BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29651_g1_i1 len=1160 path=[1:0-1159]

Length=1160
                                                                      Score     E

ref|XP_009800616.1|  PREDICTED: osmotin-like protein                    369   1e-123   
ref|XP_009594695.1|  PREDICTED: osmotin-like protein                    369   2e-123   
gb|EYU19299.1|  hypothetical protein MIMGU_mgv1a012525mg                366   2e-122   
gb|AIE54288.1|  osmotin-like protein                                    365   5e-122   
ref|NP_001234714.1|  osmotin-like protein precursor                     361   3e-120   
ref|XP_002531364.1|  Zeamatin precursor, putative                       357   9e-119   Ricinus communis
gb|KDP44218.1|  hypothetical protein JCGZ_05685                         355   3e-118   
gb|AGL07709.1|  pathogenesis-related thaumatin-like protein             351   2e-116   
ref|XP_007016468.1|  Osmotin-like protein                               350   3e-116   
ref|XP_010259948.1|  PREDICTED: osmotin-like protein                    350   4e-116   
ref|XP_011081307.1|  PREDICTED: osmotin-like protein                    350   5e-116   
ref|XP_006349009.1|  PREDICTED: osmotin-like protein-like               348   3e-115   
ref|XP_006424795.1|  hypothetical protein CICLE_v10029149mg             347   8e-115   
ref|XP_002281193.1|  PREDICTED: osmotin-like protein                    347   1e-114   Vitis vinifera
emb|CAN74416.1|  hypothetical protein VITISV_028913                     346   1e-114   Vitis vinifera
dbj|BAI63297.1|  thaumatin-like protein                                 344   1e-113   Citrus jambhiri [citronelle]
ref|XP_011042680.1|  PREDICTED: osmotin-like protein                    343   3e-113   
emb|CDP09032.1|  unnamed protein product                                342   4e-113   
ref|XP_011000269.1|  PREDICTED: osmotin-like protein                    342   9e-113   
ref|XP_002298366.1|  osmotin-like family protein                        336   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_009388624.1|  PREDICTED: osmotin-like protein                    336   2e-110   
ref|XP_010685798.1|  PREDICTED: osmotin-like protein                    335   2e-110   
ref|XP_008457495.1|  PREDICTED: osmotin-like protein                    335   3e-110   
ref|XP_006294865.1|  hypothetical protein CARUB_v10023918mg             333   1e-109   
ref|XP_010470049.1|  PREDICTED: osmotin-like protein                    332   4e-109   
ref|XP_008776643.1|  PREDICTED: LOW QUALITY PROTEIN: osmotin-like...    332   5e-109   
ref|XP_010033142.1|  PREDICTED: LOW QUALITY PROTEIN: osmotin-like...    332   5e-109   
gb|AAD53089.1|AF175270_1  osmotin-like protein                          332   5e-109   Benincasa hispida [ash gourd]
ref|XP_010510580.1|  PREDICTED: osmotin-like protein                    332   6e-109   
ref|XP_002881009.1|  hypothetical protein ARALYDRAFT_481792             332   7e-109   
ref|XP_010414484.1|  PREDICTED: osmotin-like protein                    332   8e-109   
gb|ABB86299.1|  thaumatin-like protein isoform 3                        330   1e-108   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_004150181.1|  PREDICTED: osmotin-like protein-like               331   2e-108   
ref|XP_010918389.1|  PREDICTED: osmotin-like protein                    331   2e-108   
ref|XP_003539684.1|  PREDICTED: osmotin-like protein-like               329   9e-108   
gb|EPS68133.1|  hypothetical protein M569_06639                         327   2e-107   
emb|CDX77207.1|  BnaC04g40020D                                          325   4e-106   
gb|AAM63209.1|  putative thaumatin                                      323   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180445.1|  pathogenesis-related thaumatin-like protein           323   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538000.1|  PREDICTED: osmotin-like protein-like               323   1e-105   
ref|XP_006409911.1|  hypothetical protein EUTSA_v10017135mg             323   1e-105   
ref|XP_009140942.1|  PREDICTED: osmotin-like protein                    323   3e-105   
gb|AAO12209.1|  thaumatin-like cytokinin-binding protein                322   3e-105   Brassica oleracea
emb|CDY31732.1|  BnaA04g16680D                                          321   1e-104   
ref|XP_009103714.1|  PREDICTED: osmotin-like protein                    320   2e-104   
ref|XP_007132080.1|  hypothetical protein PHAVU_011G065300g             319   4e-104   
gb|KFK32258.1|  hypothetical protein AALP_AA6G218900                    318   1e-103   
emb|CDY15787.1|  BnaC04g15370D                                          318   2e-103   
ref|XP_006846131.1|  hypothetical protein AMTR_s00012p00157270          317   3e-103   
ref|XP_004294572.1|  PREDICTED: osmotin-like protein-like               317   4e-103   
ref|XP_002313445.1|  osmotin-like family protein                        317   4e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008357503.1|  PREDICTED: osmotin-like protein                    315   2e-102   
ref|XP_007207347.1|  hypothetical protein PRUPE_ppa010410mg             310   2e-100   
ref|XP_008385133.1|  PREDICTED: osmotin-like protein                    305   2e-98    
ref|XP_008385134.1|  PREDICTED: osmotin-like protein                    304   5e-98    
ref|XP_009353813.1|  PREDICTED: osmotin-like protein                    303   2e-97    
gb|AFK44890.1|  unknown                                                 295   2e-94    
dbj|BAK00635.1|  predicted protein                                      294   3e-94    
ref|NP_001147098.1|  osmotin-like protein precursor                     294   5e-94    Zea mays [maize]
emb|CAQ15819.1|  putative thaumatin-like protein                        293   6e-94    Medicago truncatula var. truncatula
ref|NP_001044756.1|  Os01g0839900                                       292   2e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AGV54272.1|  osmotin-like protein                                    292   2e-93    
gb|ADI43216.1|  osmotin-like protein                                    291   5e-93    
gb|ADI43217.1|  osmotin-like protein                                    290   1e-92    
ref|XP_004970525.1|  PREDICTED: osmotin-like protein-like               289   3e-92    
ref|XP_002458737.1|  hypothetical protein SORBIDRAFT_03g039330          288   5e-92    Sorghum bicolor [broomcorn]
ref|XP_003564582.1|  PREDICTED: osmotin-like protein                    287   3e-91    
emb|CDM84927.1|  unnamed protein product                                280   8e-89    
ref|XP_008224274.1|  PREDICTED: osmotin-like protein                    261   2e-81    
ref|XP_009358383.1|  PREDICTED: osmotin-like protein                    258   1e-80    
ref|XP_010523133.1|  PREDICTED: osmotin-like protein                    246   5e-76    
gb|KCW52693.1|  hypothetical protein EUGRSUZ_J02061                     244   3e-75    
gb|ADB97925.1|  thaumatin-like protein L1                               233   1e-70    Pinus monticola
gb|ABK25809.1|  unknown                                                 202   7e-59    Picea sitchensis
gb|EYU34121.1|  hypothetical protein MIMGU_mgv1a022628mg                202   8e-59    
ref|XP_004233691.2|  PREDICTED: thaumatin-like protein                  202   2e-58    
ref|XP_006338784.1|  PREDICTED: thaumatin-like protein-like             202   3e-58    
ref|XP_011092890.1|  PREDICTED: thaumatin-like protein 1b               205   3e-58    
ref|XP_007160531.1|  hypothetical protein PHAVU_002G329400g             201   5e-58    
ref|XP_003631101.1|  Thaumatin-like protein                             199   2e-57    
ref|XP_003525190.1|  PREDICTED: thaumatin-like protein-like             198   6e-57    
emb|CDY30288.1|  BnaC04g31990D                                          197   8e-57    
gb|AAV64186.1|  hypothetical protein C9002                              199   8e-57    Zea mays [maize]
gb|AFK33451.1|  unknown                                                 197   1e-56    
ref|XP_006830037.1|  hypothetical protein AMTR_s00124p00098540          197   1e-56    
gb|AIU34434.1|  thaumatin-like protein 5                                196   1e-56    
emb|CDY30841.1|  BnaC04g26960D                                          197   2e-56    
ref|XP_003530957.2|  PREDICTED: thaumatin-like protein-like             197   2e-56    
gb|AFK48181.1|  unknown                                                 196   2e-56    
ref|XP_010065049.1|  PREDICTED: pathogenesis-related protein 5-like     198   2e-56    
ref|XP_011098559.1|  PREDICTED: pathogenesis-related protein 5          197   2e-56    
ref|XP_009139951.1|  PREDICTED: thaumatin-like protein                  196   2e-56    
ref|XP_010660983.1|  PREDICTED: thaumatin-like protein                  196   3e-56    
gb|KEH26933.1|  pathogenesis-related thaumatin family protein           196   4e-56    
ref|XP_010262514.1|  PREDICTED: thaumatin-like protein isoform X2       196   4e-56    
ref|XP_010262463.1|  PREDICTED: thaumatin-like protein isoform X1       196   5e-56    
ref|XP_004503284.1|  PREDICTED: thaumatin-like protein-like             196   5e-56    
ref|XP_011046468.1|  PREDICTED: pathogenesis-related protein 5-li...    197   8e-56    
ref|XP_011046459.1|  PREDICTED: pathogenesis-related protein 5-li...    197   8e-56    
ref|XP_010933188.1|  PREDICTED: thaumatin-like protein 1b               194   1e-55    
ref|XP_010450736.1|  PREDICTED: thaumatin-like protein                  195   1e-55    
ref|XP_006379282.1|  hypothetical protein POPTR_0009s13510g             197   2e-55    
gb|ABK92515.1|  unknown                                                 197   2e-55    Populus trichocarpa [western balsam poplar]
ref|XP_010065048.1|  PREDICTED: pathogenesis-related protein 5-like     195   2e-55    
ref|XP_002313721.2|  hypothetical protein POPTR_0009s13510g             197   2e-55    Populus trichocarpa [western balsam poplar]
gb|KDP45445.1|  hypothetical protein JCGZ_09694                         194   2e-55    
ref|XP_010245598.1|  PREDICTED: thaumatin-like protein 1b               196   2e-55    
gb|KCW70776.1|  hypothetical protein EUGRSUZ_F03936                     194   2e-55    
ref|NP_001131249.1|  uncharacterized protein LOC100192561 precursor     195   2e-55    Zea mays [maize]
ref|NP_198818.1|  pathogenesis-related thaumatin-like protein           194   2e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670350.1|  PREDICTED: thaumatin-like protein                  194   3e-55    
ref|XP_010065046.1|  PREDICTED: thaumatin-like protein                  194   3e-55    
ref|XP_002868677.1|  hypothetical protein ARALYDRAFT_493983             193   4e-55    
gb|KCW70779.1|  hypothetical protein EUGRSUZ_F03940                     195   4e-55    
gb|KHG15061.1|  hypothetical protein F383_19667                         193   4e-55    
ref|XP_006384568.1|  hypothetical protein POPTR_0004s17890g             196   5e-55    
gb|ABK94543.1|  unknown                                                 196   6e-55    Populus trichocarpa [western balsam poplar]
ref|XP_009775802.1|  PREDICTED: thaumatin-like protein                  193   7e-55    
ref|XP_010274714.1|  PREDICTED: thaumatin-like protein                  192   8e-55    
ref|XP_007222068.1|  hypothetical protein PRUPE_ppa009575mg             193   1e-54    
gb|ABK95807.1|  unknown                                                 192   1e-54    Populus trichocarpa [western balsam poplar]
ref|XP_002323818.2|  hypothetical protein POPTR_0017s11190g             192   1e-54    Populus trichocarpa [western balsam poplar]
ref|XP_011008365.1|  PREDICTED: thaumatin-like protein                  192   1e-54    
ref|XP_011084258.1|  PREDICTED: thaumatin-like protein                  192   1e-54    
ref|XP_006284382.1|  hypothetical protein CARUB_v10005550mg             192   1e-54    
gb|AHC69780.1|  thuamatin-like protein                                  191   2e-54    
ref|XP_004302370.1|  PREDICTED: thaumatin-like protein-like             192   2e-54    
ref|XP_009596997.1|  PREDICTED: thaumatin-like protein                  191   2e-54    
gb|KHN34189.1|  Thaumatin-like protein                                  191   3e-54    
ref|XP_006473671.1|  PREDICTED: thaumatin-like protein 1-like           193   3e-54    
ref|XP_010933187.1|  PREDICTED: thaumatin-like protein 1b               191   3e-54    
ref|XP_003554871.2|  PREDICTED: thaumatin-like protein-like             191   4e-54    
gb|KCW70777.1|  hypothetical protein EUGRSUZ_F03937                     192   4e-54    
gb|KHG03900.1|  hypothetical protein F383_27474                         190   4e-54    
emb|CAN59843.1|  hypothetical protein VITISV_030359                     190   4e-54    Vitis vinifera
ref|XP_007032343.1|  Pathogenesis-related thaumatin superfamily p...    191   5e-54    
gb|KHG27805.1|  Thaumatin-like protein 1a                               192   5e-54    
ref|XP_008233902.1|  PREDICTED: pathogenesis-related protein 5          191   5e-54    
ref|XP_010063355.1|  PREDICTED: pathogenesis-related protein 5          191   6e-54    
ref|XP_011001989.1|  PREDICTED: thaumatin-like protein 1b isoform X2    193   6e-54    
ref|XP_011001987.1|  PREDICTED: thaumatin-like protein 1b isoform X1    193   6e-54    
gb|KHG07208.1|  hypothetical protein F383_34305                         192   7e-54    
emb|CDO96933.1|  unnamed protein product                                193   7e-54    
ref|XP_010266794.1|  PREDICTED: thaumatin-like protein 1b               192   7e-54    
ref|XP_010097569.1|  hypothetical protein L484_017379                   190   8e-54    
ref|XP_002277548.1|  PREDICTED: thaumatin-like protein 1b               192   9e-54    Vitis vinifera
ref|XP_009391386.1|  PREDICTED: thaumatin-like protein                  189   1e-53    
ref|NP_001147654.1|  LOC100281263 precursor                             189   1e-53    Zea mays [maize]
gb|EYU37936.1|  hypothetical protein MIMGU_mgv1a009447mg                192   1e-53    
ref|XP_003634206.1|  PREDICTED: thaumatin-like protein                  189   1e-53    
ref|XP_010441116.1|  PREDICTED: thaumatin-like protein                  189   1e-53    
ref|XP_006405559.1|  hypothetical protein EUTSA_v10027894mg             189   2e-53    
gb|KDP23919.1|  hypothetical protein JCGZ_27079                         189   2e-53    
gb|EYU24132.1|  hypothetical protein MIMGU_mgv1a012513mg                188   3e-53    
ref|XP_009785059.1|  PREDICTED: thaumatin-like protein isoform X2       188   3e-53    
ref|XP_009785058.1|  PREDICTED: thaumatin-like protein isoform X1       188   3e-53    
ref|NP_177893.1|  Pathogenesis-related thaumatin superfamily protein    191   3e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238366.1|  PREDICTED: thaumatin-like protein 1b               191   4e-53    
ref|XP_002517440.1|  Protein P21, putative                              188   4e-53    Ricinus communis
ref|XP_009341686.1|  PREDICTED: thaumatin-like protein                  187   4e-53    
ref|XP_004235810.1|  PREDICTED: thaumatin-like protein                  188   4e-53    
ref|XP_010471966.1|  PREDICTED: pathogenesis-related protein 5-like     189   4e-53    
ref|XP_008463807.1|  PREDICTED: thaumatin-like protein                  188   4e-53    
ref|XP_007215905.1|  hypothetical protein PRUPE_ppa010781mg             187   4e-53    
ref|XP_010554023.1|  PREDICTED: thaumatin-like protein                  188   4e-53    
ref|XP_008341518.1|  PREDICTED: thaumatin-like protein isoform X2       187   4e-53    
ref|XP_008341517.1|  PREDICTED: thaumatin-like protein isoform X1       188   4e-53    
ref|XP_010933189.1|  PREDICTED: thaumatin-like protein 1b               187   5e-53    
ref|XP_007046679.1|  Pathogenesis-related thaumatin superfamily p...    190   5e-53    
ref|XP_007141088.1|  hypothetical protein PHAVU_008G166500g             189   5e-53    
ref|XP_007036794.1|  Pathogenesis-related thaumatin superfamily p...    188   5e-53    
ref|XP_010428854.1|  PREDICTED: thaumatin-like protein                  189   5e-53    
ref|XP_010090318.1|  hypothetical protein L484_024983                   191   6e-53    
ref|XP_010029259.1|  PREDICTED: thaumatin-like protein                  188   6e-53    
ref|XP_010066268.1|  PREDICTED: thaumatin-like protein 1b               190   6e-53    
ref|XP_010033498.1|  PREDICTED: thaumatin-like protein 1b               190   7e-53    
ref|XP_006435193.1|  hypothetical protein CICLE_v10001885mg             189   7e-53    
ref|NP_001058421.1|  Os06g0691200                                       187   7e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008803423.1|  PREDICTED: thaumatin-like protein                  187   1e-52    
gb|KDP29626.1|  hypothetical protein JCGZ_18788                         190   1e-52    
ref|XP_002532822.1|  Protein P21, putative                              187   1e-52    Ricinus communis
gb|AAK63884.1|AC074105_13  Putative thaumatin-like protein              189   1e-52    Oryza sativa [red rice]
ref|XP_006341532.1|  PREDICTED: thaumatin-like protein-like             187   1e-52    
ref|XP_010435956.1|  PREDICTED: thaumatin-like protein                  187   1e-52    
ref|XP_010272178.1|  PREDICTED: thaumatin-like protein                  187   1e-52    
ref|XP_007202291.1|  hypothetical protein PRUPE_ppa009119mg             188   1e-52    
ref|XP_009335804.1|  PREDICTED: thaumatin-like protein                  187   1e-52    
ref|XP_002534154.1|  Zeamatin precursor, putative                       189   1e-52    Ricinus communis
ref|XP_010257784.1|  PREDICTED: thaumatin-like protein                  186   1e-52    
ref|XP_010416727.1|  PREDICTED: pathogenesis-related protein 5-like     187   1e-52    
ref|XP_004137499.1|  PREDICTED: thaumatin-like protein-like             186   1e-52    
ref|XP_002887695.1|  predicted protein                                  187   1e-52    
ref|XP_004172611.1|  PREDICTED: thaumatin-like protein-like             187   2e-52    
ref|XP_002510548.1|  Zeamatin precursor, putative                       188   2e-52    Ricinus communis
gb|KGN50964.1|  hypothetical protein Csa_5G374740                       188   2e-52    
gb|EAY77701.1|  hypothetical protein OsI_32742                          189   2e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_003543788.1|  PREDICTED: pathogenesis-related protein 5-like     187   2e-52    
ref|XP_008801393.1|  PREDICTED: pathogenesis-related protein 5-li...    187   2e-52    
ref|XP_004140385.1|  PREDICTED: thaumatin-like protein-like             187   2e-52    
ref|XP_006431048.1|  hypothetical protein CICLE_v10012489mg             187   2e-52    
ref|XP_009620637.1|  PREDICTED: thaumatin-like protein                  186   2e-52    
ref|XP_008393422.1|  PREDICTED: thaumatin-like protein                  186   2e-52    
ref|XP_006390065.1|  hypothetical protein EUTSA_v10019646mg             186   2e-52    
emb|CDX68047.1|  BnaA07g20870D                                          187   2e-52    
ref|XP_009104608.1|  PREDICTED: thaumatin-like protein                  187   3e-52    
ref|XP_004291353.1|  PREDICTED: thaumatin-like protein 1-like           188   3e-52    
ref|XP_009367296.1|  PREDICTED: pathogenesis-related protein 5-like     187   3e-52    
ref|XP_011088584.1|  PREDICTED: thaumatin-like protein 1b               188   3e-52    
gb|ACT11052.1|  thaumatin-like protein                                  185   3e-52    
ref|XP_002317878.2|  hypothetical protein POPTR_0012s04520g             187   3e-52    Populus trichocarpa [western balsam poplar]
ref|XP_008364687.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...    185   3e-52    
ref|XP_002284403.3|  PREDICTED: pathogenesis-related protein 5          187   3e-52    Vitis vinifera
ref|XP_009622122.1|  PREDICTED: thaumatin-like protein 1                189   3e-52    
ref|XP_010929479.1|  PREDICTED: pathogenesis-related protein 5-like     187   4e-52    
ref|XP_006302655.1|  hypothetical protein CARUB_v10020759mg             186   4e-52    
ref|XP_008801392.1|  PREDICTED: pathogenesis-related protein 5-li...    187   4e-52    
ref|XP_006486762.1|  PREDICTED: thaumatin-like protein 1-like           189   4e-52    
ref|XP_009356044.1|  PREDICTED: thaumatin-like protein                  185   4e-52    
ref|XP_010041761.1|  PREDICTED: thaumatin-like protein 1b               187   4e-52    
gb|ADW08698.1|  thaumatin-like protein                                  185   4e-52    
ref|XP_008781004.1|  PREDICTED: thaumatin-like protein 1                187   4e-52    
emb|CDP20596.1|  unnamed protein product                                186   5e-52    
ref|XP_009400987.1|  PREDICTED: thaumatin-like protein 1b               185   5e-52    
ref|XP_003618434.1|  Thaumatin-like protein                             186   5e-52    
ref|XP_006422635.1|  hypothetical protein CICLE_v10028716mg             188   5e-52    
ref|XP_003563464.1|  PREDICTED: thaumatin-like protein                  185   5e-52    
gb|AFK39390.1|  unknown                                                 186   5e-52    
ref|XP_008378490.1|  PREDICTED: pathogenesis-related protein 5-like     186   6e-52    
ref|XP_009630387.1|  PREDICTED: thaumatin-like protein 1b               186   6e-52    
emb|CDX79230.1|  BnaC06g20730D                                          186   6e-52    
ref|XP_008365396.1|  PREDICTED: thaumatin-like protein                  185   6e-52    
ref|XP_006422634.1|  hypothetical protein CICLE_v10028716mg             188   7e-52    
gb|AAV64224.1|  hypothetical protein C9002                              186   8e-52    Zea mays [maize]
ref|XP_010934175.1|  PREDICTED: thaumatin-like protein 1                186   8e-52    
ref|XP_007131695.1|  hypothetical protein PHAVU_011G0342001g            184   8e-52    
ref|XP_006342063.1|  PREDICTED: thaumatin-like protein 1-like           187   9e-52    
gb|EPS57841.1|  hypothetical protein M569_16976                         186   1e-51    
ref|XP_007163959.1|  hypothetical protein PHAVU_L002100g                184   1e-51    
ref|XP_010909541.1|  PREDICTED: thaumatin-like protein                  184   1e-51    
ref|XP_003614785.1|  Pathogenesis-related protein                       185   1e-51    
ref|XP_009128246.1|  PREDICTED: pathogenesis-related protein 5-like     185   1e-51    
gb|KHG18980.1|  hypothetical protein F383_08602                         184   1e-51    
ref|XP_009400363.1|  PREDICTED: thaumatin-like protein 1b               186   1e-51    
gb|KDO80739.1|  hypothetical protein CISIN_1g023852mg                   185   1e-51    
emb|CDO98353.1|  unnamed protein product                                184   1e-51    
ref|XP_011039126.1|  PREDICTED: thaumatin-like protein                  185   2e-51    
ref|XP_010033700.1|  PREDICTED: thaumatin-like protein                  184   2e-51    
ref|XP_008230703.1|  PREDICTED: thaumatin-like protein                  184   2e-51    
gb|KHG02944.1|  hypothetical protein F383_23941                         187   2e-51    
ref|XP_004309088.1|  PREDICTED: thaumatin-like protein 1-like           186   2e-51    
emb|CDY44520.1|  BnaCnng11310D                                          185   2e-51    
ref|XP_003544148.2|  PREDICTED: pathogenesis-related protein 5-like     185   2e-51    
ref|XP_006434136.1|  hypothetical protein CICLE_v10002069mg             185   2e-51    
ref|XP_007160787.1|  hypothetical protein PHAVU_001G016600g             183   2e-51    
ref|XP_004956039.1|  PREDICTED: thaumatin-like protein 1-like           182   2e-51    
ref|XP_010467584.1|  PREDICTED: thaumatin-like protein 1b               184   2e-51    
ref|XP_006347468.1|  PREDICTED: pathogenesis-related protein 5-like     185   2e-51    
ref|XP_009389178.1|  PREDICTED: thaumatin-like protein 1                185   2e-51    
ref|XP_004512141.1|  PREDICTED: thaumatin-like protein 1-like           185   3e-51    
ref|XP_010489424.1|  PREDICTED: thaumatin-like protein 1b               183   3e-51    
ref|XP_011005396.1|  PREDICTED: thaumatin-like protein 1 isoform X1     183   3e-51    
ref|XP_010519216.1|  PREDICTED: thaumatin-like protein                  183   3e-51    
ref|XP_009785286.1|  PREDICTED: thaumatin-like protein 1b               186   3e-51    
emb|CDY19198.1|  BnaC05g13990D                                          183   3e-51    
ref|XP_006409236.1|  hypothetical protein EUTSA_v10022970mg             185   3e-51    
ref|XP_006482515.1|  PREDICTED: thaumatin-like protein-like             183   3e-51    
ref|XP_008465794.1|  PREDICTED: thaumatin-like protein                  184   3e-51    
ref|XP_006340942.1|  PREDICTED: pathogenesis-related protein 5-like     186   3e-51    
ref|XP_010091351.1|  hypothetical protein L484_020153                   184   3e-51    
gb|KEH30510.1|  pathogenesis-related thaumatin family protein           186   4e-51    
ref|XP_003540838.1|  PREDICTED: thaumatin-like protein 1-like           186   4e-51    
ref|XP_007041884.1|  Pathogenesis-related thaumatin superfamily p...    184   4e-51    
ref|XP_004171339.1|  PREDICTED: thaumatin-like protein 1-like           183   4e-51    
gb|KDP32764.1|  hypothetical protein JCGZ_12056                         184   4e-51    
ref|XP_004146145.1|  PREDICTED: thaumatin-like protein 1-like           182   4e-51    
ref|XP_004513301.1|  PREDICTED: pathogenesis-related protein 5-like     184   5e-51    
ref|XP_007221121.1|  hypothetical protein PRUPE_ppa018211mg             184   5e-51    
ref|XP_009417646.1|  PREDICTED: thaumatin-like protein                  182   6e-51    
ref|XP_007027491.1|  Thaumatin-like protein 1a                          182   6e-51    
ref|XP_002264550.2|  PREDICTED: pathogenesis-related protein 5-like     182   6e-51    
ref|XP_004505780.1|  PREDICTED: thaumatin-like protein 1-like           185   6e-51    
ref|XP_007041883.1|  Pathogenesis-related thaumatin superfamily p...    186   6e-51    
ref|XP_004147456.1|  PREDICTED: thaumatin-like protein-like             182   6e-51    
ref|XP_010662946.1|  PREDICTED: thaumatin-like protein 1                184   6e-51    
ref|XP_008801242.1|  PREDICTED: thaumatin-like protein 1                181   7e-51    
ref|XP_007041885.1|  Pathogenesis-related thaumatin superfamily p...    186   7e-51    
ref|XP_011008805.1|  PREDICTED: thaumatin-like protein                  182   7e-51    
ref|XP_002301968.2|  hypothetical protein POPTR_0002s02200g             184   8e-51    
ref|XP_004232498.1|  PREDICTED: pathogenesis-related protein 5          184   8e-51    
gb|KDO68004.1|  hypothetical protein CISIN_1g018813mg                   185   8e-51    
ref|XP_010933190.1|  PREDICTED: thaumatin-like protein 1b               182   8e-51    
gb|KDO68003.1|  hypothetical protein CISIN_1g018813mg                   185   8e-51    
gb|KGN59605.1|  Protein P21                                             182   8e-51    
ref|XP_006472729.1|  PREDICTED: thaumatin-like protein-like             183   9e-51    
ref|XP_011075843.1|  PREDICTED: thaumatin-like protein 1                183   9e-51    
ref|XP_010672697.1|  PREDICTED: thaumatin-like protein                  182   9e-51    
ref|XP_006416627.1|  hypothetical protein EUTSA_v10008614mg             181   1e-50    
ref|XP_008337996.1|  PREDICTED: thaumatin-like protein 1                182   1e-50    
ref|XP_002306940.2|  hypothetical protein POPTR_0005s26250g             184   1e-50    
ref|XP_009414066.1|  PREDICTED: thaumatin-like protein                  181   1e-50    
ref|XP_010530273.1|  PREDICTED: thaumatin-like protein 1b               183   1e-50    
ref|XP_002510549.1|  Zeamatin precursor, putative                       184   1e-50    
ref|XP_010428619.1|  PREDICTED: thaumatin-like protein 1b               184   1e-50    
ref|XP_009386565.1|  PREDICTED: thaumatin-like protein 1b isoform X2    182   1e-50    
emb|CAJ86348.1|  H0814G11.15                                            181   1e-50    
ref|XP_011045068.1|  PREDICTED: thaumatin-like protein 1b               183   1e-50    
ref|XP_006850117.1|  hypothetical protein AMTR_s00022p00227010          181   1e-50    
ref|XP_007141349.1|  hypothetical protein PHAVU_008G188000g             182   1e-50    
gb|KFK44066.1|  hypothetical protein AALP_AA1G211800                    181   1e-50    
ref|XP_010413368.1|  PREDICTED: thaumatin-like protein 1b               181   1e-50    
ref|XP_003549464.1|  PREDICTED: thaumatin-like protein 1-like           183   2e-50    
ref|XP_011084750.1|  PREDICTED: thaumatin-like protein 1                182   2e-50    
gb|KEH34729.1|  pathogenesis-related thaumatin family protein           181   2e-50    
emb|CDY26178.1|  BnaA06g12390D                                          181   2e-50    
gb|EPS57386.1|  zeamatin                                                181   2e-50    
gb|KHN34468.1|  Pathogenesis-related protein 5                          182   2e-50    
ref|XP_009625711.1|  PREDICTED: thaumatin-like protein 1b               183   2e-50    
ref|XP_009598313.1|  PREDICTED: pathogenesis-related protein 5-like     182   2e-50    
ref|XP_004287804.1|  PREDICTED: thaumatin-like protein 1-like           182   2e-50    
ref|XP_011088126.1|  PREDICTED: thaumatin-like protein                  181   2e-50    
emb|CDP12448.1|  unnamed protein product                                182   2e-50    
ref|XP_010555234.1|  PREDICTED: thaumatin-like protein 1b               184   2e-50    
gb|KCW53162.1|  hypothetical protein EUGRSUZ_J02446                     184   2e-50    
ref|XP_007141348.1|  hypothetical protein PHAVU_008G188000g             182   2e-50    
gb|KEH42142.1|  allergen Pru protein, putative                          181   2e-50    
ref|XP_006369399.1|  hypothetical protein POPTR_0001s22870g             181   2e-50    
ref|XP_004301252.1|  PREDICTED: thaumatin-like protein-like             181   2e-50    
gb|AFK46929.1|  unknown                                                 181   2e-50    
ref|XP_004500935.1|  PREDICTED: thaumatin-like protein 1-like iso...    183   2e-50    
gb|KHG24402.1|  Thaumatin-like protein 1                                182   3e-50    
gb|KDP46765.1|  hypothetical protein JCGZ_06553                         182   3e-50    
dbj|BAB11214.1|  thaumatin-like protein                                 181   3e-50    
ref|XP_008440826.1|  PREDICTED: thaumatin-like protein 1                183   3e-50    
ref|XP_009386564.1|  PREDICTED: thaumatin-like protein 1b isoform X1    182   3e-50    
gb|AES81924.2|  allergen Pru protein, putative                          180   3e-50    
ref|XP_011027593.1|  PREDICTED: thaumatin-like protein                  181   3e-50    
ref|XP_011012813.1|  PREDICTED: thaumatin-like protein                  181   3e-50    
ref|XP_011035010.1|  PREDICTED: thaumatin-like protein 1                182   3e-50    
ref|XP_002892990.1|  hypothetical protein ARALYDRAFT_889237             180   3e-50    
ref|XP_006826851.1|  hypothetical protein AMTR_s00010p00113630          180   3e-50    
gb|KGN48924.1|  hypothetical protein Csa_6G506010                       182   3e-50    
ref|XP_003625706.1|  Thaumatin-like protein                             180   3e-50    
ref|XP_007201407.1|  hypothetical protein PRUPE_ppa008035mg             183   3e-50    
ref|XP_004147029.1|  PREDICTED: pathogenesis-related protein 5-like     183   4e-50    
gb|EYU23904.1|  hypothetical protein MIMGU_mgv1a011450mg                181   4e-50    
ref|XP_004250343.2|  PREDICTED: pathogenesis-related protein 5          181   4e-50    
ref|XP_004292680.1|  PREDICTED: thaumatin-like protein-like             180   4e-50    
ref|XP_009799009.1|  PREDICTED: pathogenesis-related protein 5-like     181   4e-50    
gb|AFK34461.1|  unknown                                                 180   4e-50    
gb|ADN33945.1|  thaumatin-like protein                                  180   4e-50    
gb|KDP46766.1|  hypothetical protein JCGZ_06554                         182   4e-50    
ref|XP_008443444.1|  PREDICTED: thaumatin-like protein                  181   4e-50    
ref|XP_007018987.1|  Pathogenesis-related thaumatin superfamily p...    181   5e-50    
ref|XP_010920174.1|  PREDICTED: thaumatin-like protein 1b               182   5e-50    
ref|XP_002301966.2|  hypothetical protein POPTR_0002s02190g             182   5e-50    
ref|XP_007041882.1|  Pathogenesis-related thaumatin superfamily p...    184   5e-50    
ref|XP_002322099.1|  hypothetical protein POPTR_0015s04510g             180   5e-50    
ref|XP_009379396.1|  PREDICTED: thaumatin-like protein 1                181   5e-50    
gb|EYU26607.1|  hypothetical protein MIMGU_mgv1a012540mg                180   5e-50    
ref|XP_003615487.1|  Thaumatin-like protein                             185   5e-50    
ref|XP_008448547.1|  PREDICTED: thaumatin-like protein 1b               181   6e-50    
ref|XP_008234611.1|  PREDICTED: thaumatin-like protein 1                181   6e-50    
ref|XP_006386379.1|  hypothetical protein POPTR_0002s08760g             180   6e-50    
ref|XP_011005397.1|  PREDICTED: thaumatin-like protein 1b isoform X2    179   7e-50    
ref|XP_009629786.1|  PREDICTED: thaumatin-like protein 1b               181   7e-50    
ref|XP_007209509.1|  hypothetical protein PRUPE_ppa010418mg             179   7e-50    
ref|XP_002886132.1|  hypothetical protein ARALYDRAFT_343407             181   7e-50    
ref|XP_006653913.1|  PREDICTED: pathogenesis-related protein 5-like     180   7e-50    
gb|EYU45345.1|  hypothetical protein MIMGU_mgv1a011005mg                181   7e-50    
ref|XP_004172986.1|  PREDICTED: thaumatin-like protein-like             181   7e-50    
ref|XP_004241432.1|  PREDICTED: pathogenesis-related protein 5          181   7e-50    
ref|XP_006451631.1|  hypothetical protein CICLE_v10009291mg             179   8e-50    
ref|XP_008457672.1|  PREDICTED: thaumatin-like protein 1b               182   8e-50    
ref|XP_004517306.1|  PREDICTED: thaumatin-like protein 1a-like          179   9e-50    
ref|XP_009418409.1|  PREDICTED: thaumatin-like protein                  179   9e-50    
ref|XP_002301969.2|  hypothetical protein POPTR_0002s02200g             181   1e-49    
ref|XP_008659675.1|  PREDICTED: thaumatin-like protein 1b               181   1e-49    
ref|XP_004135026.1|  PREDICTED: thaumatin-like protein-like             181   1e-49    
gb|AIU34431.1|  thaumatin-like protein 1                                178   1e-49    
ref|NP_001031064.1|  Thaumatin-like protein                             179   1e-49    
gb|KEH19055.1|  pathogenesis-related thaumatin family protein           178   1e-49    
ref|XP_004516152.1|  PREDICTED: thaumatin-like protein-like             178   1e-49    
ref|XP_007160647.1|  hypothetical protein PHAVU_001G005000g             179   1e-49    
ref|XP_010459436.1|  PREDICTED: thaumatin-like protein                  179   1e-49    
gb|AES74022.2|  pathogenesis-related thaumatin family protein           178   1e-49    
ref|XP_008240157.1|  PREDICTED: thaumatin-like protein                  179   1e-49    
gb|EYU38795.1|  hypothetical protein MIMGU_mgv1a010603mg                180   1e-49    
ref|XP_010459682.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...    181   1e-49    
ref|XP_010471424.1|  PREDICTED: thaumatin-like protein                  178   2e-49    
ref|XP_006851913.1|  hypothetical protein AMTR_s00041p00163280          181   2e-49    
ref|XP_010539098.1|  PREDICTED: thaumatin-like protein 1b               180   2e-49    
ref|XP_007151179.1|  hypothetical protein PHAVU_004G024600g             179   2e-49    
ref|XP_007160648.1|  hypothetical protein PHAVU_001G005000g             180   2e-49    
ref|XP_009387427.1|  PREDICTED: thaumatin-like protein 1b               180   2e-49    
ref|XP_009391981.1|  PREDICTED: thaumatin-like protein 1b               180   2e-49    
ref|XP_002467352.1|  hypothetical protein SORBIDRAFT_01g026270          181   2e-49    
ref|NP_001288814.1|  thaumatin-like protein precursor                   178   2e-49    
ref|XP_007157907.1|  hypothetical protein PHAVU_002G107800g             181   2e-49    
ref|XP_010037818.1|  PREDICTED: thaumatin-like protein                  178   2e-49    
ref|NP_173261.1|  Thaumatin-like protein                                178   2e-49    
ref|XP_006419875.1|  hypothetical protein CICLE_v10005506mg             180   2e-49    
emb|CDX73199.1|  BnaC06g36470D                                          181   2e-49    
ref|XP_007160788.1|  hypothetical protein PHAVU_001G016700g             178   2e-49    
gb|AAA32875.1|  thaumatin-like protein                                  178   2e-49    
ref|XP_002533803.1|  Protein P21, putative                              179   2e-49    
ref|XP_006489344.1|  PREDICTED: thaumatin-like protein 1-like           180   2e-49    
ref|XP_008680256.1|  PREDICTED: thaumatin-like protein 1b               181   2e-49    
ref|XP_003544273.2|  PREDICTED: thaumatin-like protein 1-like           180   2e-49    
ref|XP_008803099.1|  PREDICTED: thaumatin-like protein                  178   2e-49    
gb|EEC78305.1|  hypothetical protein OsI_18027                          179   2e-49    
ref|XP_009340234.1|  PREDICTED: thaumatin-like protein 1b               181   2e-49    
ref|XP_002467254.1|  hypothetical protein SORBIDRAFT_01g022110          179   2e-49    
ref|XP_008442521.1|  PREDICTED: thaumatin-like protein                  178   2e-49    
ref|XP_009349687.1|  PREDICTED: thaumatin-like protein 1b               181   3e-49    
ref|XP_007141401.1|  hypothetical protein PHAVU_008G192300g             178   3e-49    
ref|NP_001288837.1|  thaumatin-like protein precursor                   177   3e-49    
ref|XP_006466958.1|  PREDICTED: pathogenesis-related protein 5-li...    177   3e-49    
ref|XP_008352435.1|  PREDICTED: thaumatin-like protein 1                180   3e-49    
ref|XP_004302778.1|  PREDICTED: thaumatin-like protein-like             177   3e-49    
ref|XP_004966180.1|  PREDICTED: thaumatin-like protein-like             178   3e-49    
ref|XP_002265805.1|  PREDICTED: thaumatin-like protein 1b               180   3e-49    
ref|XP_008372899.1|  PREDICTED: thaumatin-like protein 1b               181   3e-49    
gb|AHY84684.1|  thaumatin-like protein                                  177   3e-49    
ref|XP_002265925.1|  PREDICTED: thaumatin-like protein 1b               179   3e-49    
gb|ACE80963.1|  putative allergen Pru p 2.04                            180   3e-49    
ref|XP_003603771.1|  Thaumatin-like protein                             178   3e-49    
gb|ACE80962.1|  putative allergen Pru du 2.04                           180   3e-49    
ref|XP_007222615.1|  hypothetical protein PRUPE_ppa008483mg             180   4e-49    
gb|AFK49127.1|  unknown                                                 177   4e-49    
gb|ACN97419.1|  thaumatin-like protein                                  177   4e-49    
gb|ADK60776.1|  thaumatin-like protein-like protein                     177   4e-49    
ref|XP_004489362.1|  PREDICTED: thaumatin-like protein-like             178   4e-49    
gb|KFK41805.1|  hypothetical protein AALP_AA2G174200                    177   4e-49    
ref|XP_004137787.1|  PREDICTED: thaumatin-like protein-like             177   4e-49    
ref|XP_009106235.1|  PREDICTED: thaumatin-like protein 1                179   4e-49    
emb|CDY20846.1|  BnaC07g06950D                                          177   4e-49    
ref|XP_010533842.1|  PREDICTED: thaumatin-like protein 1b               180   4e-49    
ref|XP_009794723.1|  PREDICTED: thaumatin-like protein 1b               179   4e-49    
ref|XP_001784610.1|  predicted protein                                  176   5e-49    
ref|XP_010498212.1|  PREDICTED: thaumatin-like protein                  177   5e-49    
dbj|BAJ87574.1|  predicted protein                                      177   5e-49    
ref|XP_006466956.1|  PREDICTED: thaumatin-like protein 1-like           179   5e-49    
ref|XP_009774886.1|  PREDICTED: thaumatin-like protein 1b               179   5e-49    
ref|XP_008233674.1|  PREDICTED: thaumatin-like protein                  177   5e-49    
ref|XP_006480866.1|  PREDICTED: thaumatin-like protein-like             177   5e-49    
ref|XP_008394054.1|  PREDICTED: thaumatin-like protein 1                179   5e-49    
ref|XP_002306938.2|  pathogenesis-related thaumatin family protein      179   5e-49    
ref|XP_009106020.1|  PREDICTED: thaumatin-like protein isoform X2       177   5e-49    
ref|XP_004169877.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    180   5e-49    
emb|CDX96487.1|  BnaA07g30980D                                          177   5e-49    
ref|XP_008442736.1|  PREDICTED: thaumatin-like protein 1b               177   5e-49    
dbj|BAE71242.1|  putative thaumatin-like protein                        179   6e-49    
ref|XP_006299870.1|  hypothetical protein CARUB_v10016074mg             179   6e-49    
ref|XP_009401910.1|  PREDICTED: thaumatin-like protein 1b               179   6e-49    
ref|NP_001054348.1|  Os04g0689900                                       178   6e-49    
ref|XP_011083577.1|  PREDICTED: thaumatin-like protein 1b               179   6e-49    
ref|XP_006301887.1|  hypothetical protein CARUB_v10022361mg             179   7e-49    
emb|CDX72995.1|  BnaC06g34430D                                          177   7e-49    
ref|NP_179376.1|  pathogenesis-related thaumatin-like protein           177   7e-49    
ref|XP_009343698.1|  PREDICTED: thaumatin-like protein 1a               177   8e-49    
ref|XP_010941295.1|  PREDICTED: thaumatin-like protein 1b               178   8e-49    
ref|XP_008788393.1|  PREDICTED: thaumatin-like protein 1b               178   8e-49    
ref|XP_009607714.1|  PREDICTED: pathogenesis-related protein 5-like     179   8e-49    
gb|ACX32461.1|  thaumatin-like protein                                  176   8e-49    
ref|XP_006390535.1|  hypothetical protein EUTSA_v10019050mg             176   9e-49    
ref|XP_008778758.1|  PREDICTED: thaumatin-like protein 1b               177   9e-49    
emb|CDY13533.1|  BnaC02g23440D                                          179   9e-49    
ref|XP_011016386.1|  PREDICTED: thaumatin-like protein 1 isoform X1     176   9e-49    
ref|XP_008649589.1|  PREDICTED: thaumatin-like protein 1b isoform X2    178   9e-49    
ref|XP_006466957.1|  PREDICTED: pathogenesis-related protein 5-li...    178   9e-49    
ref|XP_008221247.1|  PREDICTED: thaumatin-like protein 1                179   9e-49    
ref|XP_010107327.1|  hypothetical protein L484_009461                   177   9e-49    
ref|XP_009795150.1|  PREDICTED: pathogenesis-related protein 5-li...    176   9e-49    
ref|XP_006425448.1|  hypothetical protein CICLE_v10026139mg             178   1e-48    
ref|XP_003518288.1|  PREDICTED: thaumatin-like protein 1-like           178   1e-48    
ref|XP_010536400.1|  PREDICTED: thaumatin-like protein 1b               179   1e-48    
ref|XP_002437495.1|  hypothetical protein SORBIDRAFT_10g028130          177   1e-48    
gb|KEH40232.1|  pathogenesis-related thaumatin family protein           177   1e-48    
emb|CDY72463.1|  BnaAnng41250D                                          176   1e-48    
ref|NP_177708.1|  pathogenesis-related thaumatin-like protein           179   1e-48    
gb|AAD02499.1|  thaumatin-like protein                                  176   1e-48    
ref|XP_006425450.1|  hypothetical protein CICLE_v10026181mg             177   1e-48    
ref|XP_006302686.1|  hypothetical protein CARUB_v10020795mg             177   1e-48    
ref|XP_004137850.1|  PREDICTED: thaumatin-like protein 1-like           176   1e-48    
ref|XP_006847064.1|  hypothetical protein AMTR_s00017p00203890          179   1e-48    
ref|XP_009338610.1|  PREDICTED: thaumatin-like protein                  176   1e-48    
ref|XP_006596544.1|  PREDICTED: thaumatin-like protein 1-like           178   1e-48    
ref|XP_010102631.1|  hypothetical protein L484_010920                   176   1e-48    
gb|KDP36909.1|  hypothetical protein JCGZ_08200                         178   1e-48    
ref|XP_002529658.1|  Zeamatin precursor, putative                       178   1e-48    
ref|XP_003545287.2|  PREDICTED: pathogenesis-related protein 5-like     176   1e-48    
emb|CDX88118.1|  BnaA06g27090D                                          180   1e-48    
ref|XP_009357782.1|  PREDICTED: thaumatin-like protein 1a               176   1e-48    
gb|EYU45112.1|  hypothetical protein MIMGU_mgv1a012469mg                176   1e-48    
ref|XP_010033497.1|  PREDICTED: thaumatin-like protein 1b               177   1e-48    
ref|XP_003612190.1|  Thaumatin-like protein                             178   1e-48    
ref|XP_009391045.1|  PREDICTED: thaumatin-like protein 1b isoform X1    178   1e-48    
ref|XP_010317741.1|  PREDICTED: thaumatin-like protein 1b               177   1e-48    
ref|XP_010477228.1|  PREDICTED: thaumatin-like protein 1                178   2e-48    
ref|XP_009404587.1|  PREDICTED: thaumatin-like protein isoform X1       176   2e-48    



