BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29731_g1_i1 len=1183 path=[1161:0-1182]

Length=1183
                                                                      Score     E

ref|XP_009607404.1|  PREDICTED: expansin-A10-like                       344   2e-113   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             340   5e-112   
ref|XP_004246275.1|  PREDICTED: expansin-A10-like                       338   3e-111   
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        335   4e-110   
gb|EYU46016.1|  hypothetical protein MIMGU_mgv1a012336mg                335   5e-110   
gb|ABY65114.1|  putative expansin                                       334   7e-110   Gerbera hybrid cultivar
ref|XP_009762738.1|  PREDICTED: expansin-A10-like                       335   8e-110   
ref|XP_010108480.1|  hypothetical protein L484_010673                   334   1e-109   
gb|KHN40987.1|  Expansin-A8                                             333   1e-109   
ref|XP_002280300.1|  PREDICTED: expansin-A8                             333   3e-109   Vitis vinifera
dbj|BAC66696.1|  expansin                                               333   3e-109   Vitis labrusca x Vitis vinifera [Labruscan grape]
dbj|BAJ34927.1|  similar to expansin                                    333   4e-109   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             331   1e-108   
gb|ABF48653.1|  expansin precursor                                      331   3e-108   Vasconcellea cundinamarcensis
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             330   3e-108   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        330   3e-108   Mirabilis jalapa
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        330   3e-108   
ref|NP_001275780.1|  expansin 2 precursor                               330   3e-108   
gb|ABB59694.1|  alpha-expansin 2                                        330   3e-108   Gossypium hirsutum [American cotton]
gb|AAG13982.1|AF297521_1  expansin 1                                    330   5e-108   Prunus avium [gean]
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        330   6e-108   
ref|XP_006346675.1|  PREDICTED: expansin-A10-like                       330   7e-108   
ref|NP_001240113.1|  expansin precursor                                 329   7e-108   
ref|XP_010103644.1|  hypothetical protein L484_011237                   329   9e-108   
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         328   1e-107   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        328   2e-107   
ref|XP_010253098.1|  PREDICTED: expansin-A8-like                        328   2e-107   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             328   2e-107   
gb|AAC33529.1|  expansin                                                328   3e-107   Prunus armeniaca
dbj|BAJ10397.1|  alpha-expansin                                         328   4e-107   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        327   5e-107   
dbj|BAH36861.1|  alpha expansin                                         327   9e-107   Rosa hybrid cultivar
gb|AFK41150.1|  unknown                                                 327   9e-107   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        327   1e-106   
ref|NP_001289251.1|  expansin-A4-like precursor                         326   1e-106   
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        326   1e-106   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        326   1e-106   
gb|AAF35901.1|AF230332_1  expansin 2                                    325   2e-106   Zinnia violacea [garden zinnia]
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               326   2e-106   Ricinus communis
gb|ACK36942.1|  expansin                                                325   2e-106   Annona cherimola [cherimoya]
ref|XP_004294733.1|  PREDICTED: expansin-A8-like                        326   2e-106   
ref|NP_001281040.1|  expansin-A4-like precursor                         326   2e-106   
emb|CBI15823.3|  unnamed protein product                                325   2e-106   
gb|ACA05166.1|  expansin 3                                              325   2e-106   Dimocarpus longan [longan]
gb|ACK87022.1|  expansin                                                325   3e-106   Diospyros kaki [Japanese persimmon]
ref|XP_006842458.1|  hypothetical protein AMTR_s00077p00063420          325   3e-106   
gb|ACJ70084.1|  expansin                                                325   3e-106   Diospyros kaki [Japanese persimmon]
ref|XP_011011315.1|  PREDICTED: expansin-A8-like                        325   4e-106   
gb|ACK43884.1|  expansin                                                325   4e-106   Diospyros kaki [Japanese persimmon]
ref|XP_002276565.3|  PREDICTED: expansin-A4                             325   4e-106   Vitis vinifera
gb|ABO32366.1|  expansin                                                324   6e-106   Litchi chinensis [litchi]
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      324   7e-106   
gb|ACK43222.1|  expansin 2                                              324   9e-106   Ziziphus jujuba [Chinese jujube]
gb|AFK24457.1|  expansin 4                                              324   1e-105   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   324   1e-105   
ref|NP_001265970.1|  expansin-A8-like precursor                         324   1e-105   
gb|KEH35550.1|  expansin A10                                            323   2e-105   
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        323   2e-105   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        323   2e-105   
gb|ABM66452.1|  expansin                                                323   2e-105   Vicia faba [broad bean]
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             323   2e-105   Populus trichocarpa [western balsam poplar]
gb|KEH35551.1|  expansin A10                                            323   2e-105   
gb|ABC55453.1|  expansin protein                                        323   2e-105   Rosa x borboniana [Bourbon rose]
gb|AEN70870.1|  alpha-expansin 1                                        323   2e-105   
ref|XP_002323665.1|  expansin S1 precursor family protein               323   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       322   4e-105   
gb|AFK24458.1|  expansin 5                                              322   4e-105   
gb|AFK38068.1|  unknown                                                 322   8e-105   
gb|AEQ55270.1|  expansin                                                321   1e-104   
gb|AEN70867.1|  alpha-expansin 1                                        321   1e-104   
gb|AEN70883.1|  alpha-expansin 1                                        321   2e-104   
gb|AEN70869.1|  alpha-expansin 1                                        321   2e-104   
gb|ACK43886.1|  expansin                                                320   2e-104   Diospyros kaki [Japanese persimmon]
gb|ACX69842.1|  expansin                                                320   2e-104   
gb|AEN70868.1|  alpha-expansin 1                                        320   2e-104   
gb|AEN70887.1|  alpha-expansin 1                                        320   2e-104   
gb|AEQ55268.1|  expansin                                                320   3e-104   
ref|XP_004307732.1|  PREDICTED: expansin-A8-like                        320   3e-104   
gb|ACI02326.1|  expansion-related protein                               320   4e-104   Gladiolus grandiflorus
gb|AFZ78603.1|  expansin protein                                        320   4e-104   
ref|XP_002325925.2|  alpha-expansin 8 precursor family protein          320   4e-104   Populus trichocarpa [western balsam poplar]
gb|ACM90161.1|  expansin 3                                              320   4e-104   Pyrus pyrifolia [sha li]
ref|XP_010525408.1|  PREDICTED: expansin-A8                             320   5e-104   
gb|AEC03978.1|  expansin                                                320   5e-104   
dbj|BAD00014.1|  expansin                                               318   5e-104   Malus domestica [apple tree]
ref|XP_004138396.1|  PREDICTED: expansin-A8-like                        319   5e-104   
gb|AAP48991.1|  expansin                                                319   6e-104   Sambucus nigra
gb|KHG13406.1|  Expansin-A8 -like protein                               319   7e-104   
ref|XP_009384771.1|  PREDICTED: expansin-A2                             319   7e-104   
dbj|BAD00015.1|  expansin                                               318   7e-104   Malus domestica [apple tree]
ref|XP_010670609.1|  PREDICTED: expansin-A4                             319   8e-104   
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               319   9e-104   Ricinus communis
gb|ADN03964.1|  EXP1                                                    319   9e-104   
gb|KHG01029.1|  Expansin-A15 -like protein                              319   9e-104   
ref|XP_008456774.1|  PREDICTED: expansin-A8-like                        318   1e-103   
gb|AEN70875.1|  alpha-expansin 1                                        319   1e-103   
gb|ABR17119.1|  unknown                                                 319   1e-103   Picea sitchensis
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             319   1e-103   
gb|AEN70871.1|  alpha-expansin 1                                        319   1e-103   
gb|KHG27586.1|  Expansin-A8 -like protein                               318   1e-103   
gb|AEQ55284.1|  expansin                                                318   2e-103   
gb|KHG02505.1|  Expansin-A2                                             318   2e-103   
ref|XP_006411329.1|  hypothetical protein EUTSA_v10017120mg             318   2e-103   
gb|AEQ55269.1|  expansin                                                318   2e-103   
gb|KHG29916.1|  Expansin-A8 -like protein                               318   2e-103   
ref|XP_008363931.1|  PREDICTED: expansin-A4-like                        318   3e-103   
dbj|BAJ10398.1|  alpha-expansin                                         318   3e-103   
dbj|BAC67189.1|  expansin                                               318   3e-103   Pyrus communis
gb|ADY68811.1|  alpha-expansin 1                                        318   3e-103   
gb|ADY68810.1|  alpha-expansin 1                                        318   3e-103   
ref|NP_001289209.1|  expansin precursor                                 318   3e-103   
gb|AAM22621.1|  expansin 7 precursor                                    317   3e-103   Rumex palustris
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       317   3e-103   
ref|XP_008370248.1|  PREDICTED: expansin-A4-like                        317   4e-103   
gb|AEQ55272.1|  expansin                                                317   4e-103   
gb|ABD48785.1|  alpha-expansin 1                                        317   4e-103   Gossypium hirsutum [American cotton]
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        317   4e-103   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             317   5e-103   
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    317   5e-103   
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        317   5e-103   
ref|XP_006443365.1|  hypothetical protein CICLE_v10021887mg             317   6e-103   
ref|XP_010651411.1|  PREDICTED: expansin-A10                            317   7e-103   
ref|XP_008374794.1|  PREDICTED: expansin-A8-like                        317   7e-103   
ref|XP_007205756.1|  hypothetical protein PRUPE_ppa010260mg             317   8e-103   
gb|AAM47002.1|AF512544_1  alpha-expansin precursor                      316   8e-103   Gossypium hirsutum [American cotton]
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        317   8e-103   
gb|AAB40637.1|  expansin                                                316   9e-103   Pinus taeda
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        317   9e-103   
gb|AAL87025.1|  cell wall protein Exp1 precursor                        316   1e-102   Mirabilis jalapa
gb|AAM08930.1|  expansin 1                                              316   1e-102   Musa acuminata [banana]
ref|XP_011095130.1|  PREDICTED: expansin-A4-like                        317   1e-102   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        316   1e-102   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        316   1e-102   
ref|NP_001267550.1|  expansin-A8-like precursor                         316   1e-102   
ref|XP_003613849.1|  Expansin                                           316   1e-102   
emb|CDY14120.1|  BnaC02g02370D                                          316   1e-102   
gb|AAK48845.1|AF350936_1  expansin                                      316   1e-102   Prunus cerasus [pie cherry]
ref|XP_009346913.1|  PREDICTED: expansin-A4-like                        316   1e-102   
gb|AEE69072.1|  expansin-5                                              316   2e-102   
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       316   2e-102   
gb|ACD37706.1|  alpha expansin                                          316   2e-102   Gossypium hirsutum [American cotton]
ref|XP_006398992.1|  hypothetical protein EUTSA_v10015496mg             316   2e-102   
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        316   2e-102   
emb|CDP04049.1|  unnamed protein product                                315   2e-102   
emb|CDY23890.1|  BnaC04g01470D                                          315   2e-102   
gb|AAB40635.1|  expansin                                                315   2e-102   Pinus taeda
ref|XP_009387755.1|  PREDICTED: expansin-A2                             315   2e-102   
gb|AAD47901.1|AF085330_1  expansin                                      315   2e-102   Pinus taeda
gb|AEN70885.1|  alpha-expansin 1                                        315   2e-102   
dbj|BAC66697.1|  expansin                                               315   3e-102   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|KDO43109.1|  hypothetical protein CISIN_1g025809mg                   315   3e-102   
ref|XP_009142702.1|  PREDICTED: expansin-A8                             315   3e-102   
ref|XP_007137631.1|  hypothetical protein PHAVU_009G142800g             315   3e-102   
gb|ADC35366.1|  alpha-expansin 3                                        315   3e-102   Coffea arabica [arabica coffee]
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                315   3e-102   
ref|XP_009776279.1|  PREDICTED: expansin-A8-like isoform X1             315   4e-102   
ref|XP_003616026.1|  Expansin                                           315   4e-102   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        315   4e-102   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      315   4e-102   Gossypium hirsutum [American cotton]
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        315   4e-102   
gb|AEN70881.1|  alpha-expansin 1                                        315   5e-102   
gb|ABL86681.1|  EX4                                                     315   5e-102   Gossypium barbadense [Egyptian cotton]
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        315   5e-102   
ref|XP_009384320.1|  PREDICTED: expansin-A2-like                        314   6e-102   
gb|ABL86680.1|  EXA1                                                    315   6e-102   Gossypium barbadense [Egyptian cotton]
ref|NP_001240136.1|  expansin-A1-like precursor                         314   7e-102   
ref|XP_010093601.1|  hypothetical protein L484_006489                   314   7e-102   
gb|AAY43797.1|  expansin                                                314   7e-102   Gossypium hirsutum [American cotton]
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        314   8e-102   
ref|XP_008798561.1|  PREDICTED: expansin-A8-like                        314   8e-102   
gb|AFK34543.1|  unknown                                                 314   8e-102   
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        314   8e-102   
gb|AAO92741.1|  expansin                                                314   9e-102   Gossypium hirsutum [American cotton]
gb|KHN04238.1|  Expansin-A8                                             314   9e-102   
ref|XP_004240235.1|  PREDICTED: expansin-A8-like                        314   1e-101   
gb|KCW83632.1|  hypothetical protein EUGRSUZ_B00524                     313   1e-101   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        313   1e-101   
ref|XP_003538280.1|  PREDICTED: expansin-A8                             313   1e-101   
ref|XP_004502832.1|  PREDICTED: expansin-A8-like                        313   1e-101   
ref|XP_008446373.1|  PREDICTED: expansin-A1                             313   1e-101   
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       313   1e-101   
gb|ABR16833.1|  unknown                                                 313   2e-101   Picea sitchensis
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        313   2e-101   
ref|XP_008245002.1|  PREDICTED: expansin-A4-like                        313   2e-101   
ref|XP_010030057.1|  PREDICTED: expansin-A15-like                       313   2e-101   
ref|NP_001280181.1|  expansin-A8 precursor                              313   2e-101   
gb|AFB77225.1|  expansin 3                                              313   2e-101   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        313   2e-101   
gb|AAD49956.1|AF167360_1  expansin                                      313   2e-101   Rumex palustris
gb|AAM46998.1|AF512540_1  alpha-expansin precursor                      313   2e-101   Gossypium hirsutum [American cotton]
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        313   2e-101   
dbj|BAN09211.1|  alpha expansin                                         313   2e-101   
ref|XP_007099524.1|  Expansin A8, ALPHA 1.11,EXPA8                      313   2e-101   
ref|XP_008369371.1|  PREDICTED: expansin-A8                             313   2e-101   
ref|XP_009141922.1|  PREDICTED: expansin-A8-like                        313   2e-101   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             313   2e-101   
gb|ACA05165.1|  expansin 2                                              313   3e-101   Dimocarpus longan [longan]
emb|CDP13911.1|  unnamed protein product                                312   3e-101   
gb|AEQ55281.1|  expansin                                                312   3e-101   
gb|AAR82851.1|  expansin-3                                              312   3e-101   Petunia x hybrida [garden petunia]
gb|AAB40634.1|  expansin                                                312   3e-101   Pinus taeda
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       312   3e-101   
ref|XP_007011319.1|  Expansin A8, ALPHA 1.11,EXPA8                      313   3e-101   
gb|AAL87022.1|  cell wall protein EXP3 precursor                        313   3e-101   Mirabilis jalapa
ref|NP_001289231.1|  expansin precursor                                 313   3e-101   
gb|AAB81662.1|  expansin                                                312   3e-101   Oryza sativa Indica Group [Indian rice]
ref|NP_001055842.1|  Os05g0477600                                       312   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387743.1|  PREDICTED: expansin-A2-like                        312   3e-101   
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         312   3e-101   
ref|XP_003607738.1|  Expansin                                           313   3e-101   
gb|AAC39512.1|  expansin                                                312   4e-101   Gossypium hirsutum [American cotton]
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             312   4e-101   
gb|AAF32409.1|AF230276_1  alpha-expansin 3                              311   5e-101   Triphysaria versicolor
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        312   5e-101   
gb|AAC33530.1|  expansin                                                312   5e-101   Prunus armeniaca
gb|AEC46865.1|  expansin                                                312   5e-101   
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    312   5e-101   
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             311   5e-101   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       311   5e-101   
gb|AFK39658.1|  unknown                                                 312   5e-101   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             311   6e-101   
ref|XP_004302596.1|  PREDICTED: expansin-A2-like                        311   7e-101   
gb|KHN48407.1|  Expansin-A8                                             311   7e-101   
ref|XP_010937180.1|  PREDICTED: expansin-A10-like                       311   7e-101   
gb|AGF90536.1|  expansin 2                                              311   7e-101   
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          311   7e-101   
gb|AIG88581.1|  expansin                                                311   7e-101   
ref|XP_009399909.1|  PREDICTED: expansin-A2-like                        313   8e-101   
emb|CDY24897.1|  BnaC03g22750D                                          311   8e-101   
emb|CDY04946.1|  BnaAnng01280D                                          311   9e-101   
ref|XP_002518284.1|  Alpha-expansin 8 precursor, putative               311   1e-100   Ricinus communis
ref|NP_001242219.1|  uncharacterized protein LOC100777044 precursor     311   1e-100   
gb|KEH34458.1|  expansin A10                                            311   1e-100   
ref|XP_010543681.1|  PREDICTED: expansin-A2                             311   1e-100   
gb|ACJ84647.1|  unknown                                                 311   1e-100   Medicago truncatula
gb|KHG18125.1|  Expansin-A10 -like protein                              311   1e-100   
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          311   1e-100   Sorghum bicolor [broomcorn]
gb|ADC35364.1|  alpha-expansin 1                                        311   1e-100   Coffea arabica [arabica coffee]
ref|XP_002887242.1|  ATEXPA1                                            311   1e-100   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       310   1e-100   
gb|ACZ57921.1|  expansin protein 1                                      310   1e-100   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               310   1e-100   Ricinus communis
ref|XP_007137630.1|  hypothetical protein PHAVU_009G142800g             309   2e-100   
emb|CAN79985.1|  hypothetical protein VITISV_038036                     310   2e-100   Vitis vinifera
gb|AEQ55277.1|  expansin                                                310   2e-100   
ref|XP_010452431.1|  PREDICTED: expansin-A2                             311   2e-100   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             310   2e-100   
emb|CAH18934.1|  expansin                                               310   2e-100   Pyrus communis
ref|XP_010670610.1|  PREDICTED: expansin-A2-like                        310   2e-100   
ref|XP_008456949.1|  PREDICTED: expansin-A8-like                        310   2e-100   
gb|ACJ85313.1|  unknown                                                 310   2e-100   Medicago truncatula
ref|XP_007218849.1|  hypothetical protein PRUPE_ppa010382mg             310   2e-100   
gb|ABY55298.1|  expansin                                                310   2e-100   Prunus salicina [Japanese plum]
gb|KHG14727.1|  Expansin-A8 -like protein                               310   3e-100   
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         310   3e-100   
gb|AEQ28764.1|  expansin 1                                              310   3e-100   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             310   3e-100   
gb|AGF90535.1|  alpha-expansin 1                                        310   3e-100   
gb|AGU13763.1|  expansin                                                310   3e-100   
ref|XP_010423483.1|  PREDICTED: expansin-A2-like                        310   3e-100   
gb|KHN18562.1|  Expansin-A15                                            310   3e-100   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  310   3e-100   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  310   3e-100   
ref|NP_001105040.1|  alpha expansin1 precursor                          310   3e-100   Zea mays [maize]
ref|NP_001288831.1|  expansin precursor                                 310   3e-100   
gb|ABD98053.1|  cell wall protein Exp4 precursor                        310   3e-100   Striga asiatica [witchweed]
ref|NP_001288889.1|  expansin-A2-like precursor                         310   3e-100   
ref|XP_006438715.1|  hypothetical protein CICLE_v10032548mg             309   4e-100   
ref|XP_003564501.1|  PREDICTED: expansin-A2                             310   4e-100   
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        309   4e-100   
ref|XP_008783801.1|  PREDICTED: expansin-A10                            309   4e-100   
emb|CDM84787.1|  unnamed protein product                                309   5e-100   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             311   5e-100   
emb|CDP00351.1|  unnamed protein product                                312   5e-100   
ref|XP_009389577.1|  PREDICTED: expansin-A10-like                       309   6e-100   
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    309   6e-100   
ref|XP_010508833.1|  PREDICTED: expansin-A8-like                        309   7e-100   
ref|XP_010505810.1|  PREDICTED: expansin-A8-like                        309   7e-100   
gb|ACU14460.1|  unknown                                                 309   7e-100   Glycine max [soybeans]
gb|AAB40636.1|  expansin                                                308   7e-100   
ref|XP_010517501.1|  PREDICTED: expansin-A8                             309   8e-100   
gb|EYU20096.1|  hypothetical protein MIMGU_mgv1a012489mg                309   8e-100   
ref|XP_010108685.1|  hypothetical protein L484_015671                   308   8e-100   
ref|NP_196148.1|  expansin A2                                           309   9e-100   
emb|CDY44070.1|  BnaA02g14340D                                          308   1e-99    
ref|XP_007046062.1|  Expansin A1, ALPHA 1.2,EXPA1                       315   1e-99    
ref|NP_001288866.1|  expansin-A1 precursor                              308   1e-99    
ref|XP_007157607.1|  hypothetical protein PHAVU_002G083600g             308   1e-99    
ref|XP_006600699.1|  PREDICTED: expansin-A15-like isoform X2            308   1e-99    
ref|XP_002284858.1|  PREDICTED: expansin-A1                             308   1e-99    
ref|XP_009404081.1|  PREDICTED: expansin-A15                            308   1e-99    
emb|CDY40938.1|  BnaC06g30760D                                          308   1e-99    
ref|XP_009804397.1|  PREDICTED: expansin-A10                            309   1e-99    
ref|XP_010491065.1|  PREDICTED: expansin-A2-like                        308   1e-99    
gb|ADZ24272.1|  expansin                                                306   1e-99    
gb|AAM22622.1|AF428175_1  expansin 8 precursor                          308   2e-99    
ref|XP_002871148.1|  ATEXPA2                                            308   2e-99    
ref|XP_009390308.1|  PREDICTED: expansin-A10-like                       309   2e-99    
gb|AAR09170.1|  alpha-expansin 3                                        308   2e-99    
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             308   2e-99    
ref|XP_002881731.1|  ATEXPA8                                            308   2e-99    
gb|ABO30978.2|  alpha expansin protein 4                                307   2e-99    
ref|NP_177112.1|  expansin A1                                           308   2e-99    
gb|AAB38073.1|  expansin At-EXPA2                                       308   2e-99    
ref|XP_003549683.2|  PREDICTED: expansin-A15-like isoform X1            308   2e-99    
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         307   2e-99    
ref|NP_001266033.1|  expansin-A15-like precursor                        307   3e-99    
ref|NP_001117573.1|  expansin A1                                        308   3e-99    
emb|CDY71146.1|  BnaCnng71550D                                          307   3e-99    
emb|CDM84777.1|  unnamed protein product                                307   3e-99    
gb|AAB38070.1|  expansin At-EXPA1                                       306   3e-99    
ref|XP_009765412.1|  PREDICTED: expansin-A10                            307   3e-99    
ref|NP_849869.1|  expansin A1                                           308   3e-99    
ref|NP_181593.1|  expansin A8                                           307   4e-99    
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               307   4e-99    
ref|XP_002315043.1|  expansin 4 family protein                          307   4e-99    
ref|XP_010551434.1|  PREDICTED: expansin-A10 isoform X2                 307   4e-99    
gb|ABK25460.1|  unknown                                                 307   4e-99    
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     306   4e-99    
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        308   4e-99    
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              307   4e-99    
ref|XP_007146869.1|  hypothetical protein PHAVU_006G077200g             307   4e-99    
gb|KHN28805.1|  Expansin-A15                                            307   4e-99    
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             306   4e-99    
ref|XP_008802577.1|  PREDICTED: expansin-A10-like                       307   4e-99    
ref|XP_011021020.1|  PREDICTED: expansin-A8-like                        307   5e-99    
ref|XP_010551433.1|  PREDICTED: expansin-A10 isoform X1                 307   5e-99    
ref|XP_008367551.1|  PREDICTED: expansin-A1-like                        306   5e-99    
gb|KFK24949.1|  hypothetical protein AALP_AA8G047000                    307   5e-99    
gb|AAR09169.1|  alpha-expansin 2                                        306   5e-99    
gb|KFK41377.1|  hypothetical protein AALP_AA2G122700                    306   5e-99    
ref|XP_011075523.1|  PREDICTED: expansin-A10                            306   6e-99    
ref|XP_009631918.1|  PREDICTED: expansin-A4-like                        307   7e-99    
ref|XP_008393347.1|  PREDICTED: expansin-A1-like                        306   7e-99    
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       308   9e-99    
gb|KDP45714.1|  hypothetical protein JCGZ_17321                         306   9e-99    
ref|XP_006296492.1|  hypothetical protein CARUB_v10025678mg             306   9e-99    
gb|KEH33311.1|  expansin A10                                            306   9e-99    
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         306   9e-99    
gb|AFZ78600.1|  expansin protein                                        306   1e-98    
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        306   1e-98    
ref|XP_004961745.1|  PREDICTED: expansin-A4-like                        305   1e-98    
ref|NP_001238053.1|  uncharacterized protein LOC100527059 precursor     305   1e-98    
ref|XP_002319409.1|  expansin S1 precursor family protein               305   1e-98    
gb|ABR18394.1|  unknown                                                 305   1e-98    
gb|KDP31268.1|  hypothetical protein JCGZ_11644                         305   2e-98    
gb|ABI94216.1|  EXP2                                                    304   2e-98    
gb|ABW96607.1|  expansin 4                                              304   2e-98    
emb|CBI15209.3|  unnamed protein product                                307   2e-98    
gb|ABW96606.1|  expansin 3                                              303   2e-98    
gb|AAF32411.1|AF230278_1  alpha-expansin 1                              305   2e-98    
ref|XP_002312253.1|  expansin 4 family protein                          305   2e-98    
gb|AFK38404.1|  unknown                                                 305   2e-98    
ref|XP_003527088.1|  PREDICTED: expansin-A15-like                       305   2e-98    
ref|XP_002441263.1|  hypothetical protein SORBIDRAFT_09g023440          305   2e-98    
ref|XP_008374554.1|  PREDICTED: expansin-A1-like                        305   2e-98    
ref|XP_009122138.1|  PREDICTED: expansin-A2                             305   2e-98    
ref|XP_010921135.1|  PREDICTED: expansin-A8-like isoform X2             305   3e-98    
ref|XP_009369278.1|  PREDICTED: expansin-A1-like                        305   3e-98    
ref|XP_002272879.1|  PREDICTED: expansin-A10                            305   3e-98    
emb|CBI31944.3|  unnamed protein product                                304   3e-98    
ref|XP_007138173.1|  hypothetical protein PHAVU_009G186400g             305   3e-98    
ref|NP_001044656.1|  Os01g0823100                                       305   3e-98    
ref|XP_008780525.1|  PREDICTED: expansin-A15-like isoform X2            304   4e-98    
gb|AFB77224.1|  expansin 2                                              304   4e-98    
gb|AFK48363.1|  unknown                                                 304   4e-98    
ref|XP_010552569.1|  PREDICTED: expansin-A1-like                        304   5e-98    
ref|XP_008648280.1|  PREDICTED: alpha-expansin 5 isoform X1             304   5e-98    
ref|XP_004490713.1|  PREDICTED: expansin-A8-like                        304   5e-98    
gb|AFZ78604.1|  expansin protein                                        304   5e-98    
emb|CDX70161.1|  BnaA10g25100D                                          304   6e-98    
ref|XP_010670611.1|  PREDICTED: expansin-A10                            304   6e-98    
emb|CDX98831.1|  BnaC09g50040D                                          304   6e-98    
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        304   6e-98    
gb|AAR88517.1|  expansin A2                                             303   7e-98    
ref|XP_003568245.1|  PREDICTED: expansin-A4                             304   8e-98    
gb|AAM22623.1|AF428176_1  expansin 9 precursor                          301   8e-98    
gb|AEQ28765.1|  expansin 3                                              303   1e-97    
ref|XP_007030212.1|  Alpha-expansin 1 precursor                         306   1e-97    
ref|XP_009339059.1|  PREDICTED: expansin-A1-like                        303   1e-97    
gb|AAM22632.1|AF428185_1  expansin 18 precursor                         303   1e-97    
gb|EYU22406.1|  hypothetical protein MIMGU_mgv1a012585mg                303   2e-97    
gb|ABK22806.1|  unknown                                                 303   2e-97    
ref|XP_010527915.1|  PREDICTED: expansin-A15                            303   2e-97    
gb|AEQ55280.1|  expansin                                                302   2e-97    
gb|AAM22627.1|AF428180_1  expansin 13 precursor                         303   2e-97    
gb|AFQ21787.1|  EXP4 protein                                            303   2e-97    
ref|XP_009776281.1|  PREDICTED: expansin-A8-like isoform X2             301   2e-97    
gb|AAM22628.1|AF428181_1  expansin 14 precursor                         302   2e-97    
ref|XP_007226005.1|  hypothetical protein PRUPE_ppa010379mg             302   3e-97    
ref|XP_008221599.1|  PREDICTED: expansin-A1                             302   3e-97    
gb|AEQ55273.1|  expansin                                                302   3e-97    
ref|XP_002525458.1|  Alpha-expansin 15 precursor, putative              302   3e-97    
ref|XP_006289507.1|  hypothetical protein CARUB_v10003041mg             302   3e-97    
dbj|BAB32732.1|  expansin                                               301   3e-97    
gb|KHN26255.1|  Expansin-A15                                            301   4e-97    
gb|ACM90160.1|  expansin 2                                              302   4e-97    
ref|XP_003523015.1|  PREDICTED: expansin-A15-like                       301   4e-97    
gb|EYU42010.1|  hypothetical protein MIMGU_mgv1a013914mg                300   5e-97    
dbj|BAK05504.1|  predicted protein                                      301   5e-97    
gb|AAB38074.1|  expansin Os-EXPA2                                       301   5e-97    
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             302   6e-97    
ref|XP_010066900.1|  PREDICTED: expansin-A1                             301   6e-97    
ref|XP_009629442.1|  PREDICTED: expansin-A10-like                       301   6e-97    
ref|XP_004517024.1|  PREDICTED: expansin-A15-like                       301   6e-97    
gb|AAL40354.1|AF448467_1  alpha-expansin                                301   7e-97    
ref|XP_010032826.1|  PREDICTED: expansin-A10-like                       301   7e-97    
gb|AAG13983.1|AF297522_1  expansin 2                                    301   8e-97    
emb|CDP12277.1|  unnamed protein product                                301   8e-97    
gb|AAM08929.1|  expansin 2                                              299   9e-97    
ref|XP_004294932.1|  PREDICTED: expansin-A1-like                        301   9e-97    
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       301   1e-96    
gb|ABR04073.1|  expansin 1                                              301   1e-96    
ref|XP_010498998.1|  PREDICTED: expansin-A10-like isoform X2            301   1e-96    
gb|AEQ55278.1|  expansin                                                300   1e-96    
ref|XP_009409119.1|  PREDICTED: expansin-A10-like                       300   1e-96    
ref|XP_006365348.1|  PREDICTED: expansin-A8-like                        301   1e-96    
ref|XP_004297292.1|  PREDICTED: expansin-A1-like                        300   2e-96    
gb|ACK43223.1|  alpha-expansin                                          300   2e-96    
gb|KCW52314.1|  hypothetical protein EUGRSUZ_J01729                     302   2e-96    
dbj|BAJ99188.1|  predicted protein                                      300   2e-96    
gb|ABQ45887.1|  expansin                                                300   2e-96    
ref|XP_010498997.1|  PREDICTED: expansin-A10-like isoform X1            300   2e-96    
ref|XP_011017384.1|  PREDICTED: expansin-A1-like                        300   2e-96    
ref|XP_010690765.1|  PREDICTED: expansin-A4                             300   2e-96    
gb|KFK33492.1|  hypothetical protein AALP_AA5G020100                    300   2e-96    
dbj|BAC67192.1|  expansin                                               300   2e-96    
ref|XP_010477818.1|  PREDICTED: expansin-A10 isoform X2                 300   3e-96    
ref|XP_009360325.1|  PREDICTED: expansin-A1                             300   3e-96    
gb|AGR44457.1|  expansin 4                                              300   3e-96    
gb|AAT94292.1|  alpha-expansin EXPA2                                    300   3e-96    
ref|XP_011087233.1|  PREDICTED: expansin-A1-like                        300   3e-96    
ref|XP_006415956.1|  hypothetical protein EUTSA_v10008578mg             299   3e-96    
gb|AAW88315.1|  expansin EXPA11                                         300   3e-96    
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        300   3e-96    
gb|ABG49444.1|  expansin                                                300   4e-96    
ref|XP_010477817.1|  PREDICTED: expansin-A10 isoform X1                 300   4e-96    
ref|XP_008361782.1|  PREDICTED: expansin-A1-like                        300   4e-96    
emb|CDY06975.1|  BnaA04g23400D                                          314   4e-96    
gb|AAW88314.1|  expansin EXPA10                                         299   4e-96    
gb|AAR88519.1|  expansin A1                                             300   4e-96    
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       299   4e-96    
gb|ABA62612.1|  expansin                                                299   4e-96    
gb|AHZ41241.1|  EXPB1                                                   300   4e-96    
ref|NP_178409.2|  expansin A15                                          299   4e-96    
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       299   4e-96    
gb|ABJ90221.1|  expansin 2                                              299   4e-96    
ref|XP_002319704.2|  expansin S1 precursor family protein               299   5e-96    
ref|XP_010502317.1|  PREDICTED: expansin-A15                            299   5e-96    
emb|CDY45181.1|  BnaA06g33850D                                          299   5e-96    
gb|AAC32927.1|  putative expansin                                       299   5e-96    
ref|XP_002876856.1|  ATEXPA15                                           299   5e-96    
ref|XP_002297611.1|  expansin S1 precursor family protein               299   5e-96    
ref|XP_002269517.1|  PREDICTED: expansin-A10                            299   6e-96    
emb|CDP19176.1|  unnamed protein product                                298   7e-96    
dbj|BAC67191.1|  expansin                                               298   8e-96    
ref|XP_002981865.1|  hypothetical protein SELMODRAFT_179212             300   8e-96    
gb|AAQ08016.1|  expansin                                                298   1e-95    
ref|XP_006644922.1|  PREDICTED: expansin-A2-like                        298   1e-95    
ref|XP_008389456.1|  PREDICTED: expansin-A10                            298   1e-95    
ref|XP_011034337.1|  PREDICTED: expansin-A10-like                       298   1e-95    
gb|AAW88316.1|  expansin EXPA12                                         298   1e-95    
gb|ABW96605.1|  expansin 2                                              296   2e-95    
ref|NP_001266116.1|  expansin-A15-like precursor                        298   2e-95    
ref|NP_001234364.1|  expansin precursor                                 298   2e-95    
gb|EYU35820.1|  hypothetical protein MIMGU_mgv1a012373mg                298   2e-95    
ref|XP_006395739.1|  hypothetical protein EUTSA_v10004804mg             298   2e-95    
ref|XP_011084824.1|  PREDICTED: expansin-A2-like                        298   2e-95    
ref|XP_009115411.1|  PREDICTED: expansin-A10 isoform X2                 297   2e-95    
emb|CDX93168.1|  BnaC04g47280D                                          315   2e-95    
ref|XP_009406842.1|  PREDICTED: expansin-A15-like                       297   3e-95    
gb|AEX07594.1|  expansin 2                                              297   3e-95    
ref|XP_009115410.1|  PREDICTED: expansin-A10 isoform X1                 297   3e-95    
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                297   3e-95    
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       297   3e-95    
gb|ACB45302.1|  expansin EXPA11                                         297   3e-95    
ref|XP_003552173.1|  PREDICTED: expansin-A4                             297   4e-95    
emb|CAC06433.1|  expansin                                               296   4e-95    
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             297   5e-95    
gb|AAS48872.1|  expansin EXPA3                                          296   5e-95    
gb|AAR27327.1|  expansin EXPA1                                          296   5e-95    
ref|NP_001288907.1|  expansin-A15-like precursor                        296   5e-95    
emb|CDY03019.1|  BnaC07g22080D                                          296   5e-95    
ref|XP_010460264.1|  PREDICTED: expansin-A10-like                       296   6e-95    
emb|CDY24952.1|  BnaC03g22200D                                          296   7e-95    
gb|AAF35902.1|AF230333_1  expansin 3                                    296   7e-95    
gb|EPS67093.1|  hypothetical protein M569_07682                         296   7e-95    
ref|XP_009618705.1|  PREDICTED: expansin-A15-like                       296   8e-95    
ref|XP_010093144.1|  hypothetical protein L484_005152                   296   9e-95    
gb|AFZ78605.1|  expansin protein                                        295   1e-94    
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                296   1e-94    
ref|XP_002864447.1|  ATEXPA14                                           295   2e-94    
emb|CDY07024.1|  BnaA04g22910D                                          295   2e-94    
ref|NP_001242978.1|  expansin-A4-like precursor                         295   2e-94    
ref|XP_002283741.1|  PREDICTED: expansin-A10                            295   2e-94    
gb|ACT67493.1|  expansin A1                                             295   2e-94    
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        295   2e-94    
gb|AAU90318.1|  Alpha-expansin 1 precursor , putative                   295   2e-94    
ref|XP_011071693.1|  PREDICTED: expansin-A1-like                        295   2e-94    
gb|ABL09849.1|  expansin 1                                              295   2e-94    



