct  30   WGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALRFKGSKAKLNFPERVQ  82



>ref|XP_002881295.1| AP2 domain-containing transcription factor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH57554.1| AP2 domain-containing transcription factor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=218

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPE++R
Sbjct  78   WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPEHIR  130



>ref|XP_004237483.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Solanum lycopersicum]
Length=303

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDP KAARVWLGTF+TAE AARAYDEAAL FRG++AKLNFPENV
Sbjct  145  WGKWAAEIRDPYKAARVWLGTFDTAEGAARAYDEAALTFRGSKAKLNFPENV  196



>ref|NP_180927.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
 sp|P93007.1|EF112_ARATH RecName: Full=Ethylene-responsive transcription factor ERF112 
[Arabidopsis thaliana]
 gb|AAC69127.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAM97121.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAN15555.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEC08872.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
Length=218

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPE++R
Sbjct  78   WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPEHIR  130



>ref|XP_009150111.1| PREDICTED: ethylene-responsive transcription factor ERF114 [Brassica 
rapa]
Length=227

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENV  157
            WGKWAAEIRDPQKAARVWLGTFETAE+AA AYDEAAL+F+G++AKLNFPE V
Sbjct  90   WGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSKAKLNFPERV  141



>ref|NP_001189669.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
 gb|AEC08873.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
Length=231

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPE++R
Sbjct  78   WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPEHIR  130



>ref|XP_010513072.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Camelina sativa]
Length=337

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPEN+R
Sbjct  78   WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPENIR  130


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    WGKWAAEIRDPQKAARVWLGTFetaeaaaraydeaaLRFRGNRAKLNFPENVR  160
            WGKWAAEIRDP KAARVWLGTF+TAE AA AYD+AA  FRG++AKLNFPEN+R
Sbjct  200  WGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFPENIR  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1627375116822