>ref|XP_009800616.1| PREDICTED: osmotin-like protein [Nicotiana sylvestris]
Length=252

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 195/229 (85%), Gaps = 3/229 (1%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            +GLI+T+VNNCP+TIWPAIQPN G+PVLERGGFAL+ LTHRSF AP   WSGRIWARTGC
Sbjct  27   SGLILTLVNNCPYTIWPAIQPNAGHPVLERGGFALHTLTHRSFAAPTTHWSGRIWARTGC  86

Query  423  VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
               HG+F+CATGDC GR+EC G GGA PATLAQF LH GHADFS+YG+SLVDGFN+P+T+
Sbjct  87   SYAHGKFSCATGDCGGRIECEGLGGATPATLAQFALHHGHADFSSYGVSLVDGFNIPLTV  146

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH+GKG CPVVGCRA +L  CP  LQ  LR+  G GPVVGC SGC AFKTDELCCRN++
Sbjct  147  TPHEGKGQCPVVGCRAEILQTCPAVLQ--LRSHGGHGPVVGCKSGCEAFKTDELCCRNHF  204

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  CK S YS+FFKHACP+TFTYAHD+P SLMHECS+ RELKIIFCH
Sbjct  205  NSPQTCKGSSYSEFFKHACPATFTYAHDSP-SLMHECSSPRELKIIFCH  252



>ref|XP_009594695.1| PREDICTED: osmotin-like protein [Nicotiana tomentosiformis]
Length=252

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 200/238 (84%), Gaps = 4/238 (2%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            CA + A+  +GLI+T+VNNCP+TIWPAIQPN G+PVLERGGFAL+ LTHRSF AP   WS
Sbjct  19   CALSQATY-SGLILTLVNNCPYTIWPAIQPNAGHPVLERGGFALHTLTHRSFAAPTTHWS  77

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GRIWARTGC   HG+F CATGDC GR+EC+G GGA PATLAQF LH GHADFS+YG+SLV
Sbjct  78   GRIWARTGCSYAHGKFNCATGDCGGRIECDGLGGATPATLAQFVLHHGHADFSSYGVSLV  137

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFN+P+T+TPH+GKG CPVVGCRA +L  CP  LQ  LR+  G GPVVGC SGC AFKT
Sbjct  138  DGFNIPLTVTPHEGKGQCPVVGCRAEILQTCPAVLQ--LRSHGGHGPVVGCKSGCEAFKT  195

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN++N+P  CK S YS+FFKHACP+TFTYAHD+P SLMHECS+ RELK+IFCH
Sbjct  196  DELCCRNHFNSPQTCKGSSYSEFFKHACPATFTYAHDSP-SLMHECSSPRELKVIFCH  252



>gb|EYU19299.1| hypothetical protein MIMGU_mgv1a012525mg [Erythranthe guttata]
Length=248

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 202/248 (81%), Gaps = 5/248 (2%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            +  +++F  +C    A+ P GLI+T+VNNCP+TIWPAIQPN G+P LERGGFAL  LTHR
Sbjct  6    LFPLSIFFIVCTVAKATHP-GLILTVVNNCPYTIWPAIQPNAGHPALERGGFALSSLTHR  64

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
            SF AP A WSGR+WARTGC+  HGRF+CATGDC GRLEC G GGAAPATLAQF LH GHA
Sbjct  65   SFPAPSAHWSGRLWARTGCIYAHGRFSCATGDCGGRLECGGLGGAAPATLAQFTLHHGHA  124

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            DFS+Y +SLVDGFN+PMT+TPH+GKG CPVVGCRA+LL  CP  LQVR     G   V+G
Sbjct  125  DFSSYSVSLVDGFNIPMTVTPHEGKGQCPVVGCRADLLATCPHALQVRGPPHGG---VIG  181

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C SGCAAF TDELCCRN+YN+P  C+AS YS+FFKHACP+TFTYAHD+P SL HECSA R
Sbjct  182  CKSGCAAFGTDELCCRNHYNSPQTCRASSYSEFFKHACPATFTYAHDSP-SLTHECSAPR  240

Query  906  ELKIIFCH  929
            ELK+IFCH
Sbjct  241  ELKVIFCH  248



>gb|AIE54288.1| osmotin-like protein [Nicotiana tabacum]
Length=252

 Score =   365 bits (937),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 198/238 (83%), Gaps = 4/238 (2%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            CA + A+  +GLI+T+VNNCP+TIWPAIQPN G+PVLERGGFAL+ LTHRSF AP   WS
Sbjct  19   CALSQATY-SGLILTLVNNCPYTIWPAIQPNAGHPVLERGGFALHTLTHRSFAAPTTHWS  77

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GRIWARTGC   HG+F CATGDC GR+EC+G GGA PATLAQF LH GHADFS+YG+SLV
Sbjct  78   GRIWARTGCSYAHGKFNCATGDCGGRIECDGLGGATPATLAQFVLHHGHADFSSYGVSLV  137

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFN+P+T+TPH+GKG CPVVGCRA +L  CP  LQ  LR+  G GPVVGC SGC AFKT
Sbjct  138  DGFNIPLTVTPHEGKGQCPVVGCRAEILQTCPAVLQ--LRSHGGHGPVVGCKSGCEAFKT  195

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN++N+P  CK S YS+FFKHACP+TFTYAHD+P SLMHECS+  ELK+I CH
Sbjct  196  DELCCRNHFNSPQTCKGSSYSEFFKHACPATFTYAHDSP-SLMHECSSPHELKVILCH  252



>ref|NP_001234714.1| osmotin-like protein precursor [Solanum lycopersicum]
 sp|Q41350.1|OLP1_SOLLC RecName: Full=Osmotin-like protein; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAB41124.1| osmotin-like protein [Solanum lycopersicum]
Length=252

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 191/227 (84%), Gaps = 3/227 (1%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
             I+T+VNNCP+TIWPAIQPN G+PVLERGGF L+ LTHRSF AP A WSGRIWARTGC  
Sbjct  29   FILTLVNNCPYTIWPAIQPNAGHPVLERGGFTLHSLTHRSFPAPNAHWSGRIWARTGCNY  88

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             HG+F CATGDC GR+EC+G GGAAPATLAQF LH GHADFSTYG+SLVDGFN+P+T+TP
Sbjct  89   QHGKFYCATGDCGGRIECDGLGGAAPATLAQFVLHHGHADFSTYGVSLVDGFNIPLTVTP  148

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
            H+GKG CPVVGCRANLL +CP  LQ   R+  G GPVVGC S C AFK+DE CCRN+YN+
Sbjct  149  HEGKGVCPVVGCRANLLESCPAVLQ--FRSHGGHGPVVGCKSACEAFKSDEFCCRNHYNS  206

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  CK S YS FFKHACP+TFTYAHD+P SLMHECS+ RELK+IFCH
Sbjct  207  PQTCKPSSYSQFFKHACPATFTYAHDSP-SLMHECSSPRELKVIFCH  252



>ref|XP_002531364.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF31012.1| Zeamatin precursor, putative [Ricinus communis]
Length=254

 Score =   357 bits (916),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 173/258 (67%), Positives = 205/258 (79%), Gaps = 8/258 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFIS----LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
            MA+ +  ++  LF S    L +F+ A+ P GLI+T+VNNCP+TI+PAIQPN+G PVLE+G
Sbjct  1    MAYSSAAITALLFYSTITTLTSFSQAT-PPGLILTLVNNCPYTIYPAIQPNSGSPVLEKG  59

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATL  515
            GF L  LTHRSF  P   WSGRIWARTGC   +G+F CATGDC+ ++ECNG GGA PATL
Sbjct  60   GFPLTTLTHRSFPVPNHHWSGRIWARTGCTHYNGKFHCATGDCNHQIECNGLGGATPATL  119

Query  516  AQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLR  695
            AQF LH GH DFS+YG+SLVDGFN+PMT+TPH+GKG CPVVGCRANLL  CP +LQ+R  
Sbjct  120  AQFSLHHGHNDFSSYGVSLVDGFNIPMTVTPHEGKGVCPVVGCRANLLATCPAKLQLRYP  179

Query  696  ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS  875
            A  G GPVV C SGC AF TDE CCRN+YN+P  C+AS YS FFKHACP+TFTYAHD+P 
Sbjct  180  A--GHGPVVACKSGCEAFGTDEFCCRNHYNSPQTCRASSYSQFFKHACPATFTYAHDSP-  236

Query  876  SLMHECSAARELKIIFCH  929
            SLMHECS+ RELK+IFCH
Sbjct  237  SLMHECSSPRELKVIFCH  254



>gb|KDP44218.1| hypothetical protein JCGZ_05685 [Jatropha curcas]
Length=250

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 199/250 (80%), Gaps = 3/250 (1%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            AT+L  T+  +L    +    A LI+T+VNNCP T++PAIQPN G+PVLE+GGF L  LT
Sbjct  4    ATVLFSTISTALFILFSFGQAAPLILTLVNNCPFTVYPAIQPNAGHPVLEKGGFPLSTLT  63

Query  360  HRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
            HRSF  P   W+GRIWARTGC   +G+F CATGDC+ +LECNG GGA PATLAQF LH G
Sbjct  64   HRSFPVPNQHWTGRIWARTGCTHTNGKFHCATGDCNHQLECNGLGGAPPATLAQFSLHHG  123

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
            H DFS+YG+SLVDGFNLPMT+TPH+GKG CPVVGCRANLL  CP++LQVR     G GPV
Sbjct  124  HNDFSSYGVSLVDGFNLPMTITPHEGKGVCPVVGCRANLLTTCPQKLQVRYPV--GHGPV  181

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C SGC AF TDELCCRN+YNNP  C+AS YS+FFKHACP+TFTYAHD+P SLMHECS+
Sbjct  182  VACKSGCLAFGTDELCCRNHYNNPQTCRASSYSEFFKHACPATFTYAHDSP-SLMHECSS  240

Query  900  ARELKIIFCH  929
             RELK+IFCH
Sbjct  241  PRELKVIFCH  250



>gb|AGL07709.1| pathogenesis-related thaumatin-like protein [Ziziphus jujuba]
Length=251

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 196/245 (80%), Gaps = 4/245 (2%)
 Frame = +3

Query  195  VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV  374
            +T F+ LC    A+ PA +I+T+VNNCP T+WPAIQPN+G+ VLERGGFAL+ LTHRSF 
Sbjct  11   LTTFLILCTICHATNPA-MILTLVNNCPFTVWPAIQPNSGHDVLERGGFALHTLTHRSFP  69

Query  375  APRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS  554
            AP   WSGRIWARTGC  ++ RF+CATGDC G++ECNG GG  PATL Q  LH GH DF+
Sbjct  70   APNHYWSGRIWARTGCTYSNNRFSCATGDCGGKIECNGAGGKTPATLVQITLHHGHNDFT  129

Query  555  TYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS  734
            +YG+SLVDGFNLPMT+TPH+GKG CPVVGCRANLL  CP  LQ  LR+    GPVV C S
Sbjct  130  SYGVSLVDGFNLPMTVTPHEGKGVCPVVGCRANLLATCPESLQ--LRSPPVHGPVVACKS  187

Query  735  GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK  914
             C AF TDELCCRN+YN+P  C+AS YS FFKHACP+TFTYAHD+P SLMHECS+ RELK
Sbjct  188  ACEAFGTDELCCRNHYNSPQTCRASNYSQFFKHACPATFTYAHDSP-SLMHECSSPRELK  246

Query  915  IIFCH  929
            +IFCH
Sbjct  247  VIFCH  251



>ref|XP_007016468.1| Osmotin-like protein [Theobroma cacao]
 gb|EOY34087.1| Osmotin-like protein [Theobroma cacao]
Length=253

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 201/257 (78%), Gaps = 5/257 (2%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            MA    A++        LC+F  A+ P GLI+T+VNNCP T++PAIQPN G+PVLERGGF
Sbjct  1    MASPLCASLFCFATLFLLCSFAAATQP-GLILTLVNNCPFTVYPAIQPNAGHPVLERGGF  59

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQ  521
            AL  LTHRSF AP A WSGRIWARTGC  ++G F CATGDC  R+ECNG GGA P TLAQ
Sbjct  60   ALQTLTHRSFPAPTAHWSGRIWARTGCTHSNGHFYCATGDCGHRIECNGLGGATPVTLAQ  119

Query  522  FELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRA  698
            F LH  GH D S+Y +SLVDGFN+PMT+TPH+GKG CPVVGCRANLL  CP +LQ  LR+
Sbjct  120  FSLHHGGHKDLSSYAVSLVDGFNVPMTVTPHEGKGLCPVVGCRANLLATCPDKLQ--LRS  177

Query  699  RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS  878
              G GPVVGC SGC AF TDELCCRN+YN+P  C+AS +S+FFKHACP+TFTYAHD+P S
Sbjct  178  PPGHGPVVGCKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATFTYAHDSP-S  236

Query  879  LMHECSAARELKIIFCH  929
            L HEC++ RELKIIFCH
Sbjct  237  LTHECASPRELKIIFCH  253



>ref|XP_010259948.1| PREDICTED: osmotin-like protein [Nelumbo nucifera]
Length=264

 Score =   350 bits (899),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 192/236 (81%), Gaps = 4/236 (2%)
 Frame = +3

Query  222  FTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGR  401
             T A+ P G I+T+VNNCP TIWPAIQPN G+ VLERGGFAL  LTHRSF AP   WSGR
Sbjct  33   LTHATSP-GFILTVVNNCPFTIWPAIQPNAGHVVLERGGFALQTLTHRSFPAPAHHWSGR  91

Query  402  IWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDG  581
            +WARTGC  ++GRF+CATGDC GRLECNG GG  PATLAQF LH GH D S+YG+SLVDG
Sbjct  92   LWARTGCTYSNGRFSCATGDCGGRLECNGAGGVTPATLAQFSLHHGHNDQSSYGVSLVDG  151

Query  582  FNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDE  761
            FNLPMT+TPH+GKG CPVVGC+ANLL  CP+ LQ  LR   G GPVV C SGC AF TDE
Sbjct  152  FNLPMTVTPHEGKGVCPVVGCKANLLETCPKSLQ--LRCPPGHGPVVACKSGCEAFGTDE  209

Query  762  LCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            LCCRN+YN+P  CKAS Y++FFKHACP+T TYAHD+P SLMH+CS+ RELK+IFCH
Sbjct  210  LCCRNHYNSPQTCKASSYAEFFKHACPATVTYAHDSP-SLMHQCSSPRELKVIFCH  264



>ref|XP_011081307.1| PREDICTED: osmotin-like protein [Sesamum indicum]
Length=242

 Score =   350 bits (897),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 189/232 (81%), Gaps = 9/232 (4%)
 Frame = +3

Query  234  SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWAR  413
            + P GLI+T+VNNCP TIWPAIQPN G+P LERGGFAL  LTHRSF AP   W     AR
Sbjct  20   ATPPGLILTVVNNCPFTIWPAIQPNAGHPALERGGFALSTLTHRSFPAPSGHW-----AR  74

Query  414  TGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLP  593
            TGC   HGRF+CATGDC GRLEC+G GGAAPATLAQF LH GHADFS+YG+SLVDGFNLP
Sbjct  75   TGCSYAHGRFSCATGDCGGRLECDGHGGAAPATLAQFSLHHGHADFSSYGVSLVDGFNLP  134

Query  594  MTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCR  773
            MT+TPH+GKG CPVVGCRA+LL  CP  LQVR       G VVGC SGCAAF TDELCCR
Sbjct  135  MTVTPHEGKGQCPVVGCRADLLSTCPHALQVRGPP---HGAVVGCKSGCAAFGTDELCCR  191

Query  774  NNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+YN+P  C+AS YS+FFKHACP+TFTYAHD+P SLMHECSA RELK+IFCH
Sbjct  192  NHYNSPQTCRASSYSEFFKHACPATFTYAHDSP-SLMHECSAPRELKVIFCH  242



>ref|XP_006349009.1| PREDICTED: osmotin-like protein-like [Solanum tuberosum]
Length=251

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 185/227 (81%), Gaps = 3/227 (1%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
             I+T+VNNCP+TIWPAIQPN G+PVLERGGF L+ LTHRSF AP A WSGR+WARTGC  
Sbjct  28   FILTLVNNCPYTIWPAIQPNAGHPVLERGGFTLHSLTHRSFPAPTAHWSGRVWARTGCTY  87

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             HG+F CATGDC GR+EC+G GGA PATLAQF LH GHADFSTY +SLVDGFN+P+T+TP
Sbjct  88   EHGKFYCATGDCGGRIECDGLGGAPPATLAQFVLHHGHADFSTYSVSLVDGFNIPLTVTP  147

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
            H+GKG CPVVGC+ NL  +CP  LQ   ++  G G VVGC S C AFKTDE CCRN+YN+
Sbjct  148  HEGKGVCPVVGCKENLSESCPAVLQ--FKSHGGHGSVVGCKSACEAFKTDEFCCRNHYNS  205

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  CK S YS FFKHACP+T TYAHD+P SLMHECS+ RELK+IFCH
Sbjct  206  PQTCKPSSYSQFFKHACPATITYAHDSP-SLMHECSSPRELKVIFCH  251



>ref|XP_006424795.1| hypothetical protein CICLE_v10029149mg [Citrus clementina]
 ref|XP_006488293.1| PREDICTED: osmotin-like protein-like [Citrus sinensis]
 gb|ESR38035.1| hypothetical protein CICLE_v10029149mg [Citrus clementina]
Length=248

 Score =   347 bits (889),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 195/248 (79%), Gaps = 7/248 (3%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
             +S T+ + L ++  AS     I+T+VNNCP  +WPAIQPN G+PVLERGGF L+ LTHR
Sbjct  8    FISATILLLLSSYAKASF----ILTLVNNCPFPVWPAIQPNAGHPVLERGGFYLHSLTHR  63

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
            SF AP   WSGRIWARTGC   HG+F+C TGDC  RLECNG GGA PATLAQF LH GH 
Sbjct  64   SFPAPAQHWSGRIWARTGCTYAHGKFSCVTGDCGHRLECNGLGGATPATLAQFSLHHGHN  123

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            D S+YG+SLVDGFN+PMT+TPH+GKG CPVVGCRA+LL  CP+ LQV  R+  G G VV 
Sbjct  124  DLSSYGVSLVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQV--RSPPGHGRVVA  181

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C SGC AF TDELCCRN+YN+P  C+AS +S+FFKHACP+T TYAHD+P SLMH+CS+ R
Sbjct  182  CKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSP-SLMHDCSSPR  240

Query  906  ELKIIFCH  929
            ELK+IFCH
Sbjct  241  ELKVIFCH  248



>ref|XP_002281193.1| PREDICTED: osmotin-like protein [Vitis vinifera]
Length=254

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 193/238 (81%), Gaps = 4/238 (2%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            C  + A+ P GLI+T+VNNCP TIWPAIQPN G+ VLERGGFAL+ LTHRSF AP   WS
Sbjct  21   CTLSHATNP-GLILTVVNNCPFTIWPAIQPNAGHDVLERGGFALHTLTHRSFAAPSHHWS  79

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GRIWARTGC   +G+F+C TGDC GRLEC+G GGAAPATLAQF LH G  DFS+Y +SLV
Sbjct  80   GRIWARTGCTYINGKFSCVTGDCGGRLECSGSGGAAPATLAQFTLHHGQNDFSSYAVSLV  139

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFNLPMT+TPH+GKG CPVVGCRANLL  CP +LQ+      G+  VV C SGC AF T
Sbjct  140  DGFNLPMTVTPHEGKGLCPVVGCRANLLETCPGKLQMWSPPEHGK--VVACKSGCEAFGT  197

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN+YN+P  C+AS +S+FFKHACP+TFTYAHD+P SLMHECS+ RELK+IFCH
Sbjct  198  DELCCRNHYNSPQTCRASSFSEFFKHACPATFTYAHDSP-SLMHECSSPRELKVIFCH  254



>emb|CAN74416.1| hypothetical protein VITISV_028913 [Vitis vinifera]
Length=254

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 193/238 (81%), Gaps = 4/238 (2%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            C  + A+ P GLI+T+VNNCP TIWPAIQPN G+ VLERGGFAL+ LTHRSF AP   WS
Sbjct  21   CTLSHATNP-GLILTVVNNCPFTIWPAIQPNAGHDVLERGGFALHTLTHRSFXAPSHHWS  79

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GRIWARTGC   +G+F+C TGDC GRLEC+G GGAAPATLAQF LH G  DFS+Y +SLV
Sbjct  80   GRIWARTGCTYINGKFSCVTGDCGGRLECSGSGGAAPATLAQFTLHHGQNDFSSYAVSLV  139

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFNLPMT+TPH+GKG CPVVGCRANLL  CP +LQ+      G+  VV C SGC AF T
Sbjct  140  DGFNLPMTVTPHEGKGLCPVVGCRANLLETCPGKLQMWSPPEHGK--VVACKSGCEAFGT  197

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN+YN+P  C+AS +S+FFKHACP+TFTYAHD+P SLMHECS+ RELK+IFCH
Sbjct  198  DELCCRNHYNSPQTCRASSFSEFFKHACPATFTYAHDSP-SLMHECSSPRELKVIFCH  254



>dbj|BAI63297.1| thaumatin-like protein [Citrus jambhiri]
Length=248

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 194/248 (78%), Gaps = 7/248 (3%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
             +S T+ + L ++  AS     I+T+VNNCP  +WPAIQPN G+PVLERGGF L+ LTHR
Sbjct  8    FISATILLLLSSYAKASF----ILTLVNNCPFPVWPAIQPNAGHPVLERGGFYLHSLTHR  63

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
            SF AP   WSGRIWARTGC   HG+F+C TGDC  RLE NG GGA PATLAQF LH GH 
Sbjct  64   SFPAPAQHWSGRIWARTGCTYAHGKFSCVTGDCGHRLESNGLGGATPATLAQFSLHHGHN  123

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            D S+YG+SLVDGFN+PMT+TPH+GKG CPVVGCRA+LL  CP+ LQV  R+  G G VV 
Sbjct  124  DLSSYGVSLVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQV--RSPPGHGRVVA  181

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C SGC AF TDELCCRN+YN+P  C+AS +S+FFKHACP+T TYAHD+P SLMH+CS+ R
Sbjct  182  CKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSP-SLMHDCSSPR  240

Query  906  ELKIIFCH  929
            ELK+IFCH
Sbjct  241  ELKVIFCH  248



>ref|XP_011042680.1| PREDICTED: osmotin-like protein [Populus euphratica]
Length=247

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 192/242 (79%), Gaps = 6/242 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ LC    A+ P  LI+T VNNCP TI+PAIQPN G+PVLE+GGF L  LTHRSF AP 
Sbjct  12   FVILCTLFQAARPE-LILTFVNNCPFTIYPAIQPNAGHPVLEKGGFPLQTLTHRSFRAPD  70

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYG  563
              WSGRIW RTGC  ++G+F C TGDC+ R+ECNG GGA PATLAQ  LH GH DFS+YG
Sbjct  71   QHWSGRIWGRTGCTHSNGKFQCTTGDCNNRIECNGLGGAPPATLAQITLHHGHNDFSSYG  130

Query  564  LSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCA  743
            +SLVDGFNLPMT+TPH+GKG CPVVGCRANLL  CP +L+ R  A    G VVGC SGC 
Sbjct  131  VSLVDGFNLPMTVTPHEGKGVCPVVGCRANLLSTCPDELKFRSPA----GHVVGCKSGCE  186

Query  744  AFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIF  923
            AF TDELCCRN+YN+P  C+AS +S+FFKHACP+TFTYAHD+P SLMHECS+ RELK+IF
Sbjct  187  AFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATFTYAHDSP-SLMHECSSPRELKVIF  245

Query  924  CH  929
            CH
Sbjct  246  CH  247



>emb|CDP09032.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 190/234 (81%), Gaps = 6/234 (3%)
 Frame = +3

Query  228  TASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIW  407
            TA+ P G+I+T+VNNCP+T+WPAIQPN G+PVLERGGFAL+ LTHRSF AP   WSGRIW
Sbjct  23   TATQP-GMILTLVNNCPYTVWPAIQPNAGHPVLERGGFALHTLTHRSFAAPTTHWSGRIW  81

Query  408  ARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFN  587
            ARTGC  ++  F+CATGDC GR+EC+GRGGA PATL Q  LH G ADFS+YG+SLVDGFN
Sbjct  82   ARTGCTYSNNHFSCATGDCGGRIECDGRGGATPATLVQLVLHHGPADFSSYGVSLVDGFN  141

Query  588  LPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELC  767
            +PMT+TPH+GKG CPVVGCR +L+P CP      LR     G VVGC SGC AF TDELC
Sbjct  142  IPMTVTPHEGKGTCPVVGCRVDLVPTCP----ASLRFHGPGGHVVGCKSGCEAFGTDELC  197

Query  768  CRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            CRN+YN+   CK S YSD+FKHACP+TFTYAHD+P SLMHECSA RELK+IFCH
Sbjct  198  CRNHYNSKETCKPSSYSDYFKHACPATFTYAHDSP-SLMHECSAPRELKVIFCH  250



>ref|XP_011000269.1| PREDICTED: osmotin-like protein [Populus euphratica]
Length=249

 Score =   342 bits (876),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 193/254 (76%), Gaps = 5/254 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA    + +  L  S   F  A     LIIT+VNNCP TI+PAIQPN G+PVLE+GGF L
Sbjct  1    MATATQLFTCALLFSCTLFHVAR--PELIITLVNNCPFTIYPAIQPNAGHPVLEKGGFPL  58

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
              LTHRSF AP   WSGRIW RTGC  ++G+F C TGDC+ R+ECNG GGA PATLAQ  
Sbjct  59   QTLTHRSFRAPDQLWSGRIWGRTGCAHSNGKFHCVTGDCNNRIECNGLGGATPATLAQIT  118

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            +H GH DFS+YG+SLVDGFNLPMT+TPH+GKG CPVVGCRANLL  CP +LQ R   R G
Sbjct  119  IHHGHKDFSSYGVSLVDGFNLPMTVTPHEGKGVCPVVGCRANLLATCPEKLQFRSLGRHG  178

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
               VVGC SGC A  TDELCCRN+YN+P  C+AS +S+FFKHACP+TFTYAHD+P SLMH
Sbjct  179  H--VVGCKSGCEALGTDELCCRNHYNSPRTCRASTFSEFFKHACPATFTYAHDSP-SLMH  235

Query  888  ECSAARELKIIFCH  929
            ECS+ RELK+IFCH
Sbjct  236  ECSSPRELKVIFCH  249



>ref|XP_002298366.1| osmotin-like family protein [Populus trichocarpa]
 gb|ABK95488.1| unknown [Populus trichocarpa]
 gb|EEE83171.1| osmotin-like family protein [Populus trichocarpa]
Length=249

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 191/254 (75%), Gaps = 5/254 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA    + +  L IS   F  A     LIIT+VNNC  TI+PAIQPN G+PVLE+GGF L
Sbjct  1    MATATQLFTCALLISCTLFHVAR--PELIITLVNNCHFTIYPAIQPNAGHPVLEKGGFPL  58

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
              LTHRSF AP   WSGRIW RTGC  ++G+F C TGDC+ R+ECNG GGA PATLAQ  
Sbjct  59   QTLTHRSFRAPDQLWSGRIWGRTGCAHSNGKFHCVTGDCNNRIECNGLGGATPATLAQIT  118

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            +H GH DFS+YG+SLVDGFNLPMT+TPH+GKG CPVVGCRANLL  CP +LQ R   R G
Sbjct  119  IHHGHKDFSSYGVSLVDGFNLPMTVTPHEGKGVCPVVGCRANLLATCPEKLQFRSLGRHG  178

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
               V GC SGC A  TDELCCRN+YN+P  C+AS +S+FFKHACP+TFTYAHD+P SL H
Sbjct  179  H--VAGCKSGCEALGTDELCCRNHYNSPQTCRASTFSEFFKHACPATFTYAHDSP-SLTH  235

Query  888  ECSAARELKIIFCH  929
            ECS+ RELK+IFCH
Sbjct  236  ECSSPRELKVIFCH  249



>ref|XP_009388624.1| PREDICTED: osmotin-like protein [Musa acuminata subsp. malaccensis]
Length=254

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 193/248 (78%), Gaps = 5/248 (2%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
             ++ L + +   ++A  PA + +T+VNNCP T+WPAIQPN+G+ VLERGGFAL  +THRS
Sbjct  11   FALFLVMLMVRRSSAQYPA-MTLTVVNNCPFTVWPAIQPNSGHDVLERGGFALPTVTHRS  69

Query  369  FVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHA  545
            F AP   WSGRIWARTGC   +GRF+CATGDC GRLEC G GGAAPATLAQ  LH  G  
Sbjct  70   FPAPTQHWSGRIWARTGCTYANGRFSCATGDCGGRLECGGLGGAAPATLAQVTLHHGGQQ  129

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            D S+YG+SLVDGFN+ MT+TPH+GKG CPVVGCR NLL  CP  LQ  LRA  G G VVG
Sbjct  130  DLSSYGVSLVDGFNVGMTVTPHEGKGRCPVVGCRENLLATCPDVLQ--LRAPAGGGQVVG  187

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C SGC AF TDELCCRN YN+P  C+AS YS+FFKHACP+TFTYAHD+P SL HEC+A R
Sbjct  188  CKSGCQAFGTDELCCRNMYNSPRTCRASSYSEFFKHACPATFTYAHDSP-SLTHECAAPR  246

Query  906  ELKIIFCH  929
            ELK+IFCH
Sbjct  247  ELKVIFCH  254



>ref|XP_010685798.1| PREDICTED: osmotin-like protein [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 190/251 (76%), Gaps = 5/251 (2%)
 Frame = +3

Query  180  ATILSVTLFISL-CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL  356
            A I S+TLF  L    T A   + LI+T+VNNCP TIWPA+ PN G+PVLE+GGF L  L
Sbjct  2    ALISSLTLFSFLEIILTLAQAQSELILTVVNNCPFTIWPAVLPNHGFPVLEKGGFPLSSL  61

Query  357  THRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ  536
            THRSF  P   W+GR+WARTGC  ++G+F+CATGDC GR+ECNG GG  PATLAQF +H 
Sbjct  62   THRSFPVPNTHWAGRVWARTGCTYSNGKFSCATGDCGGRIECNGLGGQVPATLAQFSIHH  121

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
            G+ D S YG+SLVDGFNLPMT+TPH+GKG CPVVGC+ANLL  CP+ L+   R   G GP
Sbjct  122  GNRDHSAYGVSLVDGFNLPMTITPHEGKGVCPVVGCKANLLQNCPKPLE--FRGLHGNGP  179

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
            +VGC SGC AF TDE CCRN YN+   C  + YS +FKHACP+TFTYAHDT  SLMH+C+
Sbjct  180  IVGCKSGCLAFNTDEFCCRNQYNSAKTCHGNTYSQYFKHACPATFTYAHDT--SLMHDCA  237

Query  897  AARELKIIFCH  929
            A RELK+IFCH
Sbjct  238  APRELKVIFCH  248



>ref|XP_008457495.1| PREDICTED: osmotin-like protein [Cucumis melo]
Length=255

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 183/229 (80%), Gaps = 3/229 (1%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            +GLI+T+VNNCP+ IWPAIQPN G+PV ERGGF L  L+HRSF AP   WSGR+WARTGC
Sbjct  30   SGLIMTLVNNCPYPIWPAIQPNAGHPVPERGGFYLPSLSHRSFPAPYQHWSGRVWARTGC  89

Query  423  VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
            V +H   TC TGDC G+LECNG GG  PATLAQF LH GH DFS+YG+SLVDGFN+P+T+
Sbjct  90   VGSHNHLTCETGDCGGKLECNGAGGKTPATLAQFSLHHGHKDFSSYGVSLVDGFNIPLTV  149

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH+G+G CPVVGC+ NLL  CPR+LQV   + R  G V+ C SGC AF  D LCCR +Y
Sbjct  150  TPHEGQGVCPVVGCKTNLLQTCPRELQV--HSPRRYGGVIACKSGCEAFNNDALCCRGHY  207

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  CKAS +S FFKHACPSTFTYAHDTP SLMHEC+A RELK+IFCH
Sbjct  208  NSPQTCKASSFSLFFKHACPSTFTYAHDTP-SLMHECAAPRELKVIFCH  255



>ref|XP_006294865.1| hypothetical protein CARUB_v10023918mg [Capsella rubella]
 gb|EOA27763.1| hypothetical protein CARUB_v10023918mg [Capsella rubella]
Length=249

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 193/243 (79%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A+    L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF AP 
Sbjct  12   FLLLISFSSAADTGRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFSAPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWARTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTGCAHYNGKFSCITGDCGNRLECNGLGGATPASLAQFDLHHGGHKDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +LL +CP  LQVR  +    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLLKSCPAHLQVRSHS----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF++DELCCR +YN+P  CKAS +S FFKHACPSTFT+AHD+P SLMH+CS+ RELK+I
Sbjct  188  EAFRSDELCCRGHYNSPNTCKASSHSLFFKHACPSTFTFAHDSP-SLMHDCSSPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>ref|XP_010470049.1| PREDICTED: osmotin-like protein [Camelina sativa]
Length=249

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 191/243 (79%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A+    L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF AP 
Sbjct  12   FLLLISFSSAADSGRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFSAPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWARTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTGCAHYNGKFSCVTGDCGNRLECNGLGGATPASLAQFDLHHGGHKDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +LL  CP  LQVR  A    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLLKTCPGHLQVRSHA----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF +DELCC+ +YN+P  CKAS +S FFKHACPSTFT+AHD+P SLMH+CS+ RELK+I
Sbjct  188  EAFHSDELCCQGHYNSPNTCKASSHSLFFKHACPSTFTFAHDSP-SLMHDCSSPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>ref|XP_008776643.1| PREDICTED: LOW QUALITY PROTEIN: osmotin-like protein [Phoenix 
dactylifera]
Length=257

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 195/260 (75%), Gaps = 7/260 (3%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPA---GLIITIVNNCPHTIWPAIQPNTGYPVLER  332
            MA +   T  S+T +     F    + A    +++T+VNNCP T+WPAIQPN+G+ +LE+
Sbjct  1    MAASSSFTFFSLTFYSLFLIFVVQQVAAQYPAMMLTVVNNCPFTVWPAIQPNSGHDLLEK  60

Query  333  GGFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPAT  512
            GGFAL  LTHRSF AP   WSGRIWARTGC  + GRF+C+TGDC GRLEC G GGA PAT
Sbjct  61   GGFALPTLTHRSFQAPTHHWSGRIWARTGCTFSGGRFSCSTGDCGGRLECGGLGGAVPAT  120

Query  513  LAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVR  689
            LAQ  LH  G  D ++YG+SLVDGFN+ MT+TPH+GKG CPVVGCRANLL  CP  LQV 
Sbjct  121  LAQITLHHGGRRDLTSYGVSLVDGFNVGMTVTPHEGKGQCPVVGCRANLLATCPDVLQV-  179

Query  690  LRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDT  869
             RA  G G V+GC SGC AF TDELCCRN +N+P  C+AS YS+FFKHACP+TFTYAHD+
Sbjct  180  -RAPAGXGAVIGCKSGCQAFGTDELCCRNKFNDPRTCRASTYSEFFKHACPATFTYAHDS  238

Query  870  PSSLMHECSAARELKIIFCH  929
            P SL H+C++ +ELK+IFCH
Sbjct  239  P-SLTHDCASPKELKVIFCH  257



>ref|XP_010033142.1| PREDICTED: LOW QUALITY PROTEIN: osmotin-like protein [Eucalyptus 
grandis]
Length=250

 Score =   332 bits (851),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 182/227 (80%), Gaps = 4/227 (2%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            L +T+VNNCP T+WPAIQPN G+PVLERGGF L  LTHRSF   R  WSGR+WART C  
Sbjct  28   LTLTLVNNCPFTVWPAIQPNAGHPVLERGGFPLLTLTHRSFPH-RRPWSGRVWARTACSH  86

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             HG   CATGDC GRLEC G GGA PATLAQF LH GHADFS+Y +SLVDGFN+PMT+TP
Sbjct  87   GHGGHFCATGDCGGRLECEGLGGATPATLAQFSLHHGHADFSSYAVSLVDGFNVPMTVTP  146

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
            H+GKG CPVVGCRANLL  CP  LQ+R  A  G GPVV C SGC AF+TDELCCRN++N+
Sbjct  147  HEGKGVCPVVGCRANLLATCPPHLQMRSPA--GHGPVVACKSGCEAFRTDELCCRNHFNS  204

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
               C+ S YS+FFKHACP+TFTYAHD+P SLMHECS+ RELK+IFCH
Sbjct  205  KDTCRPSSYSEFFKHACPATFTYAHDSP-SLMHECSSPRELKVIFCH  250



>gb|AAD53089.1|AF175270_1 osmotin-like protein [Benincasa hispida]
Length=248

 Score =   332 bits (851),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 181/229 (79%), Gaps = 3/229 (1%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
             GLI+T+VNNCP+ IWPAIQPN G+PV ERGGF L  L+HRSF AP   WSGR+WARTGC
Sbjct  23   GGLILTLVNNCPYPIWPAIQPNAGHPVPERGGFFLPSLSHRSFPAPYQHWSGRVWARTGC  82

Query  423  VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
            V +    TC TGDC G+LECNG GG  PATLAQF LH GH DFS+YG+SLVDGFN+P+T+
Sbjct  83   VGDLNYLTCQTGDCGGKLECNGAGGKTPATLAQFSLHHGHKDFSSYGVSLVDGFNIPLTI  142

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH+G G CPVVGC+ANLL  CPR+LQV    R G+  V+ C SGC AF TD LCCR +Y
Sbjct  143  TPHEGHGVCPVVGCKANLLQTCPRELQVHAPQRYGQ--VIACKSGCEAFNTDALCCRGHY  200

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  CKAS  S FFKHACPSTFTYAHDTP SLMHEC+A RELK+IFCH
Sbjct  201  NSPQTCKASSCSLFFKHACPSTFTYAHDTP-SLMHECAAPRELKVIFCH  248



>ref|XP_010510580.1| PREDICTED: osmotin-like protein [Camelina sativa]
Length=249

 Score =   332 bits (850),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 191/243 (79%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A+    L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF AP 
Sbjct  12   FLLLISFSSAADTGRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFSAPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWARTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTGCAHYNGKFSCMTGDCGNRLECNGLGGATPASLAQFDLHHGGHKDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +LL  CP  LQVR  A    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLLKTCPGHLQVRSHA----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF +DELCC+ +YN+P  CKAS +S FFKHACPSTFT+AHD+P SLMH+CS+ RELK+I
Sbjct  188  EAFHSDELCCQGHYNSPNTCKASSHSLFFKHACPSTFTFAHDSP-SLMHDCSSPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>ref|XP_002881009.1| hypothetical protein ARALYDRAFT_481792 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57268.1| hypothetical protein ARALYDRAFT_481792 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   332 bits (850),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 192/243 (79%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A   + L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL K THRSF AP 
Sbjct  12   FLLLISFSSAVDTSHLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPKYTHRSFNAPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWARTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTGCAHYNGKFSCITGDCGNRLECNGLGGAPPASLAQFDLHHGGHHDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +L+  CP  LQVR  +    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLIKTCPAHLQVRSHS----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF TDELCCR +YN+P  CKAS +S FFKHACPS+FT+AHD+P SLMH+CS+ RELK+I
Sbjct  188  EAFHTDELCCRGHYNSPNTCKASSHSLFFKHACPSSFTFAHDSP-SLMHDCSSPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>ref|XP_010414484.1| PREDICTED: osmotin-like protein [Camelina sativa]
Length=249

 Score =   332 bits (850),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 191/243 (79%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A+    L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF AP 
Sbjct  12   FLLLISFSSAADTGRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFSAPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWARTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTGCAHYNGKFSCITGDCGNRLECNGLGGATPASLAQFDLHHGGHKDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +LL  CP  LQVR  A    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLLKTCPGHLQVRSHA----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF +DELCC+ +YN+P  CKAS +S FFKHACPSTFT+AHD+P SLMH+CS+ RELK+I
Sbjct  188  EAFHSDELCCQGHYNSPNTCKASSHSLFFKHACPSTFTFAHDSP-SLMHDCSSPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>gb|ABB86299.1| thaumatin-like protein isoform 3 [Ficus pumila var. awkeotsang]
Length=222

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 180/227 (79%), Gaps = 5/227 (2%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +I+T+VNNCP+ +WPAIQPN G+PVLERGGF LY LTHRSF AP   WSGRIW RTGC+ 
Sbjct  1    MILTLVNNCPYPVWPAIQPNAGHPVLERGGFFLYSLTHRSFPAPTQHWSGRIWGRTGCIS  60

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             + RF+CATGDC G+LECNG GG  PATL Q  LH GH D S+YG+SLVDGFNL +T+TP
Sbjct  61   AYNRFSCATGDCGGQLECNGAGGKTPATLVQLSLHHGHNDLSSYGVSLVDGFNLGLTVTP  120

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
            H+GKG CPVVGCR +LL  CP +LQV    R   G VV C SGC AF TDELCCRN YN+
Sbjct  121  HEGKGVCPVVGCRPDLLATCPDRLQV----RSPHGHVVACKSGCDAFGTDELCCRNRYNS  176

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  C+AS YS FFKHACPS+FTYAHDTP SLMH+CS+ RELK+IFCH
Sbjct  177  PQTCRASSYSAFFKHACPSSFTYAHDTP-SLMHDCSSPRELKVIFCH  222



>ref|XP_004150181.1| PREDICTED: osmotin-like protein-like [Cucumis sativus]
 ref|XP_004169049.1| PREDICTED: osmotin-like protein-like [Cucumis sativus]
 gb|KGN65704.1| Osmotin-like protein [Cucumis sativus]
Length=255

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 181/229 (79%), Gaps = 3/229 (1%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            +GLI+T+VNNCP+ IWPAIQPN G+PV ERGGF L  L+HRSF AP   WSGR+WARTGC
Sbjct  30   SGLIMTLVNNCPYPIWPAIQPNAGHPVPERGGFYLPSLSHRSFPAPYQHWSGRVWARTGC  89

Query  423  VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
              +H   TCATGDC G+LECNG GG  PATLAQF LH GH DFS+YG+SLVDGFN+P+T+
Sbjct  90   TGHHNHLTCATGDCGGKLECNGAGGKTPATLAQFSLHHGHKDFSSYGVSLVDGFNIPLTI  149

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH+G+G CPVVGC+ANLL  CPR+LQV    R G   V+ C SGC AF +D  CCR +Y
Sbjct  150  TPHEGQGVCPVVGCKANLLLTCPRELQVHAPGRYGG--VIACKSGCEAFNSDAFCCRGHY  207

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  C AS +S FFK ACPSTFTYAHDTP SLMHEC+A RELK+IFCH
Sbjct  208  NSPQTCNASSFSRFFKDACPSTFTYAHDTP-SLMHECAAPRELKVIFCH  255



>ref|XP_010918389.1| PREDICTED: osmotin-like protein [Elaeis guineensis]
Length=260

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 187/244 (77%), Gaps = 6/244 (2%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LF+ +     A  PA + +T+VNNCP T+WPA+QPN+G+ VLE+GGFAL  LTHRSF AP
Sbjct  22   LFLIVVQQVAAQYPA-MTLTVVNNCPFTVWPAVQPNSGHDVLEKGGFALSTLTHRSFPAP  80

Query  381  RARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFST  557
               WSGRIW RTGC  + GRF+CATGDC GRLEC G GGAAPATLAQ  LH  G  D S+
Sbjct  81   THHWSGRIWGRTGCTFSGGRFSCATGDCGGRLECGGLGGAAPATLAQITLHHGGRRDLSS  140

Query  558  YGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG  737
            YG+SLVDGFN+ MT+TPH+GKG CPVVGCRANLL  CP  LQVR       G V+GC SG
Sbjct  141  YGVSLVDGFNVGMTVTPHEGKGQCPVVGCRANLLATCPDVLQVRAPV---GGHVIGCKSG  197

Query  738  CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI  917
            C AF TDELCCRN YNNP  C+AS YS+FFKHACP+TFTYAHD+P SL H+C + +ELK+
Sbjct  198  CQAFGTDELCCRNKYNNPRTCRASTYSEFFKHACPATFTYAHDSP-SLTHDCESPKELKV  256

Query  918  IFCH  929
            IFCH
Sbjct  257  IFCH  260



>ref|XP_003539684.1| PREDICTED: osmotin-like protein-like [Glycine max]
Length=248

 Score =   329 bits (843),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 187/240 (78%), Gaps = 4/240 (2%)
 Frame = +3

Query  213  LCAFTTASLPAG-LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRAR  389
            + A TT S P G LI+T+VNNC +T+WP IQPN G+PVL  GG  L  LTH+S   P A 
Sbjct  12   ILAVTTFSSPTGALILTLVNNCNYTVWPGIQPNAGHPVLAGGGLTLRSLTHQSIPVPDAH  71

Query  390  WSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS  569
            WSGR+WARTGC  +   F+CA+GDC GRL+CNG GGAAPATLAQ E+H G  D+++YG+S
Sbjct  72   WSGRVWARTGCSYSGTAFSCASGDCGGRLQCNGAGGAAPATLAQLEVHHGSNDYASYGVS  131

Query  570  LVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF  749
            LVDGFN+PMT TPH+GKG CPVVGCR +LL  CPR LQ R+ A  G GPVV C SGC AF
Sbjct  132  LVDGFNVPMTFTPHEGKGVCPVVGCRNDLLATCPRVLQHRVPA--GHGPVVACKSGCEAF  189

Query  750  KTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
             TDELCCRN++NNP  CK S YS FFKHACP+TFT+AHDTP SLMH+CS+ RELK+IFCH
Sbjct  190  HTDELCCRNHFNNPNTCKGSIYSSFFKHACPATFTFAHDTP-SLMHQCSSPRELKVIFCH  248



>gb|EPS68133.1| hypothetical protein M569_06639, partial [Genlisea aurea]
Length=241