>ref|XP_009607404.1| PREDICTED: expansin-A10-like [Nicotiana tomentosiformis]
Length=263

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 205/247 (83%), Gaps = 7/247 (3%)
 Frame = +3

Query  78   HFPF-FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            H PF F L L +C   SCG   +GG        W N HATFYGGADA+GTMGGACGYGNL
Sbjct  11   HLPFLFFLSLAICLQHSCGYSHNGGYS-----GWNNAHATFYGGADASGTMGGACGYGNL  65

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEE-ESRVCHPGSITVTATNFCPPNFALA  431
            YSQGYGTNTAALSTALFNSG SCG+CYELKCN   + R C  G ITVTATNFCPPN+ALA
Sbjct  66   YSQGYGTNTAALSTALFNSGLSCGSCYELKCNANADHRWCLAGIITVTATNFCPPNYALA  125

Query  432  NNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLL  611
            NN+GGWCNPPLQHFDLAEPAFL+IA YRAGIV V YRR+ C KKGGMRFTINGH+YFNL+
Sbjct  126  NNNGGWCNPPLQHFDLAEPAFLKIALYRAGIVPVLYRRVPCMKKGGMRFTINGHSYFNLV  185

Query  612  LITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNL  791
            LITNVGGAGDI SV IKGSRTGW  MSRNWGQNW++HSYLNGQSLSF+VTASDG+T+T+ 
Sbjct  186  LITNVGGAGDIRSVAIKGSRTGWQNMSRNWGQNWQSHSYLNGQSLSFKVTASDGKTITSY  245

Query  792  DVAPPDW  812
            +V P +W
Sbjct  246  NVVPANW  252



>ref|XP_003544930.1| PREDICTED: expansin-A8 [Glycine max]
 gb|KHN01887.1| Expansin-A8 [Glycine soja]
Length=254

 Score =   340 bits (872),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 207/245 (84%), Gaps = 5/245 (2%)
 Frame = +3

Query  78   HFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLY  257
            H   F LVLV+         FHG    +  G W+ GHATFYGG DA+GTMGGACGYGNLY
Sbjct  4    HASSFALVLVIFLFVE--MHFHGAT--ADYGGWQGGHATFYGGGDASGTMGGACGYGNLY  59

Query  258  SQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANN  437
            SQGYGTNTAALSTALFN+G SCGACYE++C +++ R C PG+I VTATNFCPPNFALANN
Sbjct  60   SQGYGTNTAALSTALFNNGLSCGACYEMRC-DDDPRWCKPGTIVVTATNFCPPNFALANN  118

Query  438  HGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLI  617
            +GGWCNPPLQHFD+AEPAFLQIAQYRAGIV VA+RR+ C KKGG+RFTINGH+YFNL+LI
Sbjct  119  NGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLI  178

Query  618  TNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDV  797
            TNV GAGD+ +V IKGSRT W PMSRNWGQNW+++SYLNGQSLSF+VTASDGRTVT+ +V
Sbjct  179  TNVAGAGDVHAVSIKGSRTSWQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNV  238

Query  798  APPDW  812
            AP DW
Sbjct  239  APSDW  243



>ref|XP_004246275.1| PREDICTED: expansin-A10-like [Solanum lycopersicum]
Length=255

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 204/252 (81%), Gaps = 9/252 (4%)
 Frame = +3

Query  60   FSMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggac  239
             ++E  H PF  LV + C   S     + G        WKN HATFYGG+DA+GTMGGAC
Sbjct  1    MAIEYHHLPFLFLVFLACVQHSYELGVYTG--------WKNAHATFYGGSDASGTMGGAC  52

Query  240  gYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCN-EEESRVCHPGSITVTATNFCPP  416
            GYGNLYSQGYGTNTAALST+LFNSG SCG+CYELKCN   + R C  G+ITVTATNFCPP
Sbjct  53   GYGNLYSQGYGTNTAALSTSLFNSGLSCGSCYELKCNVNADPRWCRRGTITVTATNFCPP  112

Query  417  NFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHA  596
            N+ALANN+GGWCNPPL+HFDLA+PAFL+IA YRAGIV V YRR+ C KKGGMRFTINGH+
Sbjct  113  NYALANNNGGWCNPPLRHFDLAQPAFLKIALYRAGIVPVIYRRVPCMKKGGMRFTINGHS  172

Query  597  YFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGR  776
            YFNL+LITNVGGAGDI SV IKGS+TGW  MSRNWGQNW++HSYLNGQSLSF+V ASDGR
Sbjct  173  YFNLVLITNVGGAGDIRSVSIKGSKTGWQKMSRNWGQNWQSHSYLNGQSLSFKVIASDGR  232

Query  777  TVTNLDVAPPDW  812
             VT  +VAP +W
Sbjct  233  IVTTYNVAPTNW  244



>ref|XP_003519289.1| PREDICTED: expansin-A8-like [Glycine max]
Length=254

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 178/245 (73%), Positives = 207/245 (84%), Gaps = 5/245 (2%)
 Frame = +3

Query  78   HFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLY  257
            H   F LVL++         FHG    +  G W+ GHATFYGG DA+GTMGGACGYGNLY
Sbjct  4    HASSFALVLLIFLFVE--MHFHGAT--ADYGGWQGGHATFYGGGDASGTMGGACGYGNLY  59

Query  258  SQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANN  437
            SQGYGTNTAALSTALFN+G SCGACY +KC +++ R C PG+I VTATNFCPPNFALANN
Sbjct  60   SQGYGTNTAALSTALFNNGLSCGACYAMKC-DDDPRWCKPGTIIVTATNFCPPNFALANN  118

Query  438  HGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLI  617
            +GGWCNPPLQHFD+AEPAFLQIAQYRAGIV VA+RR++C K+GG+RFTINGH+YFNL+LI
Sbjct  119  NGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVSCVKRGGIRFTINGHSYFNLVLI  178

Query  618  TNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDV  797
            TNV GAGD+ +V IKGSRT W PMSRNWGQNW+++SYLNGQSLSF+VTASDGRTVT+ +V
Sbjct  179  TNVAGAGDVHAVSIKGSRTSWQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNV  238

Query  798  APPDW  812
            AP +W
Sbjct  239  APSNW  243



>gb|EYU46016.1| hypothetical protein MIMGU_mgv1a012336mg [Erythranthe guttata]
Length=253

 Score =   335 bits (859),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 207/244 (85%), Gaps = 12/244 (5%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYS  260
            F FFIL L L FHS    +          G W+NGHATFYGG DA+GTMGGACGYGNLYS
Sbjct  11   FSFFILNL-LRFHSVEADY----------GGWENGHATFYGGGDASGTMGGACGYGNLYS  59

Query  261  QGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNH  440
            QGY TNTAALSTALFN+G +CGACYE++C E + + C  G+IT+TATNFCPPNFAL N++
Sbjct  60   QGYATNTAALSTALFNNGLTCGACYEMRC-ENDPKWCLSGTITITATNFCPPNFALPNDN  118

Query  441  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLIT  620
            GGWCNPPLQHFD+AEPAFLQIAQYRAGIV VA+RR+ C KKGG+RFTINGH+YFNL+LIT
Sbjct  119  GGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVPCMKKGGIRFTINGHSYFNLVLIT  178

Query  621  NVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVA  800
            NVGGAGDI ++ IKGS+TGW PMSRNWGQNW+++SYLNGQSLSF+VTASDGRT+T+ DVA
Sbjct  179  NVGGAGDIHALSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTITSYDVA  238

Query  801  PPDW  812
            P +W
Sbjct  239  PSNW  242



>gb|ABY65114.1| putative expansin [Gerbera hybrid cultivar]
Length=245

 Score =   334 bits (857),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 177/243 (73%), Positives = 206/243 (85%), Gaps = 13/243 (5%)
 Frame = +3

Query  84   PFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQ  263
            PF I+ L+LCF       FH      A GDW+ GHATFYGG DA+GTMGGACGYGNLYSQ
Sbjct  5    PFTIVTLLLCF-------FH-----LAHGDWQGGHATFYGGGDASGTMGGACGYGNLYSQ  52

Query  264  GYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHG  443
            GYGTNTAALSTALFN G SCG+CYE+KCN++  R C PG+I VTATNFCPPN  L+N++G
Sbjct  53   GYGTNTAALSTALFNDGLSCGSCYEMKCNDDP-RWCLPGTIIVTATNFCPPNPGLSNDNG  111

Query  444  GWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITN  623
            GWCNPPLQHFDLAEPAFLQIAQYRAGIV V+++R+ C KKGG+RFTINGH+YFNL+LITN
Sbjct  112  GWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFQRVPCAKKGGVRFTINGHSYFNLVLITN  171

Query  624  VGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAP  803
            VGGAGD+ +V IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VT SDGRT+T+ DVAP
Sbjct  172  VGGAGDVHAVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTITSNDVAP  231

Query  804  PDW  812
             +W
Sbjct  232  SNW  234



>ref|XP_009762738.1| PREDICTED: expansin-A10-like [Nicotiana sylvestris]
Length=263

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 179/237 (76%), Positives = 199/237 (84%), Gaps = 6/237 (3%)
 Frame = +3

Query  105  VLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTA  284
             +C   SCG   +GG        W N HATFYGGADA+GTMGGACGYGNLYSQGYGTNTA
Sbjct  21   AICLQHSCGYSHNGGHS-----GWNNAHATFYGGADASGTMGGACGYGNLYSQGYGTNTA  75

Query  285  ALSTALFNSGSSCGACYELKCN-EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPP  461
            ALSTALFNSG SCG+CYELKCN   E R C  G ITVTATNFCPPN+A ANN+GGWCNPP
Sbjct  76   ALSTALFNSGLSCGSCYELKCNVNAEHRWCLAGIITVTATNFCPPNYAPANNNGGWCNPP  135

Query  462  LQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGD  641
            LQHFDLAEPAFL+IA YRAGIV V YRR++C KKGGMRFTINGH+YFNL+LITNVGGAGD
Sbjct  136  LQHFDLAEPAFLKIALYRAGIVPVLYRRVSCRKKGGMRFTINGHSYFNLVLITNVGGAGD  195

Query  642  IDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            I SV IKGSRTGW  MSRNWGQNW++HSY NGQSLSF+VTAS+G+T+T+ +VAP +W
Sbjct  196  IRSVAIKGSRTGWQDMSRNWGQNWQSHSYFNGQSLSFKVTASNGKTITSYNVAPANW  252



>ref|XP_010108480.1| hypothetical protein L484_010673 [Morus notabilis]
 gb|EXC19542.1| hypothetical protein L484_010673 [Morus notabilis]
Length=254

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 203/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            F +L++ L  H +   +          G W+N HATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  13   FLMLIIKLQLHGTAANY----------GGWQNAHATFYGGGDASGTMGGACGYGNLYSQG  62

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G +CGACY+++CN +  R C PG+ITVTATNFCPPNFAL+NN+GG
Sbjct  63   YGTNTAALSTALFNNGLTCGACYQMRCNNDP-RWCLPGTITVTATNFCPPNFALSNNNGG  121

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQIAQYRAGIV V +RR+ C KKGG+RFTINGH+YFNL+LITNV
Sbjct  122  WCNPPLQHFDLAEPAFLQIAQYRAGIVPVVFRRVPCVKKGGIRFTINGHSYFNLVLITNV  181

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            G AGD+ +V IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VTASDGRTVT+ +VAP 
Sbjct  182  GSAGDVHAVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAPA  241

Query  807  DW  812
             W
Sbjct  242  GW  243



>gb|KHN40987.1| Expansin-A8 [Glycine soja]
Length=235

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 200/225 (89%), Gaps = 3/225 (1%)
 Frame = +3

Query  138  FHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGS  317
            FHG    +  G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G 
Sbjct  3    FHGAT--ADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  60

Query  318  SCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFL  497
            SCGACY +KC +++ R C PG+I VTATNFCPPNFALANN+GGWCNPPLQHFD+AEPAFL
Sbjct  61   SCGACYAMKC-DDDPRWCKPGTIIVTATNFCPPNFALANNNGGWCNPPLQHFDMAEPAFL  119

Query  498  QIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG  677
            QIAQYRAGIV VA+RR++C K+GG+RFTINGH+YFNL+LITNV GAGD+ +V IKGSRT 
Sbjct  120  QIAQYRAGIVPVAFRRVSCVKRGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTS  179

Query  678  WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            W PMSRNWGQNW+++SYLNGQSLSF+VTASDGRTVT+ +VAP +W
Sbjct  180  WQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAPSNW  224



>ref|XP_002280300.1| PREDICTED: expansin-A8 [Vitis vinifera]
 dbj|BAC66695.1| expansin [Vitis labrusca x Vitis vinifera]
 emb|CAN70346.1| hypothetical protein VITISV_012578 [Vitis vinifera]
 emb|CBI25362.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGACYE+KC
Sbjct  28   GGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYEMKC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL+N +GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  88   NDDP-KWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW PMSRNWGQ
Sbjct  147  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VTASDGRT+T+L+VAP  W
Sbjct  207  NWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGW  241



>dbj|BAC66696.1| expansin [Vitis labrusca x Vitis vinifera]
Length=252

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGACYE+KC
Sbjct  28   GGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYEMKC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL+N +GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  88   NDDP-KWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW PMSRNWGQ
Sbjct  147  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VTASDGRT+T+L+VAP  W
Sbjct  207  NWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGW  241



>dbj|BAJ34927.1| similar to expansin [Vitis hybrid cultivar]
Length=252

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGACYE+KC
Sbjct  28   GGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYEMKC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL+N +GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  88   NDDP-KWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW PMSRNWGQ
Sbjct  147  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VTASDGRT+T+L+VAP  W
Sbjct  207  NWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGW  241



>ref|XP_006435913.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
 gb|ESR49153.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
Length=254

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 203/242 (84%), Gaps = 10/242 (4%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
              + VL  CF  + G +          G W++GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  12   LLLFVLNFCFRGTFGDY---------GGGWQSGHATFYGGGDASGTMGGACGYGNLYSQG  62

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE+KC E + + C PGSI VTATNFCPPN AL+N++GG
Sbjct  63   YGTNTAALSTALFNNGLSCGSCYEMKC-ENDPKWCLPGSIIVTATNFCPPNLALSNDNGG  121

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQYRAGIV +++RRI C KKGG+RFT+NGH+YFNL+L+TNV
Sbjct  122  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLVTNV  181

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VTASDGRTVT+ +V P 
Sbjct  182  GGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSNNVVPA  241

Query  807  DW  812
            +W
Sbjct  242  NW  243



>gb|ABF48653.1| expansin precursor [Vasconcellea cundinamarcensis]
Length=258

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  31   GGWENAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMQC  90

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C PGSITVTATNFCPPNFAL+NN+GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  91   NDDP-RWCLPGSITVTATNFCPPNFALSNNNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  149

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR++C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW  MSRNWGQ
Sbjct  150  PVVFRRVSCAKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQAMSRNWGQ  209

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNG SLSF+VT SDGRTVT+ +VAP +W
Sbjct  210  NWQSNSYLNGHSLSFQVTTSDGRTVTSYNVAPANW  244



>ref|XP_007142047.1| hypothetical protein PHAVU_008G248000g [Phaseolus vulgaris]
 gb|ESW14041.1| hypothetical protein PHAVU_008G248000g [Phaseolus vulgaris]
Length=251

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 206/242 (85%), Gaps = 5/242 (2%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            FF+L++++  H +     H     +  G W+ GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  4    FFVLLILIFIHVN----MHLKTAFADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQG  59

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCGAC+E++C +++ R C  G+I VTATNFCPPNFAL NN+GG
Sbjct  60   YGTNTAALSTALFNNGLSCGACFEMRC-DDDPRWCKAGTIVVTATNFCPPNFALPNNNGG  118

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQYRAGIV VA+RR++C KKGG+RFTINGH+YFNL+LITNV
Sbjct  119  WCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVSCVKKGGIRFTINGHSYFNLVLITNV  178

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD+ +V IKGSRT W PMSRNWGQNW+++SYLNGQSLSF++TASDGRT+T  +VAP 
Sbjct  179  AGAGDVHAVSIKGSRTSWQPMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTLTAFNVAPD  238

Query  807  DW  812
            +W
Sbjct  239  NW  240



>gb|AAL87023.1| cell wall protein Exp4 precursor [Mirabilis jalapa]
Length=252

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 204/245 (83%), Gaps = 6/245 (2%)
 Frame = +3

Query  78   HFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLY  257
            ++P     LV+  H      +  G +    G W   HATFYGG DA+GTMGGACGYGNLY
Sbjct  3    YYPTLFTTLVIVIH-----VWFAGVNAGYDGGWTTAHATFYGGGDASGTMGGACGYGNLY  57

Query  258  SQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANN  437
            SQGYGTNTAALSTALFN+G SCG+CYE+KCN++  + C PGSI VTATNFCPPN+ALANN
Sbjct  58   SQGYGTNTAALSTALFNNGLSCGSCYEMKCNDDP-KWCRPGSIVVTATNFCPPNYALANN  116

Query  438  HGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLI  617
            +GGWCNPPLQHFD+A+PAFLQIAQYRAGIV +++RR+ C KKGG+RFT+NGH+YFNL+L+
Sbjct  117  NGGWCNPPLQHFDMAQPAFLQIAQYRAGIVPISFRRVPCAKKGGIRFTVNGHSYFNLVLV  176

Query  618  TNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDV  797
            TNV GAGD+ +V IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VTASDGRTVT+ ++
Sbjct  177  TNVAGAGDVHAVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSNNI  236

Query  798  APPDW  812
            AP +W
Sbjct  237  APANW  241



>ref|XP_010252076.1| PREDICTED: expansin-A8-like [Nelumbo nucifera]
Length=253

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE+KC
Sbjct  29   GGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEMKC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG+ITVTATNFCPPNFALAN++GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  89   NDDP-KWCLPGTITVTATNFCPPNFALANDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGSRTGW  MSRNWGQ
Sbjct  148  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQAMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRT+T+ +VAP  W
Sbjct  208  NWQSNSYLNGQTLSFQVTTSDGRTITSYNVAPAGW  242



>ref|NP_001275780.1| expansin 2 precursor [Citrus sinensis]
 gb|ACN87961.1| expansin 2 [Citrus sinensis]
 gb|KDO42952.1| hypothetical protein CISIN_1g025347mg [Citrus sinensis]
Length=254

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 203/242 (84%), Gaps = 10/242 (4%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
              + VL  CF  + G +          G W++GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  12   LLLFVLNFCFRGTFGDY---------GGGWQSGHATFYGGGDASGTMGGACGYGNLYSQG  62

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE+KC E + + C PGSI VTATNFCPPN AL+N++GG
Sbjct  63   YGTNTAALSTALFNNGLSCGSCYEMKC-ENDPKWCLPGSIIVTATNFCPPNLALSNDNGG  121

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQYRAGIV +++RRI C KKGG+RFT+NGH+YFNL+LITNV
Sbjct  122  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNV  181

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF++TASDGRTVT+ +V P 
Sbjct  182  GGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPG  241

Query  807  DW  812
            +W
Sbjct  242  NW  243



>gb|ABB59694.1| alpha-expansin 2 [Gossypium hirsutum]
Length=252

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 202/242 (83%), Gaps = 10/242 (4%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            F + V   C   + G +          G W+ GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  10   FLLFVFGFCLRGAFGDYV---------GGWQGGHATFYGGGDASGTMGGACGYGNLYSQG  60

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE++C + + + C PGSITVTATNFCPPN AL+N++GG
Sbjct  61   YGTNTAALSTALFNNGLSCGSCYEMRC-DSDPKWCLPGSITVTATNFCPPNLALSNDNGG  119

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR+ C KKGG+RFTINGH+YFNL+LITNV
Sbjct  120  WCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLITNV  179

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VT SDGRTVT+ +VAP 
Sbjct  180  GGAGDVHSVSIKGSKTGWQSMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPG  239

Query  807  DW  812
            +W
Sbjct  240  NW  241



>gb|AAG13982.1|AF297521_1 expansin 1 [Prunus avium]
 gb|AAK48846.1|AF350937_1 expansin [Prunus cerasus]
Length=254

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTVTN +VAP +W
Sbjct  209  NWQSNTYLNGQSLSFQVTTSDGRTVTNYNVAPGNW  243



>ref|XP_010031088.1| PREDICTED: expansin-A8-like [Eucalyptus grandis]
 gb|KCW50355.1| hypothetical protein EUGRSUZ_J00120 [Eucalyptus grandis]
Length=249

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 206/249 (83%), Gaps = 11/249 (4%)
 Frame = +3

Query  66   MENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgY  245
            M NF     + ++ LC  S+ G +          G W+ GHATFYGG DA+GTMGGACGY
Sbjct  1    MANFAAISAVALVFLCLKSAFGDY----------GGWEGGHATFYGGGDASGTMGGACGY  50

Query  246  GNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFA  425
            GNLYSQGYGTNTAALSTALFN+G SCGACYE++CN++  R C PG+I VTATNFCPPN A
Sbjct  51   GNLYSQGYGTNTAALSTALFNNGLSCGACYEMRCNDDP-RWCLPGTIMVTATNFCPPNLA  109

Query  426  LANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFN  605
            L+N++GGWCNPPLQHFD+AEPAFLQIAQY+AGIV V++RR+ C KKGG+RFTINGH+YFN
Sbjct  110  LSNDNGGWCNPPLQHFDMAEPAFLQIAQYKAGIVPVSFRRVPCVKKGGVRFTINGHSYFN  169

Query  606  LLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVT  785
            L+LITNVGGAGD+ SV IKGSRTGW  MSRNWGQNW++++Y+NGQ+LSF+VT SDGRTVT
Sbjct  170  LVLITNVGGAGDVHSVSIKGSRTGWQAMSRNWGQNWQSNAYMNGQALSFQVTTSDGRTVT  229

Query  786  NLDVAPPDW  812
            + + AP +W
Sbjct  230  SYNAAPANW  238



>ref|XP_006346675.1| PREDICTED: expansin-A10-like [Solanum tuberosum]
Length=256

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 190/214 (89%), Gaps = 1/214 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCN-  350
            WKN HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALST LFNSG SCG+CYELKCN 
Sbjct  32   WKNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTVLFNSGLSCGSCYELKCNV  91

Query  351  EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVA  530
              + R C  G+ITVTATNFCPPN+ALANN+GGWCNPPL+HFDLA+PAFL+IA YRAGIV 
Sbjct  92   NADRRWCLRGTITVTATNFCPPNYALANNNGGWCNPPLRHFDLAQPAFLKIALYRAGIVP  151

Query  531  VAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQN  710
            V YRR+ C KKGGMRFTINGH+Y NL+LITNVGGAGDI SV IKGS+TGW  MSRNWGQN
Sbjct  152  VIYRRVPCMKKGGMRFTINGHSYSNLVLITNVGGAGDIQSVSIKGSKTGWQKMSRNWGQN  211

Query  711  WEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            W++HSYLNGQSLSF+V ASDGR VT  +VAPP+W
Sbjct  212  WQSHSYLNGQSLSFKVIASDGRIVTTYNVAPPNW  245



>ref|NP_001240113.1| expansin precursor [Glycine max]
 gb|ACU19992.1| unknown [Glycine max]
 gb|KHN25812.1| Expansin-A8 [Glycine soja]
Length=250

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC
Sbjct  26   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGSCYEMKC  85

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PGSI VTATNFCPPNFALANN+GGWCNPPLQHFDLAEPAFLQIAQY+AGIV
Sbjct  86   -DTDPKWCLPGSIIVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYKAGIV  144

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  145  PVSFRRVSCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQTMSRNWGQ  204

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ ++ P +W
Sbjct  205  NWQSNSYLNGQSLSFQVTTSDGRTLTSNNIVPANW  239



>ref|XP_010103644.1| hypothetical protein L484_011237 [Morus notabilis]
 gb|EXB96527.1| hypothetical protein L484_011237 [Morus notabilis]
Length=253

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALST+LFN+G SCGACYE++C
Sbjct  29   GGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNNGLSCGACYEMRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PGSITVTATNFCPPNFAL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  89   -DNDPKWCLPGSITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGDI SV IKGS+TGW  MSRNWGQ
Sbjct  148  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDIHSVSIKGSKTGWQSMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+  VAP  W
Sbjct  208  NWQSNSYLNGQSLSFQVTLSDGRTITSNSVAPAGW  242



>gb|KDP21654.1| hypothetical protein JCGZ_03325 [Jatropha curcas]
Length=252

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 203/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
              + VL LCF  + G +          G W++GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  11   LLLFVLNLCFRGTYGDY----------GGWQSGHATFYGGGDASGTMGGACGYGNLYSQG  60

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFNSG SCG+CYE++C + + + C PGSI VTATNFCPPN+ALAN++GG
Sbjct  61   YGTNTAALSTALFNSGLSCGSCYEMRC-DNDPKWCLPGSIIVTATNFCPPNYALANDNGG  119

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQYRAGIV +++RR+ C KKGG+RFTINGH+YFNL+LI+NV
Sbjct  120  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLISNV  179

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MSRNWGQNW+++ YLNGQSLSF+VT SDG+TVT+ +V P 
Sbjct  180  GGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNGYLNGQSLSFQVTTSDGKTVTSYNVVPS  239

Query  807  DW  812
            +W
Sbjct  240  NW  241



>ref|XP_003523276.1| PREDICTED: expansin-A8-like [Glycine max]
Length=250

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC
Sbjct  26   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGSCYEMKC  85

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PGSI VTATNFCPPNFALANN+GGWCNPPLQHFDLAEPAFLQIAQY+AGIV
Sbjct  86   -DTDPKWCLPGSIIVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYKAGIV  144

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  145  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQTMSRNWGQ  204

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ ++ P +W
Sbjct  205  NWQSNSYLNGQSLSFQVTTSDGRTLTSNNIVPANW  239



>ref|XP_010253098.1| PREDICTED: expansin-A8-like [Nelumbo nucifera]
Length=254

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W  GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE++C
Sbjct  30   GGWIAGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGFSCGACYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG+ITVTATNFCPPNFAL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NDDP-KWCLPGTITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGS+TGW  MSRNWGQ
Sbjct  149  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQSMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT+ +VAP  W
Sbjct  209  NWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPAGW  243