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 191/250 (76%), Gaps = 13/250 (5%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            ++SV + I    +  A+L A L +T+VNNCP TIWPAIQPN G+P LERGGFAL  LTHR
Sbjct  3    VVSVLVLI----WRPATLSA-LTLTVVNNCPFTIWPAIQPNAGHPALERGGFALPTLTHR  57

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG--  539
            SF AP A WSGRIWART C    GRF+C TGDC GRLEC+G GG+ PATLAQ  LH G  
Sbjct  58   SFPAPDAHWSGRIWARTRCEYRQGRFSCLTGDCGGRLECDGAGGSGPATLAQVSLHHGGE  117

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
              D+S+YG+SLVDGFNLP T+TPH+GKG CPVVGCRA+LL  CP  LQV     RG G V
Sbjct  118  GEDYSSYGVSLVDGFNLPATVTPHEGKGTCPVVGCRADLLKTCPEALQV-----RGGGEV  172

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            VGC SGCAAF TDELCCRN +N+P  C+ S YS FFKH+CP+TFTYAHD+P SLMH+CS 
Sbjct  173  VGCKSGCAAFGTDELCCRNRFNSPGTCRESSYSLFFKHSCPATFTYAHDSP-SLMHQCSG  231

Query  900  ARELKIIFCH  929
             RELK+IFCH
Sbjct  232  PRELKLIFCH  241



>emb|CDX77207.1| BnaC04g40020D [Brassica napus]
Length=277

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 192/259 (74%), Gaps = 6/259 (2%)
 Frame = +3

Query  156  EQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
             +  MA  +  L+ +  + L +   A+    L +T+VN+CP T+WPAIQPN G+PVLE+G
Sbjct  24   HKYTMAKTSLPLAASFLLLLISSAAAAEAGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKG  83

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATL  515
            GFAL   THRSF  P   WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+L
Sbjct  84   GFALPTNTHRSFFPPSTHWSGRIWGRTGCSHYNGKFSCVTGDCGHRLECNGLGGATPASL  143

Query  516  AQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRL  692
            AQF+LH  GH D S+YG+SLVDGFN+PMT+TPH+G+G CPVVGCR +LL  CP  LQ+R 
Sbjct  144  AQFDLHHGGHQDLSSYGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLKTCPAHLQLRS  203

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
                  G VV C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+P
Sbjct  204  HG----GHVVACKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDSP  259

Query  873  SSLMHECSAARELKIIFCH  929
             SLMH+CS+ RELK+IFCH
Sbjct  260  -SLMHDCSSPRELKVIFCH  277



>gb|AAM63209.1| putative thaumatin [Arabidopsis thaliana]
Length=249

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 189/243 (78%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A   + L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF  P 
Sbjct  12   FLLLISFSSAVDTSRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFNVPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWART C   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTWCAHYNGKFSCLTGDCGNRLECNGLGGAPPASLAQFDLHHGGHHDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +L+  CP  LQVR  +    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLIKTCPAHLQVRSHS----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF TDELCCR +YN+P  CKAS +S FFKHACPS+FT+AHD+P SLMH+C++ RELK+I
Sbjct  188  EAFHTDELCCRGHYNSPNTCKASSHSLFFKHACPSSFTFAHDSP-SLMHDCASPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>ref|NP_180445.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 gb|AAC79584.1| putative thaumatin [Arabidopsis thaliana]
 dbj|BAC43103.1| putative thaumatin [Arabidopsis thaliana]
 gb|AAP12871.1| At2g28790 [Arabidopsis thaliana]
 gb|AAO12210.2| thaumatin-like cytokinin binding protein [Arabidopsis thaliana]
 gb|AEC08171.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=249

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 189/243 (78%), Gaps = 6/243 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ L +F++A   + L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF  P 
Sbjct  12   FLLLISFSSAVDTSRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFNVPT  71

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY  560
              WSGRIWART C   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct  72   THWSGRIWARTWCAHYNGKFSCLTGDCGNRLECNGLGGAPPASLAQFDLHHGGHHDFSSY  131

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
            G+SLVDG+N+PMT+TPH+G G CPVVGCR +L+  CP  LQVR  +    G VV C SGC
Sbjct  132  GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLIKTCPAHLQVRSHS----GHVVACKSGC  187

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF TDELCCR +YN+P  CKAS +S FFKHACPS+FT+AHD+P SLMH+C++ RELK+I
Sbjct  188  EAFHTDELCCRGHYNSPNTCKASSHSLFFKHACPSSFTFAHDSP-SLMHDCASPRELKVI  246

Query  921  FCH  929
            FCH
Sbjct  247  FCH  249



>ref|XP_003538000.1| PREDICTED: osmotin-like protein-like [Glycine max]
Length=248

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 185/238 (78%), Gaps = 4/238 (2%)
 Frame = +3

Query  219  AFTTASLPAG-LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            A TT S P G LI+T+VNNC +T+WPAIQPN G+PVL  GG  L  LTH+S   P A WS
Sbjct  14   AVTTFSSPTGALILTLVNNCNYTVWPAIQPNAGHPVLAGGGLTLRTLTHQSIPVPDAHWS  73

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GR+WARTGC  +   F+CA+GDC GRL+CNG GGA PATLAQFE+H G  D+++YG+SLV
Sbjct  74   GRVWARTGCAYSGTAFSCASGDCGGRLQCNGAGGAPPATLAQFEVHHGSNDYASYGVSLV  133

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFN+PMT+TPH+GKG CPVVGCR +LL  CP  LQ R+ A    GPVV C SGC AF T
Sbjct  134  DGFNVPMTVTPHEGKGVCPVVGCRDDLLATCPHVLQHRVPAV--HGPVVACKSGCEAFHT  191

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN++NNP  CK S YS FFKHA P+TFT+AHDTP SLMH+CS+ RELK+IFCH
Sbjct  192  DELCCRNHFNNPSTCKGSIYSSFFKHAYPATFTFAHDTP-SLMHQCSSPRELKVIFCH  248



>ref|XP_006409911.1| hypothetical protein EUTSA_v10017135mg [Eutrema salsugineum]
 gb|ESQ51364.1| hypothetical protein EUTSA_v10017135mg [Eutrema salsugineum]
Length=251

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 194/255 (76%), Gaps = 5/255 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA  +  L+ +  + L +   A+    L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL
Sbjct  1    MAKTSLPLAASFLLLLISSAAAADTGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFAL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
               THRSF AP   WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+
Sbjct  61   PTNTHRSFSAPATHWSGRIWGRTGCSHYNGKFSCVTGDCGHRLECNGLGGATPASLAQFD  120

Query  528  LHQG-HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
            LH G H D S+YG+SLVDGFN+PMT+TPH+G+G CPVVGCR +LL  CP  LQ  LR+  
Sbjct  121  LHHGAHLDLSSYGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLKTCPAHLQ--LRSGH  178

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
            G G VV C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+P SLM
Sbjct  179  G-GHVVACKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDSP-SLM  236

Query  885  HECSAARELKIIFCH  929
            H+CS+ RELK+IFCH
Sbjct  237  HDCSSPRELKVIFCH  251



>ref|XP_009140942.1| PREDICTED: osmotin-like protein [Brassica rapa]
Length=250

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 192/255 (75%), Gaps = 6/255 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA  +  L+ +  + L + TT++    L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL
Sbjct  1    MAKTSLPLAASFLLLLISSTTSADTGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFAL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
               THRSF  P   WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+
Sbjct  61   LTNTHRSFFPPSTHWSGRIWGRTGCSHYNGKFSCVTGDCGHRLECNGLGGATPASLAQFD  120

Query  528  LHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
            LH  GH D S+YG+SLVDGFN+PMT+TPH+G+G CPVVGCR +LL  CP  LQ+R     
Sbjct  121  LHHGGHQDLSSYGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLKTCPAHLQLRSHG--  178

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G VV C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+  SLM
Sbjct  179  --GHVVACKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDS-LSLM  235

Query  885  HECSAARELKIIFCH  929
            H+CS+ RELK+IFCH
Sbjct  236  HDCSSPRELKVIFCH  250



>gb|AAO12209.1| thaumatin-like cytokinin-binding protein [Brassica oleracea]
Length=250

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 191/255 (75%), Gaps = 6/255 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA  +  L+ +  + L +   A+    L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL
Sbjct  1    MAKTSLPLAASFLLLLISSAAAADAGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFAL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
               THRSF  P   WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+
Sbjct  61   PTNTHRSFFPPSTHWSGRIWGRTGCSHYNGKFSCVTGDCGHRLECNGLGGATPASLAQFD  120

Query  528  LHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
            LH  GH D S+YG+SLVDGFN+PMT+TPH+G+G CPVVGCR +LL  CP  LQ+R     
Sbjct  121  LHHGGHQDLSSYGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLKTCPAHLQLRSHG--  178

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G VV C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+P SLM
Sbjct  179  --GHVVACKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDSP-SLM  235

Query  885  HECSAARELKIIFCH  929
            H+CS+ RELK+IFCH
Sbjct  236  HDCSSPRELKVIFCH  250



>emb|CDY31732.1| BnaA04g16680D [Brassica napus]
Length=250

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 191/255 (75%), Gaps = 6/255 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA  +  L+ +  + L +F T++    L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL
Sbjct  1    MAKASLPLAASFLLLLISFATSADTGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFAL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
               THRSF  P   WSGRIW RTGC   +G F+C TGDC  RLECNG GGA PA+LAQF+
Sbjct  61   PTNTHRSFFPPSTHWSGRIWGRTGCSHYNGNFSCVTGDCGHRLECNGLGGATPASLAQFD  120

Query  528  LHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
            LH  GH D S+YG+SLVDGFN+PMT+TPH+G+G CPV+GCR +LL  CP  LQ+R     
Sbjct  121  LHHGGHQDLSSYGVSLVDGFNVPMTVTPHEGRGVCPVIGCREDLLKTCPAHLQLRSHG--  178

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G VV C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+  SLM
Sbjct  179  --GHVVACKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDS-LSLM  235

Query  885  HECSAARELKIIFCH  929
            H+CS+ RELK+IFCH
Sbjct  236  HDCSSPRELKVIFCH  250



>ref|XP_009103714.1| PREDICTED: osmotin-like protein [Brassica rapa]
 emb|CDY71394.1| BnaAnng37270D [Brassica napus]
Length=251

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 191/248 (77%), Gaps = 5/248 (2%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
            L+   F+ L + + A+    L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL   THRS
Sbjct  8    LTAFFFLLLISSSLAADTGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFALPTNTHRS  67

Query  369  FVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHA  545
            F  P   WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH 
Sbjct  68   FSPPTTHWSGRIWGRTGCSHYNGKFSCVTGDCGNRLECNGLGGATPASLAQFDLHHGGHR  127

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            D S+YG+SLVDGFN+PMT+TPH+G+G CPVVGCR +LL  CP  LQ  LR+  G G VV 
Sbjct  128  DLSSYGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLRTCPAHLQ--LRSGHG-GHVVA  184

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+P SLMH+CS+ R
Sbjct  185  CKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDSP-SLMHDCSSPR  243

Query  906  ELKIIFCH  929
            ELK+IFCH
Sbjct  244  ELKVIFCH  251



>ref|XP_007132080.1| hypothetical protein PHAVU_011G065300g [Phaseolus vulgaris]
 gb|ESW04074.1| hypothetical protein PHAVU_011G065300g [Phaseolus vulgaris]
Length=248

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 186/250 (74%), Gaps = 3/250 (1%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            A+ L +  F  L   T  S  A LI+T+VNNC +T+WPAIQPN G+PVL  GGF L+ LT
Sbjct  2    ASSLFLCTFFILAVTTLTSPTAALILTLVNNCNYTVWPAIQPNAGHPVLAGGGFTLHTLT  61

Query  360  HRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
            H+S   P   WSGR+WARTGC  +   F+C++GDC GRL+CNG GGAAPA+LAQ E H G
Sbjct  62   HQSIPVPDVHWSGRVWARTGCTYSGTAFSCSSGDCGGRLQCNGAGGAAPASLAQVEAHHG  121

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
            + D+ +Y +SLVDGFN+PMT+TPH+GKG CPVVGCRA LL  CP  LQ R+ A    GPV
Sbjct  122  NGDYVSYSVSLVDGFNVPMTVTPHEGKGVCPVVGCRAELLATCPSVLQHRVPAV--HGPV  179

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C SGC AF TDELCCRN++N+P  C+ S YS FFKHACP+TFTYAHD P SL+H+CS+
Sbjct  180  VACKSGCEAFHTDELCCRNHFNSPHTCRESVYSTFFKHACPNTFTYAHDNP-SLLHQCSS  238

Query  900  ARELKIIFCH  929
              ELK+IFCH
Sbjct  239  PHELKVIFCH  248



>gb|KFK32258.1| hypothetical protein AALP_AA6G218900 [Arabis alpina]
Length=251

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 182/228 (80%), Gaps = 5/228 (2%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            LI TIVN+CP T+WPAIQPN G+PVLE GGFAL    HRSF AP   WSGRIWARTGC  
Sbjct  28   LIFTIVNHCPFTVWPAIQPNAGHPVLENGGFALNTNNHRSFYAPTTHWSGRIWARTGCYH  87

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG-HADFSTYGLSLVDGFNLPMTLT  605
            + G+F+C TGDC  RL+CNG GGA PA+LAQF++H G H D S+YG+SLVDGFN+PMT+T
Sbjct  88   HDGKFSCVTGDCGNRLQCNGLGGATPASLAQFDIHHGAHLDLSSYGVSLVDGFNVPMTVT  147

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            PH+G+G CPVVGCR +LL  CP  LQ  LR+  G G VV C SGC AF+TDELCCRN+YN
Sbjct  148  PHEGRGVCPVVGCREDLLKTCPAHLQ--LRSGHG-GHVVACKSGCEAFRTDELCCRNHYN  204

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            +P  C+AS +S FFKHACPST T+AHD+P SLMH+CS+ RELK+IFCH
Sbjct  205  SPHTCRASSHSLFFKHACPSTMTFAHDSP-SLMHDCSSPRELKVIFCH  251



>emb|CDY15787.1| BnaC04g15370D [Brassica napus]
Length=251

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 191/248 (77%), Gaps = 5/248 (2%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
            L+   F+ L + + A+    L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL   THRS
Sbjct  8    LTGFFFLLLISSSFAADTGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFALPTNTHRS  67

Query  369  FVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFEL-HQGHA  545
            F  P   WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+L H GH 
Sbjct  68   FSPPTTHWSGRIWGRTGCSHYNGKFSCVTGDCGNRLECNGLGGATPASLAQFDLQHGGHR  127

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            D S+YG+SLVDGFN+PMT+TPH+G+G CPVVGCR +LL  CP  LQ  LR+  G G VV 
Sbjct  128  DLSSYGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLRTCPAHLQ--LRSGHG-GHVVA  184

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C SGC AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+P SLMH+CS+ R
Sbjct  185  CKSGCEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDSP-SLMHDCSSPR  243

Query  906  ELKIIFCH  929
            ELK+IFCH
Sbjct  244  ELKVIFCH  251



>ref|XP_006846131.1| hypothetical protein AMTR_s00012p00157270 [Amborella trichopoda]
 gb|ERN07806.1| hypothetical protein AMTR_s00012p00157270 [Amborella trichopoda]
Length=246

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 175/227 (77%), Gaps = 6/227 (3%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            L++T+VNNCP TIWPAIQPN G+ V E+GGFAL  L H+SF AP   WSGRIWARTGC  
Sbjct  26   LVLTLVNNCPFTIWPAIQPNAGHYVPEKGGFALETLQHKSFAAPHTHWSGRIWARTGCTY  85

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
            + GRF C TGDC GRLECNG GG APATLAQF LH GH D S+Y +SLVDGFN+PMT+TP
Sbjct  86   STGRFHCETGDC-GRLECNGAGGRAPATLAQFSLHHGHNDQSSYSVSLVDGFNVPMTVTP  144

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
            H+GKG CPVVGCR +LL  CP QL  RL A  G+  VVGC SGC AF TDELCCRN YN+
Sbjct  145  HEGKGLCPVVGCREDLLATCPTQL--RLCAANGK--VVGCKSGCEAFGTDELCCRNQYNS  200

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  C  S YS+FFKH CP+TFTYAHD+P SL H C   RELK+IFCH
Sbjct  201  PHTCHGSTYSEFFKHKCPATFTYAHDSP-SLTHNCVEPRELKVIFCH  246



>ref|XP_004294572.1| PREDICTED: osmotin-like protein-like [Fragaria vesca subsp. vesca]
Length=248

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 182/238 (76%), Gaps = 7/238 (3%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            C+   A+ P G I+T+VNNCP  IWPAIQPNTG  +LERGGF L  L+HRSF AP   WS
Sbjct  18   CSLAHATSP-GHILTVVNNCPFPIWPAIQPNTGGQILERGGFFLPSLSHRSFPAPTQSWS  76

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GRIWART C  ++ RF+C TGDC G+LECNG GGA PATLAQF LH G  D  +YG+SLV
Sbjct  77   GRIWARTHCSRSNNRFSCLTGDCGGKLECNGAGGATPATLAQFVLHHGPNDLWSYGVSLV  136

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFN+PMT+TPH+GKG CPVVGC+A+LL  CP QLQVR         VV C S C AF +
Sbjct  137  DGFNVPMTVTPHEGKGVCPVVGCKADLLATCPGQLQVRSHPG-----VVACKSACEAFGS  191

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN YN+P  C+AS +S FFKHACP+TFTYAHD+P +LMH+CS+ RELK+IFCH
Sbjct  192  DELCCRNKYNSPQTCRASSFSQFFKHACPATFTYAHDSP-TLMHQCSSPRELKVIFCH  248



>ref|XP_002313445.1| osmotin-like family protein [Populus trichocarpa]
 gb|EEE87400.1| osmotin-like family protein [Populus trichocarpa]
Length=238

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 184/242 (76%), Gaps = 15/242 (6%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            F+ LC    A+ P  LI+T+VNNCP TI+PAIQPN G+PVLE+GGF L  LTHRSF AP 
Sbjct  12   FVILCTLFHAARPE-LILTLVNNCPFTIYPAIQPNAGHPVLEKGGFPLQTLTHRSFRAPD  70

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYG  563
              WSGRIW RTGC  ++G+F C TGDC+ R+ECNG GGA PATLAQ  LH GH DFS+YG
Sbjct  71   QHWSGRIWGRTGCTHSNGKFQCTTGDCNNRIECNGLGGAPPATLAQITLHHGHNDFSSYG  130

Query  564  LSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCA  743
            +SLVDGFNLPMT+TPH+GKG CPVVGCRANLL  CP +L+ R  A    G VVGC SGC 
Sbjct  131  VSLVDGFNLPMTVTPHEGKGVCPVVGCRANLLSTCPDELKFRSSA----GHVVGCKSGCE  186

Query  744  AFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIF  923
            A         N+YN+P  C+AS +S+FFKHACP+TFTYAHD+P SL HECS+ RELK+IF
Sbjct  187  A---------NHYNSPQTCRASSFSEFFKHACPATFTYAHDSP-SLTHECSSPRELKVIF  236

Query  924  CH  929
            CH
Sbjct  237  CH  238



>ref|XP_008357503.1| PREDICTED: osmotin-like protein [Malus domestica]
Length=255

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 187/249 (75%), Gaps = 7/249 (3%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            +LS T F+ L A   A+ P   I+T+VNNCP  IWPAIQPN+G+PVLERGGF L  LTHR
Sbjct  13   LLSATTFLILAAVVHATHPQPSILTLVNNCPFPIWPAIQPNSGHPVLERGGFFLNALTHR  72

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH  542
            SF AP   WSGRIWART C  N    +C TGDC GRLECNG GGA P+TLAQ  LH  G 
Sbjct  73   SFPAPTQPWSGRIWARTHCTQNGPHLSCLTGDCGGRLECNGAGGATPSTLAQISLHHGGP  132

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
            AD  +YG+SLVDGFN+P+T+TPH+G G CPVVGC+ANLL  CP +L+V   + +G   VV
Sbjct  133  ADLFSYGVSLVDGFNVPLTVTPHEGHGVCPVVGCKANLLATCPDRLKV--TSPKG---VV  187

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C AF TDELCCRN+YN+P  C+AS YS FFK ACP+TFT+AHD+P +LMH+CS+ 
Sbjct  188  ACKSACEAFGTDELCCRNHYNSPQTCRASGYSQFFKQACPTTFTFAHDSP-TLMHQCSSP  246

Query  903  RELKIIFCH  929
            RELK+IFCH
Sbjct  247  RELKVIFCH  255



>ref|XP_007207347.1| hypothetical protein PRUPE_ppa010410mg [Prunus persica]
 gb|EMJ08546.1| hypothetical protein PRUPE_ppa010410mg [Prunus persica]
Length=250

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 185/249 (74%), Gaps = 8/249 (3%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            TIL +T F+ LC+   A+ PA  + T+VNNCP  +WP IQPN+G+PVLERGGF L  L+H
Sbjct  10   TIL-LTTFLILCSLAHATSPAPFL-TLVNNCPFPLWPGIQPNSGHPVLERGGFYLPALSH  67

Query  363  RSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
            RSF  P   WSGRIWART C      F+C TGDC GRLECNG GGAAPATLAQ  LH G 
Sbjct  68   RSFPTPTQPWSGRIWARTHCTQTQNHFSCLTGDCGGRLECNGAGGAAPATLAQVSLHHGP  127

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             D  +YG+SLVDGFN+P+T+TPH+G G CPVVGC+A+LL  CP     RLR     G VV
Sbjct  128  NDLFSYGVSLVDGFNVPLTITPHEGHGVCPVVGCKADLLATCPE----RLRVTSHPG-VV  182

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C AF+TDELCCRN+YN+P  C+AS YS+FFK ACP+TFT+AHD+P +LMH+CS+ 
Sbjct  183  ACKSACEAFRTDELCCRNHYNSPQTCRASSYSEFFKRACPATFTFAHDSP-TLMHQCSSP  241

Query  903  RELKIIFCH  929
             ELK+IFCH
Sbjct  242  HELKVIFCH  250



>ref|XP_008385133.1| PREDICTED: osmotin-like protein [Malus domestica]
Length=262

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 184/248 (74%), Gaps = 8/248 (3%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            ILS T  I L     A+     I+T+VNNCP  IWPAIQPN+G+PVL+RGGF L    HR
Sbjct  21   ILSATFLI-LSTVAHATKHPQSILTVVNNCPFPIWPAIQPNSGHPVLQRGGFFLKPFNHR  79

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
            SF AP   WSGRIWART C     R +C TGDC GRLECNG GGAAP+TL Q +LHQG  
Sbjct  80   SFPAPIQPWSGRIWARTHCTQKGPRLSCLTGDCGGRLECNGAGGAAPSTLXQIDLHQGGP  139

Query  546  -DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             D  +YG+SLVDGFN+PMT+TPH G+G CPVVGC+A+LL  CP +L+V  ++ +G   VV
Sbjct  140  RDLFSYGVSLVDGFNVPMTVTPHKGQGRCPVVGCKADLLATCPDRLKV--KSPKG---VV  194

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C SGC AF TD+LCCRN+YN+P  C+AS YS FFKHACP+TFT+A+D+P  LMH+CS+ 
Sbjct  195  ACKSGCEAFGTDKLCCRNHYNSPQTCRASSYSQFFKHACPTTFTFAYDSP-PLMHQCSSP  253

Query  903  RELKIIFC  926
            RELK+IFC
Sbjct  254  RELKVIFC  261



>ref|XP_008385134.1| PREDICTED: osmotin-like protein [Malus domestica]
Length=258

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 184/248 (74%), Gaps = 8/248 (3%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            ILS T  I L     A+     I+T+VNNCP  IWPAIQPN+G+PVL+RGGF L    HR
Sbjct  17   ILSATFLI-LSTVAHATKHPQSILTVVNNCPFPIWPAIQPNSGHPVLQRGGFFLKPFNHR  75

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
            SF AP   WSGRIWART C     R +C TGDC GRLECNG GGAAP+TL Q +LHQG  
Sbjct  76   SFPAPIQPWSGRIWARTHCTQKGPRLSCLTGDCGGRLECNGAGGAAPSTLVQIDLHQGGP  135

Query  546  -DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             D  +YG+SLVDGFN+PMT+TPH G+G CPVVGC+A+LL  CP +L+V  ++ +G   VV
Sbjct  136  RDLFSYGVSLVDGFNVPMTVTPHKGQGRCPVVGCKADLLATCPDRLKV--KSPKG---VV  190

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C SGC AF TD+LCCRN+YN+P  C+AS YS FFKHACP+TFT+A+D+P  LMH+CS+ 
Sbjct  191  ACKSGCEAFGTDKLCCRNHYNSPQTCRASSYSQFFKHACPTTFTFAYDSP-PLMHQCSSP  249

Query  903  RELKIIFC  926
            RELK++FC
Sbjct  250  RELKVLFC  257



>ref|XP_009353813.1| PREDICTED: osmotin-like protein [Pyrus x bretschneideri]
Length=262

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 182/248 (73%), Gaps = 8/248 (3%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            ILS T  I L     A+     I+T+VNNCP  IWPAIQPN+G+PVLERGGF L    HR
Sbjct  21   ILSATFLI-LSTVAHANKHPQSILTVVNNCPFPIWPAIQPNSGHPVLERGGFFLKAFNHR  79

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
            SF  P   WSGRIWART C     R +C TGDC GRLECNG GGAAP+TLAQ +LHQG  
Sbjct  80   SFPTPIKPWSGRIWARTHCTQKGPRLSCLTGDCGGRLECNGAGGAAPSTLAQIDLHQGGP  139

Query  546  -DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             D  +YG+SLVDGFN+PMT+TPH G G CPVVGC+ANLL  CP  L+V  ++ +G   VV
Sbjct  140  RDLFSYGVSLVDGFNVPMTITPHKGHGQCPVVGCKANLLATCPDPLKV--KSPKG---VV  194

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C SGC AF TD+LCCRN+YN+P  C+AS YS FFK ACP+TFT+A+D+P +LMH+CS+ 
Sbjct  195  ACKSGCEAFGTDKLCCRNHYNSPQTCRASSYSQFFKRACPNTFTFAYDSP-ALMHQCSSP  253

Query  903  RELKIIFC  926
            RELK+IFC
Sbjct  254  RELKVIFC  261



>gb|AFK44890.1| unknown [Medicago truncatula]
 gb|KEH30120.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=252

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 175/242 (72%), Gaps = 6/242 (2%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            FI L  F+ +     LI T VNNCP+T+WPAI PN G+PVL   GF L   TH S   P 
Sbjct  17   FIFLTIFSPSQ---ALIFTFVNNCPYTVWPAIIPNGGFPVLSSSGFELRHFTHLSIPVPD  73

Query  384  ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYG  563
              W+GR WARTGC   + +F+C TGDC   L+C+G GG+ PATL QF++H G+ DFS+Y 
Sbjct  74   THWAGRAWARTGCSTANNKFSCLTGDCGNSLQCHGAGGSPPATLVQFDVHHGNKDFSSYS  133

Query  564  LSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCA  743
            +SLVDGFN P+T+TPH+GKG CPVVGC+A+L+ +CP  LQ R+    G GPVV C SGC 
Sbjct  134  VSLVDGFNTPLTVTPHEGKGECPVVGCKADLVASCPPVLQHRV--PMGHGPVVACKSGCE  191

Query  744  AFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIF  923
            AF +DE CCRN++NNP  CK + YS FFK ACP+TFT+AHD+P SL+H+CS+  ELK+IF
Sbjct  192  AFHSDEHCCRNHFNNPQTCKPTVYSKFFKDACPATFTFAHDSP-SLIHQCSSPGELKVIF  250

Query  924  CH  929
            CH
Sbjct  251  CH  252



>dbj|BAK00635.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 182/257 (71%), Gaps = 8/257 (3%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            M MA P  +L +  F+  C    A   A + +T+VNNCP+ +WP IQ + G  VLE GGF
Sbjct  1    MGMASPKLLLLLATFLPSCGLLLADF-APMTLTVVNNCPYPVWPGIQGSAGSEVLEGGGF  59

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNHG-RFTCATGDCDGRLECNGRGGAAPATLA  518
             L  L+HRSF AP   WSGRIWARTGC    G +  CATGDC GRL+C G GGAAPATLA
Sbjct  60   YLPSLSHRSFPAPAHAWSGRIWARTGCTPAGGEQLRCATGDCGGRLQCGGLGGAAPATLA  119

Query  519  QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRA  698
            Q  LH G+ D S+YG+S+VDGFN+ +++TPH+G+G+CPV+ CR +L   CP +LQVR   
Sbjct  120  QVSLHHGN-DQSSYGVSVVDGFNVGLSVTPHEGRGNCPVLACRKDLTQTCPGELQVR---  175

Query  699  RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS  878
             +G G VV C SGC A  +DELCCRN YN+P  C+ S+YSDFFK ACP  FTYAHD+P S
Sbjct  176  -QGGGAVVACRSGCLALGSDELCCRNAYNSPAACRPSKYSDFFKSACPQAFTYAHDSP-S  233

Query  879  LMHECSAARELKIIFCH  929
            L HECSA RELK+IFCH
Sbjct  234  LTHECSAPRELKVIFCH  250



>ref|NP_001147098.1| osmotin-like protein precursor [Zea mays]
 ref|NP_001152945.1| LOC100284104 precursor [Zea mays]
 gb|ACG25428.1| osmotin-like protein precursor [Zea mays]
 gb|ACG39220.1| osmotin-like protein precursor [Zea mays]
Length=248

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 182/254 (72%), Gaps = 6/254 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA P  +L +      C    A+  A + +T+VNNCP+ +WP IQ N+G+ VLE GGF L
Sbjct  1    MASPKPLLLLATSFLSCGLLVAADYAPMTLTVVNNCPYPVWPGIQANSGHDVLEGGGFFL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
              L+H+SF AP   WSGRIWARTGC     +  CATGDC GRL+C G GGAAPATLAQ  
Sbjct  61   PPLSHKSFPAPAHPWSGRIWARTGCAGAGAQLHCATGDCGGRLQCGGLGGAAPATLAQVN  120

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            LH G+ D ++YG+S+VDGFN+ +++TPH+G+G+CPV+ CR NL   CP +LQ+R  A   
Sbjct  121  LHHGN-DQTSYGVSVVDGFNVGLSVTPHEGRGNCPVLACRKNLTETCPGELQLRSPA---  176

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G V+ C SGC AF+TDELCCRN YN+P  C+AS+YS+FFK  CP  FTYAHD+P SL H
Sbjct  177  -GSVLACKSGCEAFRTDELCCRNMYNSPHTCRASKYSEFFKRECPQAFTYAHDSP-SLTH  234

Query  888  ECSAARELKIIFCH  929
            EC+A RELK+IFCH
Sbjct  235  ECAAPRELKVIFCH  248



>emb|CAQ15819.1| putative thaumatin-like protein [Medicago truncatula var. truncatula]
Length=224

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            LI T VNNCP+T+WPAI PN G+PVL   GF L   TH S   P   W+GR WARTGC  
Sbjct  1    LIFTFVNNCPYTVWPAIIPNGGFPVLSSSGFELRHFTHLSIPVPDTHWAGRAWARTGCST  60

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             + +F+C TGDC   L+C+G GG+ PATL QF++H G+ DFS+Y +SLVDGFN P+T+TP
Sbjct  61   ANNKFSCLTGDCGNSLQCHGAGGSPPATLVQFDVHHGNKDFSSYSVSLVDGFNTPLTVTP  120

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
            H+GKG CPVVGC+A+L+ +CP  LQ R+    G GPVV C SGC AF +DE CCRN++NN
Sbjct  121  HEGKGECPVVGCKADLVASCPPVLQHRV--PMGHGPVVACKSGCEAFHSDEHCCRNHFNN  178

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  CK + YS FFK ACP+TFT+AHD+P SL+H+CS+  ELK+IFCH
Sbjct  179  PQTCKPTVYSKFFKDACPATFTFAHDSP-SLIHQCSSPGELKVIFCH  224



>ref|NP_001044756.1| Os01g0839900 [Oryza sativa Japonica Group]
 dbj|BAB67891.1| putative thaumatin-like cytokinin-binding protein [Oryza sativa 
Japonica Group]
 dbj|BAB93211.1| putative thaumatin-like cytokinin-binding protein [Oryza sativa 
Japonica Group]
 dbj|BAF06670.1| Os01g0839900 [Oryza sativa Japonica Group]
 gb|EAY76440.1| hypothetical protein OsI_04374 [Oryza sativa Indica Group]
 gb|EAZ14099.1| hypothetical protein OsJ_04023 [Oryza sativa Japonica Group]
 dbj|BAG87528.1| unnamed protein product [Oryza sativa Japonica Group]
Length=247

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 173/229 (76%), Gaps = 6/229 (3%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            A + +TIVNNCP+ +WP IQ N+G+ VLE GGF L  L+HRSF AP   WSGRIWARTGC
Sbjct  25   APMTLTIVNNCPYPVWPGIQANSGHDVLEGGGFFLPALSHRSFAAPAHPWSGRIWARTGC  84

Query  423  VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
                 +  CATGDC GRL+C G GGAAPATLAQ  LH G+ D ++YG+S+VDGFN+ +++
Sbjct  85   TGAGAQLHCATGDCGGRLQCAGLGGAAPATLAQVSLHHGN-DQTSYGVSVVDGFNVGLSV  143

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH+G+G+CPV+ CR NL   CP +LQ+R  A    G VV C SGC AF+TDELCCRN Y
Sbjct  144  TPHEGRGNCPVLACRKNLTETCPSELQLRTPA----GSVVACKSGCEAFRTDELCCRNMY  199

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  C++S+YS+FFK  CP  FTYAHD+P SL HEC+A RELK+IFCH
Sbjct  200  NSPRTCRSSKYSEFFKRECPQAFTYAHDSP-SLTHECAAPRELKVIFCH  247



>gb|AGV54272.1| osmotin-like protein [Phaseolus vulgaris]
Length=254

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 177/250 (71%), Gaps = 3/250 (1%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            A+ L +  F  L   T  S  A LI+T+VNNC +T+WPAIQPN G+PVL  GGF L+ LT
Sbjct  2    ASSLFLCTFFILAVTTLTSPTAALILTLVNNCNYTVWPAIQPNAGHPVLAGGGFTLHTLT  61

Query  360  HRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
            H+S   P   WSGR+WARTGC  +   F+CA+GDC GRL+CNG GGAAPA+LAQ E H G
Sbjct  62   HQSIPVPDVHWSGRVWARTGCTYSGTAFSCASGDCGGRLQCNGAGGAAPASLAQVEAHHG  121

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
            + D+ +Y +SLVDGFN+PMT+TPH+GKG CPVVGCRA LL  CP  LQ R+ A    GPV
Sbjct  122  NGDYVSYSVSLVDGFNVPMTVTPHEGKGVCPVVGCRAELLATCPSVLQHRVPAV--HGPV  179

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C SGC AF TDELCCRN++N+P   + S YS+FFKHAC +  T+A + P    ++CS 
Sbjct  180  VACKSGCEAFHTDELCCRNHFNSPSKWRESVYSNFFKHACQTKVTFAEENP-LFRNQCSP  238

Query  900  ARELKIIFCH  929
             R +K IFCH
Sbjct  239  PRGIKAIFCH  248



>gb|ADI43216.1| osmotin-like protein [Oryza sativa Indica Group]
Length=247

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 172/229 (75%), Gaps = 6/229 (3%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            A + +TIVNNCP+ +WP IQ N+G+ VLE GGF L  L+HRSF AP   WSGRIWARTGC
Sbjct  25   APMTLTIVNNCPYPVWPGIQANSGHDVLEGGGFFLPALSHRSFAAPAHPWSGRIWARTGC  84

Query  423  VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
                 +  CATGDC GRL+C G GGAAPATLAQ  LH G+ D ++YG+S+VDGFN+ + +
Sbjct  85   TGAGAQLHCATGDCGGRLQCAGLGGAAPATLAQVSLHHGN-DQTSYGVSVVDGFNVGLPV  143

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH+G+G+CPV+ CR NL   CP +LQ+R  A    G VV C SGC AF+TDELCCRN Y
Sbjct  144  TPHEGRGNCPVLACRKNLTETCPSELQLRTPA----GSVVACKSGCEAFRTDELCCRNMY  199

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  C++S+YS+FFK  CP  FTYAHD+P SL HEC+A RELK+IFCH
Sbjct  200  NSPRTCRSSKYSEFFKRECPQAFTYAHDSP-SLTHECAAPRELKVIFCH  247



>gb|ADI43217.1| osmotin-like protein [Oryza sativa Indica Group]
Length=247

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 182/256 (71%), Gaps = 9/256 (4%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            M +   A++++ +L    C    A   A + +TIVNNCP+ +WP IQ N+G+ VLE GGF
Sbjct  1    MGLDQAASLVATSLLS--CGVILADY-APMTLTIVNNCPYPVWPGIQANSGHDVLEGGGF  57

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQ  521
             L  L+HRSF AP   WSGRIWARTGC     +  C TGDC GRL+C G GGAAPATLAQ
Sbjct  58   FLPALSHRSFAAPAHPWSGRIWARTGCTGAGAQLHCTTGDCGGRLQCAGLGGAAPATLAQ  117

Query  522  FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRAR  701
              LH G+ D ++YG+S+VDGFN+ +++TPH+G+G+CPV+ CR NL   CP +LQ+R  A 
Sbjct  118  VSLHHGN-DQTSYGVSVVDGFNVGLSVTPHEGRGNCPVLACRKNLTETCPSELQLRTPA-  175

Query  702  RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
               G VV C SGC AF+TDELCCRN YN+P  C++S+YS+FFK  CP  FTY HD+P SL
Sbjct  176  ---GSVVACKSGCEAFRTDELCCRNMYNSPRTCRSSKYSEFFKRECPQAFTYVHDSP-SL  231

Query  882  MHECSAARELKIIFCH  929
             HEC+A RELK+IFCH
Sbjct  232  THECAAPRELKVIFCH  247



>ref|XP_004970525.1| PREDICTED: osmotin-like protein-like [Setaria italica]
Length=249

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 180/254 (71%), Gaps = 5/254 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA P  +L +   +  C    A+  A + +T+VNNCP  +WP IQ N+G+ VLE GGF L
Sbjct  1    MASPKLLLLLATSLLGCGLLAAADYAPMTLTVVNNCPFPVWPGIQANSGHDVLEGGGFFL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
              L+H+SF AP   WSGRIWARTGC     +  CATGDC GRL+C G GGAAP TLAQ  
Sbjct  61   PALSHKSFPAPSHPWSGRIWARTGCTGAGAQLHCATGDCGGRLQCAGLGGAAPTTLAQVN  120

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            LH G  D ++YG+S+VDGFN+ +++TPH+G+G+CPV+ CR +L   CP +LQ+R  A   
Sbjct  121  LHHGGDDQASYGVSVVDGFNVGLSVTPHEGRGNCPVLACRTDLTQTCPGELQLRSPA---  177

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G V+ C SGC AF+TDELCCRN YN+P  C+AS+YS+FFK  CP  FTYAHD+P SL H
Sbjct  178  -GAVLACKSGCEAFRTDELCCRNMYNSPRTCRASKYSEFFKRECPQAFTYAHDSP-SLTH  235

Query  888  ECSAARELKIIFCH  929
            +C+A RELK+IFCH
Sbjct  236  QCAAPRELKVIFCH  249



>ref|XP_002458737.1| hypothetical protein SORBIDRAFT_03g039330 [Sorghum bicolor]
 gb|EES03857.1| hypothetical protein SORBIDRAFT_03g039330 [Sorghum bicolor]
Length=251

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 176/238 (74%), Gaps = 6/238 (3%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            C    ++  A + +T+VNNCP+ +WP IQ N+G+ VLE GGF L  L+H+SF AP   WS
Sbjct  20   CGLLVSADYAPMTLTVVNNCPYPVWPGIQANSGHDVLEGGGFFLPALSHKSFPAPAHPWS  79

Query  396  GRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV  575
            GRIWARTGC     +  CATGDC GRL+C G GGAAPATLAQ  LH G+ D ++YG+S+V
Sbjct  80   GRIWARTGCTGAGAQLHCATGDCGGRLQCGGLGGAAPATLAQVNLHHGN-DQTSYGVSVV  138

Query  576  DGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKT  755
            DGFN+ +++TPH+G+G+CPV+ CR NL   CP +LQ+R  A    G V+ C SGC AF+T
Sbjct  139  DGFNVGLSVTPHEGRGNCPVLACRRNLTETCPGELQLRSPA----GSVLACKSGCEAFRT  194

Query  756  DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            DELCCRN YN+P  C+AS+YS+FFK  CP  FTYAHD+P SL HEC+A RELK+IFCH
Sbjct  195  DELCCRNMYNSPRTCRASKYSEFFKRECPQAFTYAHDSP-SLTHECAAPRELKVIFCH  251



>ref|XP_003564582.1| PREDICTED: osmotin-like protein [Brachypodium distachyon]
Length=254

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 172/255 (67%), Gaps = 9/255 (4%)
 Frame = +3

Query  177  PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL  356
            P   L +   I  C    A   A + +T+VNNCP+ IWP IQ N    VLE GGF L  L
Sbjct  5    PKLFLLLATLIPSCGLLLADF-APMTLTVVNNCPYPIWPGIQANADSEVLEGGGFYLPAL  63

Query  357  THRSFVAPRARWSGRIWARTGCVLNHG--RFTCATGDCDGRLECNGRGGAAPATLAQFEL  530
            +H SF AP   WSGRIWARTGC    G     CATGDC GRL+C G GGAAPATLAQ  L
Sbjct  64   SHHSFPAPTHAWSGRIWARTGCAPAGGAQELRCATGDCGGRLQCGGLGGAAPATLAQVSL  123

Query  531  HQG--HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
            H G    D S+YG+S+VDGFN+ +++TPH+G+G+CPV+ CR NL   CP +LQVR  A  
Sbjct  124  HHGGNDNDQSSYGVSVVDGFNVGLSVTPHEGRGNCPVLACRKNLTETCPSELQVRAGAGD  183

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
            G   VV C SGC AF TDELCCRN YN+P  C+AS+YS FFK  CP  FTYAHD+P SL 
Sbjct  184  G---VVACKSGCQAFGTDELCCRNMYNSPQTCRASKYSQFFKGECPQAFTYAHDSP-SLT  239

Query  885  HECSAARELKIIFCH  929
            HECSA RELK+IFCH
Sbjct  240  HECSAPRELKVIFCH  254



>emb|CDM84927.1| unnamed protein product [Triticum aestivum]
Length=250

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 178/255 (70%), Gaps = 6/255 (2%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA P  +L +   +  C    A   A + +T+VNNC + IWP IQ + G  VLE GGF L
Sbjct  1    MASPKLLLLLATLLPSCGLLLADF-APMTLTVVNNCAYPIWPGIQGSAGSEVLEGGGFFL  59

Query  348  YKLTHRSFVAPRARWSGRIWARTGCV-LNHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
              L+HRSF AP   WSGRIWARTGC     G+  CATGDC GRL+C G GGAAPATLAQ 
Sbjct  60   PSLSHRSFPAPTHAWSGRIWARTGCTPAGAGQLRCATGDCGGRLQCGGLGGAAPATLAQV  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             LH G  D S+YG+S+VDGFN+ +++TPH+G+G+CPV+ CR +L  +CP +LQVR  A  
Sbjct  120  SLHHGGDDQSSYGVSVVDGFNVGLSVTPHEGRGNCPVLACRKDLTQSCPGELQVRAAAGG  179

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
            G   V  C SGC AF TDELCCRN YN+P  C+ S+YSDFFK+ CP  FTYAHD+P SL 
Sbjct  180  G---VAACKSGCLAFGTDELCCRNAYNSPAACRPSKYSDFFKNECPQAFTYAHDSP-SLT  235

Query  885  HECSAARELKIIFCH  929
            H+CSA RELK+IFCH
Sbjct  236  HQCSAPRELKVIFCH  250



>ref|XP_008224274.1| PREDICTED: osmotin-like protein [Prunus mume]
Length=232

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 164/239 (69%), Gaps = 28/239 (12%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP-RARW  392
            CA   A+ PA  + T+VNNCP  +WP IQPN+G+PVLERGGF L  L+HR F  P + R 
Sbjct  21   CALAHATSPAPFL-TLVNNCPFPLWPGIQPNSGHPVLERGGFYLPALSHRPFPTPTQPRP  79

Query  393  SGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSL  572
             GR                     DGRLECNG GGAAPATLAQ  LH G  D  +YG+SL
Sbjct  80   PGRR--------------------DGRLECNGAGGAAPATLAQVSLHHGPNDLFSYGVSL  119

Query  573  VDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFK  752
            VDGFN+P+T+TPH+G G CPVVGC+A+LL  CP +L+V   A      VV C S C AF+
Sbjct  120  VDGFNVPLTITPHEGHGVCPVVGCKADLLATCPERLRVTSHAG-----VVACKSACEAFR  174

Query  753  TDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            TDELCCRN YN+P  C+AS YS+FFK ACP+TFT+AHD+P +LMH+CS+  ELK+IFCH
Sbjct  175  TDELCCRNQYNSPQTCRASSYSEFFKRACPATFTFAHDSP-TLMHQCSSPHELKVIFCH  232



>ref|XP_009358383.1| PREDICTED: osmotin-like protein [Pyrus x bretschneideri]
Length=224

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 164/249 (66%), Gaps = 38/249 (15%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            +LS T F+ L A   A+ P+  I+T+VNNCP  IWPAIQPN+G+PVLERGGF L  LTHR
Sbjct  13   LLSATTFLILSAVVHANYPSSSILTLVNNCPFPIWPAIQPNSGHPVLERGGFFLNALTHR  72

Query  366  SFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG-H  542
            SF AP    S                                GGA P+TLAQ  LH G  
Sbjct  73   SFPAPTQPSSA-------------------------------GGATPSTLAQISLHHGGP  101

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
            AD  +YG+SLVDGFN+P+T+TPH+G G CPVVGC+ANLL  CP     RL+    +G VV
Sbjct  102  ADLYSYGVSLVDGFNVPLTVTPHEGHGVCPVVGCKANLLATCPD----RLKVTSPKG-VV  156

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C AF TDELCCRN+YN+P  C+ASRYS FFK ACP+TFT+AHD+P +LMH+CS+ 
Sbjct  157  ACKSACEAFGTDELCCRNHYNSPQTCRASRYSQFFKQACPTTFTFAHDSP-TLMHQCSSP  215

Query  903  RELKIIFCH  929
            RELK+IFCH
Sbjct  216  RELKVIFCH  224



>ref|XP_010523133.1| PREDICTED: osmotin-like protein [Tarenaya hassleriana]
Length=211

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 152/229 (66%), Gaps = 43/229 (19%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            L +T+VNNCP TIWPAIQPN G+PVLERGGFAL  L HRSF+AP                
Sbjct  24   LYLTVVNNCPFTIWPAIQPNAGHPVLERGGFALPTLHHRSFLAP----------------  67

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG--HADFSTYGLSLVDGFNLPMTL  602
                                 G AAPATLAQF+LH G    DF +YG+SLVDGFN+PMT+
Sbjct  68   ---------------------GAAAPATLAQFDLHHGGPQRDFCSYGVSLVDGFNVPMTV  106

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
            TPH G+G CPVVGCR +LL  CP  LQVR   R   G VV C SGC AF+TDELCCRN+Y
Sbjct  107  TPHMGRGVCPVVGCRHDLLRTCPPPLQVRSGLR---GHVVACKSGCEAFRTDELCCRNHY  163

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            N+P  C+ S YS FFK ACP+TFT+AHD+P SLMH+C +  ELK+IFCH
Sbjct  164  NSPQTCRPSEYSRFFKEACPATFTFAHDSP-SLMHDCESPNELKVIFCH  211



>gb|KCW52693.1| hypothetical protein EUGRSUZ_J02061, partial [Eucalyptus grandis]
Length=224

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 134/161 (83%), Gaps = 3/161 (2%)
 Frame = +3

Query  447  CATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGH  626
            CATGDC GRLEC G GGA PATLAQF LH GHADFS+Y +SLVDGFN+PMT+TPH+GKG 
Sbjct  67   CATGDCGGRLECEGLGGATPATLAQFSLHHGHADFSSYAVSLVDGFNVPMTVTPHEGKGV  126

Query  627  CPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKA  806
            CPVVGCRANLL  CP  LQ+R  A  G GPVV C SGC AF+TDELCCRN++N+   C+ 
Sbjct  127  CPVVGCRANLLATCPPHLQMRSPA--GHGPVVACKSGCEAFRTDELCCRNHFNSKDTCRP  184

Query  807  SRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            S YS+FFKHACP+TFTYAHD+P SLMHECS+ RELK+IFCH
Sbjct  185  SSYSEFFKHACPATFTYAHDSP-SLMHECSSPRELKVIFCH  224



>gb|ADB97925.1| thaumatin-like protein L1 [Pinus monticola]
Length=252

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 147/228 (64%), Gaps = 8/228 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            L ITI+N+CP TIWP +Q + G+ VLE+GGFAL  L  RSF      W+G +WARTGC  
Sbjct  32   LTITIMNSCPTTIWPGLQASEGHDVLEQGGFALESLKSRSFSVANP-WNGVVWARTGCSF  90

Query  429  NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
            +  + +C TGDCDG+L+CNG GG  P TLAQ  LH G  D S+Y LSLV+GFNLP+T TP
Sbjct  91   SGEKGSCLTGDCDGKLQCNGTGGRNPVTLAQLSLHHGGNDVSSYTLSLVNGFNLPLTFTP  150

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC-RNNYN  785
            H G+G C +  C AN+L +CP++LQV     +    V+ C + C AF+TD  CC   +YN
Sbjct  151  HGGRGRCGIPRCMANMLESCPKELQV-----KNGDNVIACKTACQAFRTDAYCCTSQHYN  205

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
                C  + YS  FK ACP+ F Y  D P +L+H C    E+K+IFCH
Sbjct  206  GSRTCPPTTYSQIFKRACPNAFAYPDDNP-ALVHNCVTPNEIKLIFCH  252



>gb|ABK25809.1| unknown [Picea sitchensis]
Length=243

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/250 (46%), Positives = 146/250 (58%), Gaps = 12/250 (5%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            A   ++  F+SL      S       T+ N C H++WP IQP+ G PVL  GGF L  L 
Sbjct  3    AKFANLAAFLSLLCIAGGSGVFATTFTLFNKCKHSVWPGIQPSAGRPVLANGGFRLMPLQ  62

Query  360  HRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ  536
              S V P A WSGRIW R GC  +  G+  CATGDC G+L CNG GGA PATLA+  L  
Sbjct  63   AMSIVPP-AGWSGRIWGRHGCSFDSDGKGLCATGDCGGQLHCNGAGGAPPATLAEITL--  119

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
            G  DF  Y +SLVDG+NLP+ + P  G G C   GC ++L  +CP  LQV+      +G 
Sbjct  120  GTQDF--YDVSLVDGYNLPIAIAPRRGSGKCTYAGCISDLNLSCPPSLQVKNE----QGC  173

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
            V+ C S C AF T + CC  +Y NP  C+ + +S  FK+ACP  ++YA+D P+SL+  CS
Sbjct  174  VMACKSACFAFSTPQYCCTGSYGNPQTCRPTSFSRLFKNACPRAYSYAYDDPNSLV-TCS  232

Query  897  AARELKIIFC  926
             A  L I FC
Sbjct  233  GADYL-ITFC  241



>gb|EYU34121.1| hypothetical protein MIMGU_mgv1a022628mg, partial [Erythranthe 
guttata]
Length=243

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 132/229 (58%), Gaps = 12/229 (5%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            + + N CP  IWPA  PN G+PVL  GGF L     R F AP   W+GRIWARTGC  + 
Sbjct  9    LYVSNKCPFPIWPATAPNQGHPVLANGGFHLQPGKTRKFQAP-GDWTGRIWARTGCNFDP  67

Query  432  --HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
              + +  C TGDCDG+LECNG  G  PATL +F L       + Y +SLVDG+NLP+ ++
Sbjct  68   TGNRKSACETGDCDGKLECNGTIGIPPATLVEFTLQIDKKKPNFYDVSLVDGYNLPVHVS  127

Query  606  PHD--GKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN  779
            P     +  C + GC  NL  ACP +LQV      GRG +V C S C AF  D  CCRN 
Sbjct  128  PRSPAAESKCHIGGCSGNLKAACPAELQVV----NGRGEIVACKSACLAFNLDSFCCRNE  183

Query  780  YNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            Y  P  C+ S YS  FK ACPS F+YA D P  L++   AA E  I FC
Sbjct  184  YGTPEKCRPSVYSKMFKDACPSYFSYAFDAPPPLVN--CAADEYVITFC  230



>ref|XP_004233691.2| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=270

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 143/262 (55%), Gaps = 14/262 (5%)
 Frame = +3

Query  159  QMAMAFPATILSVTLFISLCAFTTASL---PAGLIITIVNNCPHTIWPAIQPNTGYPVLE  329
            Q+ M F     ++ LF  +C F T+       G  I I N CP  IWPA  PNTG+PVL 
Sbjct  2    QITMNFSRISFALQLFF-ICHFITSGKLREVEGCSIYISNKCPFPIWPATAPNTGHPVLS  60

Query  330  RGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN---HGRFTCATGDCDGRLECNGRGGA  500
             GGF L     R   AP   WSGRIWARTGC  N   + +  C TGDCDG+LEC G  G 
Sbjct  61   NGGFYLPSGGVRRIGAP-GDWSGRIWARTGCNFNVPTNHKPACETGDCDGKLECEGTIGL  119

Query  501  APATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQL  680
             PATL +  +       S Y +SLVDG+NLP+++T       C + GC  NL   CP +L
Sbjct  120  PPATLVEMTIQYDKKQPSFYDVSLVDGYNLPVSVTNKPSSTKCLIRGCTKNLKDTCPPEL  179

Query  681  QVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYA  860
            QV        G VV C S C AF  D  CCRN Y +P  CK S YS  FK+ACPS  +YA
Sbjct  180  QV----VNDGGQVVACKSACLAFNLDSFCCRNKYGSPEKCKPSVYSSLFKNACPSYVSYA  235

Query  861  HDTPSSLMHECSAARELKIIFC  926
             DTPS ++  CS + +  I FC
Sbjct  236  FDTPSPVL-SCS-SDQFIITFC  255



>ref|XP_006338784.1| PREDICTED: thaumatin-like protein-like [Solanum tuberosum]
Length=266

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 143/262 (55%), Gaps = 14/262 (5%)
 Frame = +3

Query  159  QMAMAFPATILSVTLFISLCAFTTASL---PAGLIITIVNNCPHTIWPAIQPNTGYPVLE  329
            ++ M F     ++ LF  +C F T+       G  I I N CP  IWPA  PNTG+PVL 
Sbjct  2    EITMIFSRISFALQLFF-ICHFITSGKLREVEGCSIYISNKCPFPIWPATAPNTGHPVLA  60

Query  330  RGGFALYKLTHRSFVAPRARWSGRIWARTGC---VLNHGRFTCATGDCDGRLECNGRGGA  500
             GGF L     R   AP   WSGRIWARTGC   V  + +  C TGDCDG+LEC G  G 
Sbjct  61   DGGFYLPSGGVRRIGAP-GDWSGRIWARTGCNFDVSTNHKPACETGDCDGKLECEGTIGL  119

Query  501  APATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQL  680
             PATL +  +       S Y +SLVDG+NLP+++T       C + GC  N+   CP +L
Sbjct  120  PPATLVEMTIQYDKKQPSFYDVSLVDGYNLPVSVTNKPSSSKCLIRGCTQNMKDTCPTEL  179

Query  681  QVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYA  860
            QV        G VV C S C AF  D  CCRN Y +P  CK S YS  FK ACPS  +YA
Sbjct  180  QV----VNDEGQVVACKSACLAFNLDSFCCRNKYGSPEKCKPSVYSSLFKKACPSYVSYA  235

Query  861  HDTPSSLMHECSAARELKIIFC  926
             DTPS ++  CS+ + + I FC
Sbjct  236  FDTPSPVV-SCSSDQSV-ITFC  255



>ref|XP_011092890.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
 ref|XP_011092891.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
Length=364

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 146/256 (57%), Gaps = 16/256 (6%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            M + F    L +TL ISL  F+ A+   G   T VN C HT+WP I  N G P L+  GF
Sbjct  1    MDLWFSYLSLILTLQISLLLFSRAAF--GAKFTFVNKCDHTVWPGILANAGSPTLDSTGF  58

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDC-DGRLECNGRGGAAPATLA  518
             L + + R+F+AP A WSGR W RTGC  +    TC TGDC  G+ ECNG G A PATLA
Sbjct  59   ELPQDSSRTFLAP-AGWSGRFWGRTGCKFSDESGTCQTGDCGSGQAECNGSGAAPPATLA  117

Query  519  QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRA  698
            +F L  G  DF  Y +SLVDG+NLPM +    G G C   GC  +L  ACP +L+VR  A
Sbjct  118  EFTLGTGGLDF--YDVSLVDGYNLPMIVEATGGTGMCASTGCVTDLNRACPSELRVRGGA  175

Query  699  RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS  878
                     C S C AF + E CC   +N+P  C+ S YS  FK ACP +++YA+D P+S
Sbjct  176  --------ACQSACEAFGSPEYCCSGAFNSPASCRPSVYSQMFKSACPRSYSYAYDDPTS  227

Query  879  LMHECSAARELKIIFC  926
                CS A +  + FC
Sbjct  228  TF-TCSGA-DYTVTFC  241



>ref|XP_007160531.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
 gb|ESW32525.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
Length=248

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 138/248 (56%), Gaps = 10/248 (4%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            I    LF  L   +     A       N CPH +WP IQP+ G P+L RGGF L      
Sbjct  6    ITLTALFFLLSTLSPLKASAASSFVFYNKCPHPVWPGIQPSAGKPILARGGFKLAPNRAY  65

Query  366  SFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
            S   P A WSGR W R GC  +  GR  CATGDC G L CNG GG  PATLA+F L    
Sbjct  66   SLQLP-ALWSGRFWGRHGCAFDASGRGRCATGDCGGSLYCNGIGGTPPATLAEFTLGN-E  123

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+NLP+++TP  G G C   GC ++L   CP  LQVR R  +    VV
Sbjct  124  QDF--YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKR---VV  178

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C+AF + + CC  +Y +P  CK + YS  FK ACP  ++YA+D P+S+   C+ A
Sbjct  179  ACKSACSAFNSPKYCCTGSYGSPQACKPTVYSKIFKSACPKAYSYAYDDPTSIA-TCTKA  237

Query  903  RELKIIFC  926
              L I FC
Sbjct  238  NYL-ITFC  244



>ref|XP_003631101.1| Thaumatin-like protein [Medicago truncatula]
 gb|AET05577.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 142/252 (56%), Gaps = 12/252 (5%)
 Frame = +3

Query  180  ATILSVTLFIS--LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            A  L  TLF +  L A+T     +   +   N CPH +WPAIQP  G P+L RGGF L  
Sbjct  2    AASLFTTLFFTAFLIAYTPVVKVSAASVVFYNKCPHPVWPAIQPGAGKPILARGGFNLPP  61

Query  354  LTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFEL  530
                S   P  +WSGR W R GC  +  G   CATGDC G L CNG GG  PATLA+F  
Sbjct  62   NKAYSLQVP-PQWSGRFWGRHGCTFDASGHGHCATGDCGGSLFCNGIGGTPPATLAEFTF  120

Query  531  HQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGR  710
             +   D   Y +SLVDG+NLP+++TP  G G C   GC ++L   CP  LQVR R ++  
Sbjct  121  GK---DLDFYDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKH-  176

Query  711  GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE  890
              VVGC S CAAF +   CC  N+  P  CK + YS  FK ACP  ++YA+D P+S+   
Sbjct  177  --VVGCRSACAAFNSPRYCCTGNFGTPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIA-T  233

Query  891  CSAARELKIIFC  926
            C+ A  + I FC
Sbjct  234  CTNASYM-ITFC  244



>ref|XP_003525190.1| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=245

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 141/248 (57%), Gaps = 14/248 (6%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            IL+   F+    FT   + A   +   N CPH +WP IQP+ G PVL RGGF L      
Sbjct  7    ILTTIFFL----FTVLKVSASSSVIFYNKCPHPVWPGIQPSAGKPVLARGGFKLAPNRAY  62

Query  366  SFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
            S   P A WSGR W R GC  +  GR  CATGDC G L CNG GG+ PATLA+  L    
Sbjct  63   SLQLP-ALWSGRFWGRHGCAFDVGGRGRCATGDCGGSLFCNGIGGSPPATLAELTLGN-E  120

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+NLP+++TP  G G C   GC ++L   CP  LQVR R  +    VV
Sbjct  121  QDF--YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKR---VV  175

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C+AF + + CC  +Y +P  CK + YS  FK ACP  ++YA+D P+S+   C+ A
Sbjct  176  ACKSACSAFNSPKYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIA-TCTKA  234

Query  903  RELKIIFC  926
                + FC
Sbjct  235  NYF-LTFC  241



>emb|CDY30288.1| BnaC04g31990D [Brassica napus]
Length=255

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 133/243 (55%), Gaps = 8/243 (3%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LFI  C          +   + N CP  IWPA+ PN+G+PVL  GGF L     R    P
Sbjct  11   LFIISCIVHGKVSCHEVTFYVQNKCPFPIWPAVAPNSGHPVLSSGGFYLPCGNTRRIDVP  70

Query  381  RARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST  557
               W+GRIWARTGC   ++    C TGDCDGRLECNG  G  PATL Q  +    +  + 
Sbjct  71   WG-WNGRIWARTGCDFTSNWNQACETGDCDGRLECNGLIGKPPATLIQIAVQADKSKLNF  129

Query  558  YGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG  737
            Y +SLVDG+NLP+T+T       C + GC  +L   CP +LQV  +     G VV C S 
Sbjct  130  YDVSLVDGYNLPVTVTSKPMSSKCTIFGCHRDLKTTCPEELQVVNK----EGRVVACKSA  185

Query  738  CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI  917
            C AF  D  CCRN Y  P  CK + YS  FK ACPS ++YA+D P  L+    AA+E  I
Sbjct  186  CLAFDNDRFCCRNAYGTPDKCKRTTYSMLFKEACPSYYSYAYDAPPPLVS--CAAKEYII  243

Query  918  IFC  926
             FC
Sbjct  244  TFC  246



>gb|AAV64186.1| hypothetical protein C9002 [Zea mays]
 gb|ACF79579.1| unknown [Zea mays]
 tpg|DAA49989.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=288

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/273 (40%), Positives = 146/273 (53%), Gaps = 12/273 (4%)
 Frame = +3

Query  132  HYIATTSTEQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNT  311
             Y A T++      F   ++++  F++  A     L   ++  + N CP  +WPA  PNT
Sbjct  5    QYSAWTTSAARHRVFSCALMALVSFVA--AGRPMVLADAIVFHVANRCPFPVWPASAPNT  62

Query  312  GYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL---NHGRFTCATGDCDGRLEC  482
            G+PVL  GGF + +   R  VAP A W+GR WARTGC       G   C TGDC+GRL C
Sbjct  63   GHPVLAGGGFYVPQGKSRRVVAP-ANWNGRFWARTGCNFTANGMGVAGCLTGDCEGRLAC  121

Query  483  NGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG-----HCPVVGCR  647
            NG  GA PATL +  LH+     S+Y +SLVDG+NLP+ ++     G      C + GC 
Sbjct  122  NGSVGAPPATLVEVSLHEDAPKGSSYDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCA  181

Query  648  ANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFF  827
             N+   CP +LQV      G   VV C S C AF  D  CCR  Y  P  C+ + YS  F
Sbjct  182  KNVNAVCPPELQVTATGSGGGKTVVACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLF  241

Query  828  KHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            K ACP+ ++YA+DT ++    C  A+E  I FC
Sbjct  242  KDACPAYYSYAYDTAATTASGCY-AQEYIITFC  273



>gb|AFK33451.1| unknown [Lotus japonicus]
Length=260

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 137/254 (54%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M  P +I    + +    +        +   I N CP  IWPA  PN+G PV+  GGF L
Sbjct  1    MQLPMSIAVFFVILPSILYGINVEAHQVTFYIHNKCPFPIWPATSPNSGQPVIAEGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                 +  VAP   WSGRIWARTGC   ++ +  C TGDCDGRL CNG  G  P TL +F
Sbjct  61   ASGQTQRVVAPWT-WSGRIWARTGCNFASNWKPACETGDCDGRLACNGLIGTPPVTLVEF  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             L  G    + Y +S+VDG+N+P+++TP      C + GC  +L   C  +L+V      
Sbjct  120  SLQGGRGKPNFYDVSIVDGYNIPVSVTPKITNPKCTIQGCLKDLKRCCLHELEV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
             +G VV C S C AF  D+ CCRN Y +P  CK S YS  FK ACPS F+YA DTPS L+
Sbjct  176  AKGEVVACKSACLAFDNDKFCCRNEYGSPEKCKPSVYSKIFKDACPSYFSYAFDTPSPLV  235

Query  885  HECSAARELKIIFC  926
                 + E  I FC
Sbjct  236  S--CGSSEYIITFC  247



>ref|XP_006830037.1| hypothetical protein AMTR_s00124p00098540 [Amborella trichopoda]
 gb|ERM97453.1| hypothetical protein AMTR_s00124p00098540 [Amborella trichopoda]
Length=248

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 135/234 (58%), Gaps = 23/234 (10%)
 Frame = +3

Query  240  PAGLIITIVNNCPHTIWPAIQPNTGYPVLERGG---FALYKLTHRSFVAPRARWSGRIWA  410
            P  L +TIVNNC  TIWP+I+PN G   +  G    F L  L   SF  P A WSGR++A
Sbjct  34   PNTLNLTIVNNCAFTIWPSIEPNQGSSQIITGNQQTFYLKTLQIESFAMPAAPWSGRVYA  93

Query  411  RTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF-STYGLSLVDGFN  587
            RTGC  N     CATG+              P T+AQF ++  + +  S Y +SLVDGFN
Sbjct  94   RTGC--NPAPTACATGN------------KPPFTIAQFSINPTNPNTNSAYSVSLVDGFN  139

Query  588  LPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELC  767
            LPMT+TPH G G+CPVVGCR +LL  CP QL VR    R    VV C S C AF+ DE C
Sbjct  140  LPMTVTPHGGAGNCPVVGCRHDLLKTCPAQLVVRGDGSR----VVACKSACEAFQNDEYC  195

Query  768  CRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            CR  +     CK S YS+ FK  CP T+T+  D P +   EC A  ELK+IFCH
Sbjct  196  CRGAFAGQGKCKPSSYSEGFKSVCPDTYTFPADNPFA-KDECKAPIELKVIFCH  248



>gb|AIU34434.1| thaumatin-like protein 5, partial [Medicago truncatula var. truncatula]
Length=223

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 131/225 (58%), Gaps = 10/225 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            +   N CPH +WPAIQP  G P+L RGGF L      S   P  +WSGR W R GC  + 
Sbjct  3    VVFYNKCPHPVWPAIQPGAGKPILARGGFNLPPNKAYSLQVP-PQWSGRFWGRHGCTFDA  61

Query  432  HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
             G   CATGDC G L CNG GG  PATLA+F   +   D   Y +SLVDG+NLP+++TP 
Sbjct  62   SGHGHCATGDCGGSLFCNGIGGTPPATLAEFTFGK---DLDFYDVSLVDGYNLPISITPF  118

Query  612  DGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP  791
             G G C   GC ++L   CP  LQVR R ++    VVGC S CAAF +   CC  N+  P
Sbjct  119  KGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKH---VVGCRSACAAFNSPRYCCTGNFGTP  175

Query  792  LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              CK + YS  FK ACP  ++YA+D P+S+   C+ A  + I FC
Sbjct  176  QTCKPTAYSRIFKTACPKAYSYAYDDPTSIA-TCTNASYM-ITFC  218



>emb|CDY30841.1| BnaC04g26960D [Brassica napus]
Length=256

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 128/223 (57%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG  437
            + N CP  IWPA+ PN+G+PVL  GGF L     R    P   W+GRIWARTGC  + + 
Sbjct  32   VQNKCPFPIWPAVAPNSGHPVLASGGFYLPCGNTRRIDVPWG-WNGRIWARTGCDFSSNW  90

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
               C TGDCDGRLECNG  G  PATL Q  +    +  + Y +SLVDG+NLP+T+T    
Sbjct  91   NQACETGDCDGRLECNGLIGKPPATLIQIAVQADKSKLNFYDVSLVDGYNLPVTVTSKPM  150

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
               C + GC  +L   CP +LQV  +     G VV C S C AF  D  CCRN Y  P  
Sbjct  151  SSKCTIFGCHRDLKTTCPEELQVVNK----EGRVVACKSACLAFDNDRFCCRNAYGTPDK  206

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK + YS  FK ACPS ++YA+D P  L+    AA+E  I FC
Sbjct  207  CKRTTYSMLFKEACPSYYSYAYDAPPPLVS--CAAKEYIITFC  247



>ref|XP_003530957.2| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=253

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 141/248 (57%), Gaps = 13/248 (5%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
             L+   F++L   T   + A   +   N C H +WP IQP+ G PVL RGGF L      
Sbjct  14   FLTTIFFLTL---TVLKVSASSSVIFYNKCQHPVWPGIQPSAGKPVLARGGFKLAPNRAY  70

Query  366  SFVAPRARWSGRIWARTGCVLNHG-RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
            S   P A WSGR W R GC  + G R  CATGDC G L CNG GG+ PATLA+F L    
Sbjct  71   SLQLP-ALWSGRFWGRHGCSFDAGGRGRCATGDCGGSLFCNGIGGSPPATLAEFTLGN-E  128

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+NLP+++TP  G G C   GC ++L   CP  LQVR R  +    VV
Sbjct  129  QDF--YDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKR---VV  183

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C+AF +   CC  +Y +P  CK + YS  FK ACP  ++YA+D P+S+   C+ A
Sbjct  184  ACKSACSAFNSPRYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIA-TCTKA  242

Query  903  RELKIIFC  926
              L + FC
Sbjct  243  NYL-VTFC  249



>gb|AFK48181.1| unknown [Medicago truncatula]
Length=249

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 141/252 (56%), Gaps = 12/252 (5%)
 Frame = +3

Query  180  ATILSVTLFIS--LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            A  L  TLF +  L A+T     +   +   N CPH +WPAIQP  G P+L RGGF L  
Sbjct  2    AASLFTTLFFTAFLIAYTPVVKVSAASVVFYNKCPHPVWPAIQPGAGKPILARGGFNLPP  61

Query  354  LTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFEL  530
                S   P  +WSGR W R GC  +  G   CATGDC G L CNG  G  PATLA+F  
Sbjct  62   NKAYSLQVP-PQWSGRFWGRHGCTFDASGHGHCATGDCGGSLFCNGIDGTPPATLAEFTF  120

Query  531  HQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGR  710
             +   D   Y +SLVDG+NLP+++TP  G G C   GC ++L   CP  LQVR R ++  
Sbjct  121  GK---DLDFYDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKH-  176

Query  711  GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE  890
              VVGC S CAAF +   CC  N+  P  CK + YS  FK ACP  ++YA+D P+S+   
Sbjct  177  --VVGCRSACAAFNSPRYCCTGNFGTPQTCKPTAYSRIFKTACPKAYSYAYDDPTSIA-T  233

Query  891  CSAARELKIIFC  926
            C+ A  + I FC
Sbjct  234  CTNASYM-ITFC  244



>ref|XP_010065049.1| PREDICTED: pathogenesis-related protein 5-like [Eucalyptus grandis]
Length=295

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 141/252 (56%), Gaps = 10/252 (4%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            F AT +S     +L + +T  +   +    +N CP +IWPA+ PNTG PV+  GGF L +
Sbjct  36   FDATYISTLPIHTLLSRSTV-VAEQVTFNFLNRCPFSIWPAMAPNTGQPVIAEGGFYL-Q  93

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNHGRF-TCATGDCDGRLECNGRGGAAPATLAQFEL  530
               R  V+    W GRIWARTGC     R  TC TGDC G+L C G  G  PATL Q  L
Sbjct  94   WASRKLVSVPPGWKGRIWARTGCSFASNRPPTCETGDC-GQLRCRGLIGTPPATLVQVWL  152

Query  531  HQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGR  710
            H   A  S Y +SLVDGFNLP+++     +  C + GC   L   CP +LQV      G+
Sbjct  153  HADEAKPSFYNISLVDGFNLPISVQTRPTQPECEIPGCSKPLNGLCPEELQVM----NGK  208

Query  711  GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE  890
            G VV C S C AF TDE CCRN Y  P  CK S YS  FK ACP  +++ +D+P   +  
Sbjct  209  GKVVACKSACLAFNTDEYCCRNEYATPDKCKPSVYSRLFKDACPGYYSHPYDSPRPQVS-  267

Query  891  CSAARELKIIFC  926
              A++E +IIFC
Sbjct  268  -CASKEFEIIFC  278



>ref|XP_011098559.1| PREDICTED: pathogenesis-related protein 5 [Sesamum indicum]
Length=260

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 127/224 (57%), Gaps = 9/224 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN--H  434
            + N CP  IWPA  PN G+PV+  GGF L     R F AP   W+GRIWARTGC  +  +
Sbjct  33   VSNKCPFPIWPATAPNQGHPVIANGGFYLPPGKIRKFQAP-GNWTGRIWARTGCNFDSTN  91

Query  435  GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD  614
             + TC TGDCDG+LECNG  G  PATL +F L       + Y +SLVDG+NLP+ +    
Sbjct  92   HKPTCETGDCDGKLECNGAIGLPPATLVEFTLQVDKKKPNFYDVSLVDGYNLPVHVWTKA  151

Query  615  GKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL  794
                C + GC  +L   CP +LQV      G+G +V C S C AF  D  CCRN Y +P 
Sbjct  152  SDTKCQIGGCSKDLKATCPTELQV----LNGQGEIVACKSACLAFNLDSFCCRNAYGSPE  207

Query  795  MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             CK S YS  FK ACPS F+YA  TP  L     A+ E  I FC
Sbjct  208  KCKPSVYSQLFKDACPSYFSYAFQTPPPLAS--CASDEYVITFC  249



>ref|XP_009139951.1| PREDICTED: thaumatin-like protein [Brassica rapa]
Length=255

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 127/223 (57%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL-NHG  437
            + N CP  IWPA+ PN+G PVL  GGF L     R    P   W+GRIWARTGC   ++ 
Sbjct  31   VQNKCPFPIWPAVAPNSGQPVLSSGGFYLPCGNTRRIDVPWG-WNGRIWARTGCDFTSNW  89

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
               C TGDCDGRLECNG  G  PATL Q  +    +  + Y +SLVDG+NLP+T+T    
Sbjct  90   NQACETGDCDGRLECNGLIGKPPATLIQIAVQADKSKLNFYDVSLVDGYNLPVTVTSKPM  149

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
               C + GC  +L   CP +LQV  +     G VV C S C AF  D  CCRN Y  P  
Sbjct  150  SSKCTIFGCHRDLKTTCPEELQVVNK----EGRVVACKSACLAFDNDRFCCRNAYGTPDK  205

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK + YS  FK ACPS ++YA+D P  L+    AA+E  I FC
Sbjct  206  CKRTTYSMLFKEACPSYYSYAYDAPPPLVS--CAAKEYIITFC  246



>ref|XP_010660983.1| PREDICTED: thaumatin-like protein [Vitis vinifera]
Length=259

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 132/233 (57%), Gaps = 10/233 (4%)
 Frame = +3

Query  231  ASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWA  410
            A+ P  L I+  N CP  IWPA  PN G+PV+  GGF+L     R   AP   WSGR+WA
Sbjct  25   AAQPVSLYIS--NKCPFPIWPATAPNAGHPVIADGGFSLPSGQTRRIYAP-PTWSGRLWA  81

Query  411  RTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFN  587
            RTGC  N + +  C TGDCDGR  CNG  G  PATL Q  L    +  S Y +SLVDG+N
Sbjct  82   RTGCKFNSNWQPACQTGDCDGRFACNGTIGLPPATLVQISLQPDKSKPSFYDVSLVDGYN  141

Query  588  LPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELC  767
            LP+++T       C + GC  N+   CP++LQV          VV C S C AF  D  C
Sbjct  142  LPVSVTTKPRASKCSIGGCLTNMNSLCPQELQVLSNNME----VVACKSACLAFNLDMFC  197

Query  768  CRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CRN Y  P  CK S YS  FK ACPS ++YA DTP+ L++    ++E  I FC
Sbjct  198  CRNEYGTPEKCKPSVYSKMFKGACPSYYSYAFDTPAPLVN--CPSKEYIITFC  248



>gb|KEH26933.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=240

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 140/248 (56%), Gaps = 14/248 (6%)
 Frame = +3

Query  189  LSVTLF-ISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            L +TLF IS  A T  S      IT+ N CPH IWP +QP  G P++ +GGF L      
Sbjct  4    LILTLFLISNIAVTEVS---ATTITLYNKCPHQIWPGLQPTAGKPIIAQGGFNLPSNNAY  60

Query  366  SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
            +   P   WSGRIWAR  C  +  G   C TGDC G L CNG GG  PATLA+F L    
Sbjct  61   TLQLP-PLWSGRIWARDNCSFDATGHGHCTTGDCGGILSCNGLGGTPPATLAEFTLGNDQ  119

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+NLP+T+TP +G G C   GC  +L   CP  LQVR         VV
Sbjct  120  -DF--YDVSLVDGYNLPLTITPLNGNGKCEFAGCVRDLNVMCPMSLQVR---SSDMNQVV  173

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
            GC S C AF + E CC  +Y +P  CK + YS  FK ACP  ++YA D P+S++  CS A
Sbjct  174  GCKSACYAFNSPEYCCTGSYGSPQACKPTSYSRIFKLACPKAYSYAFDDPTSIV-TCSMA  232

Query  903  RELKIIFC  926
              L + FC
Sbjct  233  NYL-VTFC  239



>ref|XP_010262514.1| PREDICTED: thaumatin-like protein isoform X2 [Nelumbo nucifera]
Length=247

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 142/258 (55%), Gaps = 16/258 (6%)
 Frame = +3

Query  156  EQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
            E M     A + S  +F  +    +A+      I + N C H +WP IQP+ G P+L RG
Sbjct  2    EVMLRTLLALLFSALIFCYISVEVSAT-----TIALYNKCSHPVWPGIQPSAGKPILARG  56

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPAT  512
            GF L      S   P A WSGRIW R  C  +  GR  CATGDC G L CNG GGA PAT
Sbjct  57   GFKLNPNQAYSLKIP-AGWSGRIWGRQDCYFDGSGRGHCATGDCGGALYCNGVGGAPPAT  115

Query  513  LAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRL  692
            LA+  L  G  DF  Y +SLVDG+NL +++TP  GKG C   GC ++L   CP  LQVR 
Sbjct  116  LAEITL--GEQDF--YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNLMCPVGLQVRS  171

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
               R    VV C S C AF++ + CC   Y NP  CK + YS  FK ACP  ++YA+D P
Sbjct  172  HDNR---RVVACKSACFAFQSPKYCCTGTYGNPQSCKPTAYSRIFKTACPKAYSYAYDDP  228

Query  873  SSLMHECSAARELKIIFC  926
            +S+   CS    L + FC
Sbjct  229  TSIA-TCSGGSYL-VTFC  244



>ref|XP_010262463.1| PREDICTED: thaumatin-like protein isoform X1 [Nelumbo nucifera]
Length=248

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 142/258 (55%), Gaps = 15/258 (6%)
 Frame = +3

Query  156  EQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
            E M     A + S  +F   C  +   + A   I + N C H +WP IQP+ G P+L RG
Sbjct  2    EVMLRTLLALLFSALIF---CYISVVEVSA-TTIALYNKCSHPVWPGIQPSAGKPILARG  57

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPAT  512
            GF L      S   P A WSGRIW R  C  +  GR  CATGDC G L CNG GGA PAT
Sbjct  58   GFKLNPNQAYSLKIP-AGWSGRIWGRQDCYFDGSGRGHCATGDCGGALYCNGVGGAPPAT  116

Query  513  LAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRL  692
            LA+  L  G  DF  Y +SLVDG+NL +++TP  GKG C   GC ++L   CP  LQVR 
Sbjct  117  LAEITL--GEQDF--YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNLMCPVGLQVRS  172

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
               R    VV C S C AF++ + CC   Y NP  CK + YS  FK ACP  ++YA+D P
Sbjct  173  HDNR---RVVACKSACFAFQSPKYCCTGTYGNPQSCKPTAYSRIFKTACPKAYSYAYDDP  229

Query  873  SSLMHECSAARELKIIFC  926
            +S+   CS    L + FC
Sbjct  230  TSIA-TCSGGSYL-VTFC  245



>ref|XP_004503284.1| PREDICTED: thaumatin-like protein-like [Cicer arietinum]
Length=251

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 134/227 (59%), Gaps = 14/227 (6%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            I + N CPH +WP IQP+ G P+L RGGF L      S   P   WSGR W R GC  + 
Sbjct  32   IILYNKCPHPVWPGIQPSAGKPILARGGFNLPPNKAYSLQVP-PLWSGRFWGRHGCTFDS  90

Query  432  --HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
              HGR  CATGDC G L CNG GG  PATLA+F L     DF  Y +SLVDG+NLP+++T
Sbjct  91   TGHGR--CATGDCGGSLFCNGIGGTPPATLAEFTLGNDQ-DF--YDVSLVDGYNLPISIT  145

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            P  G G C   GC ++L   CP  LQVR R ++    VV C S C+AF +   CC  N+ 
Sbjct  146  PFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKR---VVACKSACSAFNSPRYCCTGNFG  202

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            +P  CK + YS  FK ACP  ++YA+D P+S+   C+ A  L I FC
Sbjct  203  SPQACKPTAYSRIFKTACPKAYSYAYDDPTSI-STCTNASYL-ITFC  247



>ref|XP_011046468.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Populus 
euphratica]
Length=339

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 145/251 (58%), Gaps = 17/251 (7%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            ++++S  + + L ++    L A    T VN C +T+WP I  N G P L+  GF L K +
Sbjct  9    SSLISTLVILFLVSYKGGVLAA--TFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDS  66

Query  360  HRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH  533
             RSF+AP   WSGR WARTGC  +  G  +C+TGDC  G++ECNG G + PATLA+F L 
Sbjct  67   SRSFIAPTG-WSGRFWARTGCNFDESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLG  125

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
             G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L      R G G
Sbjct  126  SGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCVSDLNRQCPQEL------RSGEG  177

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
                C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S    C
Sbjct  178  DA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTFT-C  234

Query  894  SAARELKIIFC  926
            S A +  + FC
Sbjct  235  SGA-DYTVTFC  244



>ref|XP_011046459.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Populus 
euphratica]
Length=340

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 145/251 (58%), Gaps = 17/251 (7%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            ++++S  + + L ++    L A    T VN C +T+WP I  N G P L+  GF L K +
Sbjct  9    SSLISTLVILFLVSYKGGVLAA--TFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDS  66

Query  360  HRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH  533
             RSF+AP   WSGR WARTGC  +  G  +C+TGDC  G++ECNG G + PATLA+F L 
Sbjct  67   SRSFIAPTG-WSGRFWARTGCNFDESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLG  125

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
             G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L      R G G
Sbjct  126  SGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCVSDLNRQCPQEL------RSGEG  177

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
                C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S    C
Sbjct  178  DA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTFT-C  234

Query  894  SAARELKIIFC  926
            S A +  + FC
Sbjct  235  SGA-DYTVTFC  244



>ref|XP_010933188.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=241

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 124/226 (55%), Gaps = 12/226 (5%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
             T  NNC  TIWP IQ N   P   + GF L      S  A  ++W+GRIW RTGC  N 
Sbjct  25   FTFKNNCAKTIWPGIQDNPNVPAFPQTGFTLAASASNSITA-SSKWAGRIWGRTGCSTNA  83

Query  435  GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTP  608
            GRFTC TGDC  G++ CNG GG  PATL +F L   G  D+  Y +SLVDGFNLP ++TP
Sbjct  84   GRFTCQTGDCGTGQVACNGNGGTPPATLLEFTLDGSGGKDY--YDISLVDGFNLPASITP  141

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
              G   C    C AN+   CP QLQV        G VV C S C AF   + CC   YN+
Sbjct  142  Q-GVSGCQTTSCSANINAQCPSQLQVTES-----GTVVACKSACLAFDQPQYCCTGAYNS  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  CKA+ YS+FFK  CP  ++YA+D  SS    C       I FC
Sbjct  196  PKTCKATSYSEFFKKECPQAYSYAYDDSSSTF-TCPNGANYLITFC  240



>ref|XP_010450736.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=256

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/254 (43%), Positives = 137/254 (54%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M F +T L     IS C          +   + N C   IWPA+ PN+G+PVL  GGF L
Sbjct  1    MKFYSTSLLQLFIISSCILYGKITSHEVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                 +   AP   WSGRIWARTGC   ++ +  C TGDCDG LECNG  G  PATL Q 
Sbjct  61   PCGGIKRIDAPWG-WSGRIWARTGCDFTSNWKQACETGDCDGHLECNGLIGKPPATLIQI  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             + +  +  + Y +SLVDG+NLP+ +        C + GC  +L   CP +LQV      
Sbjct  120  AVQEDKSKPNFYDVSLVDGYNLPVAVNSKPTSSICTISGCHKDLKTTCPEELQV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G +V C S C AF  D  CCRN Y  P  CK + YS  FK ACPS ++YA+DTP  L+
Sbjct  176  EEGRIVACKSACLAFDNDRFCCRNAYGTPEKCKRTTYSMLFKEACPSYYSYAYDTPPPLV  235

Query  885  HECSAARELKIIFC  926
              CS A+E  I FC
Sbjct  236  -TCS-AKEYFITFC  247



>ref|XP_006379282.1| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
 gb|ERP57079.1| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
Length=343

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 145/251 (58%), Gaps = 17/251 (7%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            ++++S  + + L ++    L A    T VN C +T+WP I  N G P L+  GF L K +
Sbjct  9    SSLISTLVLLFLVSYKGGVLAA--TFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDS  66

Query  360  HRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH  533
             RSF+AP   WSGR WARTGC  +  G  +C+TGDC  G++ECNG G + PATLA+F L 
Sbjct  67   SRSFIAPTG-WSGRFWARTGCNFDESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLG  125

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
             G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L      R G G
Sbjct  126  SGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCVSDLNRQCPQEL------RSGEG  177

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
                C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S    C
Sbjct  178  DA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTFT-C  234

Query  894  SAARELKIIFC  926
            S A +  + FC
Sbjct  235  SGA-DYTVTFC  244



>gb|ABK92515.1| unknown [Populus trichocarpa]
 gb|AFZ78665.1| thaumatin [Populus tomentosa]
Length=344

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 145/251 (58%), Gaps = 17/251 (7%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            ++++S  + + L ++    L A    T VN C +T+WP I  N G P L+  GF L K +
Sbjct  9    SSLISTLVLLFLVSYKGGVLAA--TFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDS  66

Query  360  HRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH  533
             RSF+AP   WSGR WARTGC  +  G  +C+TGDC  G++ECNG G + PATLA+F L 
Sbjct  67   SRSFIAPTG-WSGRFWARTGCNFDESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLG  125

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
             G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L      R G G
Sbjct  126  SGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCVSDLNRQCPQEL------RSGEG  177

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
                C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S    C
Sbjct  178  DA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTFT-C  234

Query  894  SAARELKIIFC  926
            S A +  + FC
Sbjct  235  SGA-DYTVTFC  244



>ref|XP_010065048.1| PREDICTED: pathogenesis-related protein 5-like [Eucalyptus grandis]
Length=275

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 137/252 (54%), Gaps = 9/252 (4%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            F AT    TL I      +  +   +    +N CP +IWPA+ PNTG PV+  GGF L +
Sbjct  15   FDATTYISTLPIHTLLSRSTVVAEQVTFNFLNRCPFSIWPAMAPNTGQPVIAEGGFYL-Q  73

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNHGRF-TCATGDCDGRLECNGRGGAAPATLAQFEL  530
               R  V+    W GRIWARTGC     R  TC TGDC G+L C G  G  PATL Q  L
Sbjct  74   WASRKLVSVPPGWKGRIWARTGCSFASNRPPTCETGDC-GQLGCRGLIGTPPATLVQVWL  132

Query  531  HQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGR  710
            H   A  S Y +SLVDGFNLP+++     +  C + GC   L   CP +LQV      G+
Sbjct  133  HADEAKPSFYDISLVDGFNLPISVQTRPTQPECEIPGCSKPLNSLCPEELQVM----NGK  188

Query  711  GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE  890
            G VV C S C AF TDE CCRN Y  P  CK S YS  FK ACP  +++ +D  S+    
Sbjct  189  GKVVACKSACLAFNTDEYCCRNEYATPDKCKPSVYSRLFKDACPGYYSHPYD--SARPQV  246

Query  891  CSAARELKIIFC  926
              A++E +IIFC
Sbjct  247  SCASKEFEIIFC  258



>ref|XP_002313721.2| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
 gb|EEE87676.2| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
Length=344

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 145/251 (58%), Gaps = 17/251 (7%)
 Frame = +3

Query  180  ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            ++++S  + + L ++    L A    T VN C +T+WP I  N G P L+  GF L K +
Sbjct  9    SSLISTLVLLFLVSYKGGVLAA--TFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDS  66

Query  360  HRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH  533
             RSF+AP   WSGR WARTGC  +  G  +C+TGDC  G++ECNG G + PATLA+F L 
Sbjct  67   SRSFIAPTG-WSGRFWARTGCNFDESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLG  125

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
             G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L      R G G
Sbjct  126  SGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCVSDLNRQCPQEL------RSGEG  177

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
                C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S    C
Sbjct  178  DA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTFT-C  234

Query  894  SAARELKIIFC  926
            S A +  + FC
Sbjct  235  SGA-DYTVTFC  244



>gb|KDP45445.1| hypothetical protein JCGZ_09694 [Jatropha curcas]
Length=261

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 128/221 (58%), Gaps = 8/221 (4%)
 Frame = +3

Query  267  NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRF-  443
            N CP  IWPA  PNTG+PV+  GGF L     +  +AP   W+GRIWARTGC  +  R  
Sbjct  36   NKCPFPIWPATAPNTGHPVIADGGFYLPSGKSQQIIAPW-DWNGRIWARTGCNFSSNRLP  94

Query  444  TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG  623
             C TGDCDGRL CNG  G  P TL Q  L    +  + Y +SLVDG+N+P+++T      
Sbjct  95   ACQTGDCDGRLACNGLIGIPPVTLVQISLQADKSKPNFYDVSLVDGYNIPISITSRPLSS  154

Query  624  HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCK  803
             C + GC  NL   CP +LQV        G ++ C S C AF  D  CCRN + +P  CK
Sbjct  155  KCTIGGCSKNLNSLCPHELQV----INNNGEIIACKSACLAFNLDSFCCRNEFGSPEKCK  210

Query  804  ASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             + YS+ FK ACP+ ++YA D+P  L++   A++E  I FC
Sbjct  211  PNVYSNVFKKACPNYYSYAFDSPPPLVN--CASKEYVITFC  249



>ref|XP_010245598.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=324

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 134/230 (58%), Gaps = 15/230 (7%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            +G   T VN C +T+WP I  N G P L+  GF L K + RSF AP   WSGR W RTGC
Sbjct  24   SGTTFTFVNKCDYTVWPGILANAGSPKLDSTGFELAKGSSRSFQAPTG-WSGRFWGRTGC  82

Query  423  VLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPM  596
              +  GR +C+TGDC  G++ECNG G A PATLA+F L  G  DF  Y +SLVDG+NLPM
Sbjct  83   NFDGSGRGSCSTGDCGSGQIECNGAGAAPPATLAEFTLGSGSQDF--YDVSLVDGYNLPM  140

Query  597  TLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRN  776
             +    G+G C   GC  +L   CP +L+V      G G    C S C AF T E CC  
Sbjct  141  IVEGSGGQGTCTSTGCVTDLNQRCPTELKV------GEGDA--CKSACEAFGTPEYCCSG  192

Query  777  NYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            ++N P  C+ S YS  FK ACP +++YA+D  +S    C+ A +  I FC
Sbjct  193  SFNTPATCRPSVYSQMFKSACPKSYSYAYDDATSTFT-CTGA-DYTIAFC  240



>gb|KCW70776.1| hypothetical protein EUGRSUZ_F03936 [Eucalyptus grandis]
Length=265