>ref|XP_007205762.1| hypothetical protein PRUPE_ppa010314mg [Prunus persica]
 gb|EMJ06961.1| hypothetical protein PRUPE_ppa010314mg [Prunus persica]
Length=254

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  209  NWQSNTYLNGQSLSFQVTTSDGRTVTSYNVAPGNW  243



>gb|AAC33529.1| expansin [Prunus armeniaca]
Length=254

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  209  NWQSNNYLNGQSLSFQVTTSDGRTVTSYNVAPGNW  243



>dbj|BAJ10397.1| alpha-expansin [Dianthus caryophyllus]
Length=254

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 211/253 (83%), Gaps = 11/253 (4%)
 Frame = +3

Query  57   LFSMENFHFPFFILVL-VLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmgg  233
            + S + F   F++LV   LCF +          + +  G W N HATFYGG DA+GTMGG
Sbjct  1    MASSQTFVAIFYLLVASTLCFTA---------VNANYGGGWTNAHATFYGGGDASGTMGG  51

Query  234  acgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCP  413
            ACGYGNLYSQGYGT+TAALSTALFNSG SCG+CYE+KCN++  + C+PGSI VTATNFCP
Sbjct  52   ACGYGNLYSQGYGTSTAALSTALFNSGLSCGSCYEIKCNDDP-KWCNPGSIIVTATNFCP  110

Query  414  PNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGH  593
            PN+ALANN+GGWCNPPLQHFDLAEP++L+IAQYRAGIV V++RR+AC +KGG+RFTINGH
Sbjct  111  PNYALANNNGGWCNPPLQHFDLAEPSYLKIAQYRAGIVPVSFRRVACLRKGGIRFTINGH  170

Query  594  AYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDG  773
            +YFNL+LITNV GAGD+ +V IKGS+TGW  MSRNWGQNW+++SYLNGQ+LSF+VT+SDG
Sbjct  171  SYFNLVLITNVAGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNSYLNGQTLSFKVTSSDG  230

Query  774  RTVTNLDVAPPDW  812
            RTVT+ ++ P +W
Sbjct  231  RTVTSNNIVPGNW  243



>ref|XP_008242138.1| PREDICTED: expansin-A8-like [Prunus mume]
Length=254

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTVT+  VAP +W
Sbjct  209  NWQSNNYLNGQSLSFQVTTSDGRTVTSYSVAPGNW  243



>dbj|BAH36861.1| alpha expansin [Rosa hybrid cultivar]
Length=253

 Score =   327 bits (837),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W  GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE++C
Sbjct  29   GGWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PGSI VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  89   -DNDPRWCRPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  148  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQSMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ LSF+VT SDGRTVT+ +VAP +W
Sbjct  208  NWQSNSYLNGQLLSFQVTTSDGRTVTSYNVAPGNW  242



>gb|AFK41150.1| unknown [Lotus japonicus]
Length=254

 Score =   327 bits (837),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             +++ R C PGSI VTATNFCPPN +LANN+GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  90   -DDDPRWCKPGSIIVTATNFCPPNPSLANNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YF+L+LITNVGGAGD+ S  IKGSR+GW PMSRNWGQ
Sbjct  149  PVAFRRVPCAKKGGIRFTINGHSYFSLVLITNVGGAGDVHSASIKGSRSGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRTVT+++VAP +W
Sbjct  209  NWQSNSYLNGQALSFQVTTSDGRTVTSINVAPANW  243



>ref|XP_008354429.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=254

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   -DNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  209  NWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNW  243



>ref|NP_001289251.1| expansin-A4-like precursor [Pyrus x bretschneideri]
 dbj|BAC67190.1| expansin [Pyrus communis]
 gb|AGR44456.1| expansin 3 [Pyrus x bretschneideri]
Length=254

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   -DNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  209  NWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNW  243



>ref|XP_011080662.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=253

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W NGHATFYGG+DA+GTMGGACGYGNLYSQGYGTNT ALSTALFN+G +CGACYE++C
Sbjct  29   GGWDNGHATFYGGSDASGTMGGACGYGNLYSQGYGTNTVALSTALFNNGLTCGACYEMRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + + C PG+ITVTATNFCPPNFAL NN GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  89   -ANDPKWCLPGTITVTATNFCPPNFALPNNDGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR+ C KKGG+RFTING+ YFNL+LITNVGGAGD+ +V IKGSRTGW PMSRNWGQ
Sbjct  148  PVVFRRVPCVKKGGIRFTINGNLYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYL+GQSLSF+VT SDGRT+T+ +VAP DW
Sbjct  208  NWQSNSYLHGQSLSFQVTTSDGRTLTSYNVAPSDW  242



>ref|XP_009374380.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=254

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+ C
Sbjct  30   GSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMMC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  209  NWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNW  243



>gb|AAF35901.1|AF230332_1 expansin 2 [Zinnia violacea]
Length=245

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+NGHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  21   GGWENGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  80

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PGSI VTATNFCPPN  L+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  81   NDDP-KWCLPGSIVVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  139

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             ++++R+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSRNWGQ
Sbjct  140  PISFQRVPCVKKGGVRFTINGHSYFNLILITNVGGAGDVHSVSIKGSKTGWQSMSRNWGQ  199

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ +VAP +W
Sbjct  200  NWQSNSYLNGQSLSFQVTTSDGRTITSYNVAPSNW  234



>ref|XP_002520863.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
 gb|EEF41572.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
Length=252

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCG+CYE++C
Sbjct  28   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEMRC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PG+ITVTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  88   -DNDPKWCLPGTITVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RRI C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGS+TGW  MSRNWGQ
Sbjct  147  PVSFRRIPCAKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQTMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SY+NGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  207  NWQSNSYMNGQSLSFQVTTSDGRTVTSYNVAPANW  241



>gb|ACK36942.1| expansin [Annona cherimola]
Length=248

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = +3

Query  162  APGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYEL  341
            A   W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+
Sbjct  22   ADSGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEM  81

Query  342  KCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAG  521
            +CN++  R C PG+ITVTAT FCPPNFALANN+GGWCNPPLQHFDLAEPAFLQIAQYRAG
Sbjct  82   RCNDDP-RWCLPGTITVTATYFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYRAG  140

Query  522  IVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNW  701
            IV V++RR+ C KKGG+RFTINGH+YFNL+L+TNV GAGD+ SV IKGS+TGW  MSRNW
Sbjct  141  IVPVSFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVHSVSIKGSKTGWRAMSRNW  200

Query  702  GQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            GQNW+++SYLNGQSLSF+VT SDGRTVT+ +V P  W
Sbjct  201  GQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVVPAGW  237



>ref|XP_004294733.1| PREDICTED: expansin-A8-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W  GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE++C
Sbjct  29   GGWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PGSI VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  89   -DNDPRWCRPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  148  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQSMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  208  NWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNW  242



>ref|NP_001281040.1| expansin-A4-like precursor [Malus domestica]
 gb|AAM08928.1| expansin 1 [Malus domestica]
Length=254

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+ TMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+ C
Sbjct  30   GSWEGVHATFYGGGDASATMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMMC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  209  NWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNW  243



>emb|CBI15823.3| unnamed protein product [Vitis vinifera]
Length=233

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 189/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGAC+E++C +
Sbjct  11   WEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEMRC-D  69

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + R C PGSITVTATNFCPPNFALANN+GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  70   NDPRWCLPGSITVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  129

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            A+RR+ C KKGG+RFTINGH YF L+L+TNV GAGDI SV IKGSRTGW  MSRNWGQNW
Sbjct  130  AFRRVPCAKKGGIRFTINGHKYFILVLVTNVAGAGDIHSVSIKGSRTGWQTMSRNWGQNW  189

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++S LNGQSLSF VTA DGRTVT+ +VAP  W
Sbjct  190  QSNSVLNGQSLSFMVTAGDGRTVTSFNVAPSGW  222



>gb|ACA05166.1| expansin 3 [Dimocarpus longan]
Length=253

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 204/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
             F +++ LC  +  G      +D    G W++GHATFYGG DA+GTMGGACGYGNLY QG
Sbjct  12   LFFMLISLCLQAVYG------DD----GGWQSGHATFYGGGDASGTMGGACGYGNLYGQG  61

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE+KC +++ + C PGS+ VTATNFCPPN ALAN++GG
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMKC-DKDPKWCLPGSVIVTATNFCPPNNALANDNGG  120

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQYRAGIV +++RR+ C KKGG+RFT+NGH+YFNL+LITNV
Sbjct  121  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTVNGHSYFNLVLITNV  180

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD+ SV IKGS+TGW PMSRNWGQNW+++SYLNGQSLSF+VT SDG+TVT+ +V P 
Sbjct  181  AGAGDVHSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTSYNVVPA  240

Query  807  DW  812
            +W
Sbjct  241  NW  242



>gb|ACK87022.1| expansin [Diospyros kaki]
Length=254

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGT TAALSTALFN+G SCGACYELKC
Sbjct  30   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYELKC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++ +R C PG+ITVTATNFCPPN +L N++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV
Sbjct  90   NDD-ARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+++R+ C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V +KGSRTGW PMSRNWGQ
Sbjct  149  PVSFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF++TASDGRTVT+ +VAP +W
Sbjct  209  NWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNW  243



>ref|XP_006842458.1| hypothetical protein AMTR_s00077p00063420 [Amborella trichopoda]
 gb|ERN04133.1| hypothetical protein AMTR_s00077p00063420 [Amborella trichopoda]
Length=253

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+ GHATFYGG DATGTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE++CN+
Sbjct  31   WQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRCND  90

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            +  R C PGSI VTATNFCPPN  L+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  91   DP-RWCLPGSIVVTATNFCPPNLGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  149

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            A+RRI C KKGG+RFTINGH+YFNL+LITNVGGAGDI +V IKGS  GW PMSRNWGQNW
Sbjct  150  AFRRIPCVKKGGIRFTINGHSYFNLVLITNVGGAGDIHAVSIKGSNGGWQPMSRNWGQNW  209

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  210  QSNSYLNGQSLSFQVTTSDGRTVTSYNVAPSNW  242



>gb|ACJ70084.1| expansin [Diospyros kaki]
Length=254

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGT TAALSTALFN+G SCGACYELKC
Sbjct  30   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYELKC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++ +R C PG+ITVTATNFCPPN +L N++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV
Sbjct  90   NDD-ARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+++R+ C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V +KGSRTGW PMSRNWGQ
Sbjct  149  PVSFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF++TASDGRTVT+ +VAP +W
Sbjct  209  NWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNW  243



>ref|XP_011011315.1| PREDICTED: expansin-A8-like [Populus euphratica]
Length=254

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 203/250 (81%), Gaps = 11/250 (4%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M++F F    LVL    H   G +          G W+ GHATFYGG+DA+GTMGGACG
Sbjct  5    AMQDFVFVQLYLVLSFLLHGIYGDY----------GGWQVGHATFYGGSDASGTMGGACG  54

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGT+TAALSTALFN+G SCGAC++++CN    + CH G+ITVTATNFCPPN+
Sbjct  55   YGNLYSQGYGTSTAALSTALFNNGLSCGACFQIRCNNSP-KWCHSGTITVTATNFCPPNY  113

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL+N++GGWCNPPLQHFDLA+PAFLQIAQYRAGIV V +RR+ C KKGG+RFTINGH+YF
Sbjct  114  ALSNDNGGWCNPPLQHFDLAQPAFLQIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYF  173

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            NL+LITNV GAGD+ +V IKGSRTGW  MSRNWGQNW+++SYLNGQ LSFRVT SDG+TV
Sbjct  174  NLVLITNVAGAGDVHAVSIKGSRTGWQTMSRNWGQNWQSNSYLNGQGLSFRVTTSDGKTV  233

Query  783  TNLDVAPPDW  812
            T  +V PP W
Sbjct  234  TCYNVVPPYW  243



>gb|ACK43884.1| expansin [Diospyros kaki]
 gb|ACK43885.1| expansin [Diospyros kaki]
Length=254

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGT TAALSTALFN+G SCGACYELKC
Sbjct  30   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYELKC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++ +R C PG+ITVTATNFCPPN +L N++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV
Sbjct  90   NDD-ARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+++R+ C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V +KGSRTGW PMSRNWGQ
Sbjct  149  PVSFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF++TASDGRTVT+ +VAP +W
Sbjct  209  NWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNW  243



>ref|XP_002276565.3| PREDICTED: expansin-A4 [Vitis vinifera]
Length=253

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 189/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGAC+E++C +
Sbjct  31   WEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEMRC-D  89

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + R C PGSITVTATNFCPPNFALANN+GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  90   NDPRWCLPGSITVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  149

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            A+RR+ C KKGG+RFTINGH YF L+L+TNV GAGDI SV IKGSRTGW  MSRNWGQNW
Sbjct  150  AFRRVPCAKKGGIRFTINGHKYFILVLVTNVAGAGDIHSVSIKGSRTGWQTMSRNWGQNW  209

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++S LNGQSLSF VTA DGRTVT+ +VAP  W
Sbjct  210  QSNSVLNGQSLSFMVTAGDGRTVTSFNVAPSGW  242



>gb|ABO32366.1| expansin [Litchi chinensis]
Length=253

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 204/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
             F +++ LC     G +   G+D    G W++GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  12   LFSMLISLCLQ---GVY---GDD----GGWQSGHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE+KC  +  + C PGS+ VTATNFCPPN ALAN++GG
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMKCGNDP-KWCLPGSVIVTATNFCPPNNALANDNGG  120

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQYRAGIV +++RR+ C KKGG+RFT+NGH+YFNL+LITNV
Sbjct  121  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTVNGHSYFNLVLITNV  180

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD+ SV IKGS+TGW PMSRNWGQNW+++SYLNGQSLSF+VT SDG+TVT+ +V P 
Sbjct  181  AGAGDVHSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTSYNVVPD  240

Query  807  DW  812
            +W
Sbjct  241  NW  242



>ref|XP_007017076.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
 gb|EOY34695.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
Length=254

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+N HATFYGG DA+GTMGGACGYGNLYSQGYGT TAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTKTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C  G+ITVTATNFCPPNFAL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NDDP-KWCLSGTITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR+ C KKGG+RFTINGH+YFNL+LITNVGG GD+ +V IKGS+TGW PMSRNWGQ
Sbjct  149  PVVFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGEGDVHAVSIKGSKTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ LSF+VT SDG+TVT+ +V P DW
Sbjct  209  NWQSNSYLNGQGLSFQVTTSDGQTVTSYNVVPADW  243



>gb|ACK43222.1| expansin 2 [Ziziphus jujuba]
Length=259

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 204/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
                VL LC     GTF   G++    G W+ GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  18   LLFCVLNLCLR---GTF---GDN----GGWQGGHATFYGGGDASGTMGGACGYGNLYSQG  67

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE++C + + + C PGSI VTATNFCPPNFAL+N++GG
Sbjct  68   YGTNTAALSTALFNNGLSCGSCYEMRC-DSDPKWCLPGSILVTATNFCPPNFALSNDNGG  126

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQIAQY+AGIV +++RR+ C KKGG+RFTINGH+YFNL+LITNV
Sbjct  127  WCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCVKKGGVRFTINGHSYFNLVLITNV  186

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VT SDGRT+T+ +V P 
Sbjct  187  GGAGDVHSVSIKGSKTGWQTMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSYNVVPA  246

Query  807  DW  812
            +W
Sbjct  247  NW  248



>gb|AFK24457.1| expansin 4 [Ziziphus jujuba]
Length=253

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 204/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
                VL LC     GTF   G++    G W+ GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  12   LLFCVLNLCLR---GTF---GDN----GGWQGGHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE++C + + + C PGSI VTATNFCPPNFAL+N++GG
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMRC-DSDPKWCLPGSILVTATNFCPPNFALSNDNGG  120

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQIAQY+AGIV +++RR+ C KKGG+RFTINGH+YFNL+LITNV
Sbjct  121  WCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCVKKGGVRFTINGHSYFNLVLITNV  180

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MS+NWGQNW+++SYLNGQSLSF+VT SDGRT+T+ +V P 
Sbjct  181  GGAGDVHSVSIKGSKTGWQTMSKNWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSYNVVPA  240

Query  807  DW  812
            +W
Sbjct  241  NW  242



>gb|KDO49685.1| hypothetical protein CISIN_1g025193mg [Citrus sinensis]
Length=256

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 205/250 (82%), Gaps = 11/250 (4%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M+NF F      + +  H+  G +          G W+  HATFYGG+DA+GTMGGACG
Sbjct  7    AMKNFPFLVLFFFISIFVHAINGDY----------GGWQIAHATFYGGSDASGTMGGACG  56

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGTNTAALSTALFN+G SCGACYE++C   + + C PG+ITVTATNFCPPN+
Sbjct  57   YGNLYSQGYGTNTAALSTALFNNGLSCGACYEIRC-ANDPQWCLPGTITVTATNFCPPNY  115

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL+N++GGWCNPPLQHFDLA+P+FL IAQYRAGIV V +RR+ C KKGG+RFTINGH+YF
Sbjct  116  ALSNDNGGWCNPPLQHFDLAQPSFLHIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYF  175

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            NL+LITNVGGAGD+ +VFIKGS+TGW  MSRNWGQNW+++SYL+GQSLSF+VT SDGRT+
Sbjct  176  NLVLITNVGGAGDVKAVFIKGSKTGWQAMSRNWGQNWQSNSYLDGQSLSFKVTTSDGRTI  235

Query  783  TNLDVAPPDW  812
            T+ +V P +W
Sbjct  236  TSYNVVPANW  245



>ref|NP_001265970.1| expansin-A8-like precursor [Cicer arietinum]
 emb|CAC19184.1| alpha-expansin [Cicer arietinum]
Length=260

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  36   GGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  95

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C PGSI VTATNFCPPN +LANN+GGWCNPPLQHFD+AEPAFLQIA+YRAGIV
Sbjct  96   NDDP-RWCKPGSIIVTATNFCPPNPSLANNNGGWCNPPLQHFDMAEPAFLQIAEYRAGIV  154

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+L+TNVGGAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  155  PVSFRRVPCMKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSRTGWQSMSRNWGQ  214

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ LSF+VT SDGRT+T+ +VAP +W
Sbjct  215  NWQSNSYLNGQPLSFQVTTSDGRTMTSYNVAPSNW  249



>gb|KEH35550.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 199/242 (82%), Gaps = 10/242 (4%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
                VL LC   + G +          G W+N HATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  11   ILFFVLSLCLRGTFGDY---------GGGWENAHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE+KCN +  + C PGSI VTATNFCPPNFA +N +GG
Sbjct  62   YGTNTAALSTALFNNGLSCGSCYEMKCNSDP-KWCLPGSILVTATNFCPPNFAESNTNGG  120

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQIAQY+AGIV +++RR+ C KKGG+RFTINGH+YFNL+L+TNV
Sbjct  121  WCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLVTNV  180

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGS+TGW  MSRNWGQNW++++YLNGQSLSF+VT SDGRT+T+ +V P 
Sbjct  181  GGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNVVPG  240

Query  807  DW  812
            +W
Sbjct  241  NW  242



>ref|XP_011089527.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=249

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 203/242 (84%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            F I+ L+L  H++   +          G W++ HATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  8    FAIISLLLQLHAAVADY----------GAWESAHATFYGGGDASGTMGGACGYGNLYSQG  57

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G +CGACY+++C + + + C PG+ITVTATNFCPPN+AL NN+GG
Sbjct  58   YGTNTAALSTALFNNGLTCGACYQVRC-DNDPQWCLPGTITVTATNFCPPNYALPNNNGG  116

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+A+PAFLQIA+YRAGIV VA+RR+ C KKGG+RFTINGH+YFNL+LITNV
Sbjct  117  WCNPPLQHFDMAQPAFLQIARYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNV  176

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD+ +V IKGSRTGW  MSRNWGQNW+++SYLN QSLSF+VT SDGRTVTN +VAP 
Sbjct  177  AGAGDVHAVSIKGSRTGWQRMSRNWGQNWQSNSYLNAQSLSFQVTTSDGRTVTNYNVAPS  236

Query  807  DW  812
            +W
Sbjct  237  NW  238



>ref|XP_011019014.1| PREDICTED: expansin-A8-like [Populus euphratica]
Length=254

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 205/250 (82%), Gaps = 11/250 (4%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M+   F    LV  L F  +CG            G W+ GHATFYGG+DA+GTMGGACG
Sbjct  5    AMQFSVFLQLFLVFSLLFQGTCGD----------RGGWQMGHATFYGGSDASGTMGGACG  54

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGT+TAALSTALFN+G SCGAC++++CN +  + CH  +ITVTATNFCPPN+
Sbjct  55   YGNLYSQGYGTSTAALSTALFNNGLSCGACFQIRCNNDP-KWCHSSTITVTATNFCPPNY  113

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL+N++GGWCNPPLQHFDLA+PAFL+IAQYRAGIV V +RR+ C KKGG+RFTINGH+YF
Sbjct  114  ALSNDNGGWCNPPLQHFDLAQPAFLKIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYF  173

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            NL+LITNV GAGD+ +V +KGSRTGW  MSRNWGQ+W+++SYLNGQSLSFRVTASDGRTV
Sbjct  174  NLVLITNVAGAGDVHAVSVKGSRTGWQAMSRNWGQDWQSNSYLNGQSLSFRVTASDGRTV  233

Query  783  TNLDVAPPDW  812
            T+ ++ P +W
Sbjct  234  TSYNIVPANW  243



>gb|ABM66452.1| expansin [Vicia faba]
Length=254

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C PGSI VTATNFCPPN A ANN GGWCNPPLQHFD+AEPAFLQIA+YRAGIV
Sbjct  90   NDDP-RWCKPGSIIVTATNFCPPNPAQANNDGGWCNPPLQHFDMAEPAFLQIAEYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YF+L+L+TNVGGAGD+ S+ IKGSRT W PMSRNWGQ
Sbjct  149  PVSFRRVPCFKKGGVRFTINGHSYFDLVLVTNVGGAGDVHSISIKGSRTSWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ +VAP +W
Sbjct  209  NWQSNSYLNGQSLSFQVTTSDGRTITSYNVAPANW  243



>ref|XP_002309181.2| hypothetical protein POPTR_0006s10850g [Populus trichocarpa]
 gb|EEE92704.2| hypothetical protein POPTR_0006s10850g [Populus trichocarpa]
Length=254

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 204/250 (82%), Gaps = 11/250 (4%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M+   F    LV  L FH +CG            G W+ GHATFYGG+DA+GTMGGACG
Sbjct  5    AMQFSVFLQLFLVFSLLFHGTCGD----------RGGWQIGHATFYGGSDASGTMGGACG  54

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGT+TAALSTALFN+G SCGAC++++CN +  + CH  +ITVTATNFCPPN+
Sbjct  55   YGNLYSQGYGTSTAALSTALFNNGLSCGACFQIRCNNDP-KWCHSSTITVTATNFCPPNY  113

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            ALAN+ GGWCNPPLQHFDLA+PAFL+IAQYRAGIV V +RR+ C KKGG+RFTINGH+YF
Sbjct  114  ALANDDGGWCNPPLQHFDLAQPAFLKIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYF  173

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            NL+LITNV GAGD+ +V +KGSRTGW  MSRNWGQ+W+++SYLNGQSLSFRVTASDG TV
Sbjct  174  NLVLITNVAGAGDVHAVSVKGSRTGWQTMSRNWGQDWQSNSYLNGQSLSFRVTASDGTTV  233

Query  783  TNLDVAPPDW  812
            T+ ++ P +W
Sbjct  234  TSYNIVPANW  243



>gb|KEH35551.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/241 (70%), Positives = 199/241 (83%), Gaps = 10/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
               VL LC   + G +          G W+N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  12   LFFVLSLCLKGTFGDY---------GGGWENAHATFYGGGDASGTMGGACGYGNLYSQGY  62

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCG+CYE+KCN +  + C PGSI VTATNFCPPNFA +N +GGW
Sbjct  63   GTNTAALSTALFNNGLSCGSCYEMKCNSDP-KWCLPGSILVTATNFCPPNFAESNTNGGW  121

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPPLQHFDLAEPAFLQIAQY+AGIV +++RR+ C KKGG+RFTINGH+YFNL+L+TNVG
Sbjct  122  CNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLVTNVG  181

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ SV IKGS+TGW  MSRNWGQNW++++YLNGQSLSF+VT SDGRT+T+ +V P +
Sbjct  182  GAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNVVPGN  241

Query  810  W  812
            W
Sbjct  242  W  242



>gb|ABC55453.1| expansin protein [Rosa x borboniana]
Length=253

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W  GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE++C
Sbjct  29   GGWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PGSI VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  89   -DNDPRWCRPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
            +VA+RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  148  SVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVVGAGDVHSVSIKGSRTGWQSMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYL+GQ LSF+VT SDGRTVT+ +VAP +W
Sbjct  208  NWQSNSYLSGQLLSFQVTTSDGRTVTSYNVAPGNW  242



>gb|AEN70870.1| alpha-expansin 1 [Gossypium turneri]
Length=258

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 209/250 (84%), Gaps = 7/250 (3%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M +  FP F  +      S C + F G ++    G W+N HATFYGGADATGTMGGACG
Sbjct  5    TMMSQIFPLFFFLF-----SVCNSIFLG-DNGDENGGWQNAHATFYGGADATGTMGGACG  58

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+
Sbjct  59   YGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNY  117

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL++++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YF
Sbjct  118  ALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYF  177

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            N++LITNVGGAGDI SV +KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+
Sbjct  178  NMVLITNVGGAGDITSVSVKGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTI  237

Query  783  TNLDVAPPDW  812
            TN +V P  W
Sbjct  238  TNYNVVPAGW  247



>ref|XP_002323665.1| expansin S1 precursor family protein [Populus trichocarpa]
 gb|EEF05426.1| expansin S1 precursor family protein [Populus trichocarpa]
Length=254

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 204/250 (82%), Gaps = 11/250 (4%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M++F F    LVL    H   G +          G W+ GHATFYGG+DA+GTMGGACG
Sbjct  5    AMQDFVFVQLYLVLSFLLHGIYGDY----------GGWQVGHATFYGGSDASGTMGGACG  54

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGT+TAALSTALFN+G SCGAC++++CN +  + CH G+ITVTATNFCPPN+
Sbjct  55   YGNLYSQGYGTSTAALSTALFNNGLSCGACFQIRCNNDP-KWCHSGTITVTATNFCPPNY  113

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL+N++GGWCNPPL+HFDLA+PAFLQIAQYRAGIV V +RR+ C KKGG+RFTINGH+YF
Sbjct  114  ALSNDNGGWCNPPLKHFDLAQPAFLQIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYF  173

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            NL+LITNV GAGD+ +V IKGSRTGW  MSRNWGQNW+++SYLNGQ LSFRVT SDG+TV
Sbjct  174  NLVLITNVAGAGDVHAVSIKGSRTGWQTMSRNWGQNWQSNSYLNGQRLSFRVTTSDGKTV  233

Query  783  TNLDVAPPDW  812
            T  +V P +W
Sbjct  234  TWYNVVPANW  243



>ref|XP_003529476.1| PREDICTED: expansin-A15-like [Glycine max]
 gb|KHN28137.1| Expansin-A15 [Glycine soja]
Length=248

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + R C PGSI VTATNFCPPN AL N++GGWCNPPLQHFDLA+P FL+IAQY+AGIV
Sbjct  83   -ANDHRWCLPGSIVVTATNFCPPNNALPNDNGGWCNPPLQHFDLAQPVFLRIAQYKAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+AC +KGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGWMPMSRNWGQ
Sbjct  142  PVSFRRVACRRKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWMPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  202  NWQSNNYLNGQSLSFKVTTSDGRTVASNNVAPSGW  236



>gb|AFK24458.1| expansin 5 [Ziziphus jujuba]
Length=254

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               +++ C PGSI VTATNFCPPN AL+N +GGWCNPPLQHFDLAEPAFL IAQYRAGIV
Sbjct  90   -SNDAKWCLPGSIIVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLHIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD  +V IKGS+TGW  MSRNWGQ
Sbjct  149  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDAHAVSIKGSKTGWQAMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VTASDGRTVT+ +VAP  W
Sbjct  209  NWQSNSYLNGQSLSFQVTASDGRTVTSYNVAPAGW  243



>gb|AFK38068.1| unknown [Medicago truncatula]
Length=253

 Score =   322 bits (824),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/241 (70%), Positives = 198/241 (82%), Gaps = 10/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
               VL LC   + G +          G W+N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  12   LFFVLSLCLKGTFGDY---------GGGWENAHATFYGGGDASGTMGGACGYGNLYSQGY  62

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCG+CYE+KCN +  + C PGSI VTATNFCPPNFA +N +GGW
Sbjct  63   GTNTAALSTALFNNGLSCGSCYEMKCNSDP-KWCLPGSILVTATNFCPPNFAESNTNGGW  121

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPPLQHFDLAEPAFLQIAQY+AGIV ++ RR+ C KKGG+RFTINGH+YFNL+L+TNVG
Sbjct  122  CNPPLQHFDLAEPAFLQIAQYKAGIVPISIRRVPCVKKGGIRFTINGHSYFNLVLVTNVG  181

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ SV IKGS+TGW  MSRNWGQNW++++YLNGQSLSF+VT SDGRT+T+ +V P +
Sbjct  182  GAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNVVPGN  241

Query  810  W  812
            W
Sbjct  242  W  242



>gb|AEQ55270.1| expansin [Breonia chinensis]
 gb|AEQ55285.1| expansin [Breonia chinensis]
Length=252

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 201/245 (82%), Gaps = 11/245 (4%)
 Frame = +3

Query  78   HFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLY  257
            +         +C  ++ G +          G W++ HATFYGG DA+GTMGGACGYGNLY
Sbjct  8    YLSLLFFFFTICLRTTFGDY----------GGWQSAHATFYGGGDASGTMGGACGYGNLY  57

Query  258  SQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANN  437
            SQGYGTNTAALSTALFN+G SCG+CYE++C + + + C PG+ITVTATNFCPPN AL N+
Sbjct  58   SQGYGTNTAALSTALFNNGLSCGSCYEIRC-DSDPKWCLPGTITVTATNFCPPNPALPND  116

Query  438  HGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLI  617
            +GGWCNPP QHFDLAEPAFLQIAQYRAGIV VA++R+ C KKGG+RFTINGH+YFNL+L+
Sbjct  117  NGGWCNPPRQHFDLAEPAFLQIAQYRAGIVPVAFQRVPCRKKGGVRFTINGHSYFNLVLV  176

Query  618  TNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDV  797
            TNV GAGD+ SV IKGSRTGW PMSRNWGQNW+++SYLNGQSLSF++T+SDGRT+T+ +V
Sbjct  177  TNVAGAGDVHSVSIKGSRTGWQPMSRNWGQNWQSNSYLNGQSLSFQITSSDGRTLTSYNV  236

Query  798  APPDW  812
            AP +W
Sbjct  237  APANW  241



>gb|AEN70867.1| alpha-expansin 1 [Gossypium thurberi]
Length=258

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 203/244 (83%), Gaps = 7/244 (3%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYS  260
            FP F  +  +C      T    G +    G W+  HATFYGGADATGTMGGACGYGNLYS
Sbjct  11   FPLFFFLFSVC------TSIFLGANGDDNGGWQTAHATFYGGADATGTMGGACGYGNLYS  64

Query  261  QGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNH  440
            QGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++
Sbjct  65   QGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDN  123

Query  441  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLIT  620
            GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LIT
Sbjct  124  GGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLIT  183

Query  621  NVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVA  800
            NVGGAGDI SV IKGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +V 
Sbjct  184  NVGGAGDITSVSIKGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVV  243

Query  801  PPDW  812
            P  W
Sbjct  244  PAGW  247



>gb|AEN70883.1| alpha-expansin 1 [Gossypium armourianum]
 gb|AEN70884.1| alpha-expansin 1 [Gossypium harknessii]
Length=258