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 132/227 (58%), Gaps = 9/227 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +    +N CP++IWPA+ PNTG PV+  GGF L +   R  V     W GRIWARTGC  
Sbjct  30   VTFNFLNRCPYSIWPAMAPNTGQPVIAEGGFHL-QWASRKLVPVPPGWKGRIWARTGCSF  88

Query  429  NHGRF-TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
               R  TC T DC G+L C+G  G  PATL Q  LH   A  S Y +SLVDGFNLP+++ 
Sbjct  89   ASNRPPTCETRDC-GQLGCHGLIGTPPATLVQVWLHADEAKPSFYDISLVDGFNLPISVQ  147

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
                +  C + GC   L   CP++LQV      G+G VV C S C AF TDE CCRN Y 
Sbjct  148  TRPTQPECEIPGCSKPLNSLCPKELQVV----NGKGKVVACKSACLAFNTDEYCCRNEYA  203

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK + YS  FK ACP  +++ +D+P  L+    A++E +IIFC
Sbjct  204  TPDKCKPNVYSRLFKDACPGYYSHPYDSPRPLVS--CASKEFEIIFC  248



>ref|NP_001131249.1| uncharacterized protein LOC100192561 precursor [Zea mays]
 gb|ACG42500.1| osmotin-like protein precursor [Zea mays]
Length=288

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/253 (43%), Positives = 137/253 (54%), Gaps = 14/253 (6%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIV----NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF  371
             ++L +F  A  P  L   IV    N CP  +WPA  PNTG+PVL  GGF + +   R  
Sbjct  23   LMALVSFVAAGRPMVLADAIVFHVANRCPFPVWPASAPNTGHPVLAGGGFYVPQGKSRRV  82

Query  372  VAPRARWSGRIWARTGCVLN---HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
            VAP A W+GR WARTGC       G   C TGDC+GRL CNG  GA PATL +  LH+  
Sbjct  83   VAP-ANWNGRFWARTGCNFTANGMGVAGCLTGDCEGRLACNGSVGAPPATLVEVSLHEDA  141

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKG-----HCPVVGCRANLLPACPRQLQVRLRARRG  707
               S+Y +SLVDG+NLP+ ++     G      C + GC  N+   CP +LQV      G
Sbjct  142  PKGSSYDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCAKNVNAVCPPELQVTATGSGG  201

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
               VV C S C AF  D  CCR  Y  P  C+ + YS  FK ACP+ ++YA+D  ++   
Sbjct  202  GKTVVACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLFKDACPAYYSYAYDIAATTAS  261

Query  888  ECSAARELKIIFC  926
             C  A+E  I FC
Sbjct  262  GCY-AQEYIITFC  273



>ref|NP_198818.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 dbj|BAB10226.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AAR24653.1| At5g40020 [Arabidopsis thaliana]
 dbj|BAF00030.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AED94502.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=256

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/254 (43%), Positives = 137/254 (54%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M F +T L     IS C          +   + N C   IWPA+ PN+G+PVL  GGF L
Sbjct  1    MKFQSTSLLQLFIISSCIVYGKVTSHEVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                 +   AP   WSGRIWARTGC   ++ +  C TGDCDG LECNG  G  PATL Q 
Sbjct  61   PCGGIKRIDAPLG-WSGRIWARTGCDFTSNSKQACETGDCDGHLECNGLIGKPPATLIQI  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             +    +  + Y +SLVDG+NLP+ +        C ++GC  +L   CP +LQV      
Sbjct  120  AVQADKSKPNFYDVSLVDGYNLPVVVNSKPVSSKCTILGCHKDLKTTCPEELQV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G VV C S C AF  D  CCRN Y  P  CK + YS  FK ACP+ ++YA++TP  L+
Sbjct  176  EEGRVVACKSACLAFDNDRFCCRNAYGTPEKCKRNTYSMLFKEACPNYYSYAYETPPPLV  235

Query  885  HECSAARELKIIFC  926
              CS A+E  I FC
Sbjct  236  -TCS-AKEYLITFC  247



>ref|XP_010670350.1| PREDICTED: thaumatin-like protein [Beta vulgaris subsp. vulgaris]
Length=272

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 142/265 (54%), Gaps = 24/265 (9%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M  P  ++  TL   L  +  A     ++IT  N CP TIWPA   NTG+PV+  GGF L
Sbjct  5    MKLPRLVI-CTLLWHLLLYGVAGHTVSIVIT--NKCPFTIWPATARNTGHPVIANGGFCL  61

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-------NHGRFT----CATGDCDGRLECNGRG  494
                     AP   WSGRIWARTGC         +H   T    C TGDCDGRLECNG  
Sbjct  62   KSEQSTRIQAPW-DWSGRIWARTGCSFKAEYQQDDHTNSTWAPACQTGDCDGRLECNGLI  120

Query  495  GAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMT-LTPHDGKGHCPVVGCRANLLPACP  671
            GA PATL +  L+      S Y +SLVDG+NLP++ L P   K  C + GC  +L   CP
Sbjct  121  GAPPATLVELTLNTDKNQPSFYDVSLVDGYNLPVSVLVPSAPK--CSIRGCYRDLKAICP  178

Query  672  RQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTF  851
             +LQV+     G G +V C S C AF  D  CCRN Y N   C  S YSD FK ACPS  
Sbjct  179  LELQVK----DGGGNIVACKSACLAFNLDRFCCRNEYRNAEKCTPSLYSDVFKGACPSYV  234

Query  852  TYAHDTPSSLMHECSAARELKIIFC  926
            +YA D+PS LM      +EL + FC
Sbjct  235  SYAFDSPSPLMS--CLVKELYVTFC  257



>ref|XP_010065046.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
Length=264

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 132/227 (58%), Gaps = 9/227 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +    +N CP++IWPA+ PNTG PV+  GGF L +   R  V     W GRIWARTGC  
Sbjct  29   VTFNFLNRCPYSIWPAMAPNTGQPVIAEGGFHL-QWASRKLVPVPPGWKGRIWARTGCSF  87

Query  429  NHGRF-TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
               R  TC T DC G+L C+G  G  PATL Q  LH   A  S Y +SLVDGFNLP+++ 
Sbjct  88   ASNRPPTCETRDC-GQLGCHGLIGTPPATLVQVWLHADEAKPSFYDISLVDGFNLPISVQ  146

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
                +  C + GC   L   CP++LQV      G+G VV C S C AF TDE CCRN Y 
Sbjct  147  TRPTQPECEIPGCSKPLNSLCPKELQVV----NGKGKVVACKSACLAFNTDEYCCRNEYA  202

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK + YS  FK ACP  +++ +D+P  L+    A++E +IIFC
Sbjct  203  TPDKCKPNVYSRLFKDACPGYYSHPYDSPRPLVS--CASKEFEIIFC  247



>ref|XP_002868677.1| hypothetical protein ARALYDRAFT_493983 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44936.1| hypothetical protein ARALYDRAFT_493983 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/254 (43%), Positives = 137/254 (54%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M F +T L     IS C          +   + N C   IWPA+ PN+G+PVL  GGF L
Sbjct  1    MKFHSTSLLQLFIISSCIVYGKVTSHEVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                 +   AP   WSGRIWARTGC   ++ +  C TGDCDG LECNG  G  PATL Q 
Sbjct  61   PCGGIKRIDAPWG-WSGRIWARTGCDFTSNWKQACETGDCDGHLECNGLIGKPPATLIQI  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             +    +  + Y +SLVDG+NLP+ +        C ++GC  +L   CP +LQV      
Sbjct  120  AVEADKSKPNFYDVSLVDGYNLPVAVNSKPVSSKCNILGCHKDLKTTCPEELQV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G +V C S C AF  D  CCRN Y  P  CK + YS  FK ACP+ ++YA+DTP  L+
Sbjct  176  EEGQIVACKSACLAFDNDRFCCRNAYGTPEKCKRNTYSMLFKEACPNYYSYAYDTPPPLV  235

Query  885  HECSAARELKIIFC  926
              CS A+E  I FC
Sbjct  236  -TCS-AKEYLITFC  247



>gb|KCW70779.1| hypothetical protein EUGRSUZ_F03940 [Eucalyptus grandis]
Length=311

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 130/227 (57%), Gaps = 9/227 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +    +N CP +IWPA+ PNTG PV+  GGF L +   R  V+    W GRIWARTGC  
Sbjct  80   VTFNFLNRCPFSIWPAMAPNTGQPVIAEGGFYL-QWASRKLVSVPPGWKGRIWARTGCSF  138

Query  429  NHGRF-TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
               R  TC TGDC G+L C G  G  PATL Q  LH   A  S Y +SLVDGFNLP+++ 
Sbjct  139  ASNRPPTCETGDC-GQLRCRGLIGTPPATLVQVWLHADEAKPSFYNISLVDGFNLPISVQ  197

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
                +  C + GC   L   CP +LQV      G+G VV C S C AF TDE CCRN Y 
Sbjct  198  TRPTQPECEIPGCSKPLNGLCPEELQVM----NGKGKVVACKSACLAFNTDEYCCRNEYA  253

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK S YS  FK ACP  +++ +D+P   +    A++E +IIFC
Sbjct  254  TPDKCKPSVYSRLFKDACPGYYSHPYDSPRPQVS--CASKEFEIIFC  298



>gb|KHG15061.1| hypothetical protein F383_19667 [Gossypium arboreum]
Length=253

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 134/236 (57%), Gaps = 8/236 (3%)
 Frame = +3

Query  222  FTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGR  401
            F+  SL   +   + N CP  IWPA  PNTG+PV+  GGF L     + F AP   W+GR
Sbjct  14   FSGHSLAHTVTFYVHNKCPFPIWPATAPNTGHPVIANGGFYLPSGQMQRFEAPWT-WNGR  72

Query  402  IWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVD  578
            IWARTGC  N + +  C TGDCDGRL+CNG  G  PATL Q  L       + Y +SLVD
Sbjct  73   IWARTGCNFNSNWQPACETGDCDGRLQCNGLIGIPPATLVQVALQGDKGKPNFYDVSLVD  132

Query  579  GFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTD  758
            G+NLP+++T       C +  C  N    CP+++QV  +     G VV C S C AF  D
Sbjct  133  GYNLPVSVTTRPFSPKCTIGSCSKNPNNFCPQEVQVVNK----NGEVVACKSACLAFDID  188

Query  759  ELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              CCRN +  P  CK S YS  FK ACPS ++YA D P  L++   A+++  IIFC
Sbjct  189  SFCCRNEFGTPEKCKPSVYSKMFKDACPSYYSYAFDMPPPLVN--CASKDYVIIFC  242



>ref|XP_006384568.1| hypothetical protein POPTR_0004s17890g [Populus trichocarpa]
 gb|ERP62365.1| hypothetical protein POPTR_0004s17890g [Populus trichocarpa]
Length=342

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 144/253 (57%), Gaps = 18/253 (7%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            FP  I S  L + L ++    L A    T VN C HT+WP I  N G P L+  GF L +
Sbjct  8    FPTLISSFVLLL-LVSYKGCVLAA--TFTFVNKCEHTVWPGILANAGSPRLDSTGFELQQ  64

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE  527
             + RSF+AP   WSGR WARTGC  +  G   C+TGDC  G++ECNG G A PATLA+F 
Sbjct  65   DSSRSFIAPTG-WSGRFWARTGCNFDESGAGLCSTGDCGSGQVECNGFGAAPPATLAEFT  123

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L  G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L+V      G
Sbjct  124  LGSGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCISDLNIQCPQELRV------G  175

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G    C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S   
Sbjct  176  EGDA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTF-  232

Query  888  ECSAARELKIIFC  926
             CS A +  + FC
Sbjct  233  TCSGA-DYTVTFC  244



>gb|ABK94543.1| unknown [Populus trichocarpa]
Length=342

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 144/253 (57%), Gaps = 18/253 (7%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            FP  I S  L + L ++    L A    T VN C HT+WP I  N G P L+  GF L +
Sbjct  8    FPTLISSFVLLL-LVSYKGCVLAA--TFTFVNKCEHTVWPGILANAGSPRLDSTGFELQQ  64

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE  527
             + RSF+AP   WSGR WARTGC  +  G   C+TGDC  G++ECNG G A PATLA+F 
Sbjct  65   DSSRSFIAPTG-WSGRFWARTGCNFDEAGAGLCSTGDCGSGQVECNGFGAAPPATLAEFT  123

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L  G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L+V      G
Sbjct  124  LGSGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCISDLNIQCPQELRV------G  175

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G    C S C AF + E CC   +N P  CK S YS+ FK ACP +++YA+D  +S   
Sbjct  176  EGDA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAACPKSYSYAYDDATSTF-  232

Query  888  ECSAARELKIIFC  926
             CS A +  + FC
Sbjct  233  TCSGA-DYTVTFC  244



>ref|XP_009775802.1| PREDICTED: thaumatin-like protein [Nicotiana sylvestris]
Length=262

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 141/259 (54%), Gaps = 14/259 (5%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGL---IITIVNNCPHTIWPAIQPNTGYPVLERGG  338
            M F +   ++ LF+ +  FTT+     +   II I N CP  IWPA  PN G+PV+  GG
Sbjct  1    MKFSSISPAILLFL-IWHFTTSGKLGEVEACIIYINNKCPFPIWPATAPNAGHPVIANGG  59

Query  339  FALYKLTHRSFVAPRARWSGRIWARTGCVLN---HGRFTCATGDCDGRLECNGRGGAAPA  509
            F L     R + AP   WSGRIWARTGC  +   + +  C TGDCDG+LEC G  G  P 
Sbjct  60   FYLPPGRTRRYGAP-GDWSGRIWARTGCNFDDPTNHKPACETGDCDGKLECEGTIGLPPV  118

Query  510  TLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVR  689
            TL +  +       S Y +SLVDG+NLP+++T       C +  C  NL   CP +LQV 
Sbjct  119  TLVEMSIQFDKKQPSFYDVSLVDGYNLPVSITSKPSASKCVITSCSRNLNAMCPPELQV-  177

Query  690  LRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDT  869
                   G VV C S C AF  D  CCRN Y +P  CK S YS  FK +CPS  TYA DT
Sbjct  178  ---INDEGQVVACKSACLAFNLDSFCCRNKYGSPDKCKPSVYSSLFKKSCPSYVTYAFDT  234

Query  870  PSSLMHECSAARELKIIFC  926
            PS ++  CS + +  I FC
Sbjct  235  PSPVVG-CS-SDQFVITFC  251



>ref|XP_010274714.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=246

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 128/225 (57%), Gaps = 11/225 (5%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            I + N C H +WP IQP  G PV+ RGGF L      S   P A WSGRIW R  C  + 
Sbjct  29   IALYNKCSHPVWPGIQPGAGKPVIARGGFKLNPNQAYSLKVP-AGWSGRIWGRQDCYFDA  87

Query  432  HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
             GR  C TGDC G L CNG GG  PATLA  E+  G  DF  Y +SLVDG+NLP+++TP 
Sbjct  88   SGRGCCVTGDCGGNLYCNGLGGTPPATLA--EITFGEQDF--YDVSLVDGYNLPISITPF  143

Query  612  DGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP  791
             G G C   GC ++L   CP  LQVR R  R    VV C S C AFK+ + CC   Y NP
Sbjct  144  RGTGKCNYAGCISDLNEMCPVGLQVRSRDNRR---VVACKSACFAFKSPKYCCTGTYGNP  200

Query  792  LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              CK + YS  FK ACP  ++YA+D P+S+   C     L + FC
Sbjct  201  QSCKPTAYSRIFKSACPKAYSYAYDDPTSI-ETCRGGSYL-VTFC  243



>ref|XP_007222068.1| hypothetical protein PRUPE_ppa009575mg [Prunus persica]
 gb|EMJ23267.1| hypothetical protein PRUPE_ppa009575mg [Prunus persica]
Length=286

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 132/227 (58%), Gaps = 18/227 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            I TI+NNC  T+WPA+ P   +     GGF L +     F AP   WSGRIW RTGC  +
Sbjct  30   IFTIINNCKETVWPAVTPGESF---NGGGFMLKQGQSVIFTAP-VSWSGRIWGRTGCNFD  85

Query  432  H--GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
            +  G  +C TGDC G L+C G  G  PATLA+F L    A    Y +SLVDGFNLPM +T
Sbjct  86   NKNGNTSCQTGDCGGTLKC-GASGKTPATLAEFTL----AALDFYDVSLVDGFNLPMVVT  140

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            P +G G+C V GC  +L  +CP  L V+       G  VGC S C  F TDE CCR  + 
Sbjct  141  PLNGTGNCSVSGCDGDLRSSCPSVLSVK-----ANGKTVGCRSACDVFNTDEYCCRGVFG  195

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            NP+ CK + YS  FK ACP+ ++YA+D P+S+   CS   +  + FC
Sbjct  196  NPVTCKPTYYSKMFKEACPTAYSYAYDDPTSIF-TCSGT-DYVVAFC  240



>gb|ABK95807.1| unknown [Populus trichocarpa]
Length=260

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 128/223 (57%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC-VLNHG  437
            + N CP  IWPA  PNTG+PV+  GGF L     +   AP   W GRIWARTGC   ++G
Sbjct  34   VHNKCPFAIWPATAPNTGHPVIADGGFHLTSGETKRIYAPW-DWKGRIWARTGCNFTSNG  92

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
            +  C TGDCDGRL CNG  G  P TL Q  L       + Y +SLVDG+NLP+++T    
Sbjct  93   QPACETGDCDGRLACNGLIGTPPVTLMQISLQADGTKPNFYDVSLVDGYNLPVSVTTKQI  152

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
               C + GC  NL  +CP +LQV  +     G +V C S C AF  D  CC N Y +P  
Sbjct  153  SSKCTIGGCSKNLKNSCPMELQVLNK----NGEIVACKSACLAFNLDSFCCSNEYGSPEK  208

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK S YS  FK ACP  ++YA D+P+ L++   A++E  + FC
Sbjct  209  CKPSVYSKMFKDACPYYYSYAFDSPAPLVN--CASKEYIVTFC  249



>ref|XP_002323818.2| hypothetical protein POPTR_0017s11190g [Populus trichocarpa]
 gb|EEF03951.2| hypothetical protein POPTR_0017s11190g [Populus trichocarpa]
Length=260

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 128/223 (57%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC-VLNHG  437
            + N CP  IWPA  PNTG+PV+  GGF L     +   AP   W GRIWARTGC   ++G
Sbjct  34   VHNKCPFAIWPATAPNTGHPVIADGGFHLTSGETKRIYAPW-DWKGRIWARTGCNFTSNG  92

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
            +  C TGDCDGRL CNG  G  P TL Q  L       + Y +SLVDG+NLP+++T    
Sbjct  93   QPACETGDCDGRLACNGLIGTPPVTLMQISLQADGTKPNFYDVSLVDGYNLPVSVTTKQI  152

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
               C + GC  NL  +CP +LQV  +     G +V C S C AF  D  CC N Y +P  
Sbjct  153  SSKCTIGGCSKNLKNSCPMELQVLNK----NGEIVACKSACLAFNLDSFCCSNEYGSPEK  208

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK S YS  FK ACP  ++YA D+P+ L++   A++E  + FC
Sbjct  209  CKPSVYSKMFKDACPYYYSYAFDSPAPLVN--CASKEYIVTFC  249



>ref|XP_011008365.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=260

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 131/232 (56%), Gaps = 8/232 (3%)
 Frame = +3

Query  234  SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWAR  413
            SL   +   I N CP  IWPA  PNTG+PV+  GGF L     +   AP   W GR+WAR
Sbjct  25   SLGHQVAFHIHNKCPFAIWPATAPNTGHPVIADGGFYLTSGETQRIYAPW-DWKGRMWAR  83

Query  414  TGC-VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNL  590
            TGC   + G+  C TGDCDGRL CNG  G  P TL Q  L    +  + Y +SLVDG+NL
Sbjct  84   TGCNFTSKGQPACETGDCDGRLACNGLIGTPPVTLVQVSLQADGSKPNFYDVSLVDGYNL  143

Query  591  PMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC  770
            P+++T       C + GC  NL  +CP +LQV  +     G +V C S C AF  D  CC
Sbjct  144  PVSVTTKQISSKCTIGGCSKNLKNSCPMELQVHNK----NGEIVACKSACLAFNLDSFCC  199

Query  771  RNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             N Y +P  CK S YS  FK ACP  ++YA D+P+ L++   A++E  + FC
Sbjct  200  SNEYGSPEKCKPSVYSKMFKDACPYYYSYAFDSPAPLVN--CASKEYIVTFC  249



>ref|XP_011084258.1| PREDICTED: thaumatin-like protein [Sesamum indicum]
Length=248

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 138/243 (57%), Gaps = 10/243 (4%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LF+++     +   +G  +T+ N C H +WP IQP+ G PVL RGGF L      +   P
Sbjct  12   LFLAILILHISVEVSGTTMTLYNKCSHPVWPGIQPSAGKPVLARGGFKLPPNKSYTVQLP  71

Query  381  RARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST  557
             A WSGR+W R GC  N  GR  CATGDC G L CNG GG  PATLA+  L     D   
Sbjct  72   -AGWSGRVWGRHGCSFNAEGRGRCATGDCGGALFCNGIGGPPPATLAEITLGN---DQDF  127

Query  558  YGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG  737
            Y +SLVDG+NL +++TP  GKG C   GC ++L   CP  LQVR   ++    VV C S 
Sbjct  128  YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNMMCPVGLQVRSHDKKS---VVACKSA  184

Query  738  CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI  917
            C AF +   CC  ++ NP  CK + YS  FK ACP  ++YA+D P+S+   C+    L +
Sbjct  185  CFAFNSPRYCCTGSFGNPQSCKPTAYSRIFKAACPKAYSYAYDDPTSIA-TCTGGSYL-L  242

Query  918  IFC  926
             FC
Sbjct  243  TFC  245



>ref|XP_006284382.1| hypothetical protein CARUB_v10005550mg [Capsella rubella]
 gb|EOA17280.1| hypothetical protein CARUB_v10005550mg [Capsella rubella]
Length=256

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 137/254 (54%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M F +T L     IS C          +   + N C   IWP++ PN+G PVL  GGF L
Sbjct  1    MKFYSTSLLQLFIISSCIVYGKVTSHEVTFYVQNKCAFPIWPSVAPNSGLPVLASGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                 +   AP   WSGRIWARTGC   ++ +  C TGDCDG+LECNG  G  PATL Q 
Sbjct  61   PCGGIKRIDAPWG-WSGRIWARTGCDFTSNWKQACETGDCDGQLECNGLIGKPPATLVQI  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             +    +  + Y +SLVDG+NLP+ +        C + GC  +L   CP++LQV      
Sbjct  120  AVQTDKSKPNFYDVSLVDGYNLPVAVNSKPMSSKCTISGCHKDLKTTCPQELQV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G +V C S C AF  D  CCRN Y  P  CK + YS  FK ACP+ ++YA+DTP  L+
Sbjct  176  EEGRIVACKSACLAFDNDRFCCRNAYGTPGKCKRTTYSMLFKEACPNYYSYAYDTPPPLV  235

Query  885  HECSAARELKIIFC  926
              CS A+E  I FC
Sbjct  236  -TCS-AKEYLITFC  247



>gb|AHC69780.1| thuamatin-like protein [Quercus suber]
Length=249

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 143/258 (55%), Gaps = 15/258 (6%)
 Frame = +3

Query  156  EQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
            E M  +F A +LS  +   + A  +A+      IT+ N C H +WP IQP  G P+L RG
Sbjct  2    EAMLRSFIALMLSTLMLSHIPAEVSAT-----TITLYNKCTHPVWPGIQPGAGKPILARG  56

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPAT  512
            GF L      S   P A WSGR+W R GC  +  GR  CATGDC G L CNG GGA PAT
Sbjct  57   GFKLQPNKAYSLHLP-ALWSGRLWGRHGCTFDASGRGLCATGDCGGSLFCNGLGGAPPAT  115

Query  513  LAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRL  692
            LA+  L     DF  Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR 
Sbjct  116  LAEITLGN-EQDF--YDVSLVDGYNLAISITPIKGSGKCSYAGCVSDLNMMCPVGLQVRS  172

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
               R    VV C S C AF +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P
Sbjct  173  HDNR---RVVACKSACFAFNSPRYCCTGSFGSPQACKPTAYSRIFKAACPKAYSYAYDDP  229

Query  873  SSLMHECSAARELKIIFC  926
            +S+   C+    L + FC
Sbjct  230  TSI-STCTGGNYL-VTFC  245



>ref|XP_004302370.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/255 (42%), Positives = 135/255 (53%), Gaps = 9/255 (4%)
 Frame = +3

Query  168  MAFPATILSVTLFISL-CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA  344
            M  P  + S +L ++  C      +   +   I N CP  IWPA  PN G PV+  GGF+
Sbjct  1    MKLPVFVASFSLVLTWSCMLFGHGVAHTVTFYIHNKCPFPIWPATAPNNGQPVIADGGFS  60

Query  345  LYKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQ  521
            L     +   AP + WSGRIW RTGC   ++    C TGDCDGRL CNG  G  P TL Q
Sbjct  61   LSAGQTKRITAPWS-WSGRIWGRTGCNFASNWSPACETGDCDGRLACNGLIGTPPVTLVQ  119

Query  522  FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRAR  701
              L       + Y +SLVDG+NLP+++       +C + GC  +L   CP +LQV     
Sbjct  120  IALQADKGLPNYYDVSLVDGYNLPISVMLRPVASNCSISGCLRDLKTRCPEELQV----L  175

Query  702  RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
              +G VV C S C AF  D  CCRN Y  P  CK S YS  FK ACPS ++YA+D+P  L
Sbjct  176  NSKGEVVACKSACLAFNKDSFCCRNQYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPPL  235

Query  882  MHECSAARELKIIFC  926
            ++    A E  I FC
Sbjct  236  VN--CKANEYVITFC  248



>ref|XP_009596997.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
Length=248

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 139/248 (56%), Gaps = 14/248 (6%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            + SVT+  SL +        G  +T+ N C H +WP IQP+ G P+L RGGF L      
Sbjct  11   LASVTIIFSLISVEVT----GTTMTMYNKCSHPVWPGIQPSAGKPILARGGFKLLPNKAY  66

Query  366  SFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
                P A WSGR+W R GC  +  G+  CATGDC G L CNG GG  PATLA+  L    
Sbjct  67   RLSLP-AGWSGRVWGRHGCSFDASGQGRCATGDCGGALFCNGIGGTPPATLAEITLGNDQ  125

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+NL +++TP  GKG C   GC ++L   CP  LQV+   +R    VV
Sbjct  126  -DF--YDVSLVDGYNLAISITPFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKR---QVV  179

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S CAAF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   C+  
Sbjct  180  ACKSACAAFNSPRYCCTGTFGNPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIA-TCTGG  238

Query  903  RELKIIFC  926
              L + FC
Sbjct  239  SYL-LTFC  245



>gb|KHN34189.1| Thaumatin-like protein [Glycine soja]
Length=245

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 131/221 (59%), Gaps = 10/221 (5%)
 Frame = +3

Query  267  NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL-NHGRF  443
            N CP  IWPA  PN+G PV+  GGF L     +  +AP   W+GRIWARTGC   ++ + 
Sbjct  20   NKCPFPIWPATAPNSGQPVIADGGFYLAPGQTQRVIAPWT-WNGRIWARTGCNFASNWKP  78

Query  444  TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG  623
             C TGDCDGRL CNG  G  PATL +  L   + +F  Y +SLVDG+N+P+++TP     
Sbjct  79   ACETGDCDGRLACNGLIGTPPATLVEVSLQGRNPNF--YDVSLVDGYNIPVSVTPKITNP  136

Query  624  HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCK  803
             C + GC  +L   CP +L+V       +G +V C S C AF  D+ CCRN Y +P  CK
Sbjct  137  KCNIPGCLKDLKGLCPPELEVL----NSKGEIVACKSACLAFDNDKFCCRNQYGSPGKCK  192

Query  804  ASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             S YS  FK ACP+ F+YA DTP+ L+    A+ E  I FC
Sbjct  193  PSVYSKIFKDACPNYFSYAFDTPTPLVS--CASSEFIITFC  231



>ref|XP_006473671.1| PREDICTED: thaumatin-like protein 1-like [Citrus sinensis]
Length=317

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 141/258 (55%), Gaps = 17/258 (7%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            MA +    +L +T  I  C  +T         T++N C HT+WP I  N   P L   GF
Sbjct  1    MAASQLTLVLLITHLIFSCVTST-------TFTMINKCDHTVWPGILSNADSPALSATGF  53

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLA  518
             L K   ++  AP A W GR+WART C  +  G+FTC TGDC G+LEC+G G A PATLA
Sbjct  54   QLEKGETKTLNAP-ASWGGRMWARTLCSQDSTGKFTCVTGDCGGKLECSGSGAAPPATLA  112

Query  519  QFELH-QGHADFSTYGLSLVDGFNLPMTLTPHDGKG-HCPVVGCRANLLPACPRQLQVRL  692
            +F+L   G  DF  Y +SLVDG+NLPM + P  G G +C   GC  +L  ACP +L+V  
Sbjct  113  EFKLDGYGGQDF--YDVSLVDGYNLPMLVVPQGGDGPNCTSTGCVVDLNAACPSELKVMT  170

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
                G    V C S C AF+  + CC   ++ P  CK S YS  FK ACP  ++YA+D  
Sbjct  171  DGGSGG---VACKSACEAFRQPQYCCNGAFSTPDTCKPSTYSQIFKSACPHAYSYAYDDK  227

Query  873  SSLMHECSAARELKIIFC  926
            SS    C +  +  I FC
Sbjct  228  SSTF-TCGSGPDYTITFC  244



>ref|XP_010933187.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=241

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 122/225 (54%), Gaps = 10/225 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
             T  NNC  TIWP IQ N   P   + GF L      +  AP A WSGRIW RTGC  N 
Sbjct  25   FTFKNNCAQTIWPGIQDNANSPAFPQTGFTLAASASNAITAP-AHWSGRIWGRTGCSTNA  83

Query  435  GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
            G FTC TGDC  G++ CNG GG  PA+L +F L+ G     TY +SLVDGFNLP+++TP 
Sbjct  84   GTFTCQTGDCGTGQVACNGHGGNPPASLLEFTLN-GSNGKDTYDISLVDGFNLPVSITPQ  142

Query  612  DGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP  791
             G   C    C AN+   CP QLQV        G VV C S C AF   + CC   Y++P
Sbjct  143  -GVSGCQTTSCSANINAQCPTQLQVTES-----GTVVACKSACDAFHQPQYCCTGAYSSP  196

Query  792  LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              C+ S YS FFK  CP  ++YAHD  SS    C       + FC
Sbjct  197  KACQPSSYSKFFKTECPQAYSYAHDDTSSTF-ACPTGANYLVTFC  240



>ref|XP_003554871.2| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=261

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 131/221 (59%), Gaps = 10/221 (5%)
 Frame = +3

Query  267  NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL-NHGRF  443
            N CP  IWPA  PN+G PV+  GGF L     +  +AP   W+GRIWARTGC   ++ + 
Sbjct  36   NKCPFPIWPATAPNSGQPVIADGGFYLAPGQTQRVIAPWT-WNGRIWARTGCNFASNWKP  94

Query  444  TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG  623
             C TGDCDGRL CNG  G  PATL +  L   + +F  Y +SLVDG+N+P+++TP     
Sbjct  95   ACETGDCDGRLACNGLIGTPPATLVEVSLQGRNPNF--YDVSLVDGYNIPVSVTPKITNP  152

Query  624  HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCK  803
             C + GC  +L   CP +L+V       +G +V C S C AF  D+ CCRN Y +P  CK
Sbjct  153  KCNIPGCLKDLKGLCPPELEVL----NSKGEIVACKSACLAFDNDKFCCRNQYGSPGKCK  208

Query  804  ASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             S YS  FK ACP+ F+YA DTP+ L+    A+ E  I FC
Sbjct  209  PSVYSKIFKDACPNYFSYAFDTPTPLVS--CASSEFIITFC  247



>gb|KCW70777.1| hypothetical protein EUGRSUZ_F03937 [Eucalyptus grandis]
Length=311

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 129/227 (57%), Gaps = 9/227 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +    +N CP +IWPA+ PNTG PV+  GGF L +   R  V+    W GRIWARTGC  
Sbjct  80   VTFNFLNRCPFSIWPAMAPNTGQPVIAEGGFYL-QWASRKLVSVPPGWKGRIWARTGCSF  138

Query  429  NHGRF-TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
               R  TC TGDC G+L C G  G  PATL Q  LH   A  S Y +SLVDGFNLP+++ 
Sbjct  139  ASNRPPTCETGDC-GQLGCRGLIGTPPATLVQVWLHADEAKPSFYDISLVDGFNLPISVQ  197

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
                +  C + GC   L   CP +LQV      G+G VV C S C AF TDE CCRN Y 
Sbjct  198  TRPTQPECEIPGCSKPLNSLCPEELQVM----NGKGKVVACKSACLAFNTDEYCCRNEYA  253

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK S YS  FK ACP  +++ +D  S+      A++E +IIFC
Sbjct  254  TPDKCKPSVYSRLFKDACPGYYSHPYD--SARPQVSCASKEFEIIFC  298



>gb|KHG03900.1| hypothetical protein F383_27474 [Gossypium arboreum]
Length=245

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 132/232 (57%), Gaps = 10/232 (4%)
 Frame = +3

Query  234  SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWAR  413
            S  +   IT+ N CPH +WP IQP+ G P+L RGGF L      S   P   WSGR W R
Sbjct  19   SYVSATTITLYNKCPHPVWPGIQPSAGKPLLARGGFKLRPNKAYSMRLP-PLWSGRFWGR  77

Query  414  TGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNL  590
             GC  +  GR  CATGDC G L CNG GGA PATLA+  L Q   DF  Y +SLVDG+N+
Sbjct  78   HGCSFDASGRGRCATGDCGGSLFCNGLGGAPPATLAEITLGQDQ-DF--YDVSLVDGYNI  134

Query  591  PMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC  770
             M++TP  G G C   GC ++L   CP  LQVR +  +    VV C S C AF +   CC
Sbjct  135  AMSITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSKDNKR---VVACKSACFAFNSPRYCC  191

Query  771  RNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
               + NP  CK + YS  FK ACP  ++YA+D P+S+   C+    L + FC
Sbjct  192  TGTFGNPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIA-TCTRGNYL-VTFC  241



>emb|CAN59843.1| hypothetical protein VITISV_030359 [Vitis vinifera]
Length=243

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 136/241 (56%), Gaps = 15/241 (6%)
 Frame = +3

Query  222  FTTASLPA-----GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRA  386
            F+ +S PA        I++ N C H +WP IQP  G P+L RGGF L      S   P A
Sbjct  9    FSVSSAPALREVSATTISLYNKCSHPVWPGIQPGAGKPILARGGFKLPPNKAYSLHIPAA  68

Query  387  RWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYG  563
             WSGRIW R GC  + HGR  CATGDC G L CNG GG  PATLA+  L     DF  Y 
Sbjct  69   -WSGRIWGRHGCSFDAHGRGRCATGDCGGSLFCNGMGGTPPATLAEITLGS-EQDF--YD  124

Query  564  LSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCA  743
            +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR    R    VV C S C+
Sbjct  125  VSLVDGYNLAISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSHDNR---RVVACKSACS  181

Query  744  AFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIF  923
            AF +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P+S+   C+    L + F
Sbjct  182  AFNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPRAYSYAYDDPTSIA-TCTGGNYL-VTF  239

Query  924  C  926
            C
Sbjct  240  C  240



>ref|XP_007032343.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOY03269.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=254

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 131/239 (55%), Gaps = 8/239 (3%)
 Frame = +3

Query  213  LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW  392
            L  F+  SL   +   + N CP  IWPA  PNTG+PV+  GGF L     +   AP   W
Sbjct  12   LLLFSGHSLAHTVTFFVHNKCPFPIWPATAPNTGHPVIADGGFYLPPGQTQRIEAPWT-W  70

Query  393  SGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS  569
            +GRIWARTGC  N + +  C TGDCDGRL+CNG  G  PATL Q  L       + Y +S
Sbjct  71   NGRIWARTGCSFNSNWQPACETGDCDGRLQCNGLIGTPPATLVQIALQGDKGKPNFYDVS  130

Query  570  LVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF  749
            LVDG+NLP+++        C +  C  NL   CP +L+   R     G VV C S C AF
Sbjct  131  LVDGYNLPVSVATRPSLPKCTIGSCPKNLNNLCPPELEALNR----NGEVVACKSACLAF  186

Query  750  KTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              D  CCRN Y  P  CK S YS  FK ACPS ++YA D P  L++   A++E  I FC
Sbjct  187  NLDSFCCRNEYGTPEKCKPSVYSKMFKDACPSYYSYAFDMPPPLVN--CASKEYVITFC  243



>gb|KHG27805.1| Thaumatin-like protein 1a [Gossypium arboreum]
Length=310

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 136/253 (54%), Gaps = 16/253 (6%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            F ++  S   F+S          A    T +N C HT+WP I  N G P LE  GF L K
Sbjct  4    FSSSHHSFITFLSFILVLFLEGVAAATFTFINRCDHTVWPGILANPGRPNLESTGFELKK  63

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE  527
             + RSF  P   WSGR W RTGC  +  G  +CATGDC  G++ECNG G   PATLA+F 
Sbjct  64   GSSRSFQGPTG-WSGRFWGRTGCKFDDSGHGSCATGDCGSGQVECNGAGVTPPATLAEFT  122

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L  G  DF  Y +SLV+G+NLP+T+  H G G C   GC  NL   CP +L++       
Sbjct  123  LGSGSQDF--YDVSLVNGYNLPLTVEGHGGSGECATTGCVTNLNKKCPSELRIDGG----  176

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
                 GC S C AF   E CC   YN+P  CK S YS+ FK ACP +++YA D  SS   
Sbjct  177  -----GCKSACDAFGKPEYCCNGAYNSPAACKPSMYSEMFKSACPRSYSYAFDDASSTF-  230

Query  888  ECSAARELKIIFC  926
             C+ A +  I FC
Sbjct  231  TCTGA-DYTITFC  242



>ref|XP_008233902.1| PREDICTED: pathogenesis-related protein 5 [Prunus mume]
Length=286

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 132/227 (58%), Gaps = 18/227 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            I TI+NNC  T+WPA+ P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   IFTIINNCKETVWPAVTPGESF---NGGGFMLKPGQSVIFTAP-VSWSGRIWGRTGCNFD  85

Query  432  H--GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
            +  G  +C TGDC G L+C G  G  PATLA+F L     DF  Y +SLVDGFNLPM +T
Sbjct  86   NKNGNTSCQTGDCGGTLKC-GASGKTPATLAEFTL--AAPDF--YDVSLVDGFNLPMVVT  140

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            P +G G+C V GC  +L  +CP  L V+       G  VGC S C  F TDE CCR  + 
Sbjct  141  PLNGTGNCSVSGCDGDLRSSCPSVLSVK-----ANGKTVGCRSACDVFNTDEYCCRGVFG  195

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            NP+ CK + YS  FK ACP+ ++YA+D P+S+   CS   +  + FC
Sbjct  196  NPVTCKPTYYSKMFKEACPTAYSYAYDDPTSIF-TCSGT-DYVVAFC  240



>ref|XP_010063355.1| PREDICTED: pathogenesis-related protein 5 [Eucalyptus grandis]
 gb|KCW70570.1| hypothetical protein EUGRSUZ_F03757 [Eucalyptus grandis]
Length=287

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 144/256 (56%), Gaps = 18/256 (7%)
 Frame = +3

Query  168  MAFPATILS-VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA  344
            MA P  ++S + L +++ +       +  I TI+N C  ++WPAI P   +     GGF 
Sbjct  1    MASPLNVISPLLLILAILSTGPGFSDSARIFTIINKCKESVWPAITPGENF---GGGGFI  57

Query  345  LYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQ  521
            L       F AP   WSGRIW RTGC  + +G  TC TG C   L+C   G   PATLA+
Sbjct  58   LKSGQSIVFTAPVG-WSGRIWGRTGCTFDKNGNGTCQTGSCGSELKCKASGDP-PATLAE  115

Query  522  FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRAR  701
            F L     DF  Y +SLVDGFNLP+ +TP +G+G+C V GC  +L P CP +L V+++  
Sbjct  116  FTLTA--TDF--YDVSLVDGFNLPLAVTPINGQGNCSVAGCDRDLRPTCPSELSVKMK--  169

Query  702  RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
               G  VGC S C  F TDE CC+  Y NP++C+ + YS  FK ACP+ ++YA+D P+S+
Sbjct  170  ---GKTVGCRSACDVFNTDEYCCKGVYGNPVICQPTYYSKLFKQACPTAYSYAYDDPTSI  226

Query  882  MHECSAARELKIIFCH  929
                    +  I FC 
Sbjct  227  FT--CVGTDYVITFCS  240



>ref|XP_011001989.1| PREDICTED: thaumatin-like protein 1b isoform X2 [Populus euphratica]
Length=342

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 142/253 (56%), Gaps = 18/253 (7%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            FP  I S  L + L ++    L A    T VN C HT+WP I  N G P L+  GF L +
Sbjct  8    FPTLISSCVLLL-LVSYKGCVLAA--TFTFVNKCEHTVWPGILANAGSPRLDSTGFELPQ  64

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE  527
               RSF+AP   WSGR WARTGC  +  G   C+TGDC  G++ECNG G A PATLA+F 
Sbjct  65   DASRSFIAPSG-WSGRFWARTGCNFDESGAGLCSTGDCGSGQVECNGFGAAPPATLAEFT  123

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L  G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L+V      G
Sbjct  124  LGSGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCISDLNIQCPQELRV------G  175

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G    C S C AF + E CC   +N P  CK S YS+ FK  CP +++YA+D  +S   
Sbjct  176  EGDA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAVCPKSYSYAYDDATSTF-  232

Query  888  ECSAARELKIIFC  926
             CS A +  + FC
Sbjct  233  TCSGA-DYTVTFC  244



>ref|XP_011001987.1| PREDICTED: thaumatin-like protein 1b isoform X1 [Populus euphratica]
Length=343

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 142/253 (56%), Gaps = 18/253 (7%)
 Frame = +3

Query  174  FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            FP  I S  L + L ++    L A    T VN C HT+WP I  N G P L+  GF L +
Sbjct  8    FPTLISSCVLLL-LVSYKGCVLAA--TFTFVNKCEHTVWPGILANAGSPRLDSTGFELPQ  64

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE  527
               RSF+AP   WSGR WARTGC  +  G   C+TGDC  G++ECNG G A PATLA+F 
Sbjct  65   DASRSFIAPSG-WSGRFWARTGCNFDESGAGLCSTGDCGSGQVECNGFGAAPPATLAEFT  123

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L  G  DF  Y +SLVDG+NLPM +    G G C   GC ++L   CP++L+V      G
Sbjct  124  LGSGGQDF--YDVSLVDGYNLPMVVEGSGGSGMCASTGCISDLNIQCPQELRV------G  175

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G    C S C AF + E CC   +N P  CK S YS+ FK  CP +++YA+D  +S   
Sbjct  176  EGDA--CKSACEAFGSPEYCCSGAFNTPATCKPSVYSEMFKAVCPKSYSYAYDDATSTF-  232

Query  888  ECSAARELKIIFC  926
             CS A +  + FC
Sbjct  233  TCSGA-DYTVTFC  244



>gb|KHG07208.1| hypothetical protein F383_34305 [Gossypium arboreum]
Length=313

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/250 (44%), Positives = 134/250 (54%), Gaps = 21/250 (8%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            T  S+ L + L   T A+       T +N C +T+WP I  N G P LE  GF L K + 
Sbjct  13   TFFSIILLVFLDGVTAATF------TFINKCDYTVWPGILANPGSPKLESTGFELTKGSS  66

Query  363  RSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQ  536
            RSF AP   W+GR W RTGC  +  G  +CATGDC  G +ECNG G   PATLA+F L  
Sbjct  67   RSFQAPTG-WAGRFWGRTGCNFDDSGHGSCATGDCGSGEMECNGAGAIPPATLAEFTLGS  125

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
            G  DF  Y +SLVDG+NLPM +    G G C   GC  +L   CP +L++   A      
Sbjct  126  GSQDF--YDVSLVDGYNLPMIVEGSGGSGECATTGCLTDLNKKCPSELKIDGGA------  177

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
               C S C AF   E CC   YN+P  CK S YS  FK ACP +++YA D  +S    CS
Sbjct  178  --ACKSACDAFGKPEYCCSGAYNSPTACKPSMYSQVFKSACPKSYSYAFDDATSTF-TCS  234

Query  897  AARELKIIFC  926
             A +  I FC
Sbjct  235  GA-DYAITFC  243



>emb|CDO96933.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/254 (43%), Positives = 141/254 (56%), Gaps = 16/254 (6%)
 Frame = +3

Query  171  AFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALY  350
            +FP++   + +F SL   T  +   G   T VN C +T+WP +  N G P L+  GF L 
Sbjct  5    SFPSSTSPILVF-SLALLTLFTGVRGTTFTFVNKCEYTVWPGVLANAGSPSLDSTGFELP  63

Query  351  KLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQF  524
                RSF+AP   WSGR W RTGC  +  G  +CATGDC  G++ECNG G A PATLA+F
Sbjct  64   SDASRSFIAPTG-WSGRFWGRTGCNFDGSGSGSCATGDCGSGQVECNGAGAAPPATLAEF  122

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             L  G  DF  Y +SLVDG+N+ M +    G G C   GC  +L   CP +L+V      
Sbjct  123  SLGTGGQDF--YDVSLVDGYNVAMIVEGTGGSGMCASTGCVTDLNRICPAELRV------  174

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G    C S C AF + E CC   YN+P  CK S YS  FK ACP +++YA+D P+S  
Sbjct  175  --GDGNACKSACEAFGSPEYCCSGEYNSPSSCKPSVYSQVFKSACPRSYSYAYDDPTSTF  232

Query  885  HECSAARELKIIFC  926
              CS A +  + FC
Sbjct  233  -TCSGA-DYTVTFC  244



>ref|XP_010266794.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=330

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 132/230 (57%), Gaps = 15/230 (7%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            +G   T VN C +TIWP I  N G P L+  GF L + + RSF AP   WSGR W RTGC
Sbjct  24   SGTTFTFVNKCDYTIWPGILANAGSPRLDSTGFELTQGSSRSFQAPTG-WSGRFWGRTGC  82

Query  423  VLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPM  596
              +  G+ +CATGDC  G++EC G G A PATLA+F L  G  DF  Y +SLVDG+NLPM
Sbjct  83   NFDGSGQGSCATGDCGSGQIECKGAGAAPPATLAEFTLGSGSQDF--YDVSLVDGYNLPM  140

Query  597  TLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRN  776
             +    G+G C   GC  +L   CP +L+V        G    C S C AF T E CC  
Sbjct  141  IVEGTGGQGTCASTGCVTDLNQRCPTELRV--------GEGEACKSACEAFGTPEYCCSG  192

Query  777  NYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             +N P  C+ S YS+ FK ACP +++YA+D  +S    C+ A +  I FC
Sbjct  193  EFNTPATCRPSVYSEMFKSACPKSYSYAYDDATSTFT-CTGA-DYTITFC  240



>ref|XP_010097569.1| hypothetical protein L484_017379 [Morus notabilis]
 gb|EXB69101.1| hypothetical protein L484_017379 [Morus notabilis]
Length=249

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 143/256 (56%), Gaps = 14/256 (5%)
 Frame = +3

Query  168  MAFP-ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA  344
            MA P A +L  +LF+S        + A   IT+ N C H +WP IQP+ G P+L RGGF 
Sbjct  1    MAIPQAQLLLTSLFLSH-ILVHQVVSASTTITLYNKCKHPVWPGIQPSAGQPILARGGFK  59

Query  345  LYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQ  521
            L      +   P   WSGR+W R GC  + HGR  CATGDC G L C G GGA PATLA+
Sbjct  60   LPPNKAYALRLP-PLWSGRLWGRHGCAFDAHGRGRCATGDCGGSLFCAGAGGAPPATLAE  118

Query  522  FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRL-RA  698
              L     D   Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR    
Sbjct  119  ITLGN---DQDFYDVSLVDGYNLAISITPSKGSGKCSYAGCVSDLNVMCPASLQVRSGDG  175

Query  699  RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS  878
            RR    VV C S C+AF +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P+S
Sbjct  176  RR----VVACKSACSAFNSPRYCCTGSFGSPQSCKPTAYSRIFKAACPKAYSYAYDDPTS  231

Query  879  LMHECSAARELKIIFC  926
            +   C+    L + FC
Sbjct  232  IA-TCTKGNYL-VTFC  245



>ref|XP_002277548.1| PREDICTED: thaumatin-like protein 1b [Vitis vinifera]
 emb|CBI37894.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 137/244 (56%), Gaps = 17/244 (7%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            L ISL AF+T  L  G   T VN C +T+WP I  N G   L+  GF L K T RSF+AP
Sbjct  13   LNISLMAFSTGVL--GATFTFVNRCEYTVWPGILANAGSARLDSTGFELPKDTSRSFLAP  70

Query  381  RARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFS  554
               WSGR W RTGC  +  G  +C TGDC  G +ECNG G A PATLA+F L  G  DF 
Sbjct  71   TG-WSGRFWGRTGCNFDGSGLGSCVTGDCGSGTIECNGAGAAPPATLAEFTLGTGGQDF-  128

Query  555  TYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS  734
             Y +SLVDG+NLPM +    G G C   GC  +L   CP +L+V        G    C S
Sbjct  129  -YDVSLVDGYNLPMIVEGSGGSGMCASTGCTVDLNQGCPAELKV--------GDGSACRS  179

Query  735  GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK  914
             C AF + E CC   Y+ P  C+ S YS+ FK ACP +++YA+D  +S    C+ A +  
Sbjct  180  ACEAFGSPEYCCSGAYSTPATCRPSVYSEMFKSACPRSYSYAYDDATSTF-TCAGA-DYT  237

Query  915  IIFC  926
            + FC
Sbjct  238  VTFC  241



>ref|XP_009391386.1| PREDICTED: thaumatin-like protein [Musa acuminata subsp. malaccensis]
Length=247

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 136/245 (56%), Gaps = 11/245 (4%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            L + L     A   +   + + N C  T+WP IQP+ G  VL RGGF L      S   P
Sbjct  8    LGVLLSVLANAGPSSAATLALYNKCRETVWPGIQPSAGKAVLARGGFQLLPNQAYSLRLP  67

Query  381  RARWSGRIWARTGCVLN--HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG-HADF  551
             A WSGR+W R GC  +   GR  CATGDC G L CNG GGA PATLA+F L QG   DF
Sbjct  68   -AGWSGRVWGRRGCAFDPATGRGRCATGDCGGALYCNGLGGAPPATLAEFTLGQGRQQDF  126

Query  552  STYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCN  731
              Y +SLVDG+NL M++TP  G G C   GC ++L   CP  L VR         VV C 
Sbjct  127  --YDVSLVDGYNLGMSMTPFRGSGQCGRAGCVSDLNEVCPAGLAVRGGTDN---RVVACK  181

Query  732  SGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAREL  911
            S C+AF +   CC  ++  P  CK + YS  FK ACP  ++YA+D P+S++  C+ A  L
Sbjct  182  SACSAFGSPRYCCTGSFGGPQQCKPTAYSRLFKAACPRAYSYAYDDPTSIL-TCTGASYL  240

Query  912  KIIFC  926
             + FC
Sbjct  241  -VTFC  244



>ref|NP_001147654.1| LOC100281263 precursor [Zea mays]
 gb|ACG28263.1| thaumatin-like protein precursor [Zea mays]
 gb|ACL54179.1| unknown [Zea mays]
 gb|AFW69212.1| putative thaumatin domain family protein [Zea mays]
Length=249

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 143/258 (55%), Gaps = 19/258 (7%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            MA+   AT L V +  S+C  + ++L       + N C  T+WP IQP+ G  VL RGG 
Sbjct  4    MALRAVATALLV-VAASVCGASASTL------VLYNRCGETVWPGIQPSAGKEVLARGGL  56

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLA  518
             L      S   P A WSGR+W R GC  +  GR  CATGDC G L C G GGA PATLA
Sbjct  57   QLAPGRSASVRLP-AGWSGRVWGRQGCSFDAAGRGRCATGDCGGALYCGGAGGAPPATLA  115

Query  519  QFELHQGHA-DFSTYGLSLVDGFNLPMTLTPHDGKG-HCPVVGCRANLLPACPRQLQVRL  692
            +  L    + DF  Y +SLVDG+N+P+ +TP  G G  C   GC ++L   CP  L VR 
Sbjct  116  EITLGTASSQDF--YDVSLVDGYNIPIAMTPVHGSGARCAAAGCVSDLNRVCPAGLAVR-  172

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
                G G VVGC S CAA+   + CC   + +P  CK + YS  FK ACP  ++YA+D P
Sbjct  173  ----GEGRVVGCRSACAAYGAPQYCCTGQFGSPQQCKPTAYSRLFKSACPKAYSYAYDDP  228

Query  873  SSLMHECSAARELKIIFC  926
            +S++  CSA     + FC
Sbjct  229  TSIL-TCSAGASYVVTFC  245



>gb|EYU37936.1| hypothetical protein MIMGU_mgv1a009447mg [Erythranthe guttata]
Length=342

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 142/257 (55%), Gaps = 17/257 (7%)
 Frame = +3

Query  162  MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            M  +F    L ++  I L  F+T +   G   T VN C +T+WP I  NTG P L+  GF
Sbjct  1    MDHSFYYIALFLSFHIFLVFFSTVAF--GATFTFVNKCQYTVWPGILANTGSPRLDSTGF  58

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLNHGR-FTCATGDC-DGRLECNGRGGAAPATL  515
             L + + R+FVAP A WSGR W RTGC  +     +C TGDC  G+ ECNG G A PATL
Sbjct  59   ELPQDSSRTFVAP-AGWSGRFWGRTGCAFSGSESVSCQTGDCGSGQAECNGSGAAPPATL  117

Query  516  AQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLR  695
            A+F L  G  DF  Y +SLVDG+NLPM +    G G C   GC  +L  ACP +L+V   
Sbjct  118  AEFTLGTGGLDF--YDVSLVDGYNLPMIVEASGGSGMCASTGCITDLNRACPSELRV---  172

Query  696  ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS  875
                 G    C S C AF + E CC   ++ P  C+ S YS  FK ACP +++YA+D P+
Sbjct  173  -----GGGEACKSACEAFGSPEYCCSGAFSTPAACRPSVYSQMFKSACPRSYSYAYDDPT  227

Query  876  SLMHECSAARELKIIFC  926
            S     SA  +  + FC
Sbjct  228  STFTCASA--DYTVTFC  242



>ref|XP_003634206.1| PREDICTED: thaumatin-like protein [Vitis vinifera]
 emb|CBI15563.3| unnamed protein product [Vitis vinifera]
Length=244

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 130/225 (58%), Gaps = 10/225 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            I++ N C H +WP IQP  G P+L RGGF L      S   P A WSGRIW R GC  + 
Sbjct  26   ISLYNKCSHPVWPGIQPGAGKPILARGGFKLPPNKAYSLHIPAA-WSGRIWGRHGCSFDA  84

Query  432  HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
            HGR  CATGDC G L CNG GG  PATLA+  L     DF  Y +SLVDG+NL +++TP 
Sbjct  85   HGRGRCATGDCGGSLFCNGMGGTPPATLAEITLGS-EQDF--YDVSLVDGYNLAISITPF  141

Query  612  DGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP  791
             G G C   GC ++L   CP  LQVR    R    VV C S C+AF +   CC  ++ +P
Sbjct  142  KGSGKCSYAGCVSDLNTMCPVGLQVRSHDNR---RVVACKSACSAFNSPRYCCTGSFGSP  198

Query  792  LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              CK + YS  FK ACP  ++YA+D P+S+   C+    L + FC
Sbjct  199  QSCKPTAYSKIFKAACPRAYSYAYDDPTSIA-TCTGGNYL-VTFC  241



>ref|XP_010441116.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=256

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/254 (43%), Positives = 134/254 (53%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M F +T L     IS C          +   + N C   IWPA+ PN+G+PVL  GGF L
Sbjct  1    MKFYSTSLLQLFIISSCIVYGKVTSHEVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                     AP   WSGRIWARTGC   ++ +  C TGDCDG LECNG  G  PATL Q 
Sbjct  61   PCGGIERIDAPWG-WSGRIWARTGCDFTSNWKQACETGDCDGHLECNGLIGKPPATLIQI  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             +       + Y +SLVDG+NLP+ +        C + GC  +L   CP +LQV      
Sbjct  120  AVQADKFKPNFYDVSLVDGYNLPVAVNSKPISSKCAISGCHKDLKTTCPEELQV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G +V C S C AF  D  CCRN Y  P  CK + YS  FK ACP+ ++YA+DTP  L+
Sbjct  176  EEGRIVACKSACLAFDNDRFCCRNAYGTPGKCKRNMYSMLFKEACPNYYSYAYDTPPPLV  235

Query  885  HECSAARELKIIFC  926
              CS A+E  I FC
Sbjct  236  -TCS-AKEYLITFC  247



>ref|XP_006405559.1| hypothetical protein EUTSA_v10027894mg [Eutrema salsugineum]
 dbj|BAJ34394.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47012.1| hypothetical protein EUTSA_v10027894mg [Eutrema salsugineum]
Length=256

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 130/228 (57%), Gaps = 8/228 (4%)
 Frame = +3

Query  246  GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCV  425
            G+   + N C   IWPA+ PN+G+PVL  GGF L     R    P   W+GR+WARTGC 
Sbjct  27   GVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYLPCGDTRRIDVPWG-WNGRVWARTGCD  85

Query  426  L-NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL  602
              ++    C TGDCDGRLECNG  G  P TL Q  +    +  + Y +SLVDG+NLP+ +
Sbjct  86   FTSNWNQACETGDCDGRLECNGLIGKPPVTLIQIAVQADKSKPNFYDVSLVDGYNLPVAV  145

Query  603  TPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY  782
                    C V+GC  +L+  CP +LQV  +     G VV C S C AF  D  CCRN Y
Sbjct  146  NSKPVSSKCVVLGCHKDLITTCPEELQVLNK----EGRVVACKSACLAFDNDRFCCRNAY  201

Query  783  NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              P  CK + YS  FK ACP+ ++YA++TP  L+  CS A+E  I FC
Sbjct  202  GTPEKCKRTTYSMLFKEACPNYYSYAYETPPPLV-TCS-AKEYLITFC  247



>gb|KDP23919.1| hypothetical protein JCGZ_27079 [Jatropha curcas]
Length=249

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 138/249 (55%), Gaps = 14/249 (6%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            ++L  TL ISL     +S      IT+ N C H +WP IQP+ G P+L RGGF L     
Sbjct  10   SLLFFTLIISLIPVEVSST----TITLYNKCTHPVWPGIQPSAGKPLLVRGGFKLLPNKA  65

Query  363  RSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
             S   P   WSGR W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L   
Sbjct  66   YSLNLP-PLWSGRFWGRHGCSFDASGRGRCATGDCGGSLYCNGLGGTPPATLAEITLGND  124

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
              DF  Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR R  R    V
Sbjct  125  Q-DF--YDVSLVDGYNLGISITPFKGSGKCSYAGCISDLNLMCPVGLQVRSRDNRR---V  178

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C S C AF +   CC  ++ NP  CK + YS  FK ACP  ++YA+D P+S+   C+ 
Sbjct  179  VACKSACFAFNSPRYCCTGSFGNPQTCKPTAYSRIFKAACPKAYSYAYDDPTSIA-TCTR  237

Query  900  ARELKIIFC  926
               L + FC
Sbjct  238  GNYL-VTFC  245



>gb|EYU24132.1| hypothetical protein MIMGU_mgv1a012513mg [Erythranthe guttata]
Length=248

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 133/231 (58%), Gaps = 14/231 (6%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            AG  +T+ N C H +WP IQP +G PVL +GGF L      +   P   WSGR+W R GC
Sbjct  26   AGTTMTLYNKCSHPVWPGIQPGSGKPVLAKGGFKLLPNKSYALQLPEG-WSGRLWGRHGC  84

Query  423  VLN---HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLP  593
              +   HGR  CATGDC G L CNG GG  PATLA+  L     DF  Y +SLVDG+NL 
Sbjct  85   SFDAAGHGR--CATGDCGGALFCNGMGGTPPATLAEITLGN-EQDF--YDVSLVDGYNLA  139

Query  594  MTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCR  773
            +++TP  G G C   GC ++L   CP  LQVR   ++    VV C S C AF +   CC 
Sbjct  140  ISITPFRGSGKCSYAGCVSDLNMMCPVGLQVRSHDKK---KVVACKSACFAFNSPRYCCT  196

Query  774  NNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             ++ NP  CK + YS  FK ACP  ++YA+D P+S+   C+ +  L + FC
Sbjct  197  GSFGNPQTCKPTAYSKIFKTACPKAYSYAYDDPTSI-STCTGSSYL-LTFC  245



>ref|XP_009785059.1| PREDICTED: thaumatin-like protein isoform X2 [Nicotiana sylvestris]
Length=247

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 132/227 (58%), Gaps = 14/227 (6%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            +T+ N C H +WP IQP+ G P+L RGGF L          P A WSGR+W R GC  + 
Sbjct  29   MTMYNRCSHPVWPGIQPSAGKPILARGGFKLLPNKAYKLSLP-AGWSGRVWGRHGCSFDA  87

Query  432  --HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
              HGR  CATGDC G L CNG GG  PATLA+  L    +D   Y +SLVDG+NL +++T
Sbjct  88   SGHGR--CATGDCGGALFCNGIGGTPPATLAEITLG---SDQDFYDVSLVDGYNLAISIT  142

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            P  GKG C   GC ++L   CP  LQV+   +R    VV C S CAAF +   CC   + 
Sbjct  143  PFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKR---QVVACKSACAAFNSPRYCCTGTFG  199

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            NP  CK + YS  FK ACP  ++YA+D P+S+   C+ +  L + FC
Sbjct  200  NPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIA-TCTGSSYL-LTFC  244



>ref|XP_009785058.1| PREDICTED: thaumatin-like protein isoform X1 [Nicotiana sylvestris]
Length=248

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 132/227 (58%), Gaps = 14/227 (6%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            +T+ N C H +WP IQP+ G P+L RGGF L          P A WSGR+W R GC  + 
Sbjct  30   MTMYNRCSHPVWPGIQPSAGKPILARGGFKLLPNKAYKLSLP-AGWSGRVWGRHGCSFDA  88

Query  432  --HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
              HGR  CATGDC G L CNG GG  PATLA+  L    +D   Y +SLVDG+NL +++T
Sbjct  89   SGHGR--CATGDCGGALFCNGIGGTPPATLAEITLG---SDQDFYDVSLVDGYNLAISIT  143

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            P  GKG C   GC ++L   CP  LQV+   +R    VV C S CAAF +   CC   + 
Sbjct  144  PFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKR---QVVACKSACAAFNSPRYCCTGTFG  200

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            NP  CK + YS  FK ACP  ++YA+D P+S+   C+ +  L + FC
Sbjct  201  NPQSCKPTAYSRIFKTACPKAYSYAYDDPTSIA-TCTGSSYL-LTFC  245



>ref|NP_177893.1| Pathogenesis-related thaumatin superfamily protein [Arabidopsis 
thaliana]
 gb|AAG51631.1|AC012193_13 thaumatin-like protein; 12104-13574 [Arabidopsis thaliana]
 gb|AEE36011.1| Pathogenesis-related thaumatin superfamily protein [Arabidopsis 
thaliana]
Length=356

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 136/226 (60%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TI+N+C  TIWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  90   VFTIINSCDQTIWPAITPGENF---NGGGFELKPGQSIVFHAPVG-WSGRIWGRTGCKFD  145

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+   G  PA+LA+F L    A    Y +SLVDGFNLPM++TP
Sbjct  146  STGTGTCETGSCGSTLKCSA-SGKPPASLAEFTL----AALDFYDVSLVDGFNLPMSVTP  200

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CP++L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  201  MNGKGNCSVAGCVADLRPHCPQELAVK-----SNGKVISCRSACDVFDRDEYCCRGVYGN  255

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P++C+ + YS  FK ACP+ ++YA+D P+S+M  C+A+ +  I FC
Sbjct  256  PVVCQPTYYSKIFKQACPTAYSYAYDDPTSIM-TCTAS-DYVISFC  299



>ref|XP_004238366.1| PREDICTED: thaumatin-like protein 1b [Solanum lycopersicum]
Length=335

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 134/245 (55%), Gaps = 10/245 (4%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LF+++     A + +    T+VN C  TIWP +  N G   L   GF L K   ++   P
Sbjct  12   LFLTITQLFIAGVNSAATFTMVNKCQQTIWPGLLSNAGIAPLSTTGFVLQKDESKTISVP  71

Query  381  RARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFS  554
             + W GR WART C  +  G+FTCATGDC  G+LEC G   A PATLA+F L  G     
Sbjct  72   TS-WGGRFWARTHCTEDSTGKFTCATGDCGSGKLECAGGNAAPPATLAEFTL-DGSNGMD  129

Query  555  TYGLSLVDGFNLPMTLTPHDGKGH-CPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCN  731
             + +SLVDG+NLPM + P  G G+ C   GC  +L  ACP +L+V        G  V C 
Sbjct  130  FFDVSLVDGYNLPMLVVPQGGSGNNCTSTGCVVDLNGACPSELKVMSLG----GENVACK  185

Query  732  SGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAREL  911
            S C AF+ DE CC   +NNP  CK S YS  FK ACPS ++YA+D  +S    C+ A   
Sbjct  186  SACEAFRKDEYCCAGAFNNPTTCKPSSYSTLFKKACPSAYSYAYDDKTSTF-TCAGANNY  244

Query  912  KIIFC  926
             I FC
Sbjct  245  LITFC  249



>ref|XP_002517440.1| Protein P21, putative [Ricinus communis]
 gb|EEF44982.1| Protein P21, putative [Ricinus communis]
Length=261

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 138/246 (56%), Gaps = 11/246 (4%)
 Frame = +3

Query  201  LFISLCAFTTASLPA---GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF  371
             F+S    +  S PA    +   + N CP  IWPA   NTG+P++  GGF L     +  
Sbjct  10   FFLSFILHSLLSGPALAHQITFYVHNKCPFPIWPATASNTGHPIIAGGGFYLPSGQTQRI  69

Query  372  VAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHAD  548
             AP   W+GRIWARTGC  N + +  C TGDCDGRL CNG  G  PATL Q  L      
Sbjct  70   DAPW-DWNGRIWARTGCNFNSNWQSACETGDCDGRLACNGLIGTPPATLVQVSLQADKTK  128

Query  549  FSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC  728
             + Y +SLVDG+NLP+ +T       C + GC  +L+ +CP +LQV        G VV C
Sbjct  129  PNFYDVSLVDGYNLPVLVTNKQLSPKCTIGGCSKSLIRSCPHELQV----VNNNGEVVAC  184

Query  729  NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE  908
             S C AF  D  CCRN++ +P  CK + YS+ FK ACP+ ++YA D+P  L++   A++E
Sbjct  185  KSACLAFNLDTFCCRNDHGSPDKCKPNVYSNIFKDACPNYYSYAFDSPPPLVN--CASKE  242

Query  909  LKIIFC  926
              I FC
Sbjct  243  YVITFC  248



>ref|XP_009341686.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=238

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 130/227 (57%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            I TI+NNC  T+WPA+ P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  22   IFTIINNCKETVWPAVTPGENF---NGGGFVLKPGQSIVFTAP-VSWSGRIWGRTGCNFD  77

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             +G  +C TG C   L+C G  G  PATLA+F L    A    Y +SLVDGFNLP+ +TP
Sbjct  78   KNGNGSCQTGSCGSALQC-GASGKPPATLAEFTL----AALDFYDVSLVDGFNLPLVVTP  132

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC  +L P CP +L V+       G  VGC S C  F TDE CCR  Y N
Sbjct  133  LNGKGNCSVSGCDGDLRPNCPNELAVK-----ANGKTVGCRSACDVFDTDEYCCRGLYGN  187

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
              +CK + YS  FK ACP+ ++YA+D P+S+   CS   +  + FC 
Sbjct  188  AAVCKPTYYSKKFKEACPTAYSYAYDDPTSIF-TCSGT-DYVVAFCS  232



>ref|XP_004235810.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=245

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 133/231 (58%), Gaps = 9/231 (4%)
 Frame = +3

Query  195  VTLFISLCAFTT-ASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF  371
            +T F+ L  FT  AS  +   +T+ N C H +WP IQP+ G P+L RGGF L        
Sbjct  6    LTPFLLLAFFTIFASHISATTMTLYNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAYRL  65

Query  372  VAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHAD  548
              P A WSGR+W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L     D
Sbjct  66   NMP-AGWSGRVWGRHGCAFDAAGRGRCATGDCGGSLFCNGIGGTPPATLAEITLGN-EQD  123

Query  549  FSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC  728
            F  Y +SLVDG+NL +++TP  GKG C   GC ++L   CP  LQVR      +  VV C
Sbjct  124  F--YDVSLVDGYNLAISVTPVRGKGKCSYAGCVSDLNTMCPAGLQVR---SHDKSQVVAC  178

Query  729  NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
             S C+AF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S+
Sbjct  179  KSACSAFNSPRYCCTGTFGNPQTCKPTAYSRIFKTACPKAYSYAYDDPTSI  229



>ref|XP_010471966.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=279

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 141/243 (58%), Gaps = 18/243 (7%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LF++  + T  S  A  + TIVN+C   IWPAI P   +     GGF L       F AP
Sbjct  14   LFLTFLSGTKWSESA-RVFTIVNSCDQKIWPAITPGENF---NGGGFELKPGQSIVFTAP  69

Query  381  RARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST  557
               WSGRIW RTGC  +  G  TC TG C   L+C+  G   PA+LA+F L     DF  
Sbjct  70   VG-WSGRIWGRTGCKFDSTGTGTCETGSCGSTLKCSASG-KPPASLAEFTL--AAVDF--  123

Query  558  YGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG  737
            Y +SLVDGFNLPM +TP +GKG+C V GC A+L P CP +L V+       G V+ C S 
Sbjct  124  YDVSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSELAVK-----SNGKVISCRSA  178

Query  738  CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI  917
            C  F  DE CCR  Y NP++C+ + YS  FK ACP+ ++YA+D P+S+   CSA+  + I
Sbjct  179  CDVFDRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIF-TCSASDYI-I  236

Query  918  IFC  926
             FC
Sbjct  237  SFC  239



>ref|XP_008463807.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=250

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 141/249 (57%), Gaps = 11/249 (4%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            +++++TL+ +L A   + L +   IT+ N C H +WP IQP+ G P+L RGGF L     
Sbjct  8    SLVALTLY-TLFASHISVLVSATTITLYNKCSHPVWPGIQPSAGKPLLARGGFKLPPNKA  66

Query  363  RSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
             +   P A WSGR W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L   
Sbjct  67   YTLQLP-ALWSGRFWGRHGCAFDASGRGKCATGDCGGALFCNGIGGTPPATLAEITLGND  125

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
              DF  Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR    R    V
Sbjct  126  Q-DF--YDVSLVDGYNLAISITPSKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNR---RV  179

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C S C AF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   C+ 
Sbjct  180  VACKSACFAFNSPRYCCTGRFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIA-TCTG  238

Query  900  ARELKIIFC  926
               L + FC
Sbjct  239  GNYL-VTFC  246



>ref|XP_007215905.1| hypothetical protein PRUPE_ppa010781mg [Prunus persica]
 gb|EMJ17104.1| hypothetical protein PRUPE_ppa010781mg [Prunus persica]
Length=236

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 124/227 (55%), Gaps = 8/227 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +   I N CP  IWPA  PN G PV+  GGF L     R   AP + W+GRIWARTGC  
Sbjct  5    VTFDIRNKCPFPIWPATAPNNGQPVIADGGFYLPAGQTRRISAPWS-WNGRIWARTGCNF  63

Query  429  -NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
             ++    C TGDCDGRL CNG  G  P TL Q  L       + Y +SLVDG+NLP+ + 
Sbjct  64   ASNWNPACETGDCDGRLACNGLIGTPPVTLVQVSLQGDKDRPNFYDVSLVDGYNLPVAVL  123

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
                  +C + GC  NL   CP +L+V       +G VV C S C AF TD  CCRN Y 
Sbjct  124  SKPVASNCGIGGCLKNLKSWCPEELKVL----NSKGEVVACKSACLAFNTDPFCCRNEYG  179

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK S YS  FK ACPS ++YA+D+P  L+     + E  I FC
Sbjct  180  TPAKCKPSVYSKIFKDACPSYYSYAYDSPPPLVT--CKSSEYVITFC  224



>ref|XP_010554023.1| PREDICTED: thaumatin-like protein [Tarenaya hassleriana]
Length=258

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 132/243 (54%), Gaps = 8/243 (3%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            L IS C          +   + N CP  IWPAI PN+G+PVL  GGF L     R    P
Sbjct  14   LIISSCMLYGKVASHEVTFYVHNRCPFPIWPAIAPNSGHPVLASGGFFLPCGDSRRIDIP  73

Query  381  RARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST  557
               W+GR+WARTGC  + +    C TGDCDGRLECNG  G  P TL Q  +    +  + 
Sbjct  74   WG-WNGRLWARTGCNFDSNWNQACETGDCDGRLECNGMIGKPPVTLIQLAVQSDRSKPNF  132

Query  558  YGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG  737
            Y +SLVDG+N+P+ +        C + GC+ +L   CP +L+V  +     G VV C S 
Sbjct  133  YDVSLVDGYNIPVAVNSKPVSSKCTISGCQKDLKGTCPDELEVLNK----EGKVVACKSA  188

Query  738  CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI  917
            C AF  D  CCRN+Y  P  C+ + YS  FK ACP+ ++YA+DTP  L+     A+E  +
Sbjct  189  CLAFDNDRFCCRNSYGTPEKCRPNTYSTMFKEACPNYYSYAYDTPPPLVT--CFAKEYVV  246

Query  918  IFC  926
             FC
Sbjct  247  TFC  249



>ref|XP_008341518.1| PREDICTED: thaumatin-like protein isoform X2 [Malus domestica]
 ref|XP_008341519.1| PREDICTED: thaumatin-like protein isoform X2 [Malus domestica]
Length=236

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 124/223 (56%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC-VLNHG  437
            I N CP  IWPA  PNTG PV+  GGF L     +   AP + WSGRIWARTGC  +++ 
Sbjct  9    IQNKCPFPIWPATAPNTGEPVIADGGFFLPAGHTQPITAPWS-WSGRIWARTGCDFVSNC  67

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
            +  C TGDC GRL CNG  G  P TL +  L       + Y +S+VDG+NLP+ +     
Sbjct  68   KPACETGDCGGRLACNGLIGNPPVTLVEVSLQDDKGKPNFYAVSVVDGYNLPVAILSRPA  127

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
              +C V GC  +L   CP +L+V        G VV C S C AF TD  CCRN Y  P  
Sbjct  128  ASNCAVRGCLKDLKTCCPDELKVL----NDEGEVVACKSACLAFDTDSFCCRNKYGTPEK  183

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK S YS  FK ACPS ++YA+D+P  L+     A E  I FC
Sbjct  184  CKPSVYSKIFKDACPSYYSYAYDSPPPLVT--CKASEYVITFC  224



>ref|XP_008341517.1| PREDICTED: thaumatin-like protein isoform X1 [Malus domestica]
Length=260

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/250 (43%), Positives = 133/250 (53%), Gaps = 12/250 (5%)
 Frame = +3

Query  192  SVTLFISLCAFTTASLPAGLIITIV----NNCPHTIWPAIQPNTGYPVLERGGFALYKLT  359
            SV  F  L  +T      G+  T+     N CP  IWPA  PNTG PV+  GGF L    
Sbjct  6    SVAAFFLLLLWTFMLFGQGMAHTVTFYIQNKCPFPIWPATAPNTGEPVIADGGFFLPAGH  65

Query  360  HRSFVAPRARWSGRIWARTGC-VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ  536
             +   AP + WSGRIWARTGC  +++ +  C TGDC GRL CNG  G  P TL +  L  
Sbjct  66   TQPITAPWS-WSGRIWARTGCDFVSNCKPACETGDCGGRLACNGLIGNPPVTLVEVSLQD  124

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
                 + Y +S+VDG+NLP+ +       +C V GC  +L   CP +L+V        G 
Sbjct  125  DKGKPNFYAVSVVDGYNLPVAILSRPAASNCAVRGCLKDLKTCCPDELKVL----NDEGE  180

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
            VV C S C AF TD  CCRN Y  P  CK S YS  FK ACPS ++YA+D+P  L+    
Sbjct  181  VVACKSACLAFDTDSFCCRNKYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPPLVT--C  238

Query  897  AARELKIIFC  926
             A E  I FC
Sbjct  239  KASEYVITFC  248



>ref|XP_010933189.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=241

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 128/227 (56%), Gaps = 14/227 (6%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
             T  NNCP+T+WP IQ N   P   + GF L      S  AP + W+GR+W RTGC  + 
Sbjct  25   FTFQNNCPNTVWPGIQNNPNVPAFPQTGFELGASASNSITAP-SNWAGRMWGRTGCSTDA  83

Query  432  HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLT  605
             GRFTC TGDC  G++ CNG GGA PA+L +F L   G  DF  Y +SLVDGFNLP+++ 
Sbjct  84   SGRFTCQTGDCGTGQVACNGNGGAPPASLLEFTLQGDGGKDF--YDVSLVDGFNLPVSIA  141

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            P  G   C    C AN+   CP  LQ+ +      G VVGC S C AF  D+ CC   YN
Sbjct  142  PQ-GVSGCTTTSCSANINSQCPAVLQLTVS-----GAVVGCKSACLAFNQDQYCCTGPYN  195

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
                CK + YS+FFK  CP  ++YA D  SS    C+ A  L I FC
Sbjct  196  TSQTCKPTSYSEFFKSECPQAYSYAFDDSSSTF-TCTGANYL-ITFC  240



>ref|XP_007046679.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOX90836.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=317

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/250 (44%), Positives = 138/250 (55%), Gaps = 21/250 (8%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            T LS  L + L   T A+       T +N C +T+WP I  N G P LE  GF L K + 
Sbjct  13   TFLSFILVLFLEGVTAATF------TFINKCDYTVWPGILANPGSPKLESTGFELTKGSS  66

Query  363  RSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQ  536
            RSF AP   W+GR W RTGC  +  G  +CATGDC  G +ECNG G   PATLA+F L  
Sbjct  67   RSFQAPTG-WAGRFWGRTGCNFDDSGHGSCATGDCGSGEVECNGAGAIPPATLAEFTLGS  125

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
            G  DF  Y +SLVDG+NLPM +    G G C + GC ++L   CP +L++      G G 
Sbjct  126  GSQDF--YDVSLVDGYNLPMIVEGSGGSGECAITGCVSDLNKKCPSELRID-----GGG-  177

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
               C S C AF   E CC   +N+P  CK S YS+ FK ACP +++YA D  +S    C+
Sbjct  178  --ACKSACDAFGNPEYCCSGAFNSPAACKPSMYSEVFKSACPKSYSYAFDDATSTF-TCT  234

Query  897  AARELKIIFC  926
             A +  I FC
Sbjct  235  GA-DYSITFC  243



>ref|XP_007141088.1| hypothetical protein PHAVU_008G166500g [Phaseolus vulgaris]
 gb|ESW13082.1| hypothetical protein PHAVU_008G166500g [Phaseolus vulgaris]
Length=286

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 142/255 (56%), Gaps = 18/255 (7%)
 Frame = +3

Query  168  MAF-PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA  344
            MAF P TI  +T  ++L            + TIVN C  T+WPA+ P   +   + GGF 
Sbjct  1    MAFYPQTIFPITFLLALLLSGQKPCECARVFTIVNYCKETLWPAVTPGEKF---DGGGFV  57

Query  345  LYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQ  521
            L       F AP   WSGRIWARTGC  +  G+  C TG C   L+C G  G  PA+LA+
Sbjct  58   LKPGQSEVFTAP-VSWSGRIWARTGCKFDQNGKGQCQTGSCGDTLKC-GASGKTPASLAE  115

Query  522  FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRAR  701
            F L Q   DF  Y +SLVDGFN+P+ + P +GKG+C   GC ++L   CP +L     A 
Sbjct  116  FTLAQ--PDF--YDVSLVDGFNVPIAVRPINGKGNCSSAGCDSDLRTTCPNEL-----AL  166

Query  702  RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
            +  G  VGC S C  F TDE CCR  Y NP  CK + YS  FK ACP++++YA+D P+S+
Sbjct  167  KANGKTVGCRSACDVFNTDEYCCRGLYGNPSTCKPTFYSKKFKEACPTSYSYAYDDPTSI  226

Query  882  MHECSAARELKIIFC  926
               CS   +  I FC
Sbjct  227  F-TCSGT-DYVIAFC  239



>ref|XP_007036794.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOY21295.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=275

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 124/210 (59%), Gaps = 8/210 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            IT  N CPH +WP IQP+ G P+L RGGF L      S   P   WSGR W R GC  + 
Sbjct  56   ITFYNKCPHPVWPGIQPSAGKPLLARGGFKLPPNKAYSMRLP-PLWSGRFWGRHGCSFDA  114

Query  432  HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
             GR  CATGDC G L CNG GGA PATLA+  L Q   DF  Y +SLVDG+N+ M++TP 
Sbjct  115  SGRGRCATGDCGGSLFCNGLGGAPPATLAEITLGQ-EQDF--YDVSLVDGYNIAMSITPF  171

Query  612  DGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP  791
             G G C   GC ++L   CP  LQVR R  +    V+ C S C AF +   CC  ++ +P
Sbjct  172  KGSGKCSYAGCVSDLNLMCPVGLQVRSRDNKR---VLACKSACFAFNSPRYCCTGSFGSP  228

Query  792  LMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
              CK + YS  FK ACP  ++YA+D P+S+
Sbjct  229  QSCKPTAYSKIFKAACPKAYSYAYDDPTSI  258



>ref|XP_010428854.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=279

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 133/226 (59%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C   IWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCDQKIWPAITPGENF---NGGGFELKPGQSIVFTAPVG-WSGRIWGRTGCKFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L     DF  Y +SLVDGFNLPM +TP
Sbjct  86   STGTGTCETGSCGSTLKCSASG-KPPASLAEFTL--AAVDF--YDVSLVDGFNLPMAVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CP +L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  141  MNGKGNCSVAGCVADLRPHCPSELAVK-----SNGKVISCRSACDVFDRDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P++C+ + YS  FK ACP+ ++YA+D P+S+   CSAA  + I FC
Sbjct  196  PVVCQPTYYSKIFKQACPTAYSYAYDDPTSIF-TCSAADYI-ISFC  239



>ref|XP_010090318.1| hypothetical protein L484_024983 [Morus notabilis]
 gb|EXB39288.1| hypothetical protein L484_024983 [Morus notabilis]
Length=365

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 142/250 (57%), Gaps = 20/250 (8%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            T+LS+ +F+      T +  +    T VN C +T+WP I  N G P L+  GF L K T 
Sbjct  12   TVLSLIVFL-----LTPTGVSAATFTFVNRCDYTVWPGILANAGSPRLDSTGFELPKDTS  66

Query  363  RSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQ  536
            RSF+AP   WSGR WARTGC  +  G  +C TGDC  G++ECNG G A PATLA+F L  
Sbjct  67   RSFLAPTG-WSGRFWARTGCTFDESGSGSCLTGDCGSGQMECNGAGAAPPATLAEFTLGT  125

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
            G  DF  Y +SLVDG+NLPM +    G G C   GC  +L   CP +L+V      G G 
Sbjct  126  GGQDF--YDVSLVDGYNLPMFVEGSGGSGVCASTGCSTDLNRQCPAELRV------GNGD  177

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
               C S C AF + E CC   Y +P  C+ S YS+ FK ACP +++YA+D  +S    C+
Sbjct  178  A--CKSACEAFGSPEYCCSGAYGSPDTCRPSVYSEMFKAACPRSYSYAYDDATSTF-TCT  234

Query  897  AARELKIIFC  926
             A +  I FC
Sbjct  235  GA-DYTITFC  243



>ref|XP_010029259.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW56146.1| hypothetical protein EUGRSUZ_I01898 [Eucalyptus grandis]
Length=268

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 127/223 (57%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL-NHG  437
            + N C   +WPA  PNTG PV+  GGF L   T   F AP + W+GRIWARTGC   ++ 
Sbjct  34   VHNKCQFPVWPATAPNTGQPVIADGGFYLPPGTIHRFSAPPS-WAGRIWARTGCRFGSNW  92

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
               C TGDCDGRL C G  G  PATL Q  L   +   S Y +SLVDG+N+P+++     
Sbjct  93   HPACETGDCDGRLACGGLSGTPPATLVQVSLPADNDQPSFYDISLVDGYNIPISVESKPA  152

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
               C + GC  NL   CP +LQV      G G VV C S C AF  D+ CCRN Y  P  
Sbjct  153  WPKCGIPGCSKNLNDVCPAELQV----VNGEGKVVACKSACLAFNADKFCCRNQYGTPEK  208

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK S YS  FK ACP  ++YA+D+P+ L+    A+++  I FC
Sbjct  209  CKPSVYSWIFKDACPCYYSYAYDSPAPLVS--CASKDYVITFC  249



>ref|XP_010066268.1| PREDICTED: thaumatin-like protein 1b [Eucalyptus grandis]
 gb|KCW64116.1| hypothetical protein EUGRSUZ_G01772 [Eucalyptus grandis]
Length=348

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 137/242 (57%), Gaps = 15/242 (6%)
 Frame = +3

Query  207  ISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRA  386
            ++LC    +   +G   T VN C +T+WP I  N G P L+  GF L   + R+F AP  
Sbjct  20   LALCLLIISRGASGATFTFVNRCQYTVWPGILANAGSPTLDSTGFELPSDSSRAFQAPTG  79

Query  387  RWSGRIWARTGCVLNHG-RFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTY  560
             WSGR W RTGC  +     TC TGDC  G+LECNG G A PATLA+F L  G  DF  Y
Sbjct  80   -WSGRFWGRTGCSFDGSLSGTCLTGDCGSGQLECNGLGAAPPATLAEFTLGSGGQDF--Y  136

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
             +SLVDG+NLPM +    G G C   GC A+L   CP +L+V      G G    C S C
Sbjct  137  DVSLVDGYNLPMLIEGSGGSGACASTGCSADLNRQCPAELRV------GEGDA--CKSAC  188

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF + E CC   YN+P+ C+ + YS+ FK ACP +++YA+D  SS    C+ A +  + 
Sbjct  189  EAFGSPEYCCSGAYNSPVTCRPTVYSEMFKSACPRSYSYAYDDASSTF-TCTGA-DYTVT  246

Query  921  FC  926
            FC
Sbjct  247  FC  248



>ref|XP_010033498.1| PREDICTED: thaumatin-like protein 1b [Eucalyptus grandis]
 gb|KCW53163.1| hypothetical protein EUGRSUZ_J02446 [Eucalyptus grandis]
 gb|KCW53164.1| hypothetical protein EUGRSUZ_J02446 [Eucalyptus grandis]
Length=337

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 137/247 (55%), Gaps = 15/247 (6%)
 Frame = +3

Query  192  SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF  371
            S+T+  SL   + +   +G   T VN C  ++WP I  + G P L   GF L K   RSF
Sbjct  10   SLTVLSSLVVLSISRGASGATFTFVNKCDFSVWPGILSSAGSPKLASTGFELSKGGSRSF  69

Query  372  VAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHA  545
             AP   WSGR W R+GC  +  GR +CATGDC  G +ECNG G   PATLA+F L  G  
Sbjct  70   QAPTG-WSGRFWGRSGCDFDDSGRGSCATGDCGSGEVECNGAGATPPATLAEFTLGSGSL  128

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            DF  Y +SLVDG+NLPM +      G C   GC+ +L   CP++L    +A  G     G
Sbjct  129  DF--YDVSLVDGYNLPMIVQGTSESGACATTGCQTDLNLQCPKEL----KAEDG----TG  178

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C S C AF + E CC   Y++P  CK S YS  FK ACP +++YA+D  +S    CS A 
Sbjct  179  CKSACEAFGSPEYCCSGPYSSPATCKPSMYSQIFKTACPKSYSYAYDDATSTFT-CSDA-  236

Query  906  ELKIIFC  926
            +  I FC
Sbjct  237  DYTITFC  243



>ref|XP_006435193.1| hypothetical protein CICLE_v10001885mg [Citrus clementina]
 gb|ESR48433.1| hypothetical protein CICLE_v10001885mg [Citrus clementina]
Length=317

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 130/227 (57%), Gaps = 10/227 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
             T++N C HT+WP I  N   P L   GF L K   ++  AP A W GR+WART C  + 
Sbjct  25   FTMINKCDHTVWPGILSNADSPALSTTGFPLEKGETKTLNAP-ASWGGRMWARTLCSQDS  83

Query  435  -GRFTCATGDCDGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTP  608
             G+FTC TGDC G+LEC+G G A PATLA+F+L   G  DF  Y +SLVDG+NLP+ + P
Sbjct  84   TGKFTCVTGDCGGKLECSGSGAAPPATLAEFKLDGYGGQDF--YDVSLVDGYNLPVLVVP  141

Query  609  HDGKG-HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
              G G +C   GC  +L  ACP +L+V      G    V C S C AF+  + CC   ++
Sbjct  142  QGGDGPNCTSTGCVVDLNAACPSELKVMTDGGSGG---VACKSACEAFRQPQYCCNGAFS  198

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK S YS  FK ACP  ++YA+D  SS    C +  +  I FC
Sbjct  199  TPDTCKPSTYSQIFKSACPHAYSYAYDDKSSTF-TCGSGPDYTITFC  244



>ref|NP_001058421.1| Os06g0691200 [Oryza sativa Japonica Group]
 dbj|BAD45633.1| putative thaumatin-protein [Oryza sativa Japonica Group]
 dbj|BAD54510.1| putative thaumatin-protein [Oryza sativa Japonica Group]
 dbj|BAF20335.1| Os06g0691200 [Oryza sativa Japonica Group]
 dbj|BAG98320.1| unnamed protein product [Oryza sativa Japonica Group]
Length=251

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 129/226 (57%), Gaps = 6/226 (3%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
            + + N C  T+WP IQP+ G  +L RGGF L      S   P A WSGR+W R GC  + 
Sbjct  26   LALYNRCAETVWPGIQPSAGKELLARGGFQLAPNRATSIRLP-AGWSGRVWGRQGCSFDA  84

Query  435  -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
             GR  CATGDC G L CNG GGA PATLA+  L    A    Y +SLVDG+N+P+ +TP 
Sbjct  85   AGRGRCATGDCGGALYCNGAGGAPPATLAEITLASTPAAQDFYDVSLVDGYNIPIAMTPS  144

Query  612  DGKG-HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             G G +C   GC ++L   CP  L VR      R  VVGC S CAA+   + CC   + +
Sbjct  145  HGSGANCVPAGCISDLNRVCPAGLAVRGGGGDNR--VVGCRSACAAYGAPQYCCTGQFGS  202

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  CK + YS  FK ACP  ++YA+D P+S++  CSA     + FC
Sbjct  203  PQQCKPTAYSRLFKTACPKAYSYAYDDPTSIL-TCSAGASYIVTFC  247



>ref|XP_008803423.1| PREDICTED: thaumatin-like protein [Phoenix dactylifera]
Length=257

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 133/230 (58%), Gaps = 10/230 (4%)
 Frame = +3

Query  246  GLIIT--IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTG  419
            G ++T  I N CP  IWPA  PN G+PV+  GGF L     +   AP   W+GR WARTG
Sbjct  25   GQLVTFHISNKCPFPIWPAAAPNAGHPVIADGGFFLPPGQTKRVYAP-PTWNGRFWARTG  83

Query  420  CVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPM  596
            C  N   +  C TGDC+  L CNG  G  PATL +  L +  +  S Y +S+VDG+NLP+
Sbjct  84   CNFNSTSKPVCQTGDCESLLSCNGTIGMPPATLVEVALQEDKSKPSFYDVSVVDGYNLPI  143

Query  597  TLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRN  776
            +++       C + GC  ++   CP +LQV  ++    G ++ C S C AF  D  CCRN
Sbjct  144  SVSTKPADRKCWIGGCTKSINSVCPPELQVLDQS----GGIIACKSACLAFNLDVFCCRN  199

Query  777  NYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            +Y  P  CKAS YS  FK ACPS F+YA+DTPS L++    +++  I FC
Sbjct  200  SYGKPEKCKASMYSKMFKDACPSYFSYAYDTPSPLVN--CYSKDYVITFC  247