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 208/250 (83%), Gaps = 7/250 (3%)
 Frame = +3

Query  63   SMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacg  242
            +M +  FP F  +      S C + F G ++    G W+  HATFYGGADATGTMGGACG
Sbjct  5    TMMSQIFPLFFFLF-----SVCNSIFLG-DNGDENGGWQTAHATFYGGADATGTMGGACG  58

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+
Sbjct  59   YGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNY  117

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL++++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YF
Sbjct  118  ALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYF  177

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            N++LITNVGGAGDI SV +KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+
Sbjct  178  NMVLITNVGGAGDITSVSVKGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTI  237

Query  783  TNLDVAPPDW  812
            TN +V P  W
Sbjct  238  TNYNVVPAGW  247



>gb|AEN70869.1| alpha-expansin 1 [Gossypium schwendimanii]
Length=258

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 206/246 (84%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISQTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IKGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +
Sbjct  182  ITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>gb|ACK43886.1| expansin [Diospyros kaki]
Length=254

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGT TAALSTALFN+G SCGACYELKC
Sbjct  30   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYELKC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++ +R C PG+ITVTATNFCPPN +L N++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV
Sbjct  90   NDD-ARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+++R+ C KKGG+RFTINGH+YFNL+ I+NVGGAGD+ +V +KG RTGW PMSRNWGQ
Sbjct  149  PVSFQRVPCVKKGGIRFTINGHSYFNLVSISNVGGAGDVHAVSVKGPRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF++TASDGRTVT+ +VAP +W
Sbjct  209  NWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNW  243



>gb|ACX69842.1| expansin [Rubus idaeus]
Length=253

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE+ C
Sbjct  29   GGWNSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMMC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PG I VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  89   -DNDPRWCRPGRIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH++FNL+LITNV GAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  148  PVAFRRVPCVKKGGIRFTINGHSHFNLVLITNVAGAGDVHSVSIKGSRTGWQSMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  208  NWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPGNW  242



>gb|AEN70868.1| alpha-expansin 1 [Gossypium laxum]
 gb|AEN70888.1| alpha-expansin 1 [Gossypium gossypioides]
 gb|AEN70889.1| alpha-expansin 1 [Gossypium lobatum]
 gb|AEN70890.1| alpha-expansin 1 [Gossypium trilobum]
Length=258

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 206/246 (84%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IKGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +
Sbjct  182  ITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>gb|AEN70887.1| alpha-expansin 1 [Gossypium aridum]
Length=258

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 204/244 (84%), Gaps = 7/244 (3%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYS  260
            FP F  +      S C + F G  +    G W+  HATFYGGADATGTMGGACGYGNLYS
Sbjct  11   FPLFFFLF-----SVCNSIFLG-ANVDDNGGWQTAHATFYGGADATGTMGGACGYGNLYS  64

Query  261  QGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNH  440
            QGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++
Sbjct  65   QGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDN  123

Query  441  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLIT  620
            GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LIT
Sbjct  124  GGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLIT  183

Query  621  NVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVA  800
            NVGGAGDI SV IKGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +V 
Sbjct  184  NVGGAGDITSVSIKGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVV  243

Query  801  PPDW  812
            P  W
Sbjct  244  PAGW  247



>gb|AEQ55268.1| expansin [Breonia chinensis]
 gb|AEQ55283.1| expansin [Breonia chinensis]
Length=255

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE++C
Sbjct  31   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMRC  90

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C  G+ITVTATNFCPPNFAL N++GGWCNPP QHFDLAEPAFLQIAQYRAGIV
Sbjct  91   -DNDPKWCLGGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIV  149

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+L+TNV GAGDI SV IKGSRTGW  MSRNWGQ
Sbjct  150  PVAFRRVPCVKKGGLRFTINGHSYFNLVLVTNVAGAGDIHSVSIKGSRTGWQTMSRNWGQ  209

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLS  VTASDGRTVT+ +VAP +W
Sbjct  210  NWQSNSYLNGQSLSIMVTASDGRTVTSYNVAPANW  244



>ref|XP_004307732.1| PREDICTED: expansin-A8-like [Fragaria vesca subsp. vesca]
 gb|AAF21101.1|AF159563_1 expansin [Fragaria x ananassa]
Length=253

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 198/242 (82%), Gaps = 10/242 (4%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
              + VL LC   +   +  G         W  GHATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  11   LLVSVLNLCIRGTYADYGAG---------WVGGHATFYGGGDASGTMGGACGYGNLYSQG  61

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN G SCG+CYE++C + + R C PGSI VTATNFCPPNFA AN++GG
Sbjct  62   YGTNTAALSTALFNDGLSCGSCYEMRC-DNDPRWCLPGSIIVTATNFCPPNFAQANDNGG  120

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQIAQYRAGIV V++RR+AC KKGG+RFTINGH+YFNL+LITNV
Sbjct  121  WCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVACVKKGGIRFTINGHSYFNLVLITNV  180

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD+ SV IKGS+ GW  MSRNWGQNW++++YLNGQ+LSF+VT SDGRTVT+ +VAP 
Sbjct  181  AGAGDVHSVSIKGSKGGWQSMSRNWGQNWQSNNYLNGQALSFQVTTSDGRTVTSNNVAPG  240

Query  807  DW  812
            +W
Sbjct  241  NW  242



>gb|ACI02326.1| expansion-related protein [Gladiolus grandiflorus]
Length=253

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 193/214 (90%), Gaps = 1/214 (0%)
 Frame = +3

Query  171  DWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCN  350
            +W++ HATFYGG DATGTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCG+CYE+KCN
Sbjct  30   NWEDAHATFYGGGDATGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEMKCN  89

Query  351  EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVA  530
            ++  R C  GSI VTATNFCPPNFAL N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV 
Sbjct  90   DDP-RWCLSGSIVVTATNFCPPNFALPNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVP  148

Query  531  VAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQN  710
            V++RR+ C KKGG+RFT+NGH+ FNL+LI+NVGGAGD+ +V IKGS+TGW  MSRNWGQN
Sbjct  149  VSFRRVPCIKKGGIRFTVNGHSCFNLVLISNVGGAGDVHAVSIKGSKTGWQTMSRNWGQN  208

Query  711  WEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            W+++SYLNGQSLSF+VT SDG+T+T+ +VAP +W
Sbjct  209  WQSNSYLNGQSLSFQVTTSDGKTITSYNVAPSNW  242



>gb|AFZ78603.1| expansin protein [Populus tomentosa]
Length=250

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 202/242 (83%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
              + VL LC     GT+   G+D    G W+ GHATFYGG DA+GTMGGACGYG+LYSQG
Sbjct  9    LLLFVLHLCV---AGTY---GDD----GGWQGGHATFYGGGDASGTMGGACGYGDLYSQG  58

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE++C + + + C PGSITVTATNFCPPN AL+N++GG
Sbjct  59   YGTNTAALSTALFNNGLSCGSCYEMRC-DSDPKWCLPGSITVTATNFCPPNSALSNDNGG  117

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQY AGIV +++RR+ C KKGG+RFTINGH+YFNL+LITNV
Sbjct  118  WCNPPLQHFDMAEPAFLQIAQYSAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLITNV  177

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VT SDG+TVT+ +  P 
Sbjct  178  AGAGDVQSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTSYNAVPE  237

Query  807  DW  812
            +W
Sbjct  238  NW  239



>ref|XP_002325925.2| alpha-expansin 8 precursor family protein [Populus trichocarpa]
 gb|EEF00307.2| alpha-expansin 8 precursor family protein [Populus trichocarpa]
Length=250

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  26   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  85

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PGSITVTATNFCPPN AL+ ++GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  86   -DNDPKWCLPGSITVTATNFCPPNSALSKDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  144

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             +++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGS+TGW  MSRNWGQ
Sbjct  145  PISFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQAMSRNWGQ  204

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT+ +  P +W
Sbjct  205  NWQSNSYLNGQSLSFQVTTSDGRTVTSYNAVPENW  239



>gb|ACM90161.1| expansin 3 [Pyrus pyrifolia]
Length=254

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYG LYSQGYGTNTAAL+TALFN+G SCG+CYE+ C
Sbjct  30   GSWEGAHATFYGGGDASGTMGGACGYGTLYSQGYGTNTAALNTALFNNGLSCGSCYEMMC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N +  R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NNDP-RWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  149  PVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVYSVSIKGSRTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDG TVT+ +VAP +W
Sbjct  209  NWQSNSYLNGQALSFQVTTSDGSTVTSYNVAPGNW  243



>ref|XP_010525408.1| PREDICTED: expansin-A8 [Tarenaya hassleriana]
Length=253

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G +CGACYEL+C
Sbjct  29   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLTCGACYELRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            + ++ R C  G+ITVTATNFCPPNF LAN++GGWCNPPL+HFDLAEPAFLQIAQYRAGIV
Sbjct  89   DNDQ-RWCLSGTITVTATNFCPPNFGLANDNGGWCNPPLEHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS TGW  MSRNWGQ
Sbjct  148  PVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSNTGWQAMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT+ +VAP  W
Sbjct  208  NWQSNSYLNGQSLSFQVTTSDGRTVTSNNVAPSGW  242



>gb|AEC03978.1| expansin [Oncidium hybrid cultivar]
Length=251

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W++ HATFYGG DATGT+GGACGYGNLYSQGYGTNTAALSTALFN+G+SCGACYE++C +
Sbjct  23   WQSAHATFYGGGDATGTIGGACGYGNLYSQGYGTNTAALSTALFNTGTSCGACYEMRC-D  81

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++ R C PGSITVTATNFCPPN AL N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  82   DDPRWCLPGSITVTATNFCPPNNALPNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  141

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            A+RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW  MSRNWGQNW
Sbjct  142  AFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQAMSRNWGQNW  201

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDV  797
            +++SYLNGQSLSF+VT SDG+T+T+ DV
Sbjct  202  QSNSYLNGQSLSFQVTTSDGKTITSYDV  229



>dbj|BAD00014.1| expansin [Malus domestica]
Length=220

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = +3

Query  183  GHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEES  362
            GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC  +  
Sbjct  1    GHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMKCGSDP-  59

Query  363  RVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYR  542
            + C PGSI VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV V++R
Sbjct  60   KWCLPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIVPVSFR  119

Query  543  RIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAH  722
            R++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSRNWGQNW+++
Sbjct  120  RVSCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSN  179

Query  723  SYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            SYLNGQSLSF+VT SDGRT+T  +VAP +W
Sbjct  180  SYLNGQSLSFQVTTSDGRTLTADNVAPGNW  209



>ref|XP_004138396.1| PREDICTED: expansin-A8-like [Cucumis sativus]
 ref|XP_004164462.1| PREDICTED: expansin-A8-like [Cucumis sativus]
 gb|KGN45833.1| hypothetical protein Csa_6G014540 [Cucumis sativus]
Length=245

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 192/219 (88%), Gaps = 3/219 (1%)
 Frame = +3

Query  156  PSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACY  335
            PS   D+  GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CY
Sbjct  19   PSISADY--GHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCY  76

Query  336  ELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYR  515
            E+ CN +  + C PG I VTATNFCPPNFAL+N++GGWCNPPLQHFDLAEPAFLQIAQYR
Sbjct  77   EITCNSDP-KWCLPGKIIVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYR  135

Query  516  AGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSR  695
            AGIV V+++R+ C KKGG+RFTINGH+YFNL+LITNVGGAGDI SV IKGS+TGW  MSR
Sbjct  136  AGIVPVSFQRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDIHSVSIKGSKTGWQAMSR  195

Query  696  NWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NWGQNW++++YLNGQSLSF+VT SDGRTVT+ D  P +W
Sbjct  196  NWGQNWQSNNYLNGQSLSFQVTTSDGRTVTSYDAVPANW  234



>gb|AAP48991.1| expansin [Sambucus nigra]
Length=249

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 200/243 (82%), Gaps = 14/243 (6%)
 Frame = +3

Query  84   PFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQ  263
            P   L   LC  S   TF          G W++ HATFYGG DA+GTMGGACGYGNLYSQ
Sbjct  10   PLVFLSFCLCLRS---TF----------GGWESAHATFYGGGDASGTMGGACGYGNLYSQ  56

Query  264  GYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHG  443
            GYGT+TAALSTALFN+G SCG+CY++KCN++  R C PG+I VTATNFCPPN  L+N++G
Sbjct  57   GYGTDTAALSTALFNNGLSCGSCYQIKCNDDP-RWCLPGTIMVTATNFCPPNPGLSNDNG  115

Query  444  GWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITN  623
            GWCNPPLQHFDLAEPAFLQIAQYRAGIV VA++R+ C KKGG+RFTINGH+YFNL+LITN
Sbjct  116  GWCNPPLQHFDLAEPAFLQIAQYRAGIVPVAFQRVPCVKKGGIRFTINGHSYFNLVLITN  175

Query  624  VGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAP  803
            VGGAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQ+LS +VT SDGRTVT+ +VAP
Sbjct  176  VGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQTLSVQVTTSDGRTVTSNNVAP  235

Query  804  PDW  812
             DW
Sbjct  236  GDW  238



>gb|KHG13406.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=253

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C + + +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC-DSDPK  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSITVTATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR
Sbjct  94   WCLPGSITVTATNFCPPNLALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            + C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSRNWGQNW+++S
Sbjct  154  VPCIKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQLMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  214  YLNGQSLSFQVTTSDGRTVTSYNVAPGNW  242



>ref|XP_009384771.1| PREDICTED: expansin-A2 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 199/246 (81%), Gaps = 6/246 (2%)
 Frame = +3

Query  81   FPFFIL--VLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
             P F L   L L F SSC   F          DW++ HATFYGG DA+GTMGGACGYG+L
Sbjct  3    IPRFSLSDALFLLFSSSC---FLARGTLGDSYDWQSAHATFYGGGDASGTMGGACGYGDL  59

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGTNTAALSTALFN G SCG+CYELKC +++ R C PGSI +TATNFCPPN+AL +
Sbjct  60   YSQGYGTNTAALSTALFNDGLSCGSCYELKC-DDDPRWCLPGSIVITATNFCPPNYALPS  118

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            + GGWCNPP  HFD+AEPAFLQIAQYRAGIV VA+RR+ C KKGG+RFTINGH+YFNL+L
Sbjct  119  DDGGWCNPPRPHFDMAEPAFLQIAQYRAGIVPVAFRRVPCAKKGGVRFTINGHSYFNLVL  178

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNV GAGD+ +V IKGSRTGW  MSRNWGQNW++++YL+GQSLSF+VT SDGRT+T+ D
Sbjct  179  ITNVAGAGDVCAVSIKGSRTGWQVMSRNWGQNWQSNAYLDGQSLSFQVTTSDGRTITSYD  238

Query  795  VAPPDW  812
            V P DW
Sbjct  239  VVPTDW  244



>dbj|BAD00015.1| expansin [Malus domestica]
Length=220

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 189/210 (90%), Gaps = 1/210 (0%)
 Frame = +3

Query  183  GHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEES  362
            GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+ CN +  
Sbjct  1    GHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMMCNNDP-  59

Query  363  RVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYR  542
            R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V++R
Sbjct  60   RWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFR  119

Query  543  RIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAH  722
            R+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTG  PMSRNWGQNW+++
Sbjct  120  RVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGRQPMSRNWGQNWQSN  179

Query  723  SYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  180  SYLNGQALSFQVTTSDGRTVTSYNVAPGNW  209



>ref|XP_010670609.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=253

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCG+CYELKC
Sbjct  29   GGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGQSCGSCYELKC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C PGSI +TATNFCPPNFAL+N++GGWCNPPL+HFD+A+P+FL+IAQYRAGIV
Sbjct  89   NDDP-RWCLPGSIIITATNFCPPNFALSNDNGGWCNPPLEHFDMAQPSFLKIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C +KGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGS TGW  MSRNWGQ
Sbjct  148  PVSFRRVPCVRKGGIRFTINGHSYFNLVLITNVAGAGDVRSVSIKGSNTGWQAMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VTASDGRT+T+ +VA   W
Sbjct  208  NWQSNAYLNGQSLSFQVTASDGRTITSNNVASRGW  242



>ref|XP_002532867.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
 gb|EEF29521.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
Length=248

 Score =   319 bits (817),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+  HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGAC++++CN 
Sbjct  26   WQAAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGYSCGACFQIRCNS  85

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            +  + C   +ITVTATNFCPPNFALAN++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  86   DP-QWCLSRTITVTATNFCPPNFALANDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  144

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
             +RR+ C KKGGMRFTINGH+YFNL+LI+NV GAGDI +V IKG+RTGW  MSRNWGQNW
Sbjct  145  LFRRVPCVKKGGMRFTINGHSYFNLVLISNVAGAGDIGAVAIKGARTGWQTMSRNWGQNW  204

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYLNGQSLSFRVT SDGRT+T+ +VAP +W
Sbjct  205  QSNSYLNGQSLSFRVTTSDGRTITSFNVAPANW  237



>gb|ADN03964.1| EXP1 [Phytolacca acinosa]
Length=252

 Score =   319 bits (817),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC
Sbjct  28   GGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMKC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C PGSI +TATNFCPPN+ALAN++GGWCNPPLQHFD+A+PAFL+IAQYRAGIV
Sbjct  88   NDDP-RWCLPGSIIITATNFCPPNYALANDNGGWCNPPLQHFDMAQPAFLKIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             +++RR+ C +KGG+RFTINGH+YFNL+LI+NV GAGDI +V IKGSRTGW  MSRNWGQ
Sbjct  147  PISFRRVPCVRKGGIRFTINGHSYFNLVLISNVAGAGDIHAVSIKGSRTGWQTMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLN Q+LSF++TASDGRTVT+ ++ P +W
Sbjct  207  NWQSNSYLNAQTLSFQLTASDGRTVTSNNIVPSNW  241



>gb|KHG01029.1| Expansin-A15 -like protein [Gossypium arboreum]
Length=248

 Score =   319 bits (817),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              ++ + C PGSI VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IAQYRAGIV
Sbjct  83   -MDDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C +KGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW PMSRNWGQ
Sbjct  142  PVAYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTV + ++AP  W
Sbjct  202  NWQSNTYLNGQSLSFKVTTSDGRTVVSSNIAPAGW  236



>ref|XP_008456774.1| PREDICTED: expansin-A8-like [Cucumis melo]
Length=244

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 192/219 (88%), Gaps = 3/219 (1%)
 Frame = +3

Query  156  PSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACY  335
            PS   D+  GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CY
Sbjct  18   PSISADY--GHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCY  75

Query  336  ELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYR  515
            E+ CN +  + C PG I VTATNFCPPNFAL+N++GGWCNPPLQHFDLAEPAFLQIAQYR
Sbjct  76   EITCNSDP-KWCLPGKIIVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYR  134

Query  516  AGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSR  695
            AGIV V+++R+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSR
Sbjct  135  AGIVPVSFQRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSR  194

Query  696  NWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NWGQNW++++YLNGQSLSF+VT SDGRTVT+ D  P +W
Sbjct  195  NWGQNWQSNNYLNGQSLSFQVTTSDGRTVTSYDAVPGNW  233



>gb|AEN70875.1| alpha-expansin 1 [Gossypium tomentosum]
 gb|AEN70876.1| alpha-expansin 1 [Gossypium tomentosum]
Length=258

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 201/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN+LLITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMLLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +V P  W
Sbjct  197  KGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGW  247



>gb|ABR17119.1| unknown [Picea sitchensis]
Length=253

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            GDW++ HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCGACYE++C
Sbjct  29   GDWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMQC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG+I VTATNFCPPN AL NN GGWCNPPLQHFD+AEP++L+IA+YR+GIV
Sbjct  89   NDDP-QWCLPGTIMVTATNFCPPNNALPNNDGGWCNPPLQHFDMAEPSYLKIAKYRSGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             + YRR+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGSRTGW PMSRNWGQ
Sbjct  148  PILYRRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTV + + AP +W
Sbjct  208  NWQSNSYLNGQSLSFQVTTSDGRTVVSYNAAPSNW  242



>ref|XP_006429564.1| hypothetical protein CICLE_v10013804mg [Citrus clementina]
 ref|XP_006481180.1| PREDICTED: expansin-A8-like [Citrus sinensis]
 gb|ESR42804.1| hypothetical protein CICLE_v10013804mg [Citrus clementina]
Length=256

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE++C
Sbjct  32   GGWQIAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIRC  91

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + + C PG+ITVTATNFCPPN+AL+N++GGWCNPPLQHFDLA+P+FL IAQYRAGIV
Sbjct  92   -ANDPQWCLPGTITVTATNFCPPNYALSNDNGGWCNPPLQHFDLAQPSFLHIAQYRAGIV  150

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V +RR  C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +VFIKGS+TGW  MSRNWGQ
Sbjct  151  PVLFRRAPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVKAVFIKGSKTGWQAMSRNWGQ  210

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYL+GQSLSF+VT SDGRT+T+ +V P +W
Sbjct  211  NWQSNSYLDGQSLSFKVTTSDGRTITSYNVVPANW  245



>gb|AEN70871.1| alpha-expansin 1 [Gossypium mustelinum]
Length=258

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 205/246 (83%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNVVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IKGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +
Sbjct  182  ITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>gb|KHG27586.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=253

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE+KC + + +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMKC-DNDPK  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFAL+N++GGWCNPPLQHFD+AEPAFLQIAQYRAGIV +++RR
Sbjct  94   WCLPGSIIVTATNFCPPNFALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            + C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW  MSRNWGQNW+++S
Sbjct  154  VPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  214  YLNGQSLSFQVTTSDGRTVTSYNVAPANW  242



>gb|AEQ55284.1| expansin [Breonia chinensis]
Length=255

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTA+FN+G +CG+CYE++C
Sbjct  31   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNNGLACGSCYEMRC  90

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C  G+ITVTATNFCPPNFAL N++GGWCNPP QHFDLAEPAFLQIAQYRAGIV
Sbjct  91   -DGDPKWCLSGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIV  149

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKG +RFTINGH+YFNL+L+TNV GAGDI +V IKGSRTGW  MSRNWGQ
Sbjct  150  PVAFRRVTCVKKGSIRFTINGHSYFNLVLVTNVAGAGDIHAVSIKGSRTGWQSMSRNWGQ  209

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF VTASDGRTVT+ +VAP +W
Sbjct  210  NWQSNSYLNGQSLSFMVTASDGRTVTSYNVAPANW  244



>gb|KHG02505.1| Expansin-A2 [Gossypium arboreum]
Length=257

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 204/246 (83%), Gaps = 12/246 (5%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F L  V      C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFLFSV------CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  61

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  62   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  120

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN+ L
Sbjct  121  DNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMAL  180

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IKGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +
Sbjct  181  ITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYN  240

Query  795  VAPPDW  812
            V P  W
Sbjct  241  VVPAGW  246



>ref|XP_006411329.1| hypothetical protein EUTSA_v10017120mg [Eutrema salsugineum]
 gb|ESQ52782.1| hypothetical protein EUTSA_v10017120mg [Eutrema salsugineum]
Length=257

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE+KC
Sbjct  32   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMKC  91

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C   +ITVTATNFCPPN  L+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  92   NDDP-RWCLSSTITVTATNFCPPNLGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  150

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG-WMPMSRNWG  704
             V++RR+AC KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V IKGS+TG W  MSRNWG
Sbjct  151  PVSFRRVACMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTGSWQAMSRNWG  210

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLN QSLSF+VT SDGRTV + DVAP +W
Sbjct  211  QNWQSNSYLNDQSLSFQVTTSDGRTVVSNDVAPSNW  246



>gb|AEQ55269.1| expansin [Breonia chinensis]
Length=255

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTA+FN+G +CG+CYE++C
Sbjct  31   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNNGLACGSCYEMRC  90

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C  G+ITVTATNFCPPNFAL N++GGWCNPP QHFDLAEPAFLQIAQYRAGIV
Sbjct  91   -DGDPKWCLSGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIV  149

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKG +RFTINGH+YFNL+L+TNV GAGDI +V IKGSRTGW  MSRNWGQ
Sbjct  150  PVAFRRVTCVKKGSIRFTINGHSYFNLVLVTNVAGAGDIHAVSIKGSRTGWQSMSRNWGQ  209

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF VTASDGRTVT+ +VAP +W
Sbjct  210  NWQSNSYLNGQSLSFMVTASDGRTVTSYNVAPANW  244



>gb|KHG29916.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=253

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CG+CYE++C + + R
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGSCYEMRC-DNDPR  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGS+TVTATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR
Sbjct  94   WCLPGSVTVTATNFCPPNLALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            + C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V IKGS+TGW  MSRNWGQNW+++S
Sbjct  154  VPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  214  YLNGQSLSFQVTTSDGRTVTSYNVAPANW  242



>ref|XP_008363931.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=255

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 192/220 (87%), Gaps = 2/220 (1%)
 Frame = +3

Query  159  SAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYE  338
            ++ G W  GHATFYGG+DA GTMGGACGYGNLYSQGYGT+TAALSTALFNSG SCGACY+
Sbjct  25   ASDGGWYTGHATFYGGSDAAGTMGGACGYGNLYSQGYGTSTAALSTALFNSGLSCGACYQ  84

Query  339  LKCN-EEESRVCHP-GSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQY  512
            L+CN E + + C P G ITVTATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFL IA+Y
Sbjct  85   LRCNHESDPKWCLPVGVITVTATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLHIAEY  144

Query  513  RAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMS  692
            R GIV V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW+PMS
Sbjct  145  RGGIVPVLFRRVPCLKKGGIRFTINGHSYFNLVLITNVGGAGDVRTVSIKGSRTGWLPMS  204

Query  693  RNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            RNWGQNW+++SYLNGQ LSF+VT SDGRTVT+ +V P  W
Sbjct  205  RNWGQNWQSNSYLNGQRLSFKVTTSDGRTVTSYNVVPAGW  244



>dbj|BAJ10398.1| alpha-expansin [Dianthus caryophyllus]
Length=252

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/241 (68%), Positives = 201/241 (83%), Gaps = 10/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
             +L+L  C H + G +          G W + HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  11   IVLILFTCLHGAYGDY---------GGGWTSAHATFYGGGDASGTMGGACGYGNLYSQGY  61

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GT+TAALSTALFN+G SCGACY+L+C+ +  + C PGSI VTATNFCPPN +L N++GGW
Sbjct  62   GTSTAALSTALFNNGLSCGACYQLQCSGDP-KWCLPGSIMVTATNFCPPNPSLPNDNGGW  120

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPPLQHFDLAEP+FL+IAQYRAGIV V++RR+ C +KGG+RFTINGH+YFNL+L+TNVG
Sbjct  121  CNPPLQHFDLAEPSFLRIAQYRAGIVPVSFRRVPCARKGGVRFTINGHSYFNLVLVTNVG  180

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ +V IKGSRTGW PMSRNWGQNW+++ Y+NGQSLSF+VT SDGRT+T+ +VAP +
Sbjct  181  GAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNGYMNGQSLSFQVTTSDGRTITSNNVAPSN  240

Query  810  W  812
            W
Sbjct  241  W  241



>dbj|BAC67189.1| expansin [Pyrus communis]
Length=253

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC  +  +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMKCGSDP-K  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV +++RR
Sbjct  94   WCLPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW P+SRNWGQNW+++S
Sbjct  154  VSCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQPLSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRT+T  +VAP +W
Sbjct  214  YLNGQSLSFQVTTSDGRTLTANNVAPGNW  242



>gb|ADY68811.1| alpha-expansin 1 [Gossypium raimondii]
Length=258

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 201/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASD RT+TN +V PP W
Sbjct  197  KGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDSRTMTNYNVVPPGW  247



>gb|ADY68810.1| alpha-expansin 1 [Gossypium herbaceum subsp. africanum]
Length=258

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 205/246 (83%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+C + + + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRC-DNDPQWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IKGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +
Sbjct  182  ITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>ref|NP_001289209.1| expansin precursor [Pyrus x bretschneideri]
 gb|AGR44455.1| expansin 2 [Pyrus x bretschneideri]
Length=253

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC  +  +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMKCGSDP-K  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFA AN++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV +++RR
Sbjct  94   WCLPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW P+SRNWGQNW+++S
Sbjct  154  VSCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQPLSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRT+T  +VAP +W
Sbjct  214  YLNGQSLSFQVTTSDGRTLTANNVAPGNW  242



>gb|AAM22621.1| expansin 7 precursor [Rumex palustris]
Length=253

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            GDW  GHATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G SCGAC+E+KC
Sbjct  29   GDWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACFEMKC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              +  R C  G ITVTATNFCPPNFALAN++GGWCNPPLQHFDLAEPAFLQIAQY AGIV
Sbjct  89   TADP-RWCIGGVITVTATNFCPPNFALANDNGGWCNPPLQHFDLAEPAFLQIAQYHAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ SV IKGS  GW  MSRNWGQ
Sbjct  148  PVSFRRVPCGRKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSSGGWQAMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF VT SDGRT+T+ +VAP +W
Sbjct  208  NWQSNSYLNGQSLSFMVTTSDGRTLTSSNVAPSNW  242



>ref|XP_010921302.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=247

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGAC+E+KC
Sbjct  23   GGWSDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            + + S  C PGSI VTATNFCPPN AL N++GGWCNPPLQHFDL++P F +IAQY+AGIV
Sbjct  83   SNDGSW-CLPGSIIVTATNFCPPNNALPNDNGGWCNPPLQHFDLSQPVFQRIAQYKAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V YRR+ C K GG+RFTINGH+YFNL+LI+NVGGAGD+ +V IKGS+TGW PMSRNWGQ
Sbjct  142  PVQYRRVPCVKNGGIRFTINGHSYFNLVLISNVGGAGDVTAVSIKGSQTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT++DVAP +W
Sbjct  202  NWQSNSYLNGQSLSFQVTTSDGRTVTSMDVAPNNW  236



>ref|XP_008370248.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=255

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 192/220 (87%), Gaps = 2/220 (1%)
 Frame = +3

Query  159  SAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYE  338
            ++ G W  GHATFYGG+DA GTMGGACGYGNLYSQGYGT+TAALSTALFNSG SCGACY+
Sbjct  25   ASDGGWYTGHATFYGGSDAAGTMGGACGYGNLYSQGYGTSTAALSTALFNSGLSCGACYQ  84

Query  339  LKCN-EEESRVCHP-GSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQY  512
            L+CN E + + C P G ITVTATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFL IA+Y
Sbjct  85   LRCNHESDPKWCLPXGVITVTATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLHIAEY  144

Query  513  RAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMS  692
            R GIV V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW+PMS
Sbjct  145  RGGIVPVLFRRVPCLKKGGIRFTINGHSYFNLVLITNVGGAGDVRTVSIKGSRTGWLPMS  204

Query  693  RNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            RNWGQNW+++SYLNGQ LSF+VT SDGRTVT+ +V P  W
Sbjct  205  RNWGQNWQSNSYLNGQRLSFKVTTSDGRTVTSYNVVPAGW  244



>gb|AEQ55272.1| expansin [Breonia chinensis]
 gb|AEQ55287.1| expansin [Breonia chinensis]
Length=253

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  29   GSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PG+ITVTATNFCPPN AL N++GGWCNPP QHFDLAEPAFLQIAQYRAGIV
Sbjct  89   -DSDPKWCLPGTITVTATNFCPPNPALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA++R+ C KKGG+RFTINGH+YFNL+L+TNVGGAGD+ SV IKG+RTGW  MSRNWGQ
Sbjct  148  PVAFQRVPCGKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGARTGWQSMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF++T SDGRT+T+ +VAP +W
Sbjct  208  NWQSNSYLNGQSLSFQITTSDGRTLTSYNVAPANW  242



>gb|ABD48785.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|ACD37707.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68812.1| alpha-expansin 1 [Gossypium hirsutum]
Length=258

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 205/246 (83%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFL+IA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLRIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IKGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +
Sbjct  182  ITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>ref|XP_011076589.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=252

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 192/222 (86%), Gaps = 4/222 (2%)
 Frame = +3

Query  156  PSAPGD---WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCG  326
            P A GD   W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CG
Sbjct  21   PGAYGDYGGWDSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCG  80

Query  327  ACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIA  506
            ACYEL C+ E  R C PG+ITVTATNFCPPN +L N++GGWCNPP QHFDLAEPA+LQIA
Sbjct  81   ACYELTCSGEP-RWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPRQHFDLAEPAYLQIA  139

Query  507  QYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMP  686
            QY+AGIV V++RR+ C+KKGG+RFTINGH+YFNL+L+TNVGGAGDI SV IKGS TGW P
Sbjct  140  QYKAGIVPVSFRRVPCQKKGGIRFTINGHSYFNLVLVTNVGGAGDIRSVSIKGSNTGWQP  199

Query  687  MSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            MSRNWGQNW+++SYLNGQSLSF+VT SDGR +T+ DVA   W
Sbjct  200  MSRNWGQNWQSNSYLNGQSLSFQVTTSDGRIITSYDVASTGW  241



>ref|XP_010921134.1| PREDICTED: expansin-A2-like isoform X1 [Elaeis guineensis]
Length=255

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 192/213 (90%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE++C  
Sbjct  33   WQTGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEMQC-A  91

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + + C PGSI VTATNFCPPN+AL N++GGWCNPPLQHFDLAEPAFLQI+QYRAGIV +
Sbjct  92   NDPQWCLPGSIIVTATNFCPPNYALPNDNGGWCNPPLQHFDLAEPAFLQISQYRAGIVPI  151

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            ++RR+ C KKGG+RFT+NGH+YFNL+LI+NVGGAGD+++V IKGS+TGW  MS+NWGQNW
Sbjct  152  SFRRVPCVKKGGIRFTVNGHSYFNLVLISNVGGAGDVNAVSIKGSKTGWQAMSQNWGQNW  211

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            ++++YL+GQSLSF+VT SDGRTVT+ DV P +W
Sbjct  212  QSNAYLDGQSLSFQVTTSDGRTVTSYDVVPANW  244



>gb|KFK42332.1| hypothetical protein AALP_AA2G242600 [Arabis alpina]
Length=257

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 197/229 (86%), Gaps = 8/229 (3%)
 Frame = +3

Query  135  FFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFN  308
            FF G  G+D    G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN
Sbjct  23   FFQGAHGDD----GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFN  78

Query  309  SGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEP  488
            +G +CGACYE+KCN++  R C   SI VTATNFCPPNF L+N++GGWCNPPLQHFDLAEP
Sbjct  79   NGLTCGACYEMKCNDDP-RWCLGSSIIVTATNFCPPNFGLSNDNGGWCNPPLQHFDLAEP  137

Query  489  AFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGS  668
            AFLQIAQYRAGIV V++RR+ C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ SV IKGS
Sbjct  138  AFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHSVSIKGS  197

Query  669  RTG-WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +TG W  MSRNWGQNW+++SY+N QSLSF+VT SDGRT+ + DVAP +W
Sbjct  198  KTGSWQAMSRNWGQNWQSNSYMNDQSLSFQVTTSDGRTMVSNDVAPSNW  246



>ref|XP_009399910.1| PREDICTED: expansin-A2-like [Musa acuminata subsp. malaccensis]
Length=255

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 200/243 (82%), Gaps = 2/243 (1%)
 Frame = +3

Query  84   PFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQ  263
            P   L   L F  S   FF  G   ++ G W+N HATFYGG DA+GTMGGACGYGNLYSQ
Sbjct  4    PISSLSDALFFLISSFGFFISGAVGNSYG-WQNAHATFYGGGDASGTMGGACGYGNLYSQ  62

Query  264  GYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHG  443
            GYGTNTAALSTALFN G SCG+CYE++C  ++ R C PGSI VTATNFCPPN AL N++G
Sbjct  63   GYGTNTAALSTALFNDGLSCGSCYEMRC-ADDPRWCLPGSIVVTATNFCPPNNALPNDNG  121

Query  444  GWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITN  623
            GWCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR+ C KKGG+RFTINGH+YFNL+LITN
Sbjct  122  GWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLITN  181

Query  624  VGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAP  803
            VGGAGD+ +V IKGS+TGW  MSRNWGQNW+++SYL+GQSLSF++T SDGRT+T+ +VA 
Sbjct  182  VGGAGDVHAVSIKGSKTGWQTMSRNWGQNWQSNSYLDGQSLSFQLTTSDGRTITSYNVAS  241

Query  804  PDW  812
              W
Sbjct  242  AGW  244



>ref|XP_006443365.1| hypothetical protein CICLE_v10021887mg [Citrus clementina]
 ref|XP_006479065.1| PREDICTED: expansin-A15-like isoform X1 [Citrus sinensis]
 ref|XP_006479066.1| PREDICTED: expansin-A15-like isoform X2 [Citrus sinensis]
 ref|XP_006479067.1| PREDICTED: expansin-A15-like isoform X3 [Citrus sinensis]
 ref|XP_006479068.1| PREDICTED: expansin-A15-like isoform X4 [Citrus sinensis]
 gb|ESR56605.1| hypothetical protein CICLE_v10021887mg [Citrus clementina]
Length=247

 Score =   317 bits (811),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G +CGAC+E+KC
Sbjct  23   GGWSSAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGVTCGACFEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               ++R C PGSI VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IA Y+AGIV
Sbjct  83   -VNDNRWCLPGSIIVTATNFCPPNHALPNNAGGWCNPPLQHFDLSQPIFQHIAHYKAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V YRRIAC K+GG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  142  PVQYRRIACSKRGGIRFTINGHSYFNLVLITNVGGAGDVVSVSIKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGR+V +++VAPP+W
Sbjct  202  NWQSNSYLNGQALSFKVTTSDGRSVISINVAPPNW  236



>ref|XP_010651411.1| PREDICTED: expansin-A10 [Vitis vinifera]
 ref|XP_010651412.1| PREDICTED: expansin-A10 [Vitis vinifera]
 emb|CAN82746.1| hypothetical protein VITISV_024594 [Vitis vinifera]
 emb|CBI16572.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   317 bits (811),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE+KC
Sbjct  23   GGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEVKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              ++ R C PGSITVTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IAQY+AGIV
Sbjct  83   VNDK-RWCLPGSITVTATNFCPPNNALTNNAGGWCNPPLQHFDLSQPVFQHIAQYKAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V YRR+AC+K GG+RFT+NGH+YFNL+LITNVGGAGD+ SV IKGS+T W  MSRNWGQ
Sbjct  142  PVQYRRVACKKTGGIRFTVNGHSYFNLVLITNVGGAGDVVSVSIKGSKTSWQAMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQ+LSF+VT SDGR+V + +VAPP+W
Sbjct  202  NWQSNTYLNGQALSFKVTTSDGRSVVSNNVAPPNW  236



>ref|XP_008374794.1| PREDICTED: expansin-A8-like [Malus domestica]
Length=253

 Score =   317 bits (811),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 198/244 (81%), Gaps = 10/244 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYS  260
            F     VL LC     GTF   G            HATFYGG DA+GTMGGACGYGNLYS
Sbjct  9    FALLFFVLNLCLQ---GTFGDYGGGWEGG------HATFYGGGDASGTMGGACGYGNLYS  59

Query  261  QGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNH  440
            QGYGTNTAALSTALFN+G SCG+CYE+KC  +  + C PGSI VTATNFCPPNFA AN++
Sbjct  60   QGYGTNTAALSTALFNNGLSCGSCYEMKCGSDP-KWCLPGSIIVTATNFCPPNFAQANDN  118

Query  441  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLIT  620
            GGWCNPPLQHFDLAEPAFL+IAQYRAGIV V++RR++C KKGG+RFTINGH+YFNL+LIT
Sbjct  119  GGWCNPPLQHFDLAEPAFLKIAQYRAGIVPVSFRRVSCVKKGGIRFTINGHSYFNLVLIT  178

Query  621  NVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVA  800
            NVGGAGD+ SV IKGS+TGW  MSRNWGQNW+++SYLNGQSLSF+VT SDGRT+T  +VA
Sbjct  179  NVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTLTABNVA  238

Query  801  PPDW  812
            P +W
Sbjct  239  PGNW  242



>ref|XP_007205756.1| hypothetical protein PRUPE_ppa010260mg [Prunus persica]
 gb|EMJ06955.1| hypothetical protein PRUPE_ppa010260mg [Prunus persica]
Length=257

 Score =   317 bits (811),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 193/216 (89%), Gaps = 1/216 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G+W+  HATFYGG+D++GTMGGACGYGNLYSQGYGT+TAALSTALFN+G SCGACY+L+C
Sbjct  31   GEWQTAHATFYGGSDSSGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYQLRC  90

Query  348  N-EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGI  524
            N E + + C PG IT+TATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFL IA YRAGI
Sbjct  91   NHESDPKWCLPGGITITATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLHIAAYRAGI  150

Query  525  VAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWG  704
            V V ++R+ C KKGG+RFT+NGH+YFNL+LITNVGG+GD+ +V IKGS+TGW+PMSRNWG
Sbjct  151  VPVLFKRVPCVKKGGIRFTMNGHSYFNLVLITNVGGSGDVRAVSIKGSKTGWLPMSRNWG  210

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLNGQSLSF+VTASDG T+T+ +V P  W
Sbjct  211  QNWQSNSYLNGQSLSFKVTASDGLTLTSSNVVPASW  246



>gb|AAM47002.1|AF512544_1 alpha-expansin precursor [Gossypium hirsutum]
Length=248

 Score =   316 bits (810),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            GDW N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC
Sbjct  23   GDWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              ++ +   PGS  VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IAQYRAGIV
Sbjct  83   -MDDGKWGLPGSFVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C +KGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW PMSRNWGQ
Sbjct  142  PVAYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  202  NWQSNTYLNGQSLSFKVTTSDGRTVVSSNVAPAGW  236



>ref|XP_008808309.1| PREDICTED: expansin-A2-like [Phoenix dactylifera]
Length=258

 Score =   317 bits (811),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 191/219 (87%), Gaps = 3/219 (1%)
 Frame = +3

Query  162  APGD--WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACY  335
            A GD  W+N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG CY
Sbjct  30   ASGDSGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGVCY  89

Query  336  ELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYR  515
            E++C  ++ + C PGSI VTATNFCPPN+AL+N++GGWCNPPLQHFDLAEPAFLQIAQYR
Sbjct  90   EMRC-ADDPKWCRPGSIIVTATNFCPPNYALSNDNGGWCNPPLQHFDLAEPAFLQIAQYR  148

Query  516  AGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSR  695
            AGIV +++RR+ C KKGG+RFTINGH+YFNL+LI+NV GAGD+ +V IKGS+TGW  MSR
Sbjct  149  AGIVPISFRRVPCAKKGGIRFTINGHSYFNLVLISNVAGAGDVHAVSIKGSKTGWQAMSR  208

Query  696  NWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NWGQNW++++YL+GQSLSF+VT SDGRT T+ DV P  W
Sbjct  209  NWGQNWQSNAYLDGQSLSFQVTTSDGRTDTSSDVVPAGW  247



>gb|AAB40637.1| expansin, partial [Pinus taeda]
Length=232

 Score =   316 bits (809),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCGACYE++C
Sbjct  8    GGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMQC  67

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL N++GGWCNPPLQHFD+AEPAFL+IA+YR GIV
Sbjct  68   NDDP-QWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             + Y R+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+++V IKGSR+GW PMSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVNAVSIKGSRSGWQPMSRNWGQ  186

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTV + +VAP +W
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNW  221



>ref|XP_010931357.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=253

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 196/221 (89%), Gaps = 3/221 (1%)
 Frame = +3

Query  156  PSAPGD--WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGA  329
            P   GD  W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGA
Sbjct  23   PGILGDSSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGA  82

Query  330  CYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQ  509
            CYE+KC ++ +R C PG+I VTATNFCPPN+ALAN++GGWCNPPL+HFDLAEP+FLQIA+
Sbjct  83   CYEMKCTDD-ARWCLPGTIVVTATNFCPPNYALANDNGGWCNPPLRHFDLAEPSFLQIAR  141

Query  510  YRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPM  689
            YRAGIV V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW  M
Sbjct  142  YRAGIVPVSFRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQAM  201

Query  690  SRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            S+NWGQNW++++YL+GQSLSF+VTASDGRT+T+ +V P  W
Sbjct  202  SQNWGQNWQSNAYLDGQSLSFQVTASDGRTITSYNVVPAGW  242



>gb|AAL87025.1| cell wall protein Exp1 precursor [Mirabilis jalapa]
Length=252

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = +3

Query  135  FFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSG  314
            FFHG    +  G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G
Sbjct  19   FFHG--VYANYGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNG  76

Query  315  SSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAF  494
             SCG+CYELKCN +  + C  GSI +TATNFCPPN+ALANN+GGWCNPPLQHFD+A+PAF
Sbjct  77   LSCGSCYELKCNGDP-KWCLRGSIIITATNFCPPNYALANNNGGWCNPPLQHFDMAQPAF  135

Query  495  LQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRT  674
            L+IAQYRAGIV V++RR+ C ++GG+RFTINGH+YFNL+LI+NVGGAGDI +V IKGSRT
Sbjct  136  LKIAQYRAGIVPVSFRRVPCMRRGGIRFTINGHSYFNLVLISNVGGAGDIHAVSIKGSRT  195

Query  675  GWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            GW  MSRNWGQNW++++YLNGQ+LSFRVT SDGR+VT+ ++ P  W
Sbjct  196  GWQTMSRNWGQNWQSNAYLNGQTLSFRVTTSDGRSVTSNNIVPYHW  241



>gb|AAM08930.1| expansin 1 [Musa acuminata]
 gb|AAN31756.1| expansin1 [Musa acuminata]
Length=255

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE++C  
Sbjct  33   WQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEVRC-A  91

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++ R C PGSI VTATNFCPPN+AL +++GGWCNPP QHFDLAEPAFLQIAQYRAGIV V
Sbjct  92   DDPRWCLPGSIVVTATNFCPPNYALPSDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIVPV  151

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            ++RR+AC KKGG+RFTINGH+YF L+LITNVG AGD+ +V IKGS+TGW  MSRNWGQNW
Sbjct  152  SFRRVACVKKGGVRFTINGHSYFILVLITNVGAAGDVHAVSIKGSKTGWQRMSRNWGQNW  211

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYL+GQSLSF+VT SDGRT+T+ +VAP  W
Sbjct  212  QSNSYLDGQSLSFQVTTSDGRTITSYNVAPAGW  244



>ref|XP_011095130.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=263

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = +3

Query  144  GGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSC  323
            GG   S    W+  HATFYGG+DA GTMGGACGYGNLYSQGYGT TAALSTALFN+G SC
Sbjct  31   GGRVLSHGSGWQTAHATFYGGSDAAGTMGGACGYGNLYSQGYGTTTAALSTALFNNGLSC  90

Query  324  GACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQI  503
            GACYE++CN++  + C   +ITVTATNFCPPN+ALA+++GGWCNPP QHFDLAEPAFL+I
Sbjct  91   GACYEMRCNDDP-KWCLSATITVTATNFCPPNYALASDNGGWCNPPRQHFDLAEPAFLKI  149

Query  504  AQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWM  683
            AQYRAGIV V YRR+ C KKGGMRFTINGH+YFNL+LITNVGGAGD+   +IKGSRTGW 
Sbjct  150  AQYRAGIVPVVYRRVPCVKKGGMRFTINGHSYFNLVLITNVGGAGDVHDAWIKGSRTGWR  209

Query  684  PMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            PM+RNWGQNW+++SYL+GQ+LSFRVTASDGRT+T  DV P  W
Sbjct  210  PMARNWGQNWQSNSYLDGQALSFRVTASDGRTLTANDVVPRGW  252



>ref|XP_009622932.1| PREDICTED: expansin-A8-like [Nicotiana tomentosiformis]
Length=254

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G WKN HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYEL C
Sbjct  30   GGWKNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYELTC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               +++ C  G+ITVTATNFCPPN +L N++GGWCNPPLQHFDLAEPAFLQ+AQYRAGIV
Sbjct  90   -SNDAQWCLQGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLQLAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C+KKGG+RFTINGH+YFNL+L+TNVGGAGD++SV IKGS +GW  MSRNWGQ
Sbjct  149  PVSFRRVPCKKKGGIRFTINGHSYFNLVLVTNVGGAGDVNSVSIKGSGSGWQTMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLN QSLSF+VT SDGRT+T+ +VAP +W
Sbjct  209  NWQSNSYLNSQSLSFQVTTSDGRTITSYNVAPHNW  243



>ref|XP_003518007.1| PREDICTED: expansin-A1-like [Glycine max]
 gb|KHN01248.1| Expansin-A1 [Glycine soja]
Length=250

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 190/227 (84%), Gaps = 1/227 (0%)
 Frame = +3

Query  132  TFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNS  311
            T F         G W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+
Sbjct  13   TMFSSAYGYGYGGGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNN  72

Query  312  GSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPA  491
            G SCG+CYE++C  +  R C PGSI VTATNFCPPN AL NN GGWCNPP+ HFDL++P 
Sbjct  73   GLSCGSCYEIRCVNDH-RWCLPGSIMVTATNFCPPNNALPNNAGGWCNPPMHHFDLSQPV  131

Query  492  FLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSR  671
            FL+IAQYRAGIV V+YRR+ C ++GG+RFTINGH+YFNL+LITNVGGAGD+  V IKGSR
Sbjct  132  FLRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHGVAIKGSR  191

Query  672  TGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            TGWMPMSRNWGQNW++++YLNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  192  TGWMPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGW  238



>ref|NP_001267550.1| expansin-A8-like precursor [Cucumis sativus]
 gb|AAB37746.1| expansin S1 precursor [Cucumis sativus]
 gb|KGN50732.1| Expansin S1 [Cucumis sativus]
Length=250

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++GHATFYGG DA+GTMGGACGYGNLYSQGYGTNT ALSTALFN+G SCGAC+E+ C
Sbjct  26   GGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTVALSTALFNNGLSCGACFEMTC  85

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              +  + C PG+I VTATNFCPPNFAL NN+GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  86   TNDP-KWCLPGTIRVTATNFCPPNFALPNNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  144

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  145  PVSFRRVPCMKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQSMSRNWGQ  204

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQ LSF+VT SDGRT+T  ++ P +W
Sbjct  205  NWQSNNYLNGQGLSFQVTLSDGRTLTAYNLVPSNW  239



>ref|XP_003613849.1| Expansin [Medicago truncatula]
 gb|AES96807.1| expansin A10 [Medicago truncatula]
 gb|AFK37003.1| unknown [Medicago truncatula]
Length=248

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 199/242 (82%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
             FI+V +  F S+ G            G W N HATFYGG+DA+GTMGGACGYGNLYSQG
Sbjct  6    LFIMVFLTMFSSAYGY----------GGGWVNAHATFYGGSDASGTMGGACGYGNLYSQG  55

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFNSG SCG+C+E++C   + + C PGSI VTATNFCPPN AL NN+GG
Sbjct  56   YGTNTAALSTALFNSGLSCGSCFEIRC-AGDRKWCLPGSILVTATNFCPPNTALPNNNGG  114

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLA+P FL+IAQY+AGIV V+YRR+ C ++GG+RFTINGH+YFNL+L+TNV
Sbjct  115  WCNPPLQHFDLAQPVFLRIAQYKAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLVTNV  174

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV IKGSR+GWM MSRNWGQNW++++YLNGQ+LSF+VT SDG+TV + +VAP 
Sbjct  175  GGAGDVHSVAIKGSRSGWMQMSRNWGQNWQSNNYLNGQALSFKVTTSDGKTVISNNVAPS  234

Query  807  DW  812
             W
Sbjct  235  GW  236



>emb|CDY14120.1| BnaC02g02370D [Brassica napus]
Length=255

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 202/241 (84%), Gaps = 6/241 (2%)
 Frame = +3

Query  93   ILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYG  272
            IL++ LC  + C    +  ++    G W+ GHATFYGGADA+GTMGGACGYGNLYSQGYG
Sbjct  9    ILIISLCTFNFCFQRINSDDN----GGWERGHATFYGGADASGTMGGACGYGNLYSQGYG  64

Query  273  TNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
              TAALSTALF SG +CGAC+EL+C E++ + C PGSI V+ATNFCPPNFALAN++GGWC
Sbjct  65   LQTAALSTALFQSGQTCGACFELRC-EDDDQWCLPGSIIVSATNFCPPNFALANDNGGWC  123

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPLQHFDLA+PAFLQIAQYRAGIV VA+RR+ CEK GG+RFTING++YF+L+LITNVGG
Sbjct  124  NPPLQHFDLAQPAFLQIAQYRAGIVPVAFRRVQCEKPGGIRFTINGNSYFDLVLITNVGG  183

Query  633  AGDIDSVFIKGSRTG-WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            AGD+ +V +KGS+T  W  MSRNWGQNW++++YL GQSLSF+VTASDGR+V + DV P D
Sbjct  184  AGDVKAVALKGSKTNQWQSMSRNWGQNWQSNAYLRGQSLSFQVTASDGRSVVSYDVVPED  243

Query  810  W  812
            W
Sbjct  244  W  244



>gb|AAK48845.1|AF350936_1 expansin [Prunus cerasus]
Length=253

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 187/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE++C + + +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRC-DSDPK  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPN A +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V++RR
Sbjct  94   WCLPGSIIVTATNFCPPNLAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFT+NGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSRNWGQNW+++S
Sbjct  154  VSCVKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQ+LSF+VT SDGRTVT+ +  P DW
Sbjct  214  YLNGQALSFQVTTSDGRTVTSTNAVPADW  242



>ref|XP_009346913.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=255

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 192/220 (87%), Gaps = 2/220 (1%)
 Frame = +3

Query  159  SAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYE  338
            ++ G W  GHATFYGG+DA GTMGGACGYGNLYSQGYGT+TAALSTALFNSG SCGACY+
Sbjct  25   ASDGGWHTGHATFYGGSDAVGTMGGACGYGNLYSQGYGTSTAALSTALFNSGLSCGACYQ  84

Query  339  LKCNEE-ESRVCHPGS-ITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQY  512
            L+CN + + + C PG  ITVTATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFL IA+Y
Sbjct  85   LRCNHQSDPKWCLPGGVITVTATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLHIAEY  144

Query  513  RAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMS  692
            R GIV V +RR+ C KKGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGSRTGW+PMS
Sbjct  145  RGGIVPVLFRRVPCLKKGGIRFTVNGHSYFNLVLITNVGGAGDVRAVSIKGSRTGWLPMS  204

Query  693  RNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            RNWGQNW+++SYLNGQ LSF+VT SDGRTVT+ +V P  W
Sbjct  205  RNWGQNWQSNSYLNGQRLSFKVTTSDGRTVTSYNVVPAGW  244



>gb|AEE69072.1| expansin-5 [Petunia hybrid cultivar]
Length=258

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 204/242 (84%), Gaps = 3/242 (1%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            F I+ L+L   +  GT FH     +  G W++ HATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  9    FSIISLLLFIINFFGTSFH--VTFADYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQG  66

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G +CGACY+L C   +++ C PG+ITVTATNFCPPN +L N++GG
Sbjct  67   YGTNTAALSTALFNNGLTCGACYQLMC-RNDAQWCLPGTITVTATNFCPPNPSLPNDNGG  125

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLAEPAFLQ+AQYRAGIV V++RR+ C KKGG+RFTINGH+YFNL+L+TNV
Sbjct  126  WCNPPLQHFDLAEPAFLQLAQYRAGIVPVSFRRVPCNKKGGIRFTINGHSYFNLVLVTNV  185

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD++SV IKG+R+GW  MSRNWGQNW+++  LNGQSLSF+VT SDGRTVT+ +VAP 
Sbjct  186  GGAGDVNSVSIKGARSGWQTMSRNWGQNWQSNVNLNGQSLSFQVTTSDGRTVTSYNVAPA  245

Query  807  DW  812
            +W
Sbjct  246  NW  247



>ref|XP_010678491.1| PREDICTED: expansin-A10-like [Beta vulgaris subsp. vulgaris]
Length=251

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCGAC+E++C
Sbjct  26   GGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNQGLSCGACFEMRC  85

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               +++ C PGSI VTATNFCPPN AL NN GGWCNPPL+HFDLA+P F QIA Y+AGIV
Sbjct  86   -VSDAKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLRHFDLAQPVFQQIAHYKAGIV  144

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRT W  MSRNWGQ
Sbjct  145  PVSFRRVPCRKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTNWQSMSRNWGQ  204

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++S+LNGQSLSF+VTASDGRTVT L+VAPP+W
Sbjct  205  NWQSNSFLNGQSLSFKVTASDGRTVTALNVAPPNW  239



>gb|ACD37706.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68813.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|AEN70882.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 200/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASD RT+TN +V P  W
Sbjct  197  KGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYNVVPAGW  247



>ref|XP_006398992.1| hypothetical protein EUTSA_v10015496mg [Eutrema salsugineum]
 gb|ESQ40445.1| hypothetical protein EUTSA_v10015496mg [Eutrema salsugineum]
Length=255

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/241 (70%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +3

Query  93   ILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYG  272
            I +L LC  + C  FF    D +  G+W++GHATFYGGADA+GTMGGACGYG+LYSQGYG
Sbjct  9    IFILSLCTLNFC--FFVINSDDN--GEWESGHATFYGGADASGTMGGACGYGDLYSQGYG  64

Query  273  TNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
              TAALSTALF +G  CGAC+EL+C E++ + C PGSI V+ATNFCPPNFALAN++GGWC
Sbjct  65   LQTAALSTALFRNGQKCGACFELRC-EDDPQWCLPGSIIVSATNFCPPNFALANDNGGWC  123

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPL+HFDLAEPAFLQIAQYRAGIV VA+RR+ CEK GG+RFTING++YF+L+LITNVGG
Sbjct  124  NPPLEHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKSGGIRFTINGNSYFDLVLITNVGG  183

Query  633  AGDIDSVFIKGSRTG-WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            AGD+ +V +KGS+TG W  MSRNWGQNW++++YL GQSLSF+VTA DGRTV + DV P D
Sbjct  184  AGDVRAVSLKGSKTGQWQSMSRNWGQNWQSNTYLRGQSLSFQVTAGDGRTVVSYDVVPQD  243

Query  810  W  812
            W
Sbjct  244  W  244



>ref|XP_008792215.1| PREDICTED: expansin-A8-like [Phoenix dactylifera]
Length=255

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 188/213 (88%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE+KC +
Sbjct  33   WQTAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEMKCAD  92

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            + +  C PG+I VTATNFCPPN+AL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  93   DPTW-CLPGTIVVTATNFCPPNYALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  151

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            ++RR+ C KKGG+RFT+NGH+YFNL+LITNV GAGD+ +V IKGS+TGW  MSRNWGQNW
Sbjct  152  SFRRVPCVKKGGVRFTVNGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQAMSRNWGQNW  211

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            ++++YL GQSLSF+VT SDGRTVT+ D  P  W
Sbjct  212  QSNAYLGGQSLSFQVTTSDGRTVTSYDAVPAGW  244



>emb|CDP04049.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE++C
Sbjct  30   GGWQGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C  G+ITVTATNFCPPNFAL N++GGWCNPP QHFDLAEPAFLQIAQYRAGIV
Sbjct  90   -DGDPKWCLGGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C KKGG+RFT+NGH++FNL+L+TNV GAGDI +V IKGSRTGW  MSRNWGQ
Sbjct  149  PVAYRRVPCAKKGGIRFTVNGHSFFNLVLVTNVAGAGDIHAVSIKGSRTGWQTMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++S+LNGQSLS  VTASDGRTVT+ +VAP +W
Sbjct  209  NWQSNSHLNGQSLSITVTASDGRTVTSYNVAPANW  243



>emb|CDY23890.1| BnaC04g01470D [Brassica napus]
Length=255

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE+KC
Sbjct  30   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMKC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C   +ITVTATNFCPPNF L+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  90   NDDP-RWCLGSTITVTATNFCPPNFGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG-WMPMSRNWG  704
             V++RR+ C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V I+GS+TG W  MSRNWG
Sbjct  149  PVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIRGSKTGSWQAMSRNWG  208

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLN QSLSF+VT SDGRTV + D+AP +W
Sbjct  209  QNWQSNSYLNDQSLSFQVTTSDGRTVVSNDIAPSNW  244



>gb|AAB40635.1| expansin, partial [Pinus taeda]
Length=232

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCGACYE++C
Sbjct  8    GGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMRC  67

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL N++GGWCNPPLQHFD+AEPAFL+IA+YR GIV
Sbjct  68   NDDP-QWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             + Y R+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGSR+GW PMSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRSGWQPMSRNWGQ  186

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTV + +VAP +W
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNW  221



>ref|XP_009387755.1| PREDICTED: expansin-A2 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 200/246 (81%), Gaps = 10/246 (4%)
 Frame = +3

Query  75   FHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            +H  FF+L       SSC  FF  G    + G W+N HATFYGG DA+GTMGGACGYGNL
Sbjct  9    YHVLFFLL------PSSC--FFLSGALAESYG-WRNAHATFYGGGDASGTMGGACGYGNL  59

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            Y QGYGTNTAALSTALF +G SCGACYE++C  ++ R C PGSI VTATNFCPPN+AL N
Sbjct  60   YGQGYGTNTAALSTALFENGLSCGACYEMRC-ADDPRWCLPGSIVVTATNFCPPNYALPN  118

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPPLQH DLAEPAFLQIAQYRAGIV V++RR+ C +KGG+RFTING +YFNL+L
Sbjct  119  DNGGWCNPPLQHLDLAEPAFLQIAQYRAGIVPVSFRRVPCVRKGGIRFTINGRSYFNLVL  178

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGD+ +V IKGS+TGW  MSRNWGQNW+++SYL+GQSLSF+VT  DGRTVT  +
Sbjct  179  ITNVGGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNSYLDGQSLSFQVTTGDGRTVTGYN  238

Query  795  VAPPDW  812
            VAP  W
Sbjct  239  VAPAGW  244



>gb|AAD47901.1|AF085330_1 expansin [Pinus taeda]
Length=253

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCGACYE++C
Sbjct  29   GGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMRC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL N++GGWCNPPLQHFD+AEPAFL+IA+YR GIV
Sbjct  89   NDDP-QWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             + Y R+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGSR+GW PMSRNWGQ
Sbjct  148  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRSGWQPMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTV + +VAP +W
Sbjct  208  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNW  242



>gb|AEN70885.1| alpha-expansin 1 [Gossypium davidsonii]
 gb|AEN70886.1| alpha-expansin 1 [Gossypium klotzschianum]
Length=258

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 200/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYS GYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSHGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +V P  W
Sbjct  197  KGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGW  247



>dbj|BAC66697.1| expansin [Vitis labrusca x Vitis vinifera]
Length=252

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGACYE+KC
Sbjct  28   GGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYEMKC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL+N +GGWCNPPLQHFDLAEPAFLQIAQY +   
Sbjct  88   NDDP-KWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYPSWNR  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
               ++R+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW PMSRNWGQ
Sbjct  147  TCVFQRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VTASDGRT+T+L+VAP  W
Sbjct  207  NWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGW  241



>gb|KDO43109.1| hypothetical protein CISIN_1g025809mg [Citrus sinensis]
Length=247

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G +CGAC+E+KC
Sbjct  23   GGWSSAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGVTCGACFEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               ++R C PGSI VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IA Y+AGIV
Sbjct  83   -VNDNRWCLPGSIIVTATNFCPPNHALPNNAGGWCNPPLQHFDLSQPIFQHIAHYKAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V YRR+AC K GG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  142  PVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVSVSIKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDGR+V +++VAPP+W
Sbjct  202  NWQSNSYLNGQALSFQVTTSDGRSVISINVAPPNW  236