>gb|KDP29626.1| hypothetical protein JCGZ_18788 [Jatropha curcas]
Length=346

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 131/230 (57%), Gaps = 15/230 (7%)
 Frame = +3

Query  243  AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC  422
            +G   T VN C +T+WP I  N G P L+  GF L K T RSF AP   WSGR WARTGC
Sbjct  22   SGATFTFVNRCEYTVWPGILANAGSPRLDSTGFELPKDTSRSFQAPTG-WSGRFWARTGC  80

Query  423  VLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPM  596
              +  G   C TGDC  G++ECNG G A PATLA+F L  G  DF  Y +SLVDG+NLPM
Sbjct  81   NFDDSGSGFCLTGDCGSGQVECNGLGAAPPATLAEFTLGTGGQDF--YDVSLVDGYNLPM  138

Query  597  TLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRN  776
             +    G G C   GC A+L   CP +L+V        G    C S C AF + E CC  
Sbjct  139  VVDGSGGSGMCASTGCSADLNRQCPAELKV--------GDGDACKSACEAFGSPEYCCSG  190

Query  777  NYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             +N P  CK S YS+ FK ACP +++YA+D  +S    C+ A +  + FC
Sbjct  191  AFNTPSTCKPSVYSEMFKAACPRSYSYAYDDATSTF-TCTGA-DYTVTFC  238



>ref|XP_002532822.1| Protein P21, putative [Ricinus communis]
 gb|EEF29561.1| Protein P21, putative [Ricinus communis]
Length=248

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 132/236 (56%), Gaps = 10/236 (4%)
 Frame = +3

Query  222  FTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGR  401
            F+  S  +   IT+ N C H +WP IQP+ G P+L RGGF L      S   P   WSGR
Sbjct  18   FSHISEVSSTTITLYNKCTHPVWPGIQPSAGKPLLARGGFKLPPNKAYSLKLP-PLWSGR  76

Query  402  IWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVD  578
             W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L     DF  Y +SLVD
Sbjct  77   FWGRHGCSFDGSGRGRCATGDCGGALFCNGIGGTPPATLAEITLGNDQ-DF--YDVSLVD  133

Query  579  GFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTD  758
            G+NL M++TP  G G C   GC ++L   CP  LQVR +  R    VV C S C+AF + 
Sbjct  134  GYNLAMSITPFKGSGKCSYAGCVSDLNLMCPVGLQVRSKDNRR---VVACKSACSAFNSP  190

Query  759  ELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   C+    L + FC
Sbjct  191  RYCCTGKFGNPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIA-TCTRGNYL-VTFC  244



>gb|AAK63884.1|AC074105_13 Putative thaumatin-like protein [Oryza sativa]
 gb|AAP52110.1| Thaumatin-like protein 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
Length=325

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 140/259 (54%), Gaps = 13/259 (5%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M+  ++ L   +F+++     A        TI NNC +T+WP +  + G   L   GFAL
Sbjct  8    MSSRSSSLLAMVFVAVAVLARAQDERAATFTITNNCAYTVWPGLLSSAGSAPLSTTGFAL  67

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHG--RFTCATGDC-DGRLECNGRGGAAPATLA  518
                 ++  AP   WSGR+W RT C  +    +F+CATGDC  G ++CNG G A PATLA
Sbjct  68   APGASQAVPAPSG-WSGRMWGRTLCAADGAGAKFSCATGDCGSGDVQCNGGGAAPPATLA  126

Query  519  QFELH-QGHADFSTYGLSLVDGFNLPMTLTPH--DGKGHCPVVGCRANLLPACPRQLQVR  689
            +F L   G  DF  + +SLVDG+NLPM +TP    G G C   GC A L  ACP  L+V 
Sbjct  127  EFTLDGSGGLDF--FDVSLVDGYNLPMLVTPSATSGSGKCAATGCVAELNGACPADLRVA  184

Query  690  LRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDT  869
                   GP V C S C AF + E CC   Y NP  C+ S YS+FFK ACP  ++YA+D 
Sbjct  185  ----SASGPAVACRSACEAFGSAEYCCSGAYGNPNTCRPSAYSEFFKAACPRAYSYAYDD  240

Query  870  PSSLMHECSAARELKIIFC  926
             +S     + A +  I FC
Sbjct  241  STSTFTCAAGATDYAITFC  259



>ref|XP_006341532.1| PREDICTED: thaumatin-like protein-like [Solanum tuberosum]
Length=247

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 132/233 (57%), Gaps = 11/233 (5%)
 Frame = +3

Query  195  VTLFISLCAFTTASL---PAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            +TLF+ L  FT  +     +   +T+ N C H +WP IQP+ G P+L RGGF L      
Sbjct  6    LTLFLVLAFFTIFASHISVSATTMTLFNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAY  65

Query  366  SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
                P   WSGR+W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L    
Sbjct  66   RLSMPVG-WSGRVWGRHGCAFDATGRGRCATGDCGGSLFCNGIGGTPPATLAEITLGN-E  123

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+NL +++TP  GKG C   GC ++L   CP  LQVR      +  VV
Sbjct  124  QDF--YDVSLVDGYNLAISVTPVRGKGKCSYAGCVSDLNTMCPAGLQVR---SHDKSQVV  178

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
             C S C+AF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S+
Sbjct  179  ACKSACSAFNSPRYCCTGTFGNPQTCKPTAYSRIFKTACPKAYSYAYDDPTSI  231



>ref|XP_010435956.1| PREDICTED: thaumatin-like protein [Camelina sativa]
Length=256

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 133/254 (52%), Gaps = 8/254 (3%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M   +T L     IS C          +   + N C   IWPA+ PN+G+PVL  GGF L
Sbjct  1    MKVYSTSLLQLFIISSCIVYGKVTSHEVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYL  60

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVL-NHGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                     AP   WSGRIWARTGC   ++ +  C TGDCDG LECNG  G  PATL Q 
Sbjct  61   PCGGIEHIDAPWG-WSGRIWARTGCDFTSNWKQACETGDCDGHLECNGLIGKPPATLIQI  119

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             +       + Y +SLVDG+NLP+ +        C + GC  +L   CP +LQV      
Sbjct  120  AVQADKFKPNFYDVSLVDGYNLPVAVNSKPISSKCAISGCHKDLKTTCPEELQV----LN  175

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G +V C S C AF  D  CCRN Y  P  CK + YS  FK ACP+ ++YA+DTP  L+
Sbjct  176  EEGRIVACKSACLAFDNDRFCCRNAYGTPGKCKRNMYSMLFKEACPNYYSYAYDTPPPLV  235

Query  885  HECSAARELKIIFC  926
              CS A+E  I FC
Sbjct  236  -TCS-AKEYLITFC  247



>ref|XP_010272178.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=258

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 126/223 (57%), Gaps = 8/223 (4%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL-NHG  437
            I N CP  IWPA   N G+PV+  GGF L     R   AP   W+GRIWARTGC   +  
Sbjct  33   IHNKCPFPIWPATASNAGHPVIADGGFYLPSGQTRRVTAPDT-WNGRIWARTGCNFASSS  91

Query  438  RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG  617
            +  C TGDC+GRL C+G  G  PATL +  L    +  S Y +SLVDG+NLP++++    
Sbjct  92   KPACQTGDCEGRLACSGSIGLPPATLVEVSLQPDKSKPSFYDVSLVDGYNLPVSVSAKPF  151

Query  618  KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM  797
              +C + GC  NL   CP +LQV        G VV C S C AF  D  CCRN Y +P  
Sbjct  152  ASNCSITGCLKNLNSLCPSELQV----LNASGQVVACKSACLAFDLDVFCCRNAYGSPEK  207

Query  798  CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            CK++ YSD FK ACPS F+YA DTP  L+     ++   I FC
Sbjct  208  CKSNMYSDMFKDACPSYFSYAFDTPPPLVR--CTSQVYVITFC  248



>ref|XP_007202291.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
 gb|EMJ03490.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
Length=306

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 133/242 (55%), Gaps = 15/242 (6%)
 Frame = +3

Query  207  ISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRA  386
            I+L     A    G   T  N C  T+WP I  + G P L+  GF L K + RSF AP  
Sbjct  9    ITLLLLIIAKGVTGATFTFTNKCDFTVWPGILASAGTPKLDSTGFELAKGSTRSFQAPTG  68

Query  387  RWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTY  560
             WSGR W RTGC  +  G  +C+TGDC  G+LECNG G A PATLA+F L  G  DF  Y
Sbjct  69   -WSGRFWGRTGCNFDGSGHGSCSTGDCGSGQLECNGAGAAPPATLAEFTLGSGSQDF--Y  125

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
             +SLVDG+NLPM +    G G C   GC  +L   CP +L+V      G G    C S C
Sbjct  126  DVSLVDGYNLPMIVEGSGGSGTCASTGCATDLNRRCPAELKVD-----GGGA---CKSAC  177

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF + E CC  +Y +P  CK S YS  FK ACP +++YA+D  SS    C+ A +  I 
Sbjct  178  DAFGSPEYCCNGDYGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTF-TCTGA-DYTIT  235

Query  921  FC  926
            FC
Sbjct  236  FC  237



>ref|XP_009335804.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=260

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 137/256 (54%), Gaps = 11/256 (4%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIIT--IVNNCPHTIWPAIQPNTGYPVLERGGF  341
            M  P ++ +  LF+ L  F          +T  I N CP  IWPA  PNTG PV+  GGF
Sbjct  1    MKLPDSVAAFFLFL-LWTFMLFGQGMAHTVTFYIQNKCPFPIWPATAPNTGQPVIADGGF  59

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGC-VLNHGRFTCATGDCDGRLECNGRGGAAPATLA  518
             L     +   AP + WSGRIWARTGC  +++ +  C TGDC GRL CNG  G  P TL 
Sbjct  60   FLPAGHTQPITAPWS-WSGRIWARTGCDFVSNCKPACETGDCGGRLACNGLIGNPPVTLV  118

Query  519  QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRA  698
            +  L       + Y +S+VDG+NLP+ ++      +C V GC  +L   CP +L+V    
Sbjct  119  EVSLQGDKGKPNFYAVSVVDGYNLPVAISSRPVASNCAVRGCLKDLKTWCPDELKVL---  175

Query  699  RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS  878
                G VV C S C AF TD  CCRN Y  P  CK S YS  FK ACPS ++YA+D+P  
Sbjct  176  -NDEGEVVACKSACLAFDTDSFCCRNKYGTPEKCKPSVYSKIFKDACPSYYSYAYDSPPP  234

Query  879  LMHECSAARELKIIFC  926
            L+     A E  I FC
Sbjct  235  LVT--CKASEYVITFC  248



>ref|XP_002534154.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF28230.1| Zeamatin precursor, putative [Ricinus communis]
Length=338

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 129/226 (57%), Gaps = 15/226 (7%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
             T VN C +T+WP I  N G P L+  GF L K T RSF AP   WSGR WARTGC  + 
Sbjct  26   FTFVNRCEYTVWPGILANAGSPRLDTTGFELPKDTSRSFQAPTG-WSGRFWARTGCAFDD  84

Query  435  -GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             G  +C TGDC  G +ECNG G A PATLA+F L  G  DF  Y +SLVDG+NLPM +  
Sbjct  85   SGSGSCLTGDCGSGLVECNGLGAAPPATLAEFTLGSGGQDF--YDVSLVDGYNLPMLVEG  142

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
              G G C   GC A+L   CP +L+V        G    C S C AF + E CC   +N 
Sbjct  143  SGGSGMCASTGCSADLNRQCPAELKV--------GGGDACKSACEAFGSPEYCCSGAFNT  194

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  CK S YS+ FK ACP +++YA+D  +S    C+ A +  + FC
Sbjct  195  PATCKPSVYSEMFKSACPRSYSYAYDDATSTF-TCTGA-DYTVTFC  238



>ref|XP_010257784.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=235

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 137/242 (57%), Gaps = 12/242 (5%)
 Frame = +3

Query  204  FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR  383
            ++ L    + S     + T+ NNC  TIWP IQP+ G P LE GGF L      S  AP 
Sbjct  5    YLQLFFLLSVSGAKATVFTLNNNCRKTIWPGIQPSAGKPDLEAGGFPLKPGETVSISAPA  64

Query  384  ARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTY  560
            A WSGR W R  C  +  G+ +C TGDC G L C+G GGA P TLA+F L+    D+  Y
Sbjct  65   A-WSGRFWGRRSCSFDPSGKGSCITGDCGGLLACSGMGGAPPVTLAEFTLNSPD-DY--Y  120

Query  561  GLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC  740
             +SLVDG+N+ +++TP  G G C    C ++L   CP  LQV+ + R     VV C S C
Sbjct  121  DISLVDGYNMAVSITPSGGSGECKPARCVSDLNQICPTNLQVKRKKR-----VVACESAC  175

Query  741  AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII  920
             AF   E CC  +Y++P  CK + YS  FK ACPS ++YA+D  SSL   C+ A  L I 
Sbjct  176  MAFNRPEYCCTGDYSSPDKCKPTNYSRVFKAACPSAYSYAYDDQSSL-RTCNGANYL-IK  233

Query  921  FC  926
            FC
Sbjct  234  FC  235



>ref|XP_010416727.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=279

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 141/243 (58%), Gaps = 18/243 (7%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LF++  + T  S  A  + TIVN+C   IWPAI P   +     GGF L       F AP
Sbjct  14   LFLTFLSGTKWSESA-RVFTIVNSCDQKIWPAITPGENF---NGGGFELKPGQSIVFTAP  69

Query  381  RARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST  557
               WSGRIW RTGC  +  G  TC TG C   L+C+  G   PA+LA+F L     DF  
Sbjct  70   VG-WSGRIWGRTGCKFDSTGTGTCETGSCGSTLKCSASG-KPPASLAEFTL--AAVDF--  123

Query  558  YGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG  737
            Y +SLVDGFNLPM +TP +GKG+C V GC A+L P CP +L V+       G V+ C S 
Sbjct  124  YDVSLVDGFNLPMAVTPMNGKGNCSVAGCVADLRPHCPSELAVK-----SNGKVISCRSA  178

Query  738  CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI  917
            C  F  DE CCR  Y NP++C+ + YS  FK ACP+ ++YA+D P+S+   C+A+  + I
Sbjct  179  CDVFDRDEYCCRGVYGNPVVCQPTYYSKIFKQACPTAYSYAYDDPTSIF-TCTASDYI-I  236

Query  918  IFC  926
             FC
Sbjct  237  SFC  239



>ref|XP_004137499.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004163817.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN64169.1| Protein P21 [Cucumis sativus]
Length=250

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 138/249 (55%), Gaps = 11/249 (4%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            +++++TL+    +  +  L +   IT  N C H +WP IQP+ G P+L RGGF L     
Sbjct  8    SVVALTLYTLFTSHISV-LVSATTITFYNKCSHPVWPGIQPSAGKPLLARGGFKLPPNKS  66

Query  363  RSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
             +   P A WSGR W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L   
Sbjct  67   YNLQLP-ALWSGRFWGRHGCAFDASGRGKCATGDCGGSLFCNGIGGTPPATLAEITLGND  125

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
              DF  Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR    R    V
Sbjct  126  Q-DF--YDVSLVDGYNLAISITPSKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNR---RV  179

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C S C AF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   C+ 
Sbjct  180  VACKSACFAFNSPRYCCTGRFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIA-TCTG  238

Query  900  ARELKIIFC  926
               L + FC
Sbjct  239  GNYL-VTFC  246



>ref|XP_002887695.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63954.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=259

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 134/226 (59%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TI+N+C   IWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  48   VFTIINSCDQKIWPAITPGENF---NGGGFELKPGQSIVFNAPVG-WSGRIWGRTGCKFD  103

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L    A    Y +SLVDGFNLPM++TP
Sbjct  104  STGTGTCETGSCGSTLKCSASG-KPPASLAEFTL----AKLDFYDVSLVDGFNLPMSVTP  158

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +G G+C V GC A+L P CP++L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  159  MNGIGNCSVAGCVADLRPHCPQELAVK-----SNGKVISCRSACDVFDRDEYCCRGVYGN  213

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P++C+ + YS  FK ACP+ ++YA+D P+S+M  C+A+ +  I FC
Sbjct  214  PVVCQPTYYSKIFKQACPTAYSYAYDDPTSIM-TCTAS-DYVISFC  257



>ref|XP_004172611.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=268

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 132/226 (58%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TI+NNC  TIWP I P   +     GGFAL +     F AP   WSGRIW RTGC  +
Sbjct  9    VFTIINNCKETIWPGIFPGENF---NGGGFALKRGQSIVFNAPVG-WSGRIWGRTGCTFD  64

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             +G   C TG C   L+C+G G   PA+LA+F L    A    Y +SLVDGFNLPM + P
Sbjct  65   ENGTGECQTGACGNSLKCSGSG-KTPASLAEFTL----AALDFYDVSLVDGFNLPMAVRP  119

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +G G C V GC  +L P CP++L V+      +G VV C S C  F  DE CCR  Y N
Sbjct  120  INGTGKCGVAGCDKDLRPECPKELAVK-----SKGKVVACRSACDVFDKDEYCCRGVYGN  174

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P+ C+ + YS  FK ACP+ ++YA+D P+S+   CSAA +  I FC
Sbjct  175  PMTCRPTFYSKKFKDACPTAYSYAYDDPTSIF-TCSAA-DYVITFC  218



>ref|XP_002510548.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF52735.1| Zeamatin precursor, putative [Ricinus communis]
Length=318

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/254 (42%), Positives = 145/254 (57%), Gaps = 15/254 (6%)
 Frame = +3

Query  186  ILSVTLFISLCA-FTTASLPAGLI---ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            +  +TL I LC+ F  +S  +G++    TI N C +T+WP I  N   P L   GFAL K
Sbjct  1    MTQLTLLIPLCSLFIASSFISGVVSTSFTITNKCDYTVWPGILSNADAPALSTTGFALQK  60

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE  527
               ++  AP A W GR+W RT C  +  G+F+C TGDC  G+LEC+G G A PATLA+F+
Sbjct  61   GETKTITAP-ASWGGRMWGRTYCTQDAAGKFSCLTGDCGSGKLECSGSGAAPPATLAEFK  119

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGH-CPVVGCRANLLPACPRQLQVRLRARR  704
            L  G+     + +SLVDG+NLP+ + P  G G  C   GC  +L  ACP +L+V   +  
Sbjct  120  LD-GYGGMDYFDVSLVDGYNLPLLVVPQGGSGQNCSSTGCVVDLNGACPSELKVT--STE  176

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
            G G  V C S C AF+  + CC   +  P  CK S YS+ FK+ACP  ++YA+D  +S  
Sbjct  177  GAG--VACKSACEAFRQPQYCCNGAFATPDTCKPSSYSEIFKNACPRAYSYAYDDKTSTF  234

Query  885  HECSAARELKIIFC  926
               SA  +  I FC
Sbjct  235  TCASA--DYTITFC  246



>gb|KGN50964.1| hypothetical protein Csa_5G374740 [Cucumis sativus]
Length=307

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 147/271 (54%), Gaps = 22/271 (8%)
 Frame = +3

Query  123  LNTHYIATTSTEQMAMAFPATILSVTLFISLCAFTTASL--PAGLIITIVNNCPHTIWPA  296
            L + Y    + ++   + P   L    F  L  F++      +  + TI+NNC  TIWP 
Sbjct  6    LASSYQKEGNLKEEEKSLPPISL---FFFVLIIFSSGGRISESARVFTIINNCKETIWPG  62

Query  297  IQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGR  473
            I P   +     GGFAL +     F AP   WSGRIW RTGC  + +G   C TG C   
Sbjct  63   IFPGENF---NGGGFALKRGQSIVFNAPVG-WSGRIWGRTGCTFDENGTGECQTGACGNS  118

Query  474  LECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRAN  653
            L+C+G G   PA+LA+F L    A    Y +SLVDGFNLPM + P +G G C V GC  +
Sbjct  119  LKCSGSG-KTPASLAEFTL----AALDFYDVSLVDGFNLPMAVRPINGTGKCGVAGCDKD  173

Query  654  LLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKH  833
            L P CP++L V+      +G VV C S C  F  DE CCR  Y NP+ C+ + YS  FK 
Sbjct  174  LRPECPKELAVK-----SKGKVVACRSACDVFDKDEYCCRGVYGNPMTCRPTFYSKKFKD  228

Query  834  ACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            ACP+ ++YA+D P+S+   CSAA +  I FC
Sbjct  229  ACPTAYSYAYDDPTSIF-TCSAA-DYVITFC  257



>gb|EAY77701.1| hypothetical protein OsI_32742 [Oryza sativa Indica Group]
Length=328

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 141/259 (54%), Gaps = 10/259 (4%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            M+  ++ L   +F+++     A        TI NNC +T+WP +  + G   L   GFAL
Sbjct  8    MSSRSSSLLAMVFVAVAVLARAQGERAATFTITNNCAYTVWPGLLSSAGSAPLSTTGFAL  67

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHG--RFTCATGDC-DGRLECNGRGGAAPATLA  518
                 ++  AP   WSGR+W RT C  +    +F+CATGDC  G ++CNG G A PATLA
Sbjct  68   APGASQAVPAPSG-WSGRMWGRTLCAADGAGAKFSCATGDCGSGDVQCNGGGAAPPATLA  126

Query  519  QFELH-QGHADFSTYGLSLVDGFNLPMTLTPH--DGKGHCPVVGCRANLLPACPRQLQVR  689
            +F L   G  DF  + +SLVDG+NLPM +TP    G G C   GC A L  ACP  L+V 
Sbjct  127  EFTLDGSGGLDF--FDVSLVDGYNLPMLVTPSATSGSGKCAATGCVAELNGACPADLRVA  184

Query  690  LRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDT  869
              +    GP V C S C AF + E CC   Y NP  C+ S YS+FFK ACP  ++YA+D 
Sbjct  185  SASSA-SGPAVACRSACEAFGSAEYCCSGAYGNPNTCRPSAYSEFFKAACPRAYSYAYDD  243

Query  870  PSSLMHECSAARELKIIFC  926
             +S     + A +  I FC
Sbjct  244  STSTFTCAAGATDYAITFC  262



>ref|XP_003543788.1| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
 gb|KHN26034.1| Pathogenesis-related protein 5 [Glycine soja]
Length=287

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 141/249 (57%), Gaps = 17/249 (7%)
 Frame = +3

Query  183  TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            TIL   L +++      +  +  + TIVN C  T+WPA+ P   +     GGF L     
Sbjct  7    TILPFILVLAIILSGQRTCDSARVFTIVNYCKETLWPAVTPGESF---NGGGFVLKPGES  63

Query  363  RSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG  539
              F AP   WSGRIWARTGC  +  G   C TG C   L+C+  G   PA+LA+F L Q 
Sbjct  64   AVFTAP-VSWSGRIWARTGCKFDQNGNGNCQTGSCGTTLKCSASG-KTPASLAEFTLAQ-  120

Query  540  HADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
              DF  Y +SLVDGFN+PM + P +GKG+C   GC ++L  +CP++L +R       G  
Sbjct  121  -PDF--YDVSLVDGFNVPMAVKPINGKGNCSTAGCDSDLRNSCPKELSLR-----ANGKT  172

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            VGC S C  F TDE CC+ NY NP  CK + YS  FK ACP++++YA+D P+S+   C+ 
Sbjct  173  VGCRSACDVFNTDEYCCKGNYGNPSTCKPTFYSKKFKEACPTSYSYAYDDPTSIF-TCTG  231

Query  900  ARELKIIFC  926
              +  I FC
Sbjct  232  T-DYVIAFC  239



>ref|XP_008801393.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 132/251 (53%), Gaps = 13/251 (5%)
 Frame = +3

Query  177  PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL  356
            P+  L  ++ + L +F    L      TI NNCPH IWP      G P L   GF L   
Sbjct  3    PSRQLFASVLVLLLSF---QLSMCCTFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPG  59

Query  357  THRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELH  533
                  AP   WSGR WARTGC  +  G  TC TGDC GR+EC G G   PATL +  L 
Sbjct  60   RSERIAAPPG-WSGRFWARTGCKFDAEGAGTCQTGDCAGRMECGGAGALPPATLFEITLG  118

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
            +G  D   Y +SLVDG+NLP+   P   +G C + GC A+L  ACP++LQV      G G
Sbjct  119  KGK-DRDFYDVSLVDGYNLPIAAAPRVPRGRCNITGCVADLNSACPKELQVD-----GDG  172

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
             VV C S C AF  D+ CC   + NP  CK S YS  FK ACP  ++YA+D  +S     
Sbjct  173  GVVACKSACEAFGLDKYCCSGEFGNPTTCKPSYYSSIFKTACPRAYSYAYDDGTSTFT--  230

Query  894  SAARELKIIFC  926
              A +  I+FC
Sbjct  231  CKAYDYTIVFC  241



>ref|XP_004140385.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
Length=295

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 132/226 (58%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TI+NNC  TIWP I P   +     GGFAL +     F AP   WSGRIW RTGC  +
Sbjct  36   VFTIINNCKETIWPGIFPGENF---NGGGFALKRGQSIVFNAPVG-WSGRIWGRTGCTFD  91

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             +G   C TG C   L+C+G G   PA+LA+F L    A    Y +SLVDGFNLPM + P
Sbjct  92   ENGTGECQTGACGNSLKCSGSG-KTPASLAEFTL----AALDFYDVSLVDGFNLPMAVRP  146

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +G G C V GC  +L P CP++L V+      +G VV C S C  F  DE CCR  Y N
Sbjct  147  INGTGKCGVAGCDKDLRPECPKELAVK-----SKGKVVACRSACDVFDKDEYCCRGVYGN  201

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P+ C+ + YS  FK ACP+ ++YA+D P+S+   CSAA +  I FC
Sbjct  202  PMTCRPTFYSKKFKDACPTAYSYAYDDPTSIF-TCSAA-DYVITFC  245



>ref|XP_006431048.1| hypothetical protein CICLE_v10012489mg [Citrus clementina]
 gb|ESR44288.1| hypothetical protein CICLE_v10012489mg [Citrus clementina]
Length=264

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 125/221 (57%), Gaps = 8/221 (4%)
 Frame = +3

Query  267  NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRF  443
            N CP  IWPA  PNTG+PV+  GGF L         AP + WSGRIWARTGC    + + 
Sbjct  32   NKCPFPIWPATAPNTGHPVIADGGFYLPSGETEIISAPWS-WSGRIWARTGCNFAPNWKP  90

Query  444  TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG  623
             C TGDCDGRL C+G  G  PATL +  L       S Y +SLVDG+NL + +T      
Sbjct  91   ACETGDCDGRLACSGLIGTPPATLVEITLAADKNKPSFYDVSLVDGYNLHVMVTTRQIST  150

Query  624  HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCK  803
             C + GCR N+   CP +LQV    R+    VV C S C AF  D  CCRN +  P  CK
Sbjct  151  KCTINGCRKNMNIFCPPELQVLNENRQ----VVACKSACLAFNLDSFCCRNEFGTPDKCK  206

Query  804  ASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             S YS  FK ACP+ ++YA+D P+ L+    A+RE  I FC
Sbjct  207  PSLYSKIFKDACPAYYSYAYDMPAPLVS--CASREFVITFC  245



>ref|XP_009620637.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
Length=263

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 135/258 (52%), Gaps = 12/258 (5%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASL--PAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF  341
            M F +   ++ LF+     T+  L       I I N CP  IWPA  PN G+PV+  G F
Sbjct  1    MKFSSISPTILLFLIWHFITSGKLGEVEACTIYINNKCPFPIWPATAPNAGHPVIANGSF  60

Query  342  ALYKLTHRSFVAPRARWSGRIWARTGCVLN---HGRFTCATGDCDGRLECNGRGGAAPAT  512
             L     R   AP   WSGRIWARTGC  +   + +  C TGDCDG+LEC G  G  P T
Sbjct  61   YLPPGRIRRIGAP-GDWSGRIWARTGCNFDDPTNHKPACETGDCDGKLECEGTIGLPPVT  119

Query  513  LAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRL  692
            L +  +       S Y +SLVDG+NLP+++T       C +  C  NL   CP +LQV  
Sbjct  120  LVEMSIQFDKRQPSFYDVSLVDGYNLPVSVTSKPSASKCVIGSCSRNLNAMCPSELQV--  177

Query  693  RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP  872
                  G VV C S C AF  D  CCRN Y +P  CK S YS  FK +CPS  TYA DTP
Sbjct  178  --INDEGQVVACKSACLAFNLDSFCCRNKYGSPDKCKPSVYSSLFKKSCPSYVTYAFDTP  235

Query  873  SSLMHECSAARELKIIFC  926
            S ++  CS + +  I FC
Sbjct  236  SPVVG-CS-SDQFVITFC  251



>ref|XP_008393422.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=250

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 133/238 (56%), Gaps = 8/238 (3%)
 Frame = +3

Query  171  AFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALY  350
            A   T L + L   L  +   S+ +   IT+ N C H +WP IQP+ G P+L RGGF L 
Sbjct  3    ALLKTSLPLMLPTLLFLYILVSVSSATTITMYNKCTHPVWPGIQPSAGQPILARGGFTLP  62

Query  351  KLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
                 +   P A WSGR W R GC  +  GR  CATGDC G L C+G GG  PATLA+  
Sbjct  63   PNKAHTLHLP-ALWSGRFWGRHGCTFDASGRGRCATGDCGGNLFCSGLGGTPPATLAEIT  121

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L     DF  Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR    R 
Sbjct  122  LGN-EQDF--YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNR-  177

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
               VV C S C+AF +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P+S+
Sbjct  178  --QVVACKSACSAFNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSI  233



>ref|XP_006390065.1| hypothetical protein EUTSA_v10019646mg, partial [Eutrema salsugineum]
 gb|ESQ27351.1| hypothetical protein EUTSA_v10019646mg, partial [Eutrema salsugineum]
Length=254

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 133/227 (59%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C   IWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCNQIIWPAITPGENF---NGGGFELKPGQSIVFNAPVG-WSGRIWGRTGCNFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L     DF  Y +SLVDGFNLPM++TP
Sbjct  86   KTGTGTCETGSCGSTLKCSASG-KPPASLAEFTL--AAVDF--YDVSLVDGFNLPMSVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CP++L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  141  MNGKGNCSVAGCVADLRPQCPKELAVK-----SNGKVISCRSACDVFDRDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P++C+ + YS  FK ACP+ ++YA+D P+S+   CS   +  I FC 
Sbjct  196  PVVCQPTFYSKIFKQACPTAYSYAYDDPTSIF-TCSGT-DYVISFCS  240



>emb|CDX68047.1| BnaA07g20870D [Brassica napus]
Length=284

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 131/227 (58%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C   +WPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCNQVVWPAITPGESF---NGGGFELKPGQSMVFNAPVG-WSGRIWGRTGCNFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L    A    Y +SLVDGFNLPM++TP
Sbjct  86   KTGTGTCETGSCGSTLKCSASG-KPPASLAEFTL----ATLDFYDVSLVDGFNLPMSVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CPR+L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  141  LNGKGNCSVAGCVADLRPKCPRELAVK-----SNGKVISCRSACDVFDKDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  C+ + YS  FK ACP++++YA+D P+S+   CS   +  I FC 
Sbjct  196  PSTCRPTYYSKLFKEACPTSYSYAYDDPTSIF-TCSGT-DYVISFCS  240



>ref|XP_009104608.1| PREDICTED: thaumatin-like protein [Brassica rapa]
Length=284

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 131/227 (58%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C   +WPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCNQVVWPAITPGESF---NGGGFELKTGPSMVFNAPVG-WSGRIWGRTGCNFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L    A    Y +SLVDGFNLPM++TP
Sbjct  86   KTGTGTCETGSCGSTLKCSASG-KPPASLAEFTL----ATLDFYDVSLVDGFNLPMSVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CPR+L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  141  LNGKGNCSVAGCVADLRPKCPRELAVK-----SNGKVISCRSACDVFDKDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  C+ + YS  FK ACP++++YA+D P+S+   CS   +  I FC 
Sbjct  196  PSTCRPTYYSKLFKEACPTSYSYAYDDPTSIF-TCSGT-DYVISFCS  240



>ref|XP_004291353.1| PREDICTED: thaumatin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=323

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 140/249 (56%), Gaps = 11/249 (4%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
             S++LF  L  FT+  L      T+VN C +T+WP I  N G P L   GFAL K   ++
Sbjct  6    FSLSLFTLLALFTSGVL--STTFTMVNKCEYTVWPGILSNAGVPPLPTTGFALVKGETKT  63

Query  369  FVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGH  542
              AP A W GR WART C  +  G+F+C TGDC  G+LEC+G G A PATLA+F L  G 
Sbjct  64   LTAP-ASWGGRFWARTLCSHDSTGKFSCVTGDCGSGKLECSGSGAAPPATLAEFTL-DGD  121

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKG-HCPVVGCRANLLPACPRQLQVRLRARRGRGPV  719
            A    + +SLVDG+NLPM + P  G G +C   GC  +L   CP +L+V   +  G    
Sbjct  122  AGLDFFDVSLVDGYNLPMLVVPQGGTGTNCTNTGCVVDLNGLCPSELKVS--SVDGSQGA  179

Query  720  VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA  899
            V C S C AF+  + CC   Y  P  CK S YS+ FK ACP  ++YA+D  +S    C+ 
Sbjct  180  VACKSACEAFQQPQYCCSGAYATPDTCKPSSYSEVFKKACPQAYSYAYDDKTSTF-TCAN  238

Query  900  ARELKIIFC  926
            A +  I FC
Sbjct  239  A-DYTITFC  246



>ref|XP_009367296.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=287

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 130/226 (58%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            I TI+NNC  T+WPA+ P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   IFTIINNCKETVWPAVTPGENF---NGGGFVLKPGQSIVFTAP-VSWSGRIWGRTGCNFD  85

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             +G  +C TG C   L+C G  G  PATLA+F L    A    Y +SLVDGFNLP+ +TP
Sbjct  86   KNGNGSCQTGSCGSALQC-GASGKPPATLAEFTL----AALDFYDVSLVDGFNLPLVVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC  +L P CP +L V+       G  VGC S C  F TDE CCR  Y N
Sbjct  141  LNGKGNCSVSGCDGDLRPNCPNELAVK-----ANGKTVGCRSACDVFDTDEYCCRGLYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              +CK + YS  FK ACP+ ++YA+D P+S+   CS   +  + FC
Sbjct  196  AAVCKPTYYSKKFKEACPTAYSYAYDDPTSIF-TCSGT-DYVVAFC  239



>ref|XP_011088584.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum]
Length=334

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 143/259 (55%), Gaps = 25/259 (10%)
 Frame = +3

Query  162  MAMAF--PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
            M ++F  PA +L+  +F  + AF       G   T VN C +T+WP I  N G P L+  
Sbjct  1    MDLSFTNPAFLLAFHIFFRV-AF-------GATFTFVNKCEYTVWPGILANAGSPTLDST  52

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGR-FTCATGDC-DGRLECNGRGGAAPA  509
            GF L   + R+F+AP A WSGR W RTGC  +     +C TGDC  G+ ECNG G A PA
Sbjct  53   GFELPPDSSRTFIAP-AGWSGRFWGRTGCTFSGSEPGSCQTGDCGSGQAECNGSGAAPPA  111

Query  510  TLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVR  689
            TLA+F L  G  DF  Y +SLVDG+NLPM +    G G C   GC  +L   CP +L+V 
Sbjct  112  TLAEFTLGTGGLDF--YDVSLVDGYNLPMIVEATGGSGMCASTGCVTDLNRVCPSELRV-  168

Query  690  LRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDT  869
                   G    C S C AF + E CC   +N+P  C+ S YS  FK ACP +++YA+D 
Sbjct  169  -------GGGEACKSACEAFGSPEYCCSGTFNSPATCRPSVYSQMFKSACPRSYSYAYDD  221

Query  870  PSSLMHECSAARELKIIFC  926
            P+S    CS A +  + FC
Sbjct  222  PTSTF-TCSGA-DYTVTFC  238



>gb|ACT11052.1| thaumatin-like protein [Arachis diogoi]
Length=241

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 135/254 (53%), Gaps = 15/254 (6%)
 Frame = +3

Query  168  MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            MA    +LS++    LC      +  G  IT+ N C +T+WP  Q N     L   GF L
Sbjct  1    MAITRVVLSLSFAFFLC------VAHGAQITLTNKCSYTVWPGSQANANSAQLSTTGFEL  54

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE  527
                 ++   P A WSG+ WARTGC  N+G F+CAT DC   LEC+G G A PA+L +F 
Sbjct  55   PTGQSKTVDVP-APWSGKFWARTGCSNNNGVFSCATADCGNHLECSGAGEATPASLMEFT  113

Query  528  L-HQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
            +   G  DF  Y +S VDGFN+P ++TP  G G C V  C AN+  ACP  LQ     + 
Sbjct  114  IASNGGQDF--YDVSNVDGFNVPSSITPQGGSGACNVASCPANINAACPAALQF----KG  167

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
              G V+GC S C  F T E CC  ++N    C A+ YS+FF + CP+ ++YA+D      
Sbjct  168  SDGSVIGCKSACVEFGTPEYCCTGDHNTAATCPATNYSEFFSNQCPNAYSYAYDDKRGTF  227

Query  885  HECSAARELKIIFC  926
              CS +    I FC
Sbjct  228  -TCSGSPNYAINFC  240



>ref|XP_002317878.2| hypothetical protein POPTR_0012s04520g [Populus trichocarpa]
 gb|EEE96098.2| hypothetical protein POPTR_0012s04520g [Populus trichocarpa]
Length=312

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/292 (40%), Positives = 153/292 (52%), Gaps = 13/292 (4%)
 Frame = +3

Query  60   RKTNNKNKQNSRPRYILQS*SLNTHYIATTSTEQMAMAFPATILSVTL-FISLCAFTTAS  236
            R+    N++  R R +    S    ++ T+  +   MA     L   L F S+  F+  S
Sbjct  30   RERTFANRERERERALFSLLSSTPFWVFTSFPQSSTMAAMLRSLLALLLFTSI--FSHIS  87

Query  237  LPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWART  416
              +   IT+ N C H +WP IQP+ G P+L RGGF L      +   P   WSGR+W R 
Sbjct  88   EVSSTTITLHNKCTHPVWPGIQPSAGKPILARGGFKLPPNKAYTLHIP-PLWSGRLWGRH  146

Query  417  GCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLP  593
            GC  +  GR  CATGDC G L CNG GG  PATLA+  L     DF  Y +SLVDG+NL 
Sbjct  147  GCSFDASGRGRCATGDCGGSLYCNGIGGTPPATLAEITLGN-EQDF--YDVSLVDGYNLA  203

Query  594  MTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCR  773
            +++TP  G G C   GC ++L   CP  LQVR +  R    VV C S C AF +   CC 
Sbjct  204  ISITPFKGSGKCSYAGCVSDLNLMCPLGLQVRSKDNRS---VVACKSACFAFNSPRYCCT  260

Query  774  NNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
              +  P  CK + YS  FK ACP  ++YA+D P+S+   C+    L + FCH
Sbjct  261  GRFGTPQACKPTAYSRIFKAACPKAYSYAYDDPTSIA-TCTRGNYL-VTFCH  310



>ref|XP_008364687.1| PREDICTED: LOW QUALITY PROTEIN: thaumatin-like protein, partial 
[Malus domestica]
Length=236

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 133/238 (56%), Gaps = 10/238 (4%)
 Frame = +3

Query  216  CAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWS  395
            C     S+ +   IT+ N C H +WP IQP+ G P+L RGGF L      +   P A WS
Sbjct  4    CDLNAVSVSSATTITMYNKCTHPVWPGIQPSAGQPILARGGFTLPPNKAHTLHLP-ALWS  62

Query  396  GRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSL  572
            GR W R GC  +  GR  CATGDC G L C+G GG  PATLA+  L     DF  Y +SL
Sbjct  63   GRFWGRHGCTFDASGRGRCATGDCGGNLFCSGLGGTPPATLAEITLGN-EQDF--YXVSL  119

Query  573  VDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFK  752
            VDG+NL +++TP  G G C   GC ++L   CP  LQVR    R    VV C S C+AF 
Sbjct  120  VDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRR---VVACKSACSAFN  176

Query  753  TDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P+S+   C+    L + FC
Sbjct  177  SPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIA-TCTRGNYL-VTFC  232



>ref|XP_002284403.3| PREDICTED: pathogenesis-related protein 5 [Vitis vinifera]
 emb|CBI19063.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 144/264 (55%), Gaps = 21/264 (8%)
 Frame = +3

Query  144  TTSTEQMA--MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGY  317
            T +  QMA  ++ P + L + + +S     + S     + TI N+C  TIWPA+ P    
Sbjct  19   TQTKRQMAPHLSSPLSFLLILIVVSSVPQMSES---ARVFTITNDCKETIWPAVFPG---  72

Query  318  PVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRG  494
               + GGFAL     R F AP + WSGRIW R+GC  +  G+  C TG C   ++C+  G
Sbjct  73   EYFDGGGFALKTGQSRVFTAPLS-WSGRIWGRSGCNFDKTGKGNCQTGSCGDNIKCSASG  131

Query  495  GAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPR  674
               PATLA+F L    A    Y +SLVDGFNLP+ + P +GKG+C + GC +NL   CP 
Sbjct  132  -KTPATLAEFTL----AALDFYDVSLVDGFNLPLVVKPINGKGNCSIAGCDSNLRDTCPS  186

Query  675  QLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFT  854
            +L     A +  G  VGC S C  F TDE CC+  Y N   C  + YS  FK ACP+ ++
Sbjct  187  EL-----ALKSSGKTVGCRSACDVFNTDEYCCKGLYGNAATCVPTSYSKKFKEACPAAYS  241

Query  855  YAHDTPSSLMHECSAARELKIIFC  926
            YA+D PSS+   CS   +  I FC
Sbjct  242  YAYDDPSSIF-TCSGTTDYVITFC  264



>ref|XP_009622122.1| PREDICTED: thaumatin-like protein 1 [Nicotiana tomentosiformis]
Length=365

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 125/229 (55%), Gaps = 15/229 (7%)
 Frame = +3

Query  246  GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCV  425
            G   T VN C +T+WP I  N G P L+  GF L + + R+F AP   WSGR W RT C 
Sbjct  28   GATFTFVNKCEYTVWPGILANAGSPTLQSTGFELPQDSSRTFTAPTG-WSGRFWGRTSCS  86

Query  426  LNHGRF-TCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMT  599
             +     +C TGDC  G +ECNG G A PATLA+F L  G  DF  Y +SLVDG+NLPM 
Sbjct  87   FDGSESGSCGTGDCGSGEVECNGAGAAPPATLAEFTLGTGGQDF--YDVSLVDGYNLPMV  144

Query  600  LTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN  779
            +    G G C   GC  +L   CP +L      R G G    C S C AF   E CC   
Sbjct  145  VEASGGSGMCATTGCVTDLNQICPTEL------RSGGGEA--CRSACEAFNKPEYCCSGA  196

Query  780  YNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            Y+ P  CK S YS  FK ACP +++YA+D P+S    CS A +  + FC
Sbjct  197  YSTPATCKPSMYSQMFKSACPRSYSYAYDDPTSTF-TCSGA-DYTVTFC  243



>ref|XP_010929479.1| PREDICTED: pathogenesis-related protein 5-like [Elaeis guineensis]
Length=310

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 131/247 (53%), Gaps = 11/247 (4%)
 Frame = +3

Query  192  SVTLFISLCAFTTA-SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
            S  +F S+  F  +  L      TI NNCPHTIWP      G P L   GF L       
Sbjct  4    SSKVFTSVLVFVLSFQLSMCCTFTIYNNCPHTIWPGTLAGAGTPQLSTTGFQLEPGRSVR  63

Query  369  FVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
              AP   WSGR+WARTGC  +  G  TC TGDC GR+EC G G   PATL +  L +G  
Sbjct  64   MAAPPG-WSGRMWARTGCEFDAQGAGTCQTGDCGGRMECGGAGALPPATLFEITLGKGK-  121

Query  546  DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG  725
            D   Y +SLVDG+NLP+   P   +G C   GC A+L  ACP++LQV      G G VV 
Sbjct  122  DPDYYDVSLVDGYNLPVAAAPRVPRGRCNATGCAADLNRACPKELQVD-----GDGGVVA  176

Query  726  CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR  905
            C S C AF  DE CC   + +P  CK S YS  FK+ACP  ++YA D  +S       A 
Sbjct  177  CKSACEAFGLDEYCCSGEFGSPGTCKPSFYSSIFKNACPRAYSYAFDDGTSTFT--CKAY  234

Query  906  ELKIIFC  926
            +  IIFC
Sbjct  235  DYTIIFC  241



>ref|XP_006302655.1| hypothetical protein CARUB_v10020759mg [Capsella rubella]
 gb|EOA35553.1| hypothetical protein CARUB_v10020759mg [Capsella rubella]
Length=280

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 132/226 (58%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C   IWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCDQKIWPAITPGENF---NGGGFELKPGQSIVFTAPVG-WSGRIWGRTGCNFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L    A    Y +SLVDGFNLPM++ P
Sbjct  86   STGTGTCETGSCGSTLKCSASG-KPPASLAEFTL----AALDFYDVSLVDGFNLPMSVNP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CP +L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  141  RNGKGNCSVAGCVADLRPHCPSELAVK-----SNGKVISCRSACDVFDRDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P++C+ + YS  FK ACP+ ++YA+D P+S+   CSA+  + I FC
Sbjct  196  PVVCQPTYYSKIFKQACPTAYSYAYDDPTSIF-TCSASDYI-ITFC  239



>ref|XP_008801392.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Phoenix 
dactylifera]
Length=292

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 132/251 (53%), Gaps = 13/251 (5%)
 Frame = +3

Query  177  PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL  356
            P+  L  ++ + L +F    L      TI NNCPH IWP      G P L   GF L   
Sbjct  3    PSRQLFASVLVLLLSF---QLSMCCTFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPG  59

Query  357  THRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELH  533
                  AP   WSGR WARTGC  +  G  TC TGDC GR+EC G G   PATL +  L 
Sbjct  60   RSERIAAPPG-WSGRFWARTGCKFDAEGAGTCQTGDCAGRMECGGAGALPPATLFEITLG  118

Query  534  QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
            +G  D   Y +SLVDG+NLP+   P   +G C + GC A+L  ACP++LQV      G G
Sbjct  119  KGK-DRDFYDVSLVDGYNLPIAAAPRVPRGRCNITGCVADLNSACPKELQVD-----GDG  172