>ref|XP_009142702.1| PREDICTED: expansin-A8 [Brassica rapa]
 emb|CDX79977.1| BnaA05g01790D [Brassica napus]
Length=257

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE+KC
Sbjct  32   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMKC  91

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C   +ITVTATNFCPPNF L+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  92   NDDP-RWCLGSTITVTATNFCPPNFGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  150

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG-WMPMSRNWG  704
             V++RR+ C KKGG+RFTINGH+YFNL+LI+NVGGAGD+ +V I+GS+TG W  MSRNWG
Sbjct  151  PVSFRRVPCMKKGGVRFTINGHSYFNLVLISNVGGAGDVHAVSIRGSKTGSWQAMSRNWG  210

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLN QSLSF+VT SDGRTV + D+AP +W
Sbjct  211  QNWQSNSYLNDQSLSFQVTTSDGRTVVSNDIAPSNW  246



>ref|XP_007137631.1| hypothetical protein PHAVU_009G142800g [Phaseolus vulgaris]
 gb|ESW09625.1| hypothetical protein PHAVU_009G142800g [Phaseolus vulgaris]
Length=252

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C + + R
Sbjct  34   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC-DSDPR  92

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFAL+N++GGWCNPPLQHFDLAEPAFLQIAQY+AGIV V++RR
Sbjct  93   WCLPGSIIVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYKAGIVPVSFRR  152

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+L+TNVGGAGD+ SV IKGSRT W  MSRNWGQNW+++S
Sbjct  153  VSCVKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSRTNWQTMSRNWGQNWQSNS  212

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGR +T+ ++ P +W
Sbjct  213  YLNGQSLSFQVTTSDGRILTSNNIVPANW  241



>gb|ADC35366.1| alpha-expansin 3 [Coffea arabica]
Length=254

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE++C
Sbjct  30   GGWQGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C  G+ITVTATNFCPPNFAL N++GGWCNPP QHFDLAEPAFLQIAQYRAGIV
Sbjct  90   -DGDPKWCLGGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C KKGG+RFTINGH++FNL+L+TNV GAGDI +V IKGSRTGW  MSRNWGQ
Sbjct  149  PVAYRRVPCAKKGGIRFTINGHSFFNLVLVTNVAGAGDILTVSIKGSRTGWQTMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++S+LNGQSLS  VTASDGRTVT+  VAP +W
Sbjct  209  NWQSNSHLNGQSLSIMVTASDGRTVTSYSVAPANW  243



>gb|EYU28773.1| hypothetical protein MIMGU_mgv1a012521mg [Erythranthe guttata]
Length=248

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACY+++C
Sbjct  23   GGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYQIRC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               E R C PGSI VTATNFCPPN AL NN GGWCNPPL HFDL++P F +IAQYRAGIV
Sbjct  83   -ANERRWCLPGSILVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYRAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+AC ++GG+RFTINGH+YFNL+LITNVGGAGD+ +V +KGSRTGW PMSRNWGQ
Sbjct  142  PVAYRRVACRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSVKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++S LNGQSLSF+VT SDGRTV + + AP  W
Sbjct  202  NWQSNSNLNGQSLSFKVTTSDGRTVVSYNAAPASW  236



>ref|XP_009776279.1| PREDICTED: expansin-A8-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009776280.1| PREDICTED: expansin-A8-like isoform X1 [Nicotiana sylvestris]
Length=254

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G WKN HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYEL C
Sbjct  30   GGWKNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYELTC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               +++ C  G+ITVTATNFCPPN +L N++GGWCNPPLQHFDLAEPAFL++AQYRAGIV
Sbjct  90   -SNDAQWCLQGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKLAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR++C KKGG+RFTINGH+YFNL+L+TNVGGAGD++SV IKGS +GW  MSRNWGQ
Sbjct  149  PVSFRRVSCNKKGGIRFTINGHSYFNLVLVTNVGGAGDVNSVSIKGSGSGWQAMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLN QSLSF+VT SDGRT+T+ +VAP +W
Sbjct  209  NWQSNSYLNSQSLSFQVTTSDGRTITSYNVAPHNW  243



>ref|XP_003616026.1| Expansin [Medicago truncatula]
 gb|AES98984.1| expansin A10 [Medicago truncatula]
Length=251

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 195/242 (81%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
             F L + + FH     +          G W++GHATFYGG DA+ TMGGACGYGNLY+QG
Sbjct  10   MFFLFIEMHFHGVIANY----------GGWQSGHATFYGGGDASATMGGACGYGNLYNQG  59

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCGACYE++C   + R C   +I VTATNFCPPN AL NN+GG
Sbjct  60   YGTNTAALSTALFNNGLSCGACYEMRC-VGDPRWCKHSTIVVTATNFCPPNSALPNNNGG  118

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFD+AEPAFLQIAQY+AGIV V++RR++C KKGG+RFTINGH+YFNL+LITNV
Sbjct  119  WCNPPLQHFDMAEPAFLQIAQYKAGIVPVSFRRVSCIKKGGIRFTINGHSYFNLILITNV  178

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
             GAGD  +V IKGS+T W PMSRNWGQNW+++SYLNGQSLSF+VT  DGRTVT+ +VAP 
Sbjct  179  AGAGDAHAVSIKGSKTSWQPMSRNWGQNWQSNSYLNGQSLSFKVTTGDGRTVTSYNVAPA  238

Query  807  DW  812
            +W
Sbjct  239  NW  240



>ref|XP_008782645.1| PREDICTED: expansin-A2-like [Phoenix dactylifera]
Length=257

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 189/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+  HATFYGG DA+GTMGGACGYGNLY QGYGTNTAALSTALFN+G SCGACYE++C  
Sbjct  35   WQTAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLSCGACYEMRC-A  93

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++SR C PGSI VTATNFCPPN AL N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV V
Sbjct  94   DDSRWCLPGSIIVTATNFCPPNNALPNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  153

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            ++RR+ C KKGG+RFTINGH+YFNL+LITNV G+GD+ +V IKGS+TGW  MS+NWGQNW
Sbjct  154  SFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGSGDVHAVSIKGSKTGWQAMSQNWGQNW  213

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            ++++YL+GQSLSF+VT SDGRTVT+ DVAP  W
Sbjct  214  QSNAYLDGQSLSFQVTTSDGRTVTSNDVAPAGW  246



>gb|AAM46997.1|AF512539_1 alpha-expansin precursor [Gossypium hirsutum]
Length=258

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 204/246 (83%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFL+IA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLRIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI S  IKGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +
Sbjct  182  ITNVGGAGDITSESIKGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>ref|XP_009410516.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=253

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 189/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYELKC +
Sbjct  31   WESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYELKC-D  89

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++ R C PGSI VTATNFCPPN AL +++GGWCNPP  HFD+A+PAFLQIAQYRAGIV V
Sbjct  90   DDPRWCLPGSIVVTATNFCPPNNALPSDNGGWCNPPRPHFDMAQPAFLQIAQYRAGIVPV  149

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            A+RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGS++GW  MSRNWGQNW
Sbjct  150  AFRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKSGWQVMSRNWGQNW  209

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYL+GQSLSFR+TASDGRT+T+ +VAP  W
Sbjct  210  QSNSYLDGQSLSFRITASDGRTITSFNVAPAGW  242



>gb|AEN70881.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 200/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFL+IA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLRIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +V P  W
Sbjct  197  KGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYNVVPAGW  247



>gb|ABL86681.1| EX4 [Gossypium barbadense]
Length=262

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 200/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            K S+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +V P  W
Sbjct  197  KCSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGW  247



>ref|XP_010043148.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW88332.1| hypothetical protein EUGRSUZ_A00721 [Eucalyptus grandis]
Length=256

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGT TAALSTALFNSG SCG+CYEL+C
Sbjct  32   GPWQSAHATFYGGHDASGTMGGACGYGNLYSQGYGTQTAALSTALFNSGLSCGSCYELRC  91

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            + +  + C P +I VTATNFCPPN+ALA ++GGWCNPP  HFDLAEPAFLQIAQYRAGIV
Sbjct  92   SGDP-KWCLPHAIMVTATNFCPPNYALAGDNGGWCNPPRAHFDLAEPAFLQIAQYRAGIV  150

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGGMRFTINGH+YFNL+L+TNV GAGD+ SV IKGSRTGWMPMSRNWGQ
Sbjct  151  PVSFRRVPCVKKGGMRFTINGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWMPMSRNWGQ  210

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF VTAS+GRT+T  +V P  W
Sbjct  211  NWQSNSYLNGQSLSFTVTASNGRTLTTYNVVPAGW  245



>ref|XP_009384320.1| PREDICTED: expansin-A2-like [Musa acuminata subsp. malaccensis]
Length=250

 Score =   314 bits (805),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 198/244 (81%), Gaps = 7/244 (3%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYS  260
            FP F L+ +    SS G    G    S    W+N HATFYGG DA+GTMGGACGYG+LYS
Sbjct  3    FPGFSLLFLF---SSIGLLAAGTSGDSG---WQNAHATFYGGGDASGTMGGACGYGDLYS  56

Query  261  QGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNH  440
            QGYGTNTAALSTALF  G+SCGACYEL+C +++ + C  GSI VTATNFCPPN AL N++
Sbjct  57   QGYGTNTAALSTALFGDGASCGACYELRC-DDDPQWCLSGSIVVTATNFCPPNNALPNDN  115

Query  441  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLIT  620
            GGWCN PLQHFD+AEPAFLQIAQYRAGIV VA+RR+ C KKGG+RFTINGH+YFNL+LIT
Sbjct  116  GGWCNLPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLIT  175

Query  621  NVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVA  800
            NVGGAGD+ +V IKGS TGW  MSRNWGQNW++++YLNGQSLSF+VT SDGRTV + DVA
Sbjct  176  NVGGAGDVHAVAIKGSSTGWQTMSRNWGQNWQSNAYLNGQSLSFQVTTSDGRTVISNDVA  235

Query  801  PPDW  812
            P  W
Sbjct  236  PAGW  239



>gb|ABL86680.1| EXA1 [Gossypium barbadense]
 gb|ADY68808.1| alpha-expansin 1 [Gossypium barbadense]
 gb|ADY68809.1| alpha-expansin 1 [Gossypium barbadense]
 gb|AEN70872.1| alpha-expansin 1 [Gossypium mustelinum]
 gb|AEN70873.1| alpha-expansin 1 [Gossypium darwinii]
 gb|AEN70874.1| alpha-expansin 1 [Gossypium darwinii]
 gb|AEN70877.1| alpha-expansin 1 [Gossypium barbadense var. brasiliense]
 gb|AEN70878.1| alpha-expansin 1 [Gossypium barbadense var. brasiliense]
 gb|AEN70879.1| alpha-expansin 1 [Gossypium barbadense var. peruvianum]
 gb|AEN70880.1| alpha-expansin 1 [Gossypium barbadense var. peruvianum]
Length=258

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 200/231 (87%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            K S+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+TN +V P  W
Sbjct  197  KCSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITNYNVVPAGW  247



>ref|NP_001240136.1| expansin-A1-like precursor [Glycine max]
 ref|XP_006574400.1| PREDICTED: expansin-A1-like isoform X1 [Glycine max]
 gb|ACU24340.1| unknown [Glycine max]
 gb|AEK69292.1| expansin A4 [Glycine max]
 gb|KHN12193.1| Expansin-A1 [Glycine soja]
Length=250

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 186/213 (87%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C  
Sbjct  27   WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCVN  86

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            +  R C PGSI VTATNFCPPN AL NN GGWCNPP+ HFDL++P FL+IAQYRAGIV V
Sbjct  87   DH-RWCLPGSIMVTATNFCPPNNALPNNAGGWCNPPMHHFDLSQPVFLRIAQYRAGIVPV  145

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            +YRR+ C ++GG+RFTINGH+YFNL+LITNVGGAGD+  V IKGSRTGWMPMSRNWGQNW
Sbjct  146  SYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHGVAIKGSRTGWMPMSRNWGQNW  205

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            ++++YLNGQSLSF+VT SDGRT  + +VAP  W
Sbjct  206  QSNNYLNGQSLSFKVTTSDGRTAVSYNVAPAGW  238



>ref|XP_010093601.1| hypothetical protein L484_006489 [Morus notabilis]
 gb|EXB54329.1| hypothetical protein L484_006489 [Morus notabilis]
Length=251

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 196/243 (81%), Gaps = 9/243 (4%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHG-GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQ  263
              + ++ + F  S G F HG GE       W + HATFYGG DA+GTMGGACGYGNLYSQ
Sbjct  5    LVVFIMAIGF-PSMGLFAHGYGEG------WSDAHATFYGGGDASGTMGGACGYGNLYSQ  57

Query  264  GYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHG  443
            GYGTNTAALSTALFN+G SCGAC+E+KC   + + C PGS+ VTATNFCPPN AL NN G
Sbjct  58   GYGTNTAALSTALFNNGMSCGACFEIKC-VSDPKWCLPGSVVVTATNFCPPNNALPNNAG  116

Query  444  GWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITN  623
            GWCNPP QHFDL++P F QIAQYRAGIV ++YRR+ C K+GG+RFTINGH+YFNL+LITN
Sbjct  117  GWCNPPQQHFDLSQPVFQQIAQYRAGIVPISYRRVPCRKRGGIRFTINGHSYFNLVLITN  176

Query  624  VGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAP  803
            VGGAGD+ +V IKGSRTGW PMSRNWGQNW+++SYLNGQSLSF+VT SDGRT+ + +V P
Sbjct  177  VGGAGDVHTVSIKGSRTGWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTIVSNNVVP  236

Query  804  PDW  812
              W
Sbjct  237  AGW  239



>gb|AAY43797.1| expansin [Gossypium hirsutum]
Length=258

 Score =   314 bits (805),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 199/231 (86%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LITNVGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGS+TGW+PMSRNWGQNW++++Y NGQSLSF+VTASD RT+TN +V P  W
Sbjct  197  KGSKTGWLPMSRNWGQNWQSNAYFNGQSLSFKVTASDSRTITNYNVVPAGW  247



>ref|XP_010470942.1| PREDICTED: expansin-A1-like [Camelina sativa]
Length=251

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 195/241 (81%), Gaps = 8/241 (3%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F+ + +L   +SC   + GG        W N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  7    FLFMAILGVMTSCVNGYAGG-------GWVNAHATFYGGGDASGTMGGACGYGNLYSQGY  59

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCGAC+EL+C + + + C PGSI VTATNFCPPN AL NN GGW
Sbjct  60   GTNTAALSTALFNNGLSCGACFELRC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGGW  118

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDL++P F +IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  119  CNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVG  178

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ SV +KGSRTGW  MSRNWGQNW+++SYLNGQ+LSF++T SDGRT+ + + AP  
Sbjct  179  GAGDVHSVMVKGSRTGWQAMSRNWGQNWQSNSYLNGQALSFKITTSDGRTIISNNAAPAG  238

Query  810  W  812
            W
Sbjct  239  W  239



>ref|XP_008798561.1| PREDICTED: expansin-A8-like [Phoenix dactylifera]
Length=250

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 188/213 (88%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALF  G SCG+CYEL+CN+
Sbjct  28   WESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFKDGLSCGSCYELRCND  87

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            +  R C PG+I VTATNFCPPN ALAN++GGWCNPPLQHFDLAEPAFL+IAQYRAGIV V
Sbjct  88   DP-RWCLPGTIVVTATNFCPPNNALANDNGGWCNPPLQHFDLAEPAFLRIAQYRAGIVPV  146

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            ++RR+ C KKGG+RFTINGH+YFNL+LI+NV GAGD+ +V IKGS+TGW  MSRNWGQNW
Sbjct  147  SFRRVPCVKKGGIRFTINGHSYFNLVLISNVAGAGDVHAVSIKGSKTGWQAMSRNWGQNW  206

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            ++++YLNGQSLSFRVT SDGRTVT+ +  P  W
Sbjct  207  QSNAYLNGQSLSFRVTTSDGRTVTSYNAVPAGW  239



>gb|AFK34543.1| unknown [Medicago truncatula]
Length=248

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 196/242 (81%), Gaps = 8/242 (3%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            F  LVLV         + +GG        W N HATFYGG+DA+GTMGGACGYGNLYSQG
Sbjct  3    FIGLVLVCSLTMFSSVYAYGG-------GWTNAHATFYGGSDASGTMGGACGYGNLYSQG  55

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCG+CYE++C   + R C PGSI VTATNFCPPN AL NN GG
Sbjct  56   YGTNTAALSTALFNNGLSCGSCYEIRC-ANDHRWCLPGSIVVTATNFCPPNNALPNNDGG  114

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPLQHFDLA+P FL+IAQY+AGIV V +RR++C +KGG+RFTINGH+YFNL+LITNV
Sbjct  115  WCNPPLQHFDLAQPVFLRIAQYKAGIVPVDFRRVSCRRKGGIRFTINGHSYFNLVLITNV  174

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ +  IKGS+TGW+ MSRNWGQNW++++YLNGQSLSF+VT SDGRTV + +VAP 
Sbjct  175  GGAGDVHAASIKGSKTGWISMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSNNVAPA  234

Query  807  DW  812
             W
Sbjct  235  GW  236



>ref|XP_010922733.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=254

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 192/214 (90%), Gaps = 1/214 (0%)
 Frame = +3

Query  171  DWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCN  350
            DW++ HATFYGG DA+GTMGGACGYGNLYSQGYGT++AALSTALFN+G SCG+CYEL+C 
Sbjct  31   DWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTSSAALSTALFNNGLSCGSCYELRC-  89

Query  351  EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVA  530
            +++ + C PG+I VTATNFCPPN+ALAN++GGWCNPP QHFDLAEPAFL+IAQYRAGIV 
Sbjct  90   DDDPKWCLPGTIVVTATNFCPPNYALANDNGGWCNPPRQHFDLAEPAFLRIAQYRAGIVP  149

Query  531  VAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQN  710
            V++RR+ C KKGG+RFTINGH+YFNL+L+TNV GAGD+ +V IKGS+TGW  MS+NWGQN
Sbjct  150  VSFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVHAVSIKGSKTGWQAMSQNWGQN  209

Query  711  WEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            W++++YL+GQSLSFRVT SDGRTVT+ DV P  W
Sbjct  210  WQSNAYLDGQSLSFRVTTSDGRTVTSYDVVPAGW  243



>gb|AAO92741.1| expansin [Gossypium hirsutum]
Length=258

 Score =   314 bits (804),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 168/246 (68%), Positives = 204/246 (83%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEPAFL+IA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPAFLRIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            ITNVGGAGDI SV IK S+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASD RT+TN +
Sbjct  182  ITNVGGAGDITSVSIKVSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>gb|KHN04238.1| Expansin-A8 [Glycine soja]
Length=255

 Score =   314 bits (804),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGT+T ALSTALFN+G SCG+CYE++C
Sbjct  31   GSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGSCYEMRC  90

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             +++ R C PGSITVTATNFCPPN +L NN+GGWCNPPLQHFD+AEPAFLQIA+YRAGIV
Sbjct  91   -DDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEYRAGIV  149

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD++SV IKGS+TGW PMSRNWGQ
Sbjct  150  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQPMSRNWGQ  209

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  210  NWQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANW  244



>ref|XP_004240235.1| PREDICTED: expansin-A8-like [Solanum lycopersicum]
Length=258

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = +3

Query  48   LACLFSMENFHFPFFILVLV-LCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgt  224
            +A  +S+  F     +L+   LCF+ S G            G W++ HAT YGG DA+GT
Sbjct  1    MAVYYSLSTFSIFHLLLIFTSLCFNESFGD----------NGGWQSAHATLYGGGDASGT  50

Query  225  mggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGS-ITVTAT  401
            MGGACGYGNL SQGYGTNTAALST+LFN+G +CGACY+LKCN  + ++C PG+ ITVTAT
Sbjct  51   MGGACGYGNLNSQGYGTNTAALSTSLFNNGLTCGACYKLKCNNNDDKLCLPGTTITVTAT  110

Query  402  NFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFT  581
            NFCPPN +L+NN+GGWCNPPLQHFDLA+PAFL+IAQY+AGIV ++++R+ C KKGG+RFT
Sbjct  111  NFCPPNPSLSNNNGGWCNPPLQHFDLAQPAFLKIAQYKAGIVPISFQRVPCMKKGGIRFT  170

Query  582  INGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVT  761
            INGH+Y+NL+L+TNVGGAGD+ SV IKGS+ GW  MSRNWGQNW+ ++YLNGQSLSF+VT
Sbjct  171  INGHSYYNLILVTNVGGAGDVHSVSIKGSKNGWQLMSRNWGQNWQNNAYLNGQSLSFQVT  230

Query  762  ASDGRTVTNLDVAPPDW  812
             SDGRT+T+ + AP +W
Sbjct  231  TSDGRTITSNNAAPSNW  247



>gb|KCW83632.1| hypothetical protein EUGRSUZ_B00524, partial [Eucalyptus grandis]
Length=245

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGAC+E+KC  
Sbjct  25   WIDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIKC-V  83

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + R C+P SI VTATNFCPPN AL NN GGWCNPPL HFDL++P F QIAQY +GIV V
Sbjct  84   NDPRWCNPASIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQYSSGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            AYRR+ C+KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQNW
Sbjct  144  AYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVRSVSIKGSRTGWQPMSRNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++S L+GQSLSF VT SDGRTV + +VAPP+W
Sbjct  204  QSNSNLDGQSLSFSVTTSDGRTVVSNNVAPPNW  236



>ref|XP_006654542.1| PREDICTED: expansin-A4-like [Oryza brachyantha]
Length=246

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G++CG+CYEL+C
Sbjct  22   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRC  81

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + R C PGSITVTATNFCPPN+ L ++ GGWCNPP  HFD+AEPAFL IAQYRAGIV
Sbjct  82   -DNDGRWCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIV  140

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+YRR+ C K+GG+RFT+NGH+YFNL+L+TNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  141  PVSYRRVPCVKRGGIRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ  200

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++++L+GQSLSF+VTASDGRTVT+ +VA P W
Sbjct  201  NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW  235



>ref|XP_003538280.1| PREDICTED: expansin-A8 [Glycine max]
Length=255

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGT+T ALSTALFN+G SCG+CYE++C
Sbjct  31   GSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGSCYEMRC  90

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             +++ R C PGSITVTATNFCPPN +L NN+GGWCNPPLQHFD+AEPAFLQIA+YRAGIV
Sbjct  91   -DDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEYRAGIV  149

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD++SV IKGS+TGW PMSRNWGQ
Sbjct  150  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQPMSRNWGQ  209

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRTVT+ +VAP +W
Sbjct  210  NWQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANW  244



>ref|XP_004502832.1| PREDICTED: expansin-A8-like [Cicer arietinum]
Length=250

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C + + +
Sbjct  32   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC-DSDPK  90

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFA +N +GGWCNPPLQHFDLAEPAFLQIAQY+AGIV +++RR
Sbjct  91   WCLPGSILVTATNFCPPNFAQSNTNGGWCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRR  150

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            + C KKGG+RFTINGH+YFNL+L+TNVGGAGD+ SV IKGSRTGW  MSRNWGQNW++++
Sbjct  151  VPCVKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSRTGWQTMSRNWGQNWQSNN  210

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRT+T+ ++ P +W
Sbjct  211  YLNGQSLSFQVTTSDGRTITSNNIVPTNW  239



>ref|XP_008446373.1| PREDICTED: expansin-A1 [Cucumis melo]
Length=248

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 193/240 (80%), Gaps = 6/240 (3%)
 Frame = +3

Query  93   ILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYG  272
            +L+ +  F++   +      D  A G W   HATFYGG+DA+GTMGGACGYGNLYSQGYG
Sbjct  4    VLIFLAGFYAIVSSV-----DAYAGGGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYG  58

Query  273  TNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
            TNTAALSTALFN+G SCG+CYE++C   + R C PGSI VTATNFCPPN AL NN GGWC
Sbjct  59   TNTAALSTALFNNGLSCGSCYEIRC-ASDPRWCLPGSIVVTATNFCPPNNALPNNAGGWC  117

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPLQHFDL++P F  IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVGG
Sbjct  118  NPPLQHFDLSQPVFQHIAQYRAGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGG  177

Query  633  AGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            AGD+ SV IKGSRTGW  MSRNWGQNW+++SYLNGQSLSF+VT SDGRTV + +  P  W
Sbjct  178  AGDVHSVSIKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVISNNAVPAGW  237



>ref|XP_008797331.1| PREDICTED: expansin-A15-like [Phoenix dactylifera]
Length=247

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 188/213 (88%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W + HATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFNSG SCGAC+E++C +
Sbjct  25   WSDAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNSGLSCGACFEIQC-K  83

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++   C PGSI VTATNFCPPN AL NN GGWCNPPL HFDL++P F +IAQY+AGIV V
Sbjct  84   DDGNWCLPGSIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
             YRR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGS+TGW PMSRNWGQNW
Sbjct  144  QYRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSQTGWQPMSRNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYL+GQSLSFRV+ SDGRTVT++DVAP +W
Sbjct  204  QSNSYLDGQSLSFRVSTSDGRTVTSMDVAPHNW  236



>gb|ABR16833.1| unknown [Picea sitchensis]
Length=250

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 200/240 (83%), Gaps = 7/240 (3%)
 Frame = +3

Query  96   LVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGT  275
            L  V CF      ++  G   +    W++ HATFYGG+DA+GTMGGACGYGNLYSQGYGT
Sbjct  6    LASVFCF------WWIAGAAYALDSSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGT  59

Query  276  NTAALSTALFNSGSSCGACYELKCNEE-ESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
            NTAALSTALFN+G +CGACYE+KCNEE + + C PG++TVTATNFCPPN AL N++GGWC
Sbjct  60   NTAALSTALFNNGLTCGACYEMKCNEETDPQWCLPGTVTVTATNFCPPNNALPNDNGGWC  119

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPLQHFD+A+PA+ QIA YR GIV + +RR+ C +KGG+RFTINGH+YFNL+LITNVGG
Sbjct  120  NPPLQHFDMAQPAYQQIAIYRGGIVPIMFRRVPCVRKGGVRFTINGHSYFNLVLITNVGG  179

Query  633  AGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            AGD+++V IKGS +GW  MSRNWGQNW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  180  AGDVEAVSIKGSNSGWQAMSRNWGQNWQSNSYLNGQTLSFQVTTSDGRTVTSYNVAPANW  239



>ref|XP_010910535.1| PREDICTED: expansin-A1-like [Elaeis guineensis]
Length=250

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 194/241 (80%), Gaps = 8/241 (3%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F+LV +L   S    + HG         W   HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  6    FLLVSLLPLFSPAHGYGHGW-------GWSRAHATFYGGGDASGTMGGACGYGNLYSQGY  58

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN G SCGACYE++C ++  R C PGSI VTATNFCPPN AL NN GGW
Sbjct  59   GTNTAALSTALFNDGLSCGACYEIRCVDDH-RWCLPGSIVVTATNFCPPNNALPNNAGGW  117

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPPLQHFDL++P F  IAQY+AGIV VAYRR+ C+KKGG+RFTINGH+YFNL+LITNVG
Sbjct  118  CNPPLQHFDLSQPVFQHIAQYKAGIVPVAYRRVPCKKKGGIRFTINGHSYFNLVLITNVG  177

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ +V IKGSRTGW PMSRNWGQNW++++YLNG +LSF+VT SDGR+V + +VAP  
Sbjct  178  GAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGLALSFKVTTSDGRSVVSYNVAPSS  237

Query  810  W  812
            W
Sbjct  238  W  238



>ref|XP_008245002.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=257

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G+W+  HATFYGG+DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G SCGACY+L+C
Sbjct  31   GEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYQLRC  90

Query  348  N-EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGI  524
            N E +   C PG IT+TATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFL IA YRAGI
Sbjct  91   NHESDPNWCLPGGITITATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLHIAAYRAGI  150

Query  525  VAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWG  704
            V V ++R+ C KKGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGS+TGW+PMSRNWG
Sbjct  151  VPVLFKRVPCVKKGGIRFTMNGHSYFNLVLITNVGGAGDVRAVSIKGSKTGWLPMSRNWG  210

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLNGQSLSF+VTASDG T+ + +V P  W
Sbjct  211  QNWQSNSYLNGQSLSFKVTASDGLTLISSNVMPAGW  246



>ref|XP_010030057.1| PREDICTED: expansin-A15-like [Eucalyptus grandis]
Length=248

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGAC+E+KC  
Sbjct  25   WIDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIKC-V  83

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + R C+P SI VTATNFCPPN AL NN GGWCNPPL HFDL++P F QIAQY +GIV V
Sbjct  84   NDPRWCNPASIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQQIAQYSSGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            AYRR+ C+KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQNW
Sbjct  144  AYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDVRSVSIKGSRTGWQPMSRNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++S L+GQSLSF VT SDGRTV + +VAPP+W
Sbjct  204  QSNSNLDGQSLSFSVTTSDGRTVVSNNVAPPNW  236



>ref|NP_001280181.1| expansin-A8 precursor [Prunus mume]
 dbj|BAE48665.1| Expansin [Prunus mume]
Length=252

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE+KC + + +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMKC-DSDPK  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPN A +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR
Sbjct  94   WCLPGSIIVTATNFCPPNLAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSRNWGQNW+++S
Sbjct  154  VSCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQ+LSF+VT SDGRTVT+ +  P DW
Sbjct  214  YLNGQALSFQVTTSDGRTVTS-NAVPADW  241



>gb|AFB77225.1| expansin 3 [Betula platyphylla]
Length=249

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 199/249 (80%), Gaps = 11/249 (4%)
 Frame = +3

Query  66   MENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgY  245
            M        + + +LC   + G +          G W+  HATFYGG+DA+GTMGGACGY
Sbjct  1    MAILAIQLSLFLFILCLRGAYGHY---------DGGWQTAHATFYGGSDASGTMGGACGY  51

Query  246  GNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFA  425
            GNLYSQGYGT TAALSTALFN+G SCGACYEL+CN++  + C PG+ITVTATN CPPN A
Sbjct  52   GNLYSQGYGTKTAALSTALFNNGLSCGACYELQCNDDP-QWCLPGTITVTATNLCPPNQA  110

Query  426  LANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFN  605
            L+N++GGWCNPPLQHFDLAEPAFL +AQYRAGIV V  RR++C ++GG+RFTINGH+YFN
Sbjct  111  LSNDNGGWCNPPLQHFDLAEPAFLHVAQYRAGIVPV-LRRVSCSRRGGIRFTINGHSYFN  169

Query  606  LLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVT  785
            L+LI+NVGGAGD+ +V IKGSRTGW  MSRNWGQNW+++SYLNGQSLSF+VTASDG TVT
Sbjct  170  LVLISNVGGAGDVQTVSIKGSRTGWQTMSRNWGQNWQSNSYLNGQSLSFKVTASDGTTVT  229

Query  786  NLDVAPPDW  812
            + +V P  W
Sbjct  230  SYNVVPAGW  238



>ref|XP_010415602.1| PREDICTED: expansin-A1-like [Camelina sativa]
Length=251

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 195/241 (81%), Gaps = 8/241 (3%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F+ + +L   +SC   + GG        W N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  7    FLFMAILGVMTSCVNGYAGG-------GWVNAHATFYGGGDASGTMGGACGYGNLYSQGY  59

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCGAC+EL+C + + + C PGSI VTATNFCPPN AL NN GGW
Sbjct  60   GTNTAALSTALFNNGLSCGACFELRC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGGW  118

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDL++P F +IAQY+AGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  119  CNPPQQHFDLSQPVFQRIAQYKAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVG  178

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ SV +KGSRTGW  MSRNWGQNW+++SYLNGQ+LSF+VT SDGRT+ + + AP  
Sbjct  179  GAGDVHSVMVKGSRTGWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTIISNNAAPAG  238