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
             VV C S C AF  D+ CC   + NP  CK S YS  FK ACP  ++YA+D  +S     
Sbjct  173  GVVACKSACEAFGLDKYCCSGEFGNPTTCKPSYYSSIFKTACPRAYSYAYDDGTSTFT--  230

Query  894  SAARELKIIFC  926
              A +  I+FC
Sbjct  231  CKAYDYTIVFC  241



>ref|XP_006486762.1| PREDICTED: thaumatin-like protein 1-like [Citrus sinensis]
Length=358

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 142/260 (55%), Gaps = 28/260 (11%)
 Frame = +3

Query  192  SVTLFISLCAFTTASLPAGLII-------------TIVNNCPHTIWPAIQPNTGYPVLER  332
            + TLF+ L + T+ SL   LI+             T VN C +TIWP I  N G P L+ 
Sbjct  4    TTTLFMDLPSCTSTSLILPLIVLLATSQGVLSATFTFVNKCDYTIWPGILANAGSPRLDS  63

Query  333  GGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAP  506
             GF L + + RSFVAP   WSGR W RT C  +  G  +C TGDC  G++ECNG G A P
Sbjct  64   TGFELPQDSSRSFVAPTG-WSGRFWGRTRCNFDGSGSGSCLTGDCGSGQVECNGLGAAPP  122

Query  507  ATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQV  686
            ATLA+F L  G  DF  Y +SLVDG+NLPM +    G G C   GC  ++   CP +L+V
Sbjct  123  ATLAEFTLGSGGQDF--YDVSLVDGYNLPMIVESSGGSGLCSTTGCSTDVNQQCPAELRV  180

Query  687  RLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHD  866
                  G G    C S C AF + E CC   +N P  CK S YS  FK ACP +++YA+D
Sbjct  181  ------GEGDA--CKSACEAFGSAEYCCSGAFNTPATCKPSVYSQVFKSACPKSYSYAYD  232

Query  867  TPSSLMHECSAARELKIIFC  926
              +S    C+ A +  + FC
Sbjct  233  DATSTFT-CTGA-DYTVTFC  250



>ref|XP_009356044.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=250

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 140/254 (55%), Gaps = 14/254 (6%)
 Frame = +3

Query  180  ATILSVTLFISLCAF----TTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL  347
            A +L  +L I L  F       S+ +   +T+ N C H +WP IQP+ G P+L RGGF L
Sbjct  2    AALLKTSLPIMLSTFLFLHVLVSVSSATTLTMYNKCTHPVWPGIQPSAGQPLLARGGFTL  61

Query  348  YKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQF  524
                  +   PR  WSGR W R GC  +  GR  CATGDC G L C+G GG  PATLA+ 
Sbjct  62   PPNKAHTLHLPRL-WSGRFWGRHGCAFDASGRGRCATGDCGGNLFCSGLGGTPPATLAEI  120

Query  525  ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARR  704
             L     DF  Y +SLVDG+NL +++TP  G G C   GC ++L   CP  LQVR    R
Sbjct  121  TLGNDQ-DF--YDVSLVDGYNLAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNR  177

Query  705  GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
                VV C S C+AF +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P+S+ 
Sbjct  178  R---VVACKSACSAFNSPRYCCTGSFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIA  234

Query  885  HECSAARELKIIFC  926
              C+    L + FC
Sbjct  235  -TCTRGNYL-VTFC  246



>ref|XP_010041761.1| PREDICTED: thaumatin-like protein 1b [Eucalyptus grandis]
 gb|KCW44097.1| hypothetical protein EUGRSUZ_L02491 [Eucalyptus grandis]
Length=310

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 130/229 (57%), Gaps = 13/229 (6%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
             TI+N C +T+WP I  N G P L   GFAL      +   P A WSGR+W RT C  N 
Sbjct  29   FTILNQCAYTVWPGILSNAGTPQLPTTGFALQPGQSNAISVP-ASWSGRLWGRTLCAQNA  87

Query  432  -HGRFTCATGDCDG-RLECNGRGGAAPATLAQFELHQGHA-DFSTYGLSLVDGFNLPMTL  602
              GRF C TGDC    +EC+G G   PATLA+F L   +  DF  Y +SLVDG+NLPM +
Sbjct  88   TEGRFVCVTGDCGSPTVECSGSGAVPPATLAEFTLDGANGLDF--YDVSLVDGYNLPMWV  145

Query  603  TPHDGKG-HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN  779
             P  GKG +C   GC A+L   CP++LQV      G G  V C S C AF   + CC   
Sbjct  146  VPRGGKGGNCTATGCAADLNAGCPKELQVD---TDGGGASVACKSACEAFGDPQYCCSGA  202

Query  780  YNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            Y+ P  CK S YS+FFK ACP+ ++YA+D  +S+    SA  +  I FC
Sbjct  203  YSTPATCKPSGYSEFFKQACPTAYSYAYDDGTSIFTCASA--DYVITFC  249



>gb|ADW08698.1| thaumatin-like protein [Ambrosia trifida]
Length=235

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 122/210 (58%), Gaps = 9/210 (4%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            +  + N C +TIWPAIQPN G PVL  GGF L +   ++   P+  W+GRIW R+GC  +
Sbjct  20   VFILQNRCKNTIWPAIQPNGGQPVLMDGGFQLGRQESKNVTTPQG-WAGRIWGRSGCKFD  78

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             HG  TC TGDC   L C G GG  PA+LA+F L+   +    Y +SLVDG+NLP+++ P
Sbjct  79   AHGEGTCVTGDCGNGLYCRGNGGEPPASLAEFTLN---SPLDFYDVSLVDGYNLPISIFP  135

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             D  G C  V C  +L   CP  L VR       G  V C S C A+ T E CC   Y N
Sbjct  136  RDDSGACTSVRCDTDLNQHCPSNLIVRGDG----GETVACKSACTAYHTPEHCCTGEYQN  191

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSS  878
            P  C+ +RYS +FK  CPS+++YA D  SS
Sbjct  192  PDTCQPTRYSQYFKQGCPSSYSYAFDDQSS  221



>ref|XP_008781004.1| PREDICTED: thaumatin-like protein 1 [Phoenix dactylifera]
Length=310

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 137/251 (55%), Gaps = 14/251 (6%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGL--IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV  374
            +F+ L +F    +  GL    T+ NNC +T+WP      G   LE  GFAL K   RS  
Sbjct  6    IFMVLHSFLLFFVSGGLAATFTLTNNCEYTVWPGSLSGAGTGELETTGFALEKGESRSLN  65

Query  375  APRARWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGH  542
            AP A+WSGR W RT C  +   G+FTC TGDC  G +EC+G G A PATLA+F L   G 
Sbjct  66   AP-AKWSGRFWGRTLCSTDSATGKFTCGTGDCGSGTMECSGGGAAPPATLAEFTLDGSGG  124

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGK---GHCPVVGCRANLLPACPRQLQVRLRARRGRG  713
             DF  Y +SLVDG+N+PM + P       G+C   GC  +L   CP  L+V L    G  
Sbjct  125  MDF--YDVSLVDGYNVPMLVVPQGASSPGGNCSATGCLVDLNGVCPSDLKVVLAGVDGGS  182

Query  714  PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC  893
              V C S C AF + + CC   Y NP  CK S YS FFK+ACP  ++YA+D  SS    C
Sbjct  183  ESVACKSACEAFGSPQYCCSGAYGNPNTCKPSSYSQFFKNACPRAYSYAYDDASSTF-TC  241

Query  894  SAARELKIIFC  926
              A  L I FC
Sbjct  242  YNANYL-ITFC  251



>emb|CDP20596.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 134/253 (53%), Gaps = 12/253 (5%)
 Frame = +3

Query  183  TILSVTLFISLC---AFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK  353
            +  SV + + LC   +  ++ +       + N CP  IWPA  PN G+PV+  GGF L  
Sbjct  5    STFSVWILVLLCHRISSGSSGVVEACTFYVSNKCPFPIWPATAPNQGFPVVANGGFYLPS  64

Query  354  LTHRSFVAPRARWSGRIWARTGCVLNHGR--FTCATGDCDGRLECNGRGGAAPATLAQFE  527
               R F AP   WSGRIWARTGC  ++      C TGDC+GRLEC G  G  P TL +F 
Sbjct  65   GRLRKFQAP-GDWSGRIWARTGCNFDYSNDGQACETGDCNGRLECAGAIGVPPVTLVEFT  123

Query  528  LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRG  707
            L       S Y +S+VDG+NLP+++TP+     C + GC +++   CP +L V       
Sbjct  124  LQVDKRQPSFYDVSIVDGYNLPVSVTPYPTAPKCYIGGCFSDIKKECPGELAV----LNE  179

Query  708  RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH  887
             G VV C S C AF  D  CCR  Y +P  CK   YS FFK  CP  F+   DTPS L++
Sbjct  180  LGQVVACKSACLAFNEDRFCCRKKYGSPATCKPDVYSRFFKAECPYYFSKPFDTPSPLVN  239

Query  888  ECSAARELKIIFC  926
                A +  I FC
Sbjct  240  --CPADQYIITFC  250



>ref|XP_009400987.1| PREDICTED: thaumatin-like protein 1b [Musa acuminata subsp. malaccensis]
Length=243

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 140/252 (56%), Gaps = 16/252 (6%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLPAG--LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH  362
            ++ T  +S   F+    PA      T+ NNCP TIWPA        +L + G  L     
Sbjct  1    MAGTWILSAAFFSAILFPAASSTTFTVKNNCPFTIWPATLTGGRSALLPQTGLELAYGES  60

Query  363  RSFVAPRARWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH  533
            +S  AP A WSGR WART C  +   GRF+CA+GDC  G +ECNG GGA P TL +F L 
Sbjct  61   QSLDAP-AGWSGRFWARTRCTTDSTSGRFSCASGDCGSGSIECNGAGGAPPTTLVEFTLQ  119

Query  534  -QGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGR  710
              G  DF  Y +S VDGFNLP+++TP  G+G C  + C A++   CP +LQ R R     
Sbjct  120  GDGGKDF--YDVSCVDGFNLPVSVTPRSGQG-CSSISCPADINAGCPPELQERAR----D  172

Query  711  GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE  890
            G VVGC S C AF TD  CCR  Y  P  CK + YS  FK+ACP  ++YA+D  +S    
Sbjct  173  GAVVGCKSACLAFDTDWYCCRGAYGTPSACKPTSYSMLFKNACPQAYSYAYDDATSTF-T  231

Query  891  CSAARELKIIFC  926
            C  A  L I FC
Sbjct  232  CVGANYL-ITFC  242



>ref|XP_003618434.1| Thaumatin-like protein [Medicago truncatula]
 gb|AES74652.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=272

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 131/226 (58%), Gaps = 11/226 (5%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL--NH  434
            I N CP  IWPA  PNTG P++  GGF L     +  +AP + WSGRIWARTGC    N+
Sbjct  33   IHNKCPFPIWPATAPNTGQPIIADGGFYLPSGQTKKILAPWS-WSGRIWARTGCNFASNN  91

Query  435  GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT-PH  611
             + +C TGDCDGRL CNG  G  PATL +  L       + Y +SLVDG+N+P+++  P+
Sbjct  92   WKPSCETGDCDGRLACNGLIGTPPATLVEITLQGDKGRPNFYDVSLVDGYNIPVSVVVPN  151

Query  612  DG-KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
                  C + GC  ++   CPR+L+V        G VV C S C AF  D  CCRN+Y +
Sbjct  152  KNINSKCNIQGCFKDVKSLCPRELEVL----NSNGEVVACKSACLAFDLDNFCCRNDYGS  207

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  C+ + YS  FK ACP+ F+YA DTP+ L+     + E  I FC
Sbjct  208  PKKCRPNVYSKIFKDACPNYFSYAFDTPTPLVS--CGSLEYIITFC  251



>ref|XP_006422635.1| hypothetical protein CICLE_v10028716mg [Citrus clementina]
 gb|ESR35875.1| hypothetical protein CICLE_v10028716mg [Citrus clementina]
Length=358

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 142/260 (55%), Gaps = 28/260 (11%)
 Frame = +3

Query  192  SVTLFISLCAFTTASLPAGLII-------------TIVNNCPHTIWPAIQPNTGYPVLER  332
            + TLF+ L + T+ SL   LI+             T VN C +TIWP I  N G P L+ 
Sbjct  4    TTTLFMDLPSCTSTSLILPLIVLLATSQGVLSATFTFVNKCDYTIWPGILANAGSPRLDS  63

Query  333  GGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAP  506
             GF L + + RSFVAP   WSGR W RT C  +  G  +C TGDC  G++ECNG G A P
Sbjct  64   TGFELPQDSSRSFVAPTG-WSGRFWGRTRCNFDGSGSGSCLTGDCGSGQVECNGLGAAPP  122

Query  507  ATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQV  686
            ATLA+F L  G  DF  Y +SLVDG+NLPM +    G G C   GC  ++   CP +L+V
Sbjct  123  ATLAEFTLGSGGQDF--YDVSLVDGYNLPMIVESSGGSGLCSTTGCSTDVNRQCPAELRV  180

Query  687  RLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHD  866
                  G G    C S C AF + E CC   +N P  CK S YS  FK ACP +++YA+D
Sbjct  181  ------GEGDA--CKSACEAFGSAEYCCSGAFNTPATCKPSVYSQVFKSACPKSYSYAYD  232

Query  867  TPSSLMHECSAARELKIIFC  926
              +S    C+ A +  + FC
Sbjct  233  DATS-TFTCTGA-DYTVTFC  250



>ref|XP_003563464.1| PREDICTED: thaumatin-like protein [Brachypodium distachyon]
Length=248

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 128/227 (56%), Gaps = 10/227 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
            + + N C  T+WP IQP  G  +L RGG  L      S   P A WSGR+W R GC  + 
Sbjct  25   MALYNRCGETVWPGIQPGAGKEILARGGLQLLPNRATSIRLP-AGWSGRVWGRQGCSFDA  83

Query  435  -GRFTCATGDCDGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTP  608
             GR  CATGDC G L CNG GGA PATLA+  L   G      Y +SLVDG+N+P+ +TP
Sbjct  84   AGRGKCATGDCGGALYCNGAGGAPPATLAEITLGASGSTSQDFYDVSLVDGYNIPIAMTP  143

Query  609  HDGKG-HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
            + G G +C   GC ++L   CP  L VR     G G VVGC S CAA+ + + CC   + 
Sbjct  144  YHGSGTNCLPAGCVSDLNRVCPAGLAVR-----GGGRVVGCRSACAAYGSPQYCCTGQFG  198

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK + YS  FK ACP  ++YA+D P+S++  C+      + FC
Sbjct  199  GPQTCKPTAYSKLFKQACPKAYSYAYDDPTSIL-TCAPGTSYVVTFC  244



>gb|AFK39390.1| unknown [Medicago truncatula]
Length=272

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 131/226 (58%), Gaps = 11/226 (5%)
 Frame = +3

Query  261  IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL--NH  434
            I N CP  IWPA  PNTG P++  GGF L     +  +AP + WSGRIWARTGC    N+
Sbjct  33   IHNKCPFPIWPATAPNTGQPIIADGGFYLPSGQTKKILAPWS-WSGRIWARTGCNFASNN  91

Query  435  GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT-PH  611
             + +C TGDCDGRL CNG  G  PATL +  L       + Y +SLVDG+N+P+++  P+
Sbjct  92   WKPSCETGDCDGRLACNGLIGTPPATLVEITLQGDKGRPNFYDVSLVDGYNIPVSVVVPN  151

Query  612  DG-KGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
                  C + GC  ++   CPR+L+V        G VV C S C AF  D  CCRN+Y +
Sbjct  152  KNINSKCNIQGCFKDVKSLCPRELEVL----NSNGEVVACKSACLAFDLDNFCCRNDYGS  207

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  C+ + YS  FK ACP+ F+YA DTP+ L+     + E  I FC
Sbjct  208  PEKCRPNVYSKIFKDACPNYFSYAFDTPTPLVS--CGSLEYIITFC  251



>ref|XP_008378490.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=287

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 131/226 (58%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            I TI+NNC  T+WPA+ P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   IFTIINNCKETVWPAVTPGENF---NGGGFVLKPGQSIVFTAP-VSWSGRIWGRTGCNFD  85

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             +G  +C TG C   L+C G  G  PATLA+F L     DF  Y +SLVDGFNLP+ +TP
Sbjct  86   KNGNGSCQTGSCGSALQC-GASGKPPATLAEFTLTA--LDF--YDVSLVDGFNLPLVVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC  +L P CP +L V+       G  VGC S C  F TDE CCR  Y N
Sbjct  141  LNGKGNCSVSGCDMDLRPNCPNELAVK-----ANGKTVGCRSACDVFDTDEYCCRGLYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              +CK + YS  FK ACP+ ++YA+D P+S+   CS   +  + FC
Sbjct  196  AAVCKPTYYSKKFKEACPTAYSYAYDDPTSIF-TCSGT-DYVVAFC  239



>ref|XP_009630387.1| PREDICTED: thaumatin-like protein 1b [Nicotiana tomentosiformis]
Length=298

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 134/248 (54%), Gaps = 13/248 (5%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
            LSV+L    CAF + S  +    TI NNCP+TIWP     +  P L   GF L       
Sbjct  10   LSVSLL--FCAFFSHSFAS--TFTITNNCPYTIWPGTLSGSSSPKLSTTGFQL-NAGQSV  64

Query  369  FVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA  545
             +     WSGRIWARTGC  +  G  +C TGDC G+LEC+G G   PA+L +  L  G A
Sbjct  65   RIPSVPGWSGRIWARTGCTFDASGVGSCQTGDCGGKLECDGLGATPPASLFEITLGTGEA  124

Query  546  -DFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +S+VDG+NLPM   P    G C + GC +NL   CP++LQV      G G VV
Sbjct  125  KDF--YDVSIVDGYNLPMVAAPEGVHGGCNITGCVSNLNMGCPKELQVV--GGDGEGNVV  180

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C AF  D+ CC   + NP  C+ S YS  FK ACP  ++YA+D  +S       A
Sbjct  181  ACKSACEAFGLDQYCCAGEFANPTTCRPSFYSSIFKRACPRAYSYAYDDGTSTFT--CKA  238

Query  903  RELKIIFC  926
             +  IIFC
Sbjct  239  DDYSIIFC  246



>emb|CDX79230.1| BnaC06g20730D [Brassica napus]
Length=292

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 132/227 (58%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C   +WPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCNQVVWPAITPGESF---NGGGFELKPGQSMVFNAPVG-WSGRIWGRTGCNFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L     DF  Y +SLVDGFNLPM++TP
Sbjct  86   KTGTGTCETGSCGSTLKCSASG-KPPASLAEFTLAT--PDF--YDVSLVDGFNLPMSVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L P CPR+L V+       G V+ C S C  F  DE CCR  Y N
Sbjct  141  LNGKGNCSVAGCVADLRPKCPRELAVK-----SNGKVISCRSACDVFDKDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P  C+ + YS  FK ACP++++YA+D P+S+   CS   +  I FC 
Sbjct  196  PSTCRPTYYSKLFKEACPTSYSYAYDDPTSIF-TCSGT-DYVISFCS  240



>ref|XP_008365396.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=262

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 127/221 (57%), Gaps = 8/221 (4%)
 Frame = +3

Query  267  NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC-VLNHGRF  443
            N CP  IWPA  PN G  V+  GGF L     +   AP + WSGRIWARTGC  +++G  
Sbjct  35   NKCPFNIWPATAPNAGKAVIADGGFYLPAGKTQRVTAPWS-WSGRIWARTGCNFVSNGNP  93

Query  444  TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG  623
             C TGDCDGRL C G  G  P TL Q  +       + Y +S+VDG+NLP+ +  +    
Sbjct  94   ACETGDCDGRLACKGLIGNPPVTLVQVSVQGDKDKLNFYDVSVVDGYNLPVVVLSNPVAS  153

Query  624  HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCK  803
            +C + GC  +L   CP++L+V  +    +G VV C S C AF TD  CCR  Y  P  CK
Sbjct  154  NCTIGGCLKDLKTRCPKELKVLNK----KGEVVACKSACLAFNTDAYCCRKEYGTPEKCK  209

Query  804  ASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             S YS  FK ACPS ++YA+DTP  L+  C A++ + I FC
Sbjct  210  PSVYSKLFKDACPSYYSYAYDTPPPLV-TCKASKYV-ITFC  248



>ref|XP_006422634.1| hypothetical protein CICLE_v10028716mg [Citrus clementina]
 gb|ESR35874.1| hypothetical protein CICLE_v10028716mg [Citrus clementina]
Length=358

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 142/260 (55%), Gaps = 28/260 (11%)
 Frame = +3

Query  192  SVTLFISLCAFTTASLPAGLII-------------TIVNNCPHTIWPAIQPNTGYPVLER  332
            + TLF+ L + T+ SL   LI+             T VN C +TIWP I  N G P L+ 
Sbjct  4    TTTLFMDLPSCTSTSLILPLIVLLATSQGVLSATFTFVNKCDYTIWPGILANAGSPRLDS  63

Query  333  GGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAP  506
             GF L + + RSFVAP   WSGR W RT C  +  G  +C TGDC  G++ECNG G A P
Sbjct  64   TGFELPQDSSRSFVAPTG-WSGRFWGRTRCNFDGSGSGSCLTGDCGSGQVECNGLGAAPP  122

Query  507  ATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQV  686
            ATLA+F L  G  DF  Y +SLVDG+NLPM +    G G C   GC  ++   CP +L+V
Sbjct  123  ATLAEFTLGSGGQDF--YDVSLVDGYNLPMIVESSGGSGLCSTTGCSTDVNRQCPAELRV  180

Query  687  RLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHD  866
                  G G    C S C AF + E CC   +N P  CK S YS  FK ACP +++YA+D
Sbjct  181  ------GEGDA--CKSACEAFGSAEYCCSGAFNTPATCKPSVYSQVFKSACPKSYSYAYD  232

Query  867  TPSSLMHECSAARELKIIFC  926
              +S    C+ A +  + FC
Sbjct  233  DATSTFT-CTGA-DYTVTFC  250



>gb|AAV64224.1| hypothetical protein C9002 [Zea mays]
Length=289

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 148/274 (54%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  HYIATTSTEQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNT  311
             Y A T++      F   ++++  F++  A     L   ++  + N CP  +WPA  PNT
Sbjct  5    QYSAWTTSAARHRVFSCALMALVSFVA--AGRPIVLADAIVFHVANRCPFPVWPASAPNT  62

Query  312  GYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL---NHGRFTCATGDCDGRLEC  482
            G+PVL  GGF + +   R  VAP A W+GR WARTGC       G   C TGDC+GRL C
Sbjct  63   GHPVLAGGGFYVPQGKSRRVVAP-ANWNGRFWARTGCNFTANGMGVAGCLTGDCEGRLAC  121

Query  483  NGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKG-----HCPVVGCR  647
            NG  GA PATL +  LH+  A  S+Y +SLVDG+NLP+ ++     G      C + GC 
Sbjct  122  NGSVGAPPATLVEVSLHEDAAKGSSYDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCA  181

Query  648  ANLLPACPRQLQVRLRARRGRGP-VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDF  824
             N+   CP +LQV      G G  VV C S C AF  D  CCR  Y  P  C+ + YS  
Sbjct  182  KNVNAVCPPELQVTATGSGGGGKTVVACKSACLAFGLDAFCCRGAYATPATCRGTVYSRL  241

Query  825  FKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            FK ACP+ ++YA+DT ++    C  A+E  + FC
Sbjct  242  FKDACPAYYSYAYDTAAATASGCY-AQEYIMTFC  274



>ref|XP_010934175.1| PREDICTED: thaumatin-like protein 1 [Elaeis guineensis]
Length=317

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 128/231 (55%), Gaps = 12/231 (5%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH  434
             T+ NNC +T+WP      G   LE  GFAL     RS  AP A+WSGR W RT C  N 
Sbjct  26   FTLTNNCEYTVWPGSLSGAGTVELETTGFALQTGESRSLNAP-AKWSGRFWGRTLCSTNS  84

Query  435  --GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTL  602
              G+FTC TGDC  G +EC+G G A PATLA+F L   G  DF  Y +SLVDG+N+PM +
Sbjct  85   TTGKFTCGTGDCGSGTVECSGFGAAVPATLAEFTLDGSGGMDF--YDVSLVDGYNVPMLV  142

Query  603  TPHDGK---GHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCR  773
             P       G+C   GC  +L   CP  L+V L +  G    V C S C AF + + CC 
Sbjct  143  VPQGATSPGGNCTATGCLVDLNGVCPSVLKVVLASANGGSESVACKSACDAFGSPQYCCS  202

Query  774  NNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              Y NP  CK S YS FFK+ACP  ++YA+D  SS    C  A  L I FC
Sbjct  203  GAYGNPSTCKPSSYSQFFKNACPRAYSYAYDDASS-TFTCYNANYL-ITFC  251



>ref|XP_007131695.1| hypothetical protein PHAVU_011G0342001g, partial [Phaseolus vulgaris]
 gb|ESW03689.1| hypothetical protein PHAVU_011G0342001g, partial [Phaseolus vulgaris]
Length=242

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 130/229 (57%), Gaps = 15/229 (7%)
 Frame = +3

Query  246  GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCV  425
            G   T VN C +T+WP I  N G P L+  GF L K T R+F A    WSGR WARTGC 
Sbjct  23   GATFTFVNRCDYTVWPGILANAGSPPLQSTGFELPKDTSRAFQASTG-WSGRFWARTGCT  81

Query  426  LN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMT  599
             +  G  +C TGDC  G++ECNG G A PATLA+F L  G  DF  Y +SLVDG+NLPM 
Sbjct  82   FDGSGSGSCLTGDCGSGQVECNGAGAAPPATLAEFTLGTGGQDF--YDVSLVDGYNLPMI  139

Query  600  LTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN  779
            +    G G C   GC ++L   CP +L    RA  G      C S C AF + E CC   
Sbjct  140  VEGTGGSGLCASTGCTSDLNQQCPAEL----RASEGSA----CKSACEAFGSPEYCCSGA  191

Query  780  YNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            Y +P  C+ S YS+ FK ACP +++YA+D  +S    CS A +  + FC
Sbjct  192  YGSPATCRPSIYSEMFKAACPRSYSYAYDDATSTFT-CSGA-DYTVTFC  238



>ref|XP_006342063.1| PREDICTED: thaumatin-like protein 1-like [Solanum tuberosum]
Length=335

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 132/245 (54%), Gaps = 10/245 (4%)
 Frame = +3

Query  201  LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP  380
            LF+++       + +    T+VN C  TIWP +  N G   L   GF L K   ++   P
Sbjct  12   LFLTITELFITGVNSAATFTMVNKCQQTIWPGLLSNAGIAPLSTTGFVLQKGESKTISVP  71

Query  381  RARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFS  554
             + W GR WART C  +  G+FTCATGDC  G++EC G     PATLA+F L  G     
Sbjct  72   TS-WGGRFWARTHCTEDSTGKFTCATGDCGSGKVECAGGNALPPATLAEFTL-DGSNGMD  129

Query  555  TYGLSLVDGFNLPMTLTPHDGKGH-CPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCN  731
             + +SLVDG+NLPM + P  G G+ C   GC  +L  ACP +L+V        G  V C 
Sbjct  130  FFDVSLVDGYNLPMLVVPQGGSGNNCTSTGCVVDLNGACPSELKVMSVG----GENVACK  185

Query  732  SGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAREL  911
            S C AF+ DE CC   YNNP  CK S YS  FK ACPS ++YA+D  +S    C+ A   
Sbjct  186  SACEAFRKDEYCCAGAYNNPTTCKPSSYSTLFKKACPSAYSYAYDDKTSTF-TCAGANNY  244

Query  912  KIIFC  926
             I FC
Sbjct  245  LITFC  249



>gb|EPS57841.1| hypothetical protein M569_16976, partial [Genlisea aurea]
Length=300

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 128/226 (57%), Gaps = 14/226 (6%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
              T VN C +T+WP I  N G   L+  GF L + + RSFVAP   WSGR W RTGC  +
Sbjct  11   TFTFVNRCEYTVWPGILANAGSARLDSAGFELRQGSSRSFVAPVG-WSGRFWGRTGCEFS  69

Query  432  HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
                +C TGDC  G+ ECNG G A P TL +F L  G  DF  Y +SLVDG+NLP+ +  
Sbjct  70   GESGSCRTGDCGSGQPECNGAGAAPPVTLVEFTLGTGGLDF--YDVSLVDGYNLPVIVDA  127

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
              G G C   GC A+L  ACP +L      R G G    C S C AF + E CC   YN+
Sbjct  128  TGGSGTCASTGCVADLNQACPSEL------RSGDGEA--CKSACEAFGSPEYCCSGAYNS  179

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  C+ S YS  FK ACP ++++A+D P+S    C+AA +  + FC
Sbjct  180  PAACRPSVYSQMFKSACPKSYSFAYDDPTSTFT-CAAA-DYTVTFC  223



>ref|XP_007163959.1| hypothetical protein PHAVU_L002100g [Phaseolus vulgaris]
 gb|ESW35953.1| hypothetical protein PHAVU_L002100g [Phaseolus vulgaris]
Length=252

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/257 (44%), Positives = 144/257 (56%), Gaps = 25/257 (10%)
 Frame = +3

Query  189  LSVTLFISLCAFTTASLP----AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL  356
            L  TLF+ +   T +++P    +   +T+ NNCP+++WP IQP  G PV+  GG  L   
Sbjct  8    LFFTLFLLI---TISAVPKPWASAATLTLSNNCPYSVWPGIQPGGGKPVVANGGLFLPPH  64

Query  357  THRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELH  533
              ++   P   WSGR+WAR GC  +  GR  CATGDC G L CNG GGA PATLA+  L 
Sbjct  65   QAQTVQLP-PLWSGRVWARHGCTFDSAGRGQCATGDCGGNLFCNGLGGAPPATLAELSLG  123

Query  534  QGHADFSTYGLSLVDGFNLPMTLTP------HDGKGHCPVVGCRANLLPACPRQLQVRLR  695
                DF  Y +S VDG+NLPMT+TP          G+C  VGC  +L   CP  LQVR R
Sbjct  124  PNQ-DF--YDVSFVDGYNLPMTITPIASPGLGPSSGNCGSVGCSRDLNTVCPMGLQVRSR  180

Query  696  ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS  875
             R     V+ C S C AF +   CC  +Y +   C  + YS  FK+ACP  ++YA D PS
Sbjct  181  ER-----VIACKSACMAFHSPNYCCTGSYASAQTCGPTEYSRIFKNACPKAYSYAFDDPS  235

Query  876  SLMHECSAARELKIIFC  926
            SL+  CS A  L + FC
Sbjct  236  SLV-TCSNANYL-VTFC  250



>ref|XP_010909541.1| PREDICTED: thaumatin-like protein [Elaeis guineensis]
Length=261

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 142/260 (55%), Gaps = 13/260 (5%)
 Frame = +3

Query  156  EQMAMAFPATILSVTLFISLCAFTTASLPAGLIIT--IVNNCPHTIWPAIQPNTGYPVLE  329
            EQ+ +    ++L   L      F   SL  G ++T  I N CP  IWPA  PN G+PV+ 
Sbjct  2    EQLILKLSTSVL-FPLIWQFILF--GSLVNGQLVTFHITNKCPFPIWPAAAPNAGHPVIG  58

Query  330  RGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAP  506
             GGF L     +   AP   W+GR WART C  N   +  C TGDCD  L CNG  G  P
Sbjct  59   DGGFFLPPGQTKRVHAP-PTWNGRFWARTDCNFNSTSKPLCQTGDCDSLLSCNGSIGMPP  117

Query  507  ATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQV  686
            ATL +  L +  +  S Y +S+VDG+NLP++++       C + GC  ++   CP +LQV
Sbjct  118  ATLVEVALQEDKSKPSFYDVSVVDGYNLPISVSTMPADRKCWIGGCTKSINSVCPPELQV  177

Query  687  RLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHD  866
              ++    G V+ C S C AF  D  CCRN+Y  P  CKAS YS  FK ACPS F+YA+D
Sbjct  178  LDQS----GGVIACKSACLAFDLDVFCCRNSYGKPQKCKASMYSKMFKDACPSYFSYAYD  233

Query  867  TPSSLMHECSAARELKIIFC  926
            +P  L++    +++  I FC
Sbjct  234  SPPPLVN--CYSKDYVITFC  251



>ref|XP_003614785.1| Pathogenesis-related protein [Medicago truncatula]
 gb|AES97743.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=282

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 137/234 (59%), Gaps = 15/234 (6%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            IL ++L +++      +  +  + TIVN C  T+WPA+ P   +     GGF L +    
Sbjct  8    ILPISLVLAIILSGQRTCESARVFTIVNYCKETLWPAVFPGEHF---NGGGFVLKQGQSS  64

Query  366  SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH  542
             F AP   WSGRIWARTGC  +  G   C TG C   L+C G  G  PA+LA+F L Q  
Sbjct  65   VFTAP-VSWSGRIWARTGCNFDQNGDGQCQTGACGTTLKCGG-AGKTPASLAEFTLAQ--  120

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDGFN+P+++ P +GKG+C   GC ++L   CP++L VR       G  V
Sbjct  121  PDF--YDVSLVDGFNVPISVKPINGKGNCSTAGCDSDLRLTCPKELSVR-----SNGKTV  173

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM  884
            GC S C  F TDE CCR N+ NP  C+ + YS  FK ACP++++YA+D P+S+ 
Sbjct  174  GCRSACDVFNTDEYCCRGNFGNPSTCRPTFYSKKFKEACPTSYSYAYDDPTSIF  227



>ref|XP_009128246.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=286

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 131/226 (58%), Gaps = 17/226 (8%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C  TIWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct  30   VFTIVNSCDQTIWPAITPGENF---NGGGFELKPGQSIVFNAPVG-WSGRIWGRTGCNFD  85

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TG C   L+C+  G   PA+LA+F L    A    Y +SLVDGFNLPM++TP
Sbjct  86   KTGTGTCETGSCGSTLKCSASG-KPPASLAEFTL----AALDFYDVSLVDGFNLPMSVTP  140

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC A+L   CP +L V+      +G VV C S C  F  DE CCR  Y N
Sbjct  141  MNGKGNCSVAGCVADLRSKCPPELAVK-----SKGKVVSCRSACDVFDRDEYCCRGVYGN  195

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P+ C+ + YS  FK ACP+ ++YA+D P+S+   CS   +  I FC
Sbjct  196  PVTCRPTNYSKMFKEACPTAYSYAYDDPTSIF-TCSGT-DYVISFC  239



>gb|KHG18980.1| hypothetical protein F383_08602 [Gossypium arboreum]
Length=240

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 136/250 (54%), Gaps = 25/250 (10%)
 Frame = +3

Query  186  ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR  365
            IL   LF  + A T         IT+ N C H +WP IQP+ G P+L RGGF L      
Sbjct  9    ILFAFLFFPISATT---------ITLYNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAY  59

Query  366  SFVAPRARWSGRIWARTGCVLN---HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ  536
            S   P   WSGR W R GC  +   HGR  CATGDC G L CNG GG  PATLA+  L Q
Sbjct  60   SMNLP-PLWSGRFWGRHGCSFDASGHGR--CATGDCGGSLFCNGLGGTPPATLAEITLAQ  116

Query  537  GHADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGP  716
               DF  Y +SLVDG+N+ M++TP  G G C   GC ++L   CP  LQVR   +     
Sbjct  117  -QQDF--YDVSLVDGYNIAMSITPFKGAGKCSYAGCVSDLNLMCPVALQVRDNKQ-----  168

Query  717  VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS  896
            VV C S C AF +   CC  ++ +P  CK + YS  FK ACP  ++YA+D P+S+   CS
Sbjct  169  VVACKSACFAFNSPRYCCTGSFGSPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIA-TCS  227

Query  897  AARELKIIFC  926
                L + FC
Sbjct  228  RGNYL-VTFC  236



>ref|XP_009400363.1| PREDICTED: thaumatin-like protein 1b [Musa acuminata subsp. malaccensis]
Length=326

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 138/261 (53%), Gaps = 17/261 (7%)
 Frame = +3

Query  156  EQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG  335
            E   ++ PA +L +T+ +    F       G   T VN C  T+WP I  N G P LE  
Sbjct  2    EPSLLSSPAPVLLLTVHLLFFLFHGGE---GATFTFVNRCGETVWPGILSNAGTPQLEST  58

Query  336  GFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDC-DGRLECNGRGGAAPAT  512
            GF L   + RSF AP A WSGR WARTGC    G ++CATGDC  G++ECNG G A PAT
Sbjct  59   GFELPVASSRSFQAP-AGWSGRFWARTGCSSTGGTWSCATGDCGSGQVECNGAGAAPPAT  117

Query  513  LAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH---DGKGHCPVVGCRANLLPACPRQLQ  683
            LA+F L    A    Y +SLVDG+NLPM +  +      G C   GC  +L   CP +L 
Sbjct  118  LAEFTLAPSSAGQDFYDVSLVDGYNLPMVVEANRRAGASGECAATGCVVDLNRMCPPEL-  176

Query  684  VRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAH  863
               R  +G      C S C AF T E CC   + +P  C+ S YS  FK ACP +++YA 
Sbjct  177  ---RTAQGEA----CRSACEAFGTPEYCCSGAFASPTTCRPSSYSQMFKAACPRSYSYAF  229

Query  864  DTPSSLMHECSAARELKIIFC  926
            D P+S    C+   +  I FC
Sbjct  230  DDPTSTF-TCAGEADYTITFC  249



>gb|KDO80739.1| hypothetical protein CISIN_1g023852mg [Citrus sinensis]
Length=276

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 132/227 (58%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            + TIVN+C  TIWPAI P   +     GGF L       F AP   WSGRIW R+GC  +
Sbjct  18   VFTIVNDCKETIWPAITPGENF---NNGGFPLKSGQSIVFNAPVG-WSGRIWGRSGCKFD  73

Query  432  -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
             +G  +C TG C   L+C+  G A PATLA+F L     DF  Y +SLVDGFNLPM++ P
Sbjct  74   KNGNGSCLTGACGTSLKCSASG-APPATLAEFTLSA--LDF--YDVSLVDGFNLPMSVKP  128

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
             +GKG+C V GC  +L   CP +L V+      +G  V C S C  F TDE CCR  Y N
Sbjct  129  INGKGNCSVAGCDGDLRLTCPSELSVK-----SKGKTVACRSACDVFNTDEYCCRGVYGN  183

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
            P++C+ + YS  FK ACP+ ++YA+D P+S+     A  +  I FC 
Sbjct  184  PVVCQPTYYSKKFKDACPTAYSYAYDDPTSIFT--CAGTDYVITFCS  228



>emb|CDO98353.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 128/225 (57%), Gaps = 10/225 (4%)
 Frame = +3

Query  255  ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-  431
            +T  N C H +WP IQP+ G P+L RGGF L      S   P A WSGR W R GC  + 
Sbjct  30   MTFYNKCSHPVWPGIQPSAGKPILARGGFKLPPNRSYSLRLP-AGWSGRFWGRHGCSFDA  88

Query  432  HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH  611
             GR  CATGDC G L CNG GG  PATLA+  L     DF  Y +SLVDG+NL +++TP 
Sbjct  89   SGRGRCATGDCGGSLFCNGLGGTPPATLAEITLGN-EQDF--YDVSLVDGYNLAISITPF  145

Query  612  DGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP  791
             G G C   GC ++L   CP  LQVR   +R    VV C S C AF +   CC  ++ NP
Sbjct  146  RGSGKCSYAGCVSDLNMMCPVGLQVRSHDKR---RVVACKSACFAFNSPRYCCTGSFGNP  202

Query  792  LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
              CK + YS  FK ACP  ++YA+D P+S+   C+    L + FC
Sbjct  203  QSCKPTAYSKIFKAACPRAYSYAYDDPTSIA-TCTGGNYL-VTFC  245



>ref|XP_011039126.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=285

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 132/237 (56%), Gaps = 10/237 (4%)
 Frame = +3

Query  222  FTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGR  401
            F+  S  +   IT+ N C H +WP IQP+ G P+L RGGF L      +   P   WSGR
Sbjct  56   FSHISEVSSTTITLHNKCTHPVWPGIQPSAGKPILARGGFKLPPNKAYTLHIP-PLWSGR  114

Query  402  IWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVD  578
             W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L +   DF  Y +SLVD
Sbjct  115  FWGRHGCSFDASGRGRCATGDCGGSLYCNGIGGTPPATLAEITLGK-EQDF--YDVSLVD  171

Query  579  GFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTD  758
            G+NL +++TP  G G C   GC ++L   CP  LQVR +  R    VV C S C AF + 
Sbjct  172  GYNLAVSITPFKGSGKCSYAGCVSDLNLMCPLGLQVRSKDNRR---VVACKSACFAFNSP  228

Query  759  ELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFCH  929
              CC   +  P  CK + YS  FK ACP  ++YA+D P+S+   C+    L + FCH
Sbjct  229  RYCCTGRFGTPQACKPTAYSRIFKAACPKAYSYAYDDPTSIA-TCTRGNYL-VTFCH  283



>ref|XP_010033700.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW84061.1| hypothetical protein EUGRSUZ_B00944 [Eucalyptus grandis]
Length=249

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 123/223 (55%), Gaps = 13/223 (6%)
 Frame = +3

Query  222  FTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGR  401
            F  A       +T VN C H +WPAIQP  G P+L RGGF L      +   P A WSGR
Sbjct  19   FHIADEALATTVTFVNRCAHPVWPAIQPGAGKPLLARGGFTLLPNKASTVRMP-ALWSGR  77

Query  402  IWARTGCVLN---HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSL  572
             W R GC  +   HGR  CATGDC G L CNG GG  PATLA+  L     D   Y +SL
Sbjct  78   FWGRHGCTFDANGHGR--CATGDCGGSLHCNGLGGTPPATLAEITLGN---DQDFYDVSL  132

Query  573  VDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFK  752
            VDG+NL +++TP  G G C   GC ++L   CP  LQVR         VV C S C AF 
Sbjct  133  VDGYNLAISITPFKGTGKCSYAGCVSDLNTMCPVGLQVRGHDNS----VVACKSACFAFN  188

Query  753  TDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL  881
            +   CC  ++ NP  CK + YS  FK ACP  ++YA+D P+S+
Sbjct  189  SPRYCCTGSFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSI  231



>ref|XP_008230703.1| PREDICTED: thaumatin-like protein [Prunus mume]
Length=260

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 125/227 (55%), Gaps = 8/227 (4%)
 Frame = +3

Query  249  LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL  428
            +   I N CP  IWPA  PN G PV+  GGF L     R   AP + W+GRIWARTGC  
Sbjct  29   VTFDIRNKCPFPIWPATAPNNGQPVIADGGFYLPAGQTRRISAPWS-WNGRIWARTGCNF  87

Query  429  -NHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT  605
             ++    C TGDC GRL CNG  G  P TL Q  L       + Y +SLVDG+NLP+ + 
Sbjct  88   ASNWNPACETGDCGGRLACNGLIGTPPVTLVQVSLQGDKDRPNFYDVSLVDGYNLPVAVL  147

Query  606  PHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN  785
                  +C + GC  NL   CP +L+V       +G VV C S C AF TD  CCRN Y 
Sbjct  148  SKPVASNCGIGGCLKNLKSWCPEELKVL----NSKGEVVACKSACLAFNTDPFCCRNEYG  203

Query  786  NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
             P  CK S YS  FK ACPS ++YA+D+P  L+  C ++ E  I FC
Sbjct  204  TPAKCKPSVYSKIFKDACPSYYSYAYDSPPPLV-TCKSS-EYVITFC  248



>gb|KHG02944.1| hypothetical protein F383_23941 [Gossypium arboreum]
Length=354

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 136/248 (55%), Gaps = 16/248 (6%)
 Frame = +3

Query  192  SVTLFISLCAFTTASLPA-GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS  368
            S+ L + L   T  S  A G   T VN C +T+WP I  N G P L+  GF L K + RS
Sbjct  9    SLALILYLIVLTLNSKGALGASFTFVNRCGYTVWPGILANAGSPTLDSTGFELPKDSSRS  68

Query  369  FVAPRARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGH  542
            F AP   WSGR W RTGC  +  G  TC TGDC  G++ECNG G A P TLA+F L  G 
Sbjct  69   FQAPTG-WSGRFWGRTGCTFDGSGSGTCVTGDCGSGQMECNGLGAAPPVTLAEFTLGTGG  127

Query  543  ADFSTYGLSLVDGFNLPMTLTPHDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV  722
             DF  Y +SLVDG+N+PM +    G G C   GC  +L   CP +L++        G   
Sbjct  128  QDF--YDVSLVDGYNIPMIVEGSGGSGLCASTGCTTDLNRQCPSELRI--------GDGD  177

Query  723  GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA  902
             C S C AF + E CC   Y+ P  CK S YS+ FK ACP +++YA+D  +S    C+ A
Sbjct  178  ACKSACEAFGSPEYCCSGAYSTPATCKPSVYSEMFKAACPRSYSYAYDDATSTF-TCTGA  236

Query  903  RELKIIFC  926
             +  + FC
Sbjct  237  -DYTVTFC  243



>ref|XP_004309088.1| PREDICTED: thaumatin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=326

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 128/226 (57%), Gaps = 7/226 (3%)
 Frame = +3

Query  252  IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN  431
            I +I NNCP+TIWP     +G P L   GF LY     + +     WSGRIWARTGC  N
Sbjct  55   IFSITNNCPYTIWPGTLSGSGTPPLPTTGFQLYS-GQSARIDSVPGWSGRIWARTGCTFN  113

Query  432  H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP  608
              G  TC TGDC GRLEC+G G   PA+L +  L +G+ D   Y +S+VDG+NLP+  TP
Sbjct  114  ELGVGTCQTGDCGGRLECDGNGATPPASLFEITLGKGN-DKDFYDVSIVDGYNLPLVATP  172

Query  609  HDGKGHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN  788
                G C   GC +++   CP++LQV +     R  V+GC S C AF +D+ CC   + N
Sbjct  173  RGVYGTCNATGCVSDINIGCPKELQV-VGGESERN-VIGCKSACDAFGSDQYCCSGQFAN  230

Query  789  PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC  926
            P  C+ S YS  FK ACP  ++YA D  +S       A E  IIFC
Sbjct  231  PTTCQPSSYSTIFKRACPRAYSYAFDDGTSTFT--CKAFEYAIIFC  274



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2821057249490