Query  810  W  812
            W
Sbjct  239  W  239



>gb|AAD49956.1|AF167360_1 expansin [Rumex palustris]
Length=253

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            GDW  GHATFYGG DA+GTMGGACGYG LYSQGYGT+TAALSTALFN+G SCGAC+E+ C
Sbjct  29   GDWNGGHATFYGGGDASGTMGGACGYGKLYSQGYGTSTAALSTALFNNGLSCGACFEINC  88

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              +  R C  G ITVTATNFCPP+FALANN+GGWCNPPLQHFDLAEPAFLQIAQY AGIV
Sbjct  89   TRDP-RWCIGGVITVTATNFCPPSFALANNNGGWCNPPLQHFDLAEPAFLQIAQYHAGIV  147

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ SV IKGSR GW  MSRNWGQ
Sbjct  148  PVSFRRVPCGRKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSRGGWQAMSRNWGQ  207

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYL GQSLSF VT SDGRT+T+ +VAP  W
Sbjct  208  NWQSNSYLKGQSLSFMVTTSDGRTLTSFNVAPFKW  242



>gb|AAM46998.1|AF512540_1 alpha-expansin precursor [Gossypium hirsutum]
Length=258

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 198/231 (86%), Gaps = 6/231 (3%)
 Frame = +3

Query  126  CGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTA  299
            C + F G  G+D    G W+  HATFYGGADATGTMGGA GYGNLYSQGYGT+TAALSTA
Sbjct  21   CNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGARGYGNLYSQGYGTSTAALSTA  77

Query  300  LFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDL  479
            LFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++++GGWCNPP +H DL
Sbjct  78   LFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHLDL  136

Query  480  AEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFI  659
            AEPAFLQIA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++LIT+VGGAGDI SV I
Sbjct  137  AEPAFLQIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVLITDVGGAGDITSVSI  196

Query  660  KGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            KGS+TGW+PMSRNWGQNW++++YLNGQSLSF+VTASD RT+TN +V P  W
Sbjct  197  KGSKTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDSRTITNYNVVPAGW  247



>ref|XP_010938009.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=256

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 189/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C  
Sbjct  34   WQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC-A  92

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++ + C PGSI VTATN+CPPN+AL N++GGWCNPP +HFDLAEPAFLQIAQYRAGIV +
Sbjct  93   DDPQWCLPGSIIVTATNYCPPNYALPNDNGGWCNPPREHFDLAEPAFLQIAQYRAGIVPI  152

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            +YRR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS TGW  MSRNWGQNW
Sbjct  153  SYRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSNTGWQAMSRNWGQNW  212

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++ YLNGQSLSF+VT+SDG+TVT+ +V P +W
Sbjct  213  QSNGYLNGQSLSFQVTSSDGKTVTSYNVVPANW  245



>dbj|BAN09211.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=249

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYS GYGTNTAALSTALFN+G SCGACY +KC
Sbjct  24   GGWQTAHATFYGGGDASGTMGGACGYGNLYSAGYGTNTAALSTALFNNGLSCGACYAIKC  83

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            +  + + C  G ITVTATNFCPPN AL N++GGWCN P QHFDLAEPA+LQIAQYRAGIV
Sbjct  84   SSSDPKYCLGGMITVTATNFCPPNPALPNDNGGWCNFPRQHFDLAEPAYLQIAQYRAGIV  143

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V + R+ C+KKGG+RFTINGH+YFNL+L+TNVGGAGD+ S+ +KGSRTGW+P+SRNWGQ
Sbjct  144  PVDFMRVPCKKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSISVKGSRTGWVPLSRNWGQ  203

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ +VAPP+W
Sbjct  204  NWQSNSYLNGQSLSFQVTTSDGRTLTSNNVAPPNW  238



>ref|XP_007099524.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
 gb|EOY20506.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
Length=257

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 194/225 (86%), Gaps = 3/225 (1%)
 Frame = +3

Query  138  FHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGS  317
            FHG       G W+  HATFYGGADATGTMGGACGYGNLYSQGYGT TAALSTALFN+G 
Sbjct  25   FHGSNRDD--GGWQTAHATFYGGADATGTMGGACGYGNLYSQGYGTTTAALSTALFNNGL  82

Query  318  SCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFL  497
            +CGACYEL+CN++  + C   +ITVTATNFCPPN+AL++++GGWCNPP +HFDLAEPAFL
Sbjct  83   TCGACYELRCNDDP-KWCISRTITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFL  141

Query  498  QIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG  677
            QIA+YRAGIV V +RR++C KKGG+RFT+NGH+YFNL+LITNVGGAGDI S  IKGS+TG
Sbjct  142  QIAEYRAGIVPVLFRRVSCVKKGGIRFTLNGHSYFNLVLITNVGGAGDITSASIKGSKTG  201

Query  678  WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            W+PMSRNWGQNW+ ++YLNGQSLSF++TASDGRT+T  +V P  W
Sbjct  202  WLPMSRNWGQNWQNNAYLNGQSLSFKLTASDGRTITKYNVVPAGW  246



>ref|XP_008369371.1| PREDICTED: expansin-A8 [Malus domestica]
Length=254

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 187/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE+KC + + +
Sbjct  36   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMKC-DSDPK  94

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAF +IAQYRAGIV V++RR
Sbjct  95   WCLPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFEKIAQYRAGIVPVSFRR  154

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS TGW  MSRNWGQNW+++S
Sbjct  155  VSCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSNTGWQSMSRNWGQNWQSNS  214

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRT+T  +VAP +W
Sbjct  215  YLNGQSLSFQVTTSDGRTLTANNVAPGNW  243



>ref|XP_009141922.1| PREDICTED: expansin-A8-like [Brassica rapa]
Length=258

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE+KC
Sbjct  33   GGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMKC  92

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C   +ITVTATNFCPPN  L+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV
Sbjct  93   NDDP-RWCLGSTITVTATNFCPPNLGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  151

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG-WMPMSRNWG  704
             V++RR+ C KKGG+RFTINGH+YFNL+LI++VGGAGD+ +V I GS+TG W  MSRNWG
Sbjct  152  PVSFRRVPCMKKGGIRFTINGHSYFNLVLISHVGGAGDVHAVSISGSKTGSWQAMSRNWG  211

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLNGQSLSF+VT SDGRTV + +VAP +W
Sbjct  212  QNWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNW  247



>ref|XP_006445551.1| hypothetical protein CICLE_v10017738mg [Citrus clementina]
 ref|XP_006488964.1| PREDICTED: expansin-A10-like [Citrus sinensis]
 gb|ESR58791.1| hypothetical protein CICLE_v10017738mg [Citrus clementina]
 gb|KDO54531.1| hypothetical protein CISIN_1g025827mg [Citrus sinensis]
Length=247

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 196/242 (81%), Gaps = 11/242 (5%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
            + I+ L   F ++ G              W N HATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  6    YIIIALFTVFKAAVGK----------GAGWTNAHATFYGGGDASGTMGGACGYGNLYSQG  55

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAA+STALFN+G +CGACY +KC   ++R C PGSI VTATNFCPPNFAL+N +GG
Sbjct  56   YGTNTAAVSTALFNNGLNCGACYAIKC-VNDNRWCLPGSIIVTATNFCPPNFALSNTNGG  114

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPPL HFDL++P FL+IAQY+AGIV V YRR+AC+K GG+RFTINGH+YFNL+LITNV
Sbjct  115  WCNPPLHHFDLSQPVFLKIAQYKAGIVPVQYRRVACKKSGGIRFTINGHSYFNLVLITNV  174

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ +V IKGS+TGW  +SRNWGQNW+++SYLNGQ+LSF+VT SDGRTV + +VAP 
Sbjct  175  GGAGDVVAVSIKGSKTGWQALSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVISNNVAPA  234

Query  807  DW  812
            +W
Sbjct  235  NW  236



>gb|ACA05165.1| expansin 2 [Dimocarpus longan]
Length=250

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = +3

Query  159  SAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYE  338
            + P  W +GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCG+CYE
Sbjct  22   AGPSGWISGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYE  81

Query  339  LKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRA  518
            +KC   ++R C PGSI VTATNFCPPN AL N+ GGWCNPP QHFDL++P F  IAQYRA
Sbjct  82   IKC-VNDARWCLPGSIVVTATNFCPPNNALPNDAGGWCNPPQQHFDLSQPVFQHIAQYRA  140

Query  519  GIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRN  698
            GIV VAYRR+ C +KGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW  MSRN
Sbjct  141  GIVPVAYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQAMSRN  200

Query  699  WGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            WGQNW++++ LNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  201  WGQNWQSNTLLNGQSLSFKVTTSDGRTVVSNNVAPAGW  238



>emb|CDP13911.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   312 bits (799),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 196/222 (88%), Gaps = 4/222 (2%)
 Frame = +3

Query  156  PSAPGD---WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCG  326
            P+A GD   W++ HATFYGG DA+GTMGGACGYGNLYSQGYGT+TAALSTALFN+G +CG
Sbjct  4    PTAFGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGLACG  63

Query  327  ACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIA  506
            +CYE++C + + + C PG+ITVTATNFCPPN AL N++GGWCNPP QHFDLAEPAFLQIA
Sbjct  64   SCYEIRC-DSDPQACLPGTITVTATNFCPPNPALPNDNGGWCNPPRQHFDLAEPAFLQIA  122

Query  507  QYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMP  686
            QYRAGIV V+++R+ C KKGG+R+TINGH+YFNL+L+TNV GAGD+ +V IKGSRTGW  
Sbjct  123  QYRAGIVPVSFQRVPCSKKGGVRYTINGHSYFNLVLVTNVAGAGDVHTVAIKGSRTGWQS  182

Query  687  MSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            MSRNWGQNW+++SYLNGQ+LSF++T SDGRT+T+ +VAP +W
Sbjct  183  MSRNWGQNWQSNSYLNGQTLSFQITTSDGRTLTSYNVAPANW  224



>gb|AEQ55281.1| expansin [Breonia chinensis]
 gb|AEQ55296.1| expansin [Breonia chinensis]
Length=247

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+C+E++C
Sbjct  22   GGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFEIRC  81

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + + C PG+I VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IAQYRAGIV
Sbjct  82   -VNDPKWCLPGTIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIV  140

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C +KGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW  MSRNWGQ
Sbjct  141  PVAYRRLPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHSVEIKGSRTGWQQMSRNWGQ  200

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGR V + +VAPP W
Sbjct  201  NWQSNTYLNGQSLSFKVTTSDGRRVVSYNVAPPGW  235



>gb|AAR82851.1| expansin-3 [Petunia x hybrida]
Length=251

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATF GG DA+GTMGGACGYGNLYSQGYGT TAALSTALFN G SCGAC+EL+C
Sbjct  27   GGWQTAHATFCGGGDASGTMGGACGYGNLYSQGYGTKTAALSTALFNDGLSCGACFELRC  86

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               E R C PG+ITVTATNFCPPNFAL +++GGWCNPP  HFD+AEPAFLQIAQYRAGIV
Sbjct  87   -AGEPRWCLPGTITVTATNFCPPNFALPSDNGGWCNPPRPHFDMAEPAFLQIAQYRAGIV  145

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             +A+RR+ C KKGG+RFTINGH+YFNL+L+TNV G GDI SV IKGSRTGW PMSRNWGQ
Sbjct  146  PIAFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDIHSVSIKGSRTGWQPMSRNWGQ  205

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSFRVT+ DGRT+T+ +VAP +W
Sbjct  206  NWQSNSYLNGQTLSFRVTSGDGRTLTSYNVAPTNW  240



>gb|AAB40634.1| expansin, partial [Pinus taeda]
Length=232

 Score =   312 bits (799),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCGACYE++C
Sbjct  8    GGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMRC  67

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  + C PG++TVTATNFCPPN AL N++GGWCNPPLQHFD+AEPAFL+IA+YR GIV
Sbjct  68   NDDP-QWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             + Y R+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGS +GW PMSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSMSGWQPMSRNWGQ  186

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+ + +VAP +W
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTIVSNNVAPSNW  221



>ref|XP_010917068.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=248

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGACYE++C
Sbjct  23   GGWSSAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYEIRC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              +  + C PGSI VTATNFCPPN AL N+ GGWCNPPLQHFDL++P F  IAQYRAGIV
Sbjct  83   VNDR-QWCLPGSIVVTATNFCPPNSALPNDAGGWCNPPLQHFDLSQPVFQHIAQYRAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C K+GG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW PMSRNWGQ
Sbjct  142  PVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQ+LSF+VT SDGR+V + +V P  W
Sbjct  202  NWQSNAYLNGQALSFKVTTSDGRSVVSYNVVPAGW  236



>ref|XP_007011319.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
 gb|EOY20129.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
Length=253

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 187/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C + + +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC-DNDPK  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C  GSI VTATNFCPPN AL+N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR
Sbjct  94   WCLAGSIIVTATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            + C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGS TGW PMSRNWGQNW+++S
Sbjct  154  VPCTKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSNTGWQPMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRTVT+ +V P  W
Sbjct  214  YLNGQSLSFQVTTSDGRTVTSYNVVPGSW  242



>gb|AAL87022.1| cell wall protein EXP3 precursor [Mirabilis jalapa]
Length=253

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 195/249 (78%), Gaps = 10/249 (4%)
 Frame = +3

Query  66   MENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgY  245
            + +    FF +   LC  S                 W N HATFYGG DA+GTMGGACGY
Sbjct  4    LRSISLAFFFITFNLCLSS---------VHCDNGNGWINAHATFYGGGDASGTMGGACGY  54

Query  246  GNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFA  425
            GNLYSQGYGTNTAALSTALFNSG SCG+CYE+KC ++ S  C PGSI VTATNFCPPN+A
Sbjct  55   GNLYSQGYGTNTAALSTALFNSGLSCGSCYEIKCKDDASW-CLPGSIIVTATNFCPPNYA  113

Query  426  LANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFN  605
            L+N +GGWCNPPLQHFD+A+PAFLQIA+YRAGIV V++RRI C +KGG+RFTINGH+YFN
Sbjct  114  LSNTNGGWCNPPLQHFDMAQPAFLQIAKYRAGIVPVSFRRIPCVRKGGIRFTINGHSYFN  173

Query  606  LLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVT  785
            L+LITNV GAGD+ SV IKGS TGW  MSRNWGQNW+++ YLNGQ+LSF+VT SDGR VT
Sbjct  174  LVLITNVAGAGDVHSVSIKGSNTGWQAMSRNWGQNWQSNGYLNGQTLSFKVTTSDGRCVT  233

Query  786  NLDVAPPDW  812
            + ++ P +W
Sbjct  234  SNNIVPSNW  242



>ref|NP_001289231.1| expansin precursor [Pyrus x bretschneideri]
 ref|XP_009363799.1| PREDICTED: expansin-A8 [Pyrus x bretschneideri]
 dbj|BAC67188.1| expansin [Pyrus communis]
 gb|AGR44454.1| expansin 1 [Pyrus x bretschneideri]
Length=254

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 187/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE+KC + + +
Sbjct  36   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMKC-DSDPK  94

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAF +IAQYRAGIV V++RR
Sbjct  95   WCLPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFEKIAQYRAGIVPVSFRR  154

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS TGW  MSRNWGQNW+++S
Sbjct  155  VSCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSNTGWQAMSRNWGQNWQSNS  214

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQSLSF+VT SDGRT+T  +VAP +W
Sbjct  215  YLNGQSLSFQVTTSDGRTLTANNVAPGNW  243



>gb|AAB81662.1| expansin [Oryza sativa Indica Group]
Length=246

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G++CG+CYEL+C
Sbjct  22   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRC  81

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            +   S  C PGSITVTATNFCPPN+ L ++ GGWCNPP  HFD+AEPAFL IAQYRAGIV
Sbjct  82   DNAGSS-CLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIV  140

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFT+NGH+YFNL+L+TNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  141  PVSFRRVPCVKKGGIRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ  200

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++++L+GQSLSF+VTASDGRTVT+ +VA P W
Sbjct  201  NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW  235



>ref|NP_001055842.1| Os05g0477600 [Oryza sativa Japonica Group]
 sp|Q0DHB7.1|EXPA4_ORYSJ RecName: Full=Expansin-A4; AltName: Full=Alpha-expansin-4; AltName: 
Full=OsEXP4; AltName: Full=OsEXPA4; AltName: Full=OsaEXPa1.22; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2Y5R6.1|EXPA4_ORYSI RecName: Full=Expansin-A4; AltName: Full=Alpha-expansin-4; AltName: 
Full=OsEXP4; AltName: Full=OsEXPA4; AltName: Full=OsaEXPa1.22; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|AAL24481.1|AF394545_1 alpha-expansin OsEXPA4 [Oryza sativa]
 gb|AAT01362.1| alpha-expansin [Oryza sativa Japonica Group]
 dbj|BAF17756.1| Os05g0477600 [Oryza sativa Japonica Group]
 gb|EAY98426.1| hypothetical protein OsI_20341 [Oryza sativa Indica Group]
 dbj|BAG94480.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64095.1| hypothetical protein OsJ_18926 [Oryza sativa Japonica Group]
Length=246

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G++CG+CYEL+C
Sbjct  22   GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRC  81

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            +   S  C PGSITVTATNFCPPN+ L ++ GGWCNPP  HFD+AEPAFL IAQYRAGIV
Sbjct  82   DNAGSS-CLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIV  140

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFT+NGH+YFNL+L+TNV GAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  141  PVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ  200

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++++L+GQSLSF+VTASDGRTVT+ +VA P W
Sbjct  201  NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGW  235



>ref|XP_009387743.1| PREDICTED: expansin-A2-like [Musa acuminata subsp. malaccensis]
Length=255

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 197/238 (83%), Gaps = 4/238 (2%)
 Frame = +3

Query  99   VLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTN  278
            VL     S C  FF  G    + G W+N HATFYGG DA+GTMGGACGYGNLY QGYGTN
Sbjct  11   VLFFSLPSLC--FFLSGALADSYG-WRNAHATFYGGGDASGTMGGACGYGNLYGQGYGTN  67

Query  279  TAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNP  458
            TAALSTALF++G SCGACYE++C  +  + C PGS+ VTATNFCPPN+AL N++GGWCNP
Sbjct  68   TAALSTALFDNGLSCGACYEMRC-ADNPQWCLPGSVVVTATNFCPPNYALPNDNGGWCNP  126

Query  459  PLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAG  638
            PLQHFDLAEPAFLQIAQYRAGIV V++RR+ C +KGG+RFT+NGH+YFNL+LITNVGGAG
Sbjct  127  PLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCVRKGGIRFTVNGHSYFNLVLITNVGGAG  186

Query  639  DIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            D+ +V IKGS+TGW  MSRNWGQNW+++SYL+GQSLSF+VT  DG TVT+ +VAP  W
Sbjct  187  DVHAVSIKGSKTGWQSMSRNWGQNWQSNSYLDGQSLSFQVTTGDGSTVTSYNVAPAGW  244



>gb|KDP30638.1| hypothetical protein JCGZ_16203 [Jatropha curcas]
Length=247

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 186/213 (87%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSGSSCGAC+E+KC  
Sbjct  25   WTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGSSCGACFEIKCVN  84

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++ R C PGSI V+ATNFCPPNFAL NN+GGWCNPPLQHFDL++P F +IAQYRAGIV V
Sbjct  85   DK-RWCLPGSIMVSATNFCPPNFALPNNNGGWCNPPLQHFDLSQPVFQRIAQYRAGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
             YRR+ C K GG+RFTINGH+YFNL+LITNVGGAG++ +V IKGS+T W  MSRNWGQNW
Sbjct  144  QYRRVPCRKTGGIRFTINGHSYFNLVLITNVGGAGNVVAVSIKGSKTNWQAMSRNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYLNGQSLSF+VT SDG TV + +VAP +W
Sbjct  204  QSNSYLNGQSLSFKVTTSDGHTVVSNNVAPSNW  236



>ref|XP_003607738.1| Expansin [Medicago truncatula]
 gb|AES89935.1| expansin-A1-like protein [Medicago truncatula]
Length=284

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 201/251 (80%), Gaps = 10/251 (4%)
 Frame = +3

Query  60   FSMENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggac  239
             +++   F   +LV  L   SS   + +GG        W N HATFYGG+DA+GTMGGAC
Sbjct  32   LTIKEMAFIGLVLVCSLTMFSS--VYAYGG-------GWTNAHATFYGGSDASGTMGGAC  82

Query  240  gYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPN  419
            GYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C  +  R C PGSI VTATNFCPPN
Sbjct  83   GYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCANDH-RWCLPGSIVVTATNFCPPN  141

Query  420  FALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAY  599
             AL NN GGWCNPPLQHFDLA+P FL+IAQY+AGIV V +RR++C +KGG+RFTINGH+Y
Sbjct  142  NALPNNDGGWCNPPLQHFDLAQPVFLRIAQYKAGIVPVDFRRVSCRRKGGIRFTINGHSY  201

Query  600  FNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRT  779
            FNL+LITNVGGAGD+ +  IKGS+TGW+ MSRNWGQNW++++YLNGQSLSF+VT SDGRT
Sbjct  202  FNLVLITNVGGAGDVHAASIKGSKTGWISMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRT  261

Query  780  VTNLDVAPPDW  812
            V + +VAP  W
Sbjct  262  VVSNNVAPAGW  272



>gb|AAC39512.1| expansin [Gossypium hirsutum]
Length=258

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 203/246 (83%), Gaps = 11/246 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHG--GEDPSAPGDWKNGHATFYggadatgtmggacgYGNL  254
            FP F  +      S C + F G  G+D    G W+  HATFYGGADATGTMGGACGYGNL
Sbjct  11   FPLFFFLF-----SVCNSIFLGANGDDN---GGWQTAHATFYGGADATGTMGGACGYGNL  62

Query  255  YSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALAN  434
            YSQGYGT+TAALSTALFN+G SCGACYEL+CN +  + C   +ITVTATNFCPPN+AL++
Sbjct  63   YSQGYGTSTAALSTALFNNGLSCGACYELRCNNDP-QWCISRTITVTATNFCPPNYALSS  121

Query  435  NHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLL  614
            ++GGWCNPP +HFDLAEP FL+IA+YRAGIV V +RR++C KKGG+R+T+NGH+YFN++L
Sbjct  122  DNGGWCNPPREHFDLAEPRFLRIAEYRAGIVPVMFRRVSCVKKGGIRYTMNGHSYFNMVL  181

Query  615  ITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLD  794
            IT +GGAGDI SV IKGSRTGW+PMSRNWGQNW++++YLNGQSLSF+VTASDGRT+T  +
Sbjct  182  ITKLGGAGDITSVSIKGSRTGWLPMSRNWGQNWQSNAYLNGQSLSFKVTASDGRTITAYN  241

Query  795  VAPPDW  812
            V P  W
Sbjct  242  VVPAGW  247



>ref|XP_006302737.1| hypothetical protein CARUB_v10020849mg [Capsella rubella]
 gb|EOA35635.1| hypothetical protein CARUB_v10020849mg [Capsella rubella]
Length=250

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 195/241 (81%), Gaps = 8/241 (3%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F+ + +L   +SC   + GG        W N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  6    FLFMAILGVMTSCVNGYAGG-------GWVNAHATFYGGGDASGTMGGACGYGNLYSQGY  58

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCGAC+EL+C + + + C PGSI VTATNFCPPN AL NN GGW
Sbjct  59   GTNTAALSTALFNNGLSCGACFELRC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGGW  117

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDL++P F +IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  118  CNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVG  177

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ SV +KGSRTGW  MSRNWGQNW+++SYLNGQ+LSF+VT SDG+T+ + + AP  
Sbjct  178  GAGDVHSVMVKGSRTGWQSMSRNWGQNWQSNSYLNGQALSFKVTTSDGQTIISNNAAPAG  237

Query  810  W  812
            W
Sbjct  238  W  238



>gb|AAF32409.1|AF230276_1 alpha-expansin 3 [Triphysaria versicolor]
Length=247

 Score =   311 bits (798),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTA+FN+G SCG+CYE++C
Sbjct  22   GGWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNTGLSCGSCYEIRC  81

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + + C PGSI VTATNFCPPN AL NN GGWCNPPL HFDLA+P F  IAQY+AGIV
Sbjct  82   -VNDGKWCLPGSILVTATNFCPPNSALPNNAGGWCNPPLHHFDLAQPVFQHIAQYKAGIV  140

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+AC ++GG+RFTINGH+YFNL+L+TNVGGAGD+ +V IKGSRTGW PMSRNWGQ
Sbjct  141  PVAYRRVACRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  200

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++S LNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  201  NWQSNSNLNGQSLSFKVTTSDGRTVLSYNVAPARW  235



>ref|XP_004135171.1| PREDICTED: expansin-A1-like [Cucumis sativus]
 gb|KGN51933.1| Alpha-expansin 1 [Cucumis sativus]
Length=248

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 192/240 (80%), Gaps = 6/240 (3%)
 Frame = +3

Query  93   ILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYG  272
            +L+ +  F++   +      D    G W   HATFYGG+DA+GTMGGACGYGNLYSQGYG
Sbjct  4    VLIFLAGFYAIVSSV-----DAYGGGGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYG  58

Query  273  TNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
            TNTAALSTALFN+G SCG+CYE+KC   + R C PGSI VTATNFCPPN AL NN GGWC
Sbjct  59   TNTAALSTALFNNGLSCGSCYEIKC-ASDPRWCLPGSIVVTATNFCPPNNALPNNAGGWC  117

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPLQHFDL++P F  IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVGG
Sbjct  118  NPPLQHFDLSQPVFQHIAQYRAGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGG  177

Query  633  AGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            AGD+ SV I+GSRTGW  MSRNWGQNW+++SYLNGQSLSF+VT SDGRTV + +  P  W
Sbjct  178  AGDVHSVSIRGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVISNNAVPAGW  237



>gb|AAC33530.1| expansin [Prunus armeniaca]
Length=252

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +3

Query  186  HATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESR  365
            HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN G SCG+CYE++C + + +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRC-DSDPK  93

Query  366  VCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRR  545
             C PGSI VTATNFCPPN A +N++GGWCNPPLQHFDLAEPAFLQIAQYRAGIV +++RR
Sbjct  94   WCLPGSIIVTATNFCPPNLAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRR  153

Query  546  IACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHS  725
            ++C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGS+TGW  MSRNWGQNW+++S
Sbjct  154  VSCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNS  213

Query  726  YLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            YLNGQ+LSF+VT SDGRTVT+ +  P DW
Sbjct  214  YLNGQALSFQVTTSDGRTVTS-NAVPADW  241



>gb|AEC46865.1| expansin [Glycine max]
Length=254

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGNLYSQGYGT+T ALSTALFN+G SCG+CYE++C
Sbjct  30   GSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             +++ R C PGSITVTATNFCPPN +L NN+GGWCNPPLQHFD+AEPAFLQIA+YRAGIV
Sbjct  90   -DDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VA+RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD++SV IKGS+TGW PMSRNWGQ
Sbjct  149  PVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT T+ +VAP +W
Sbjct  209  NWQSNSYLNGQSLSFQVTTSDGRTATSFNVAPANW  243



>ref|XP_011070988.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A10-like [Sesamum indicum]
Length=250

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 185/217 (85%), Gaps = 3/217 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCG+CYE+KC
Sbjct  23   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNH--GGWCNPPLQHFDLAEPAFLQIAQYRAG  521
               + + C PGSI VTATNFCPPN AL NN   GGWCNPPL HFDL++P F  IAQY+AG
Sbjct  83   -VNDGQWCLPGSIVVTATNFCPPNNALPNNAAGGGWCNPPLHHFDLSQPVFQHIAQYKAG  141

Query  522  IVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNW  701
            IV VAYRR+ C +KGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW PMSRNW
Sbjct  142  IVPVAYRRVPCNRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNW  201

Query  702  GQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            GQNW+++SYLNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  202  GQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNVAPASW  238



>ref|XP_006391003.1| hypothetical protein EUTSA_v10019043mg [Eutrema salsugineum]
 gb|ESQ28289.1| hypothetical protein EUTSA_v10019043mg [Eutrema salsugineum]
Length=249

 Score =   311 bits (798),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 196/241 (81%), Gaps = 9/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F+L+++L   +SC   + GG        W N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  6    FLLMVILGVMTSCVNGYGGG--------WVNAHATFYGGGDASGTMGGACGYGNLYSQGY  57

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCGAC+E++C + + + C PGSI VTATNFCPPN AL NN GGW
Sbjct  58   GTNTAALSTALFNNGLSCGACFEIRC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGGW  116

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDL++P F +IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  117  CNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVG  176

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ S  +KGSRTGW  MSRNWGQNW+++SYLNGQ+LSF+VT SDGRT+ + +VA   
Sbjct  177  GAGDVHSAAVKGSRTGWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTIVSNNVASAG  236

Query  810  W  812
            W
Sbjct  237  W  237



>ref|XP_010276443.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   311 bits (798),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 186/213 (87%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE+KC  
Sbjct  25   WTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIKC-V  83

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + + C PGSI +TATNFCPPN AL NN GGWCNPPLQHFDL++P F +IAQY+AGIV V
Sbjct  84   NDPKWCLPGSIIITATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQRIAQYKAGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
             YRR+ACEK GG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW  MSRNWGQNW
Sbjct  144  QYRRVACEKTGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSRTGWQAMSRNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYLNGQ+LSF+VT SDG+TV + +VAP +W
Sbjct  204  QSNSYLNGQALSFKVTTSDGQTVVSNNVAPANW  236



>gb|AFK39658.1| unknown [Medicago truncatula]
 gb|KEH34460.1| expansin A10 [Medicago truncatula]
Length=254

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 207/248 (83%), Gaps = 8/248 (3%)
 Frame = +3

Query  69   ENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYG  248
            + F     ILV VLC + +           +  G W++ HATFYGG DA+GTMGGACGYG
Sbjct  4    QEFSIALVILV-VLCINMNLQGVI------ADYGGWESAHATFYGGGDASGTMGGACGYG  56

Query  249  NLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFAL  428
            NLYSQGYGTNTAALSTALFN+G SCG+CYE++CN++  R C PGSI VTATNFCPPN +L
Sbjct  57   NLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCNDDP-RWCKPGSIIVTATNFCPPNPSL  115

Query  429  ANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNL  608
             NN+GGWCNPPLQHFD+AEPA+LQIA+YRAGIV V++RR+AC KKGG+RFTINGH+YFNL
Sbjct  116  PNNNGGWCNPPLQHFDMAEPAYLQIAEYRAGIVPVSFRRVACFKKGGVRFTINGHSYFNL  175

Query  609  LLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTN  788
            +L+TNVGGAGD+ S+ IKGSRTGW PMSRNWGQNW+++SYLNGQSLSF+VT SDGRT+T+
Sbjct  176  VLVTNVGGAGDVHSISIKGSRTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTMTS  235

Query  789  LDVAPPDW  812
             +VAP +W
Sbjct  236  FNVAPANW  243



>ref|XP_010511994.1| PREDICTED: expansin-A1 [Camelina sativa]
Length=248

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 194/242 (80%), Gaps = 8/242 (3%)
 Frame = +3

Query  87   FFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQG  266
              + + +L   +SC   + GG        W N HATFYGG DA+GTMGGACGYGNLYSQG
Sbjct  3    LVLFMAILGVMTSCVNGYAGG-------GWVNAHATFYGGGDASGTMGGACGYGNLYSQG  55

Query  267  YGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGG  446
            YGTNTAALSTALFN+G SCGAC+EL+C + + + C PGSI VTATNFCPPN AL NN GG
Sbjct  56   YGTNTAALSTALFNNGLSCGACFELRC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGG  114

Query  447  WCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNV  626
            WCNPP QHFDL++P F +IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNV
Sbjct  115  WCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNV  174

Query  627  GGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPP  806
            GGAGD+ SV +KGSRTGW  MSRNWGQNW+++SYLNGQ+LSF++T SDGRT+ + + AP 
Sbjct  175  GGAGDVHSVMVKGSRTGWQAMSRNWGQNWQSNSYLNGQALSFKITTSDGRTIISNNAAPA  234

Query  807  DW  812
             W
Sbjct  235  GW  236



>ref|XP_004302596.1| PREDICTED: expansin-A2-like [Fragaria vesca subsp. vesca]
Length=254

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 187/214 (87%), Gaps = 1/214 (0%)
 Frame = +3

Query  171  DWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCN  350
            DW+  HATFYGG+DATGTMGGACGYGNLYSQGYGT TAALSTALFNSG SCG+CY+L+CN
Sbjct  31   DWQTAHATFYGGSDATGTMGGACGYGNLYSQGYGTRTAALSTALFNSGLSCGSCYQLRCN  90

Query  351  EEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVA  530
            ++  + C  G ITVTATN CPPN AL+N++GGWCNPPL+HFDLAEPAFLQIA+YRAGIV 
Sbjct  91   DDP-KWCLHGDITVTATNLCPPNLALSNDNGGWCNPPLEHFDLAEPAFLQIAEYRAGIVP  149

Query  531  VAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQN  710
            V +RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSR GW PMSRNWGQN
Sbjct  150  VLFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVQSVSIKGSRAGWQPMSRNWGQN  209

Query  711  WEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            W+++SYLNGQ+LSF++T SDG T+ + +V P  W
Sbjct  210  WQSNSYLNGQTLSFKITTSDGATLIHNNVVPAGW  243



>gb|KHN48407.1| Expansin-A8 [Glycine soja]
Length=255

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 207/249 (83%), Gaps = 5/249 (2%)
 Frame = +3

Query  66   MENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgY  245
            M +  F   ++ L++ F ++       G      G W++ HATFYGG DA+GTMGGACGY
Sbjct  1    MAHKEFSIALVTLIVLFVNTN----LQGATADYGGGWQSAHATFYGGGDASGTMGGACGY  56

Query  246  GNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFA  425
            GNLYSQGYGT+T ALSTALFN+G SCG+CYE++C +++ R C PGSITVTATNFCPPN +
Sbjct  57   GNLYSQGYGTDTVALSTALFNNGLSCGSCYEMRC-DDDPRWCKPGSITVTATNFCPPNPS  115

Query  426  LANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFN  605
            L NN+GGWCNPPLQHFD+AEPAFLQIA+YRAGIV VA+RR+ C KKGG+RFTINGH+YFN
Sbjct  116  LPNNNGGWCNPPLQHFDMAEPAFLQIAEYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFN  175

Query  606  LLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVT  785
            L+LITNV GAGD++SV IKGS+TGW PMSRNWGQNW+++SYLNGQSLSF+VT SDGRTVT
Sbjct  176  LVLITNVAGAGDVNSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVT  235

Query  786  NLDVAPPDW  812
            + +VAP +W
Sbjct  236  SFNVAPANW  244



>ref|XP_010937180.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=251

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 193/241 (80%), Gaps = 8/241 (3%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F+LV +L   S    + HG         W   HATFYG  DA+GTMGGACGYGNLYSQGY
Sbjct  7    FLLVSLLPLFSPAHGYGHGW-------GWSRAHATFYGSGDASGTMGGACGYGNLYSQGY  59

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCGACYE+ C  ++ + C PG+I VTATNFCPPN AL NN GGW
Sbjct  60   GTNTAALSTALFNNGLSCGACYEIMC-VDDPKWCLPGAIVVTATNFCPPNNALPNNAGGW  118

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPPLQHFDL++P F +IAQYRAGIV VAYRR+ C KKGG+RFTINGH+YFNL+LITNVG
Sbjct  119  CNPPLQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCRKKGGIRFTINGHSYFNLVLITNVG  178

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ +V IKGSRTGW PMSRNWGQNW++++YLNGQ+LSF+VT SDG +V + +VAP  
Sbjct  179  GAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQALSFKVTTSDGHSVVSYNVAPAG  238

Query  810  W  812
            W
Sbjct  239  W  239



>gb|AGF90536.1| expansin 2 [Ammopiptanthus nanus]
Length=248

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 192/241 (80%), Gaps = 10/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
             +LV  L   SS   +  G         W N HATFYGG DA+GTMGGACGYGNLY QGY
Sbjct  6    LLLVAFLTMFSSAHAYAEG---------WTNAHATFYGGGDASGTMGGACGYGNLYGQGY  56

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCG+CYE++C  +  R C PGSI VTATNFCPPN AL NN GGW
Sbjct  57   GTNTAALSTALFNNGLSCGSCYEIRCVSDH-RWCLPGSIMVTATNFCPPNNALPNNAGGW  115

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP  HFDLA+P FL+IAQY+AGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  116  CNPPQHHFDLAQPVFLRIAQYKAGIVPVAYRRMPCRRRGGIRFTINGHSYFNLVLITNVG  175

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ +  IKGSRTGW+ MSRNWGQNW++++YLNGQSLSF+VT SDGRTV + +VAPP 
Sbjct  176  GAGDVHAAAIKGSRTGWISMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPPA  235

Query  810  W  812
            W
Sbjct  236  W  236



>ref|XP_006829796.1| hypothetical protein AMTR_s00119p00058870 [Amborella trichopoda]
 gb|ERM97212.1| hypothetical protein AMTR_s00119p00058870 [Amborella trichopoda]
Length=247

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 187/213 (88%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGAC+E+KC +
Sbjct  25   WNSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIKCVD  84

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            + S  C PGSI VTATNFCPPN AL NN GGWCNPP QHFDLA+P F QIAQY+AGIV V
Sbjct  85   DPSW-CLPGSIIVTATNFCPPNNALPNNAGGWCNPPQQHFDLAQPVFQQIAQYKAGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            AYRR+ C+KKGG+RFTINGH+YFNL+LITNVGGAGDI +V+IKGS +GW  MS+NWGQNW
Sbjct  144  AYRRVPCQKKGGIRFTINGHSYFNLVLITNVGGAGDITAVWIKGSSSGWQSMSQNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYLNGQ+LSFR+T SDGRT+ + +VAP DW
Sbjct  204  QSNSYLNGQALSFRITTSDGRTLESDNVAPSDW  236



>gb|AIG88581.1| expansin, partial [Picea wilsonii]
Length=254

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 191/215 (89%), Gaps = 2/215 (1%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W++ HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE++CNE
Sbjct  29   WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMRCNE  88

Query  354  E-ESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVA  530
            E + + C PG++TVTATNFCPPN AL N++GGWCNPPLQHFD+AEPA+ QIA+YR GIV 
Sbjct  89   ESDPQWCLPGTVTVTATNFCPPNSALPNDNGGWCNPPLQHFDMAEPAYQQIAKYRGGIVP  148

Query  531  VAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSR-TGWMPMSRNWGQ  707
            + +RR+ C +KGG+RFT+NGH+YFNL+LITNVGGAGD+ +V IKGS  TGW PMSRNWGQ
Sbjct  149  IMFRRVPCVRKGGVRFTMNGHSYFNLVLITNVGGAGDVHAVSIKGSNSTGWQPMSRNWGQ  208

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQ+LSF+VT SDG T  + DVAPPDW
Sbjct  209  NWQSNSYLNGQTLSFQVTTSDGTTAISSDVAPPDW  243



>ref|XP_009399909.1| PREDICTED: expansin-A2-like [Musa acuminata subsp. malaccensis]
Length=298

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 189/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W+N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G +CGACYE++C  
Sbjct  76   WQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLNCGACYEMRC-A  134

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
            ++ R C PGSI VTATNFCPPN+AL +++GGWCNPP QHFDLAEPAFLQIAQYRAGIV V
Sbjct  135  DDPRWCLPGSIVVTATNFCPPNYALPSDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIVPV  194

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
            ++RR+ C KKGG+RFTINGH+YF L+LITNVG AGD+ +V IKGS+TGW  MSRNWGQNW
Sbjct  195  SFRRVPCVKKGGVRFTINGHSYFILVLITNVGAAGDVHAVSIKGSKTGWQRMSRNWGQNW  254

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYL+GQSLSF+VT SDGRT+T+ +VAP  W
Sbjct  255  QSNSYLDGQSLSFQVTTSDGRTITSYNVAPAGW  287



>emb|CDY24897.1| BnaC03g22750D [Brassica napus]
Length=257

 Score =   311 bits (798),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 200/241 (83%), Gaps = 12/241 (5%)
 Frame = +3

Query  93   ILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYG  272
            IL L+    ++     HG +     G W+ GHATFYGGADA+GTMGGACGYGNLYSQ YG
Sbjct  17   ILTLLFSLQAA-----HGDD-----GGWQGGHATFYGGADASGTMGGACGYGNLYSQDYG  66

Query  273  TNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
            TNTAALSTALFN+G +CGACYE+KCN++  R C   +ITVTATNFCPPN  L+N++GGWC
Sbjct  67   TNTAALSTALFNNGLTCGACYEMKCNDDP-RWCLGSTITVTATNFCPPNLGLSNDNGGWC  125

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPLQHFDLAEPAFL+IAQYRAGIV V++RR+ C KKGG+RFTINGH+YFNL+LI+NVGG
Sbjct  126  NPPLQHFDLAEPAFLKIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGG  185

Query  633  AGDIDSVFIKGSRTG-WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            AGD+ +V I+GS+TG W  MSRNWGQNW+++SYLN QSLSF+VT SDGRTV + DVAP +
Sbjct  186  AGDVHAVSIRGSKTGSWQAMSRNWGQNWQSNSYLNDQSLSFQVTTSDGRTVISNDVAPSN  245

Query  810  W  812
            W
Sbjct  246  W  246



>emb|CDY04946.1| BnaAnng01280D [Brassica napus]
Length=255

 Score =   311 bits (797),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 191/216 (88%), Gaps = 2/216 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGGADA+GTMGGACGYGNLY+QGYG  TAALSTALF SG +CGAC+EL+C
Sbjct  30   GGWERGHATFYGGADASGTMGGACGYGNLYNQGYGLQTAALSTALFQSGQTCGACFELRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             E++ + C PGSI V+ATNFCPPNFALAN++GGWCNPPLQHFDLA+PAFLQIAQYRAGIV
Sbjct  90   -EDDDQWCLPGSIIVSATNFCPPNFALANDNGGWCNPPLQHFDLAQPAFLQIAQYRAGIV  148

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTG-WMPMSRNWG  704
             VA+RR+ CEK GG+RFTING++YF+L+LITNVGGAGD+ +V +KGS+T  W  MSRNWG
Sbjct  149  PVAFRRVQCEKPGGIRFTINGNSYFDLVLITNVGGAGDVKAVALKGSKTNQWQSMSRNWG  208

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW++++YL GQSLSF+VTASDGR+V + DV P DW
Sbjct  209  QNWQSNTYLRGQSLSFQVTASDGRSVVSYDVVPEDW  244



>ref|XP_002518284.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
 gb|EEF44044.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
Length=256

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALF++G SCGACYE+KC
Sbjct  32   GGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFDNGLSCGACYEMKC  91

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             ++  + C PG+ITVTATNFCPPN AL NN+GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  92   TDDP-KWCLPGTITVTATNFCPPNPALPNNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  150

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ +V IKGS+TGW PMSRNWGQ
Sbjct  151  PVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWGQ  210

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VTASDGRT+T+ DVAP  W
Sbjct  211  NWQSNSYLNGQSLSFQVTASDGRTLTSYDVAPSGW  245



>ref|NP_001242219.1| uncharacterized protein LOC100777044 precursor [Glycine max]
 gb|ACU24064.1| unknown [Glycine max]
Length=255

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/249 (68%), Positives = 205/249 (82%), Gaps = 5/249 (2%)
 Frame = +3

Query  66   MENFHFPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgY  245
            M +  F   ++ L++ F ++       G      G W++ HATFY G DA+GTMGGACGY
Sbjct  1    MAHKEFSIALVTLIVLFVNTN----LQGATADYGGGWQSAHATFYDGGDASGTMGGACGY  56

Query  246  GNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFA  425
            GNLYSQGYGT+T ALSTALFN+G SCG CYE++C +++ R C PGSITVTATNFCPPN +
Sbjct  57   GNLYSQGYGTDTVALSTALFNNGLSCGTCYEMRC-DDDPRWCKPGSITVTATNFCPPNPS  115

Query  426  LANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFN  605
            L NN+GGWCNPPLQHFD+AEPAFLQIA+YRAGIV VA+RR+ C KKGG+RFTINGH+YFN
Sbjct  116  LPNNNGGWCNPPLQHFDMAEPAFLQIAEYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFN  175

Query  606  LLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVT  785
            L+LITNV GAGD++SV IKGS+TGW PMSRNWGQNW+++SYLNGQSLSF+VT SDGRTVT
Sbjct  176  LVLITNVAGAGDVNSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVT  235

Query  786  NLDVAPPDW  812
            + +VAP +W
Sbjct  236  SFNVAPANW  244



>gb|KEH34458.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  36   GGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  95

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C PGSI VTATNFCPPN +L NN+GGWCNPPLQHFD+AEPA+LQIA+YRAGIV
Sbjct  96   NDDP-RWCKPGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAYLQIAEYRAGIV  154

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+L+TNVGGAGD+ S+ IKGSRTGW PMSRNWGQ
Sbjct  155  PVSFRRVPCFKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSISIKGSRTGWQPMSRNWGQ  214

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ +VAP +W
Sbjct  215  NWQSNSYLNGQSLSFQVTTSDGRTMTSFNVAPANW  249



>ref|XP_010543681.1| PREDICTED: expansin-A2 [Tarenaya hassleriana]
Length=255

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 201/244 (82%), Gaps = 10/244 (4%)
 Frame = +3

Query  81   FPFFILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYS  260
            F   +  L LCFH+      +  +D    G W++GHATFYGGADA+GTMGGACGYGNL +
Sbjct  11   FVSLVACLNLCFHA-----INCDDD----GGWQSGHATFYGGADASGTMGGACGYGNLNN  61

Query  261  QGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNH  440
            QGYGTNTAALSTALF++G +CGACYEL+C E++ + C+PGSI ++ATNFCPPNF L NN+
Sbjct  62   QGYGTNTAALSTALFDNGQTCGACYELRC-EDDPQWCNPGSIIISATNFCPPNFGLPNNN  120

Query  441  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLIT  620
            GGWCNPPLQHFD+AEPAFLQIAQYRAGIV V +RR+ C K+GG+RFTING++YF+L+LIT
Sbjct  121  GGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVGFRRVPCAKRGGIRFTINGNSYFDLVLIT  180

Query  621  NVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVA  800
            NVGGAGD+ +V +KGS TGW  MSRNWGQNW+++ YL GQSLSF+VTASDGRTV + DV 
Sbjct  181  NVGGAGDVLAVSVKGSGTGWQVMSRNWGQNWQSNMYLRGQSLSFQVTASDGRTVVSNDVV  240

Query  801  PPDW  812
            P  W
Sbjct  241  PAGW  244



>gb|ACJ84647.1| unknown [Medicago truncatula]
Length=260

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+ GHATFYGG DA+GTMGG CGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  36   GGWEGGHATFYGGGDASGTMGGVCGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  95

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
            N++  R C+PGSI VTATNFCPPN +L NN+GGWCNPPLQHFD+AEPA+LQIA+YRAGIV
Sbjct  96   NDDP-RWCNPGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAYLQIAEYRAGIV  154

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+L+TNVGGAGD+ S+ IKGSRTGW PMSRNWGQ
Sbjct  155  PVSFRRVPCFKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSISIKGSRTGWQPMSRNWGQ  214

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT+T+ +VAP +W
Sbjct  215  NWQSNSYLNGQSLSFQVTTSDGRTMTSFNVAPANW  249



>gb|KHG18125.1| Expansin-A10 -like protein [Gossypium arboreum]
Length=248

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG+DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE+KC
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + + C PGSI VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IAQY+AGIV
Sbjct  83   -VNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYKAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+YRR+ C +KGG+RFTINGH+YFNL+LI+NVG AGD+ +  IKGSRTGW PMSRNWGQ
Sbjct  142  PVSYRRVPCRRKGGIRFTINGHSYFNLVLISNVGDAGDVHAAAIKGSRTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  202  NWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGW  236



>ref|XP_002456550.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
 gb|EES01670.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
Length=252

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++ HATFYGG DA+GTMGGACGYGN+YS GYGTNTAALSTALFN G++CG+CYEL+C
Sbjct  28   GGWQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALFNDGAACGSCYELRC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
             + + + C PG+ITVTATNFCPPN+ L ++ GGWCNPP  HFD+A+PAFLQIAQYRAGIV
Sbjct  88   -DNDGQSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQPAFLQIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             VAYRR+ C KKGG+RFTINGH+YFNL+L+TNV GAGD+ SV IKGS TGW PMSRNWGQ
Sbjct  147  PVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTGWQPMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++S L+GQSLSF+VTASDGRTVT+  VAP  W
Sbjct  207  NWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGW  241



>gb|ADC35364.1| alpha-expansin 1 [Coffea arabica]
Length=257

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 199/241 (83%), Gaps = 11/241 (5%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
             ++V  +C  ++ G +          G W++ HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  17   IVVVTSMCIPTAFGDY----------GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGY  66

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GT+TAALSTALFN+G +CG+CYE++C + +   C PG+ITVTATNFCP N AL N++GGW
Sbjct  67   GTDTAALSTALFNNGLACGSCYEIRC-DSDPEACLPGTITVTATNFCPANPALPNDNGGW  125

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDLAEPAFLQIAQYRAGIV VA++R+ C KKGG+R+TINGH+YFNL+L+TNV 
Sbjct  126  CNPPRQHFDLAEPAFLQIAQYRAGIVPVAFQRVPCSKKGGVRYTINGHSYFNLVLVTNVA  185

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ +V IKGSRTGW  MSRNWGQNW+++SYLNGQ+LSF++T SDGRT+T+ +VAP +
Sbjct  186  GAGDVHTVAIKGSRTGWQSMSRNWGQNWQSNSYLNGQTLSFQITTSDGRTLTSYNVAPAN  245

Query  810  W  812
            W
Sbjct  246  W  246



>ref|XP_002887242.1| ATEXPA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63501.1| ATEXPA1 [Arabidopsis lyrata subsp. lyrata]
Length=248

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 1/217 (0%)
 Frame = +3

Query  162  APGDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYEL  341
            A G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGAC+E+
Sbjct  23   AGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEI  82

Query  342  KCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAG  521
            +C + + + C PGSI VTATNFCPPN AL NN GGWCNPP QHFDL++P F +IAQYRAG
Sbjct  83   RC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAG  141

Query  522  IVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNW  701
            IV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVGGAGD+ SV +KGSRTGW  MSRNW
Sbjct  142  IVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVMVKGSRTGWQAMSRNW  201

Query  702  GQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            GQNW+++SYLNGQSLSF+VT SDGRT+ + +VA   W
Sbjct  202  GQNWQSNSYLNGQSLSFKVTTSDGRTIVSNNVANAGW  238



>ref|XP_010257730.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257731.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257732.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257733.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 183/213 (86%), Gaps = 1/213 (0%)
 Frame = +3

Query  174  WKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNE  353
            W + H TFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCGACYE+KC  
Sbjct  25   WTDAHVTFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIKC-V  83

Query  354  EESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAV  533
             + R C PGSI VTATNFCPPN AL NN GGWCNPPLQHFDL++P F  IAQY+AGIV V
Sbjct  84   NDPRWCLPGSIIVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYKAGIVPV  143

Query  534  AYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNW  713
             YRR+AC K GG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW  MSRNWGQNW
Sbjct  144  QYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSRTGWQAMSRNWGQNW  203

Query  714  EAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            +++SYLNGQ+LSF+VT SDGRTV + +VAP +W
Sbjct  204  QSNSYLNGQALSFKVTTSDGRTVVSNNVAPANW  236



>gb|ACZ57921.1| expansin protein 1 [Brassica juncea]
 gb|ADB22388.1| expansin [Brassica juncea]
Length=249

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 198/241 (82%), Gaps = 9/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F++++VL   +S    + GG        W N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  6    FLIMVVLAVMTSRVNGYGGG--------WVNAHATFYGGGDASGTMGGACGYGNLYSQGY  57

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFN+G SCGAC+E++C + + + C PGSI VTATNFCPPN AL NN GGW
Sbjct  58   GTNTAALSTALFNNGLSCGACFEIRC-QNDGKWCLPGSIVVTATNFCPPNNALPNNAGGW  116

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDL++P F +IAQY+AGIV+VAYRR++C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  117  CNPPQQHFDLSQPVFQRIAQYKAGIVSVAYRRVSCVRRGGIRFTINGHSYFNLVLITNVG  176

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ S ++KGSRTGW  MSRNWGQNW+++SYLNGQ+LSF+VT SDGRT+ + +VA   
Sbjct  177  GAGDVHSAWVKGSRTGWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTIVSNNVASAR  236

Query  810  W  812
            W
Sbjct  237  W  237



>ref|XP_002522457.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
 gb|EEF39949.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
Length=249

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 192/241 (80%), Gaps = 9/241 (4%)
 Frame = +3

Query  90   FILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGY  269
            F LV  L   SS   +  GG        W N HATFYGG DA+GTMGGACGYGNLYSQGY
Sbjct  6    FFLVGFLAMVSSVNCYGGGG--------WINAHATFYGGGDASGTMGGACGYGNLYSQGY  57

Query  270  GTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGW  449
            GTNTAALSTALFNSG SCG+CYE++C   + + C PGSI VTATNFCPPN AL NN GGW
Sbjct  58   GTNTAALSTALFNSGLSCGSCYEIRC-VNDPKWCLPGSIVVTATNFCPPNNALPNNAGGW  116

Query  450  CNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVG  629
            CNPP QHFDL++P F  IAQYRAGIV VAYRR+ C ++GG+RFTINGH+YFNL+LITNVG
Sbjct  117  CNPPQQHFDLSQPVFQHIAQYRAGIVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVG  176

Query  630  GAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            GAGD+ +V IKGSRTGW  MSRNWGQNW++++YLNGQSLSF+VT SDGR+V + +VAP  
Sbjct  177  GAGDVHAVAIKGSRTGWQAMSRNWGQNWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPVS  236

Query  810  W  812
            W
Sbjct  237  W  237



>ref|XP_007137630.1| hypothetical protein PHAVU_009G142800g [Phaseolus vulgaris]
 gb|ESW09624.1| hypothetical protein PHAVU_009G142800g [Phaseolus vulgaris]
Length=215

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 171/190 (90%), Gaps = 1/190 (1%)
 Frame = +3

Query  243  YGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNF  422
            YGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C + + R C PGSI VTATNFCPPNF
Sbjct  16   YGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC-DSDPRWCLPGSIIVTATNFCPPNF  74

Query  423  ALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYF  602
            AL+N++GGWCNPPLQHFDLAEPAFLQIAQY+AGIV V++RR++C KKGG+RFTINGH+YF
Sbjct  75   ALSNDNGGWCNPPLQHFDLAEPAFLQIAQYKAGIVPVSFRRVSCVKKGGIRFTINGHSYF  134

Query  603  NLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTV  782
            NL+L+TNVGGAGD+ SV IKGSRT W  MSRNWGQNW+++SYLNGQSLSF+VT SDGR +
Sbjct  135  NLVLVTNVGGAGDVHSVSIKGSRTNWQTMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRIL  194

Query  783  TNLDVAPPDW  812
            T+ ++ P +W
Sbjct  195  TSNNIVPANW  204



>emb|CAN79985.1| hypothetical protein VITISV_038036 [Vitis vinifera]
Length=248

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W + HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFNSG SCGAC+E++C
Sbjct  23   GGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEIRC  82

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + R C  GSITVTATNFCPPN AL NN GGWCNPPLQHFDL++P F +IA+YRAGIV
Sbjct  83   -ANDPRWCRSGSITVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFERIAEYRAGIV  141

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+YRR+ C KKGG+RFT+NGH+YFNL+LI+NVGGAGD+ SV IKGS+TGW PMSRNWGQ
Sbjct  142  PVSYRRVPCIKKGGIRFTMNGHSYFNLVLISNVGGAGDVHSVSIKGSKTGWQPMSRNWGQ  201

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW+++SYLNGQSLSF+VT SDGRT  + +V P  W
Sbjct  202  NWQSNSYLNGQSLSFKVTLSDGRTAVSNNVVPAGW  236



>gb|AEQ55277.1| expansin [Breonia chinensis]
 gb|AEQ55292.1| expansin [Breonia chinensis]
Length=250

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 197/243 (81%), Gaps = 11/243 (5%)
 Frame = +3

Query  87   FFI-LVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQ  263
            FFI ++LV+ F  + G+   G         W   HATFYGG+DA+GTMGGACGYGNLYSQ
Sbjct  7    FFIPVILVMSFRKTQGSHDEG---------WHGAHATFYGGSDASGTMGGACGYGNLYSQ  57

Query  264  GYGTNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHG  443
            GYGT+TAALSTALFN+G SCGACYEL+CN   S+ C PG+ITVTATNFCPPNFAL NN+G
Sbjct  58   GYGTSTAALSTALFNNGLSCGACYELRCNGN-SKWCLPGTITVTATNFCPPNFALPNNNG  116

Query  444  GWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITN  623
            GWCNPPL HFDLA+PAFL++AQYRAGIV V YR++ C KKGG+RF+INGH+Y+NL+LITN
Sbjct  117  GWCNPPLHHFDLAQPAFLRMAQYRAGIVPVLYRKVPCLKKGGIRFSINGHSYYNLVLITN  176

Query  624  VGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAP  803
            V G GD+ +V IKGS TGW  MSRNWGQNW+++ YLNGQSLSFRV  SDGRTVT+ +V P
Sbjct  177  VAGVGDVHAVSIKGSSTGWQQMSRNWGQNWQSNLYLNGQSLSFRVATSDGRTVTSYNVVP  236

Query  804  PDW  812
              W
Sbjct  237  AGW  239



>ref|XP_010452431.1| PREDICTED: expansin-A2 [Camelina sativa]
Length=256

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 199/241 (83%), Gaps = 5/241 (2%)
 Frame = +3

Query  93   ILVLVLCFHSSCGTFFHGGEDPSAPGDWKNGHATFYggadatgtmggacgYGNLYSQGYG  272
            IL + LC  S C  F+    D +  G W+ GHATFYGGADA+GTMGGACGYGNLYSQGYG
Sbjct  9    ILFVSLCTLSLC--FYVINSDDNG-GGWERGHATFYGGADASGTMGGACGYGNLYSQGYG  65

Query  273  TNTAALSTALFNSGSSCGACYELKCNEEESRVCHPGSITVTATNFCPPNFALANNHGGWC  452
              TAALSTALFN+G  CGAC+EL+C E++   C PGSI V+ATNFCPPNFALAN++GGWC
Sbjct  66   LQTAALSTALFNNGQRCGACFELQC-EDDPEWCIPGSIIVSATNFCPPNFALANDNGGWC  124

Query  453  NPPLQHFDLAEPAFLQIAQYRAGIVAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGG  632
            NPPL+HFDLAEPAFLQIAQYRAGIV VA+RR+ CEK GG+RFTING+AYF+L+LITNVGG
Sbjct  125  NPPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKGGGIRFTINGNAYFDLVLITNVGG  184

Query  633  AGDIDSVFIKGSRTG-WMPMSRNWGQNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPD  809
            AGDI +V +KGS+T  W  +SRNWGQNW++++YL GQSLSF+V ASDGR V + DV P D
Sbjct  185  AGDIRAVSLKGSKTNQWQSLSRNWGQNWQSNTYLRGQSLSFQVIASDGRAVVSYDVVPRD  244

Query  810  W  812
            W
Sbjct  245  W  245



>ref|XP_011013147.1| PREDICTED: expansin-A1 [Populus euphratica]
Length=249

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W N HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  83

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
               + + C PGSI +TATNFCPPN AL NN GGWCNPP  HFDL++P F  IAQYRAGIV
Sbjct  84   -VNDPKWCLPGSIVITATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRAGIV  142

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V+YRR+ C ++GG+RFTINGH+YFNL+LITNVGGAGD+ SV IKGSRTGW PMSRNWGQ
Sbjct  143  PVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQ  202

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQSLSF+VT SDGRTV + +VAP  W
Sbjct  203  NWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPSSW  237



>emb|CAH18934.1| expansin [Pyrus communis]
Length=255

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W+  HATFYGG DA+GTMGGACGYGNLYSQGYGTNTAALSTALFN+G SCG+CYE++C
Sbjct  30   GSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  89

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRA-GI  524
             + + R C PGSI VTATNFCPPNFA +N++GGWCNPPLQHFDLAEPAFLQIAQY+    
Sbjct  90   -DNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYQCWNQ  148

Query  525  VAVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWG  704
              V++RR+ C KKGG+RFTINGH+YFNL+LITNV GAGD+ SV IKGSRTGW PMSRNWG
Sbjct  149  CQVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMSRNWG  208

Query  705  QNWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            QNW+++SYLNGQ+LSF+VT SDGRTVT+ +VAP +W
Sbjct  209  QNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNW  244



>ref|XP_010670610.1| PREDICTED: expansin-A2-like [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = +3

Query  183  GHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKCNEEES  362
            GHATFYGG DA+GTMGGACGYGNLY+QGYGT+TAALSTALFN+G SCG+CYEL C+ +  
Sbjct  30   GHATFYGGDDASGTMGGACGYGNLYNQGYGTSTAALSTALFNNGLSCGSCYELTCSGDP-  88

Query  363  RVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIVAVAYR  542
            + C PGSI VTATNFCPPNFALAN++GGWCNPPLQHFDLAEP FL+IAQYRAGIV V++R
Sbjct  89   KWCLPGSIIVTATNFCPPNFALANDNGGWCNPPLQHFDLAEPCFLKIAQYRAGIVPVSFR  148

Query  543  RIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQNWEAH  722
            R+ C K GG+RFTINGH+YFNL+LITNV GAGD+ SV IKGS T W PMSRNWGQNW+++
Sbjct  149  RVPCIKTGGIRFTINGHSYFNLVLITNVAGAGDVQSVSIKGSNTAWQPMSRNWGQNWQSN  208

Query  723  SYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
             YL+GQSLSF+VT SDGRTVT+ DVAP +W
Sbjct  209  GYLDGQSLSFQVTTSDGRTVTSYDVAPSNW  238



>ref|XP_008456949.1| PREDICTED: expansin-A8-like [Cucumis melo]
Length=252

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +3

Query  168  GDWKNGHATFYggadatgtmggacgYGNLYSQGYGTNTAALSTALFNSGSSCGACYELKC  347
            G W++GHATFYGG DA+GTMGGACGYGNLYSQGYGTNT ALST LFN+G SCGAC+E+ C
Sbjct  28   GGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTVALSTTLFNNGLSCGACFEMTC  87

Query  348  NEEESRVCHPGSITVTATNFCPPNFALANNHGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  527
              +  + C PG+I VTATNFCPPNFAL NN+GGWCNPPLQHFD+AEPAFLQIAQYRAGIV
Sbjct  88   TNDP-KWCLPGTIRVTATNFCPPNFALPNNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIV  146

Query  528  AVAYRRIACEKKGGMRFTINGHAYFNLLLITNVGGAGDIDSVFIKGSRTGWMPMSRNWGQ  707
             V++RR+ C KKGG+RFTINGH+YFNL+LITNVGGAGD+ +V IKGSRTGW  MSRNWGQ
Sbjct  147  PVSFRRVPCMKKGGVRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQAMSRNWGQ  206

Query  708  NWEAHSYLNGQSLSFRVTASDGRTVTNLDVAPPDW  812
            NW++++YLNGQ LSF+VT SDG T+T  ++ P +W
Sbjct  207  NWQSNNYLNGQGLSFQVTLSDGHTLTAYNLVPSNW  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2917093240962