BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29635_g1_i1 len=3569 path=[3547:0-3568]

Length=3569
                                                                      Score     E

ref|XP_009764556.1|  PREDICTED: uncharacterized protein LOC104216...   1835   0.0      
ref|XP_009595115.1|  PREDICTED: uncharacterized protein LOC104091...   1832   0.0      
ref|XP_006353514.1|  PREDICTED: uncharacterized protein LOC102583098   1829   0.0      
ref|XP_004251655.1|  PREDICTED: uncharacterized protein LOC101265006   1822   0.0      
ref|XP_010656234.1|  PREDICTED: uncharacterized protein LOC100245850   1727   0.0      
ref|XP_011093677.1|  PREDICTED: uncharacterized protein LOC105173...   1721   0.0      
emb|CDP03209.1|  unnamed protein product                               1718   0.0      
ref|XP_007012924.1|  Mitochondrial-processing peptidase subunit b...   1681   0.0      
ref|XP_007204667.1|  hypothetical protein PRUPE_ppa000776mg            1670   0.0      
emb|CAN62001.1|  hypothetical protein VITISV_007878                    1664   0.0      Vitis vinifera
ref|XP_009352601.1|  PREDICTED: uncharacterized protein LOC103943948   1652   0.0      
ref|XP_010244340.1|  PREDICTED: uncharacterized protein LOC104588199   1652   0.0      
gb|KDO59292.1|  hypothetical protein CISIN_1g001831mg                  1650   0.0      
ref|XP_006475387.1|  PREDICTED: uncharacterized protein LOC102615135   1649   0.0      
gb|KGN60551.1|  hypothetical protein Csa_2G000590                      1646   0.0      
ref|XP_008459201.1|  PREDICTED: uncharacterized protein LOC103498...   1644   0.0      
ref|XP_002514172.1|  Mitochondrial-processing peptidase subunit b...   1633   0.0      Ricinus communis
ref|XP_009412236.1|  PREDICTED: uncharacterized protein LOC103993779   1630   0.0      
gb|KHN16670.1|  Putative zinc protease pqqL                            1617   0.0      
ref|XP_010911803.1|  PREDICTED: uncharacterized protein LOC105037...   1612   0.0      
ref|XP_010049573.1|  PREDICTED: uncharacterized protein LOC104438184   1608   0.0      
gb|EYU41612.1|  hypothetical protein MIMGU_mgv1a000803mg               1608   0.0      
gb|KDP33755.1|  hypothetical protein JCGZ_07326                        1606   0.0      
ref|XP_006584795.1|  PREDICTED: uncharacterized protein LOC100783565   1605   0.0      
ref|XP_007160251.1|  hypothetical protein PHAVU_002G305500g            1603   0.0      
ref|XP_006451387.1|  hypothetical protein CICLE_v10010146mg            1601   0.0      
ref|XP_010667309.1|  PREDICTED: uncharacterized protein LOC104884...   1600   0.0      
ref|XP_006853937.1|  hypothetical protein AMTR_s00036p00205320         1600   0.0      
ref|XP_010545331.1|  PREDICTED: uncharacterized protein LOC104817...   1597   0.0      
ref|XP_006580490.1|  PREDICTED: uncharacterized protein LOC100797999   1597   0.0      
ref|XP_008242442.1|  PREDICTED: uncharacterized protein LOC103340775   1596   0.0      
gb|KCW82271.1|  hypothetical protein EUGRSUZ_C03689                    1596   0.0      
ref|XP_008797884.1|  PREDICTED: uncharacterized protein LOC103712...   1590   0.0      
ref|XP_010536847.1|  PREDICTED: uncharacterized protein LOC104811...   1587   0.0      
ref|XP_008337631.1|  PREDICTED: uncharacterized protein LOC103400750   1586   0.0      
ref|XP_004141166.1|  PREDICTED: probable zinc protease PqqL-like       1585   0.0      
ref|XP_010911811.1|  PREDICTED: uncharacterized protein LOC105037...   1578   0.0      
ref|XP_010451407.1|  PREDICTED: uncharacterized protein LOC104733...   1568   0.0      
ref|XP_010443322.1|  PREDICTED: uncharacterized protein LOC104726...   1564   0.0      
gb|KFK27236.1|  hypothetical protein AALP_AA8G355300                   1564   0.0      
ref|XP_009120182.1|  PREDICTED: uncharacterized protein LOC103845...   1563   0.0      
ref|XP_006279942.1|  hypothetical protein CARUB_v10025806mg            1561   0.0      
ref|XP_010483149.1|  PREDICTED: uncharacterized protein LOC104761...   1561   0.0      
ref|XP_004968985.1|  PREDICTED: uncharacterized protein LOC101760...   1555   0.0      
ref|XP_010231921.1|  PREDICTED: uncharacterized protein LOC100828786   1553   0.0      
gb|KDO59293.1|  hypothetical protein CISIN_1g001831mg                  1548   0.0      
ref|XP_010090003.1|  putative zinc protease pqqL                       1547   0.0      
ref|XP_010911827.1|  PREDICTED: uncharacterized protein LOC105037...   1538   0.0      
ref|XP_008797885.1|  PREDICTED: uncharacterized protein LOC103712...   1525   0.0      
ref|XP_010911819.1|  PREDICTED: uncharacterized protein LOC105037...   1519   0.0      
ref|XP_009764557.1|  PREDICTED: uncharacterized protein LOC104216...   1515   0.0      
gb|KHM99834.1|  Putative zinc protease pqqL                            1514   0.0      
ref|XP_004287512.1|  PREDICTED: probable zinc protease PqqL-like       1514   0.0      
ref|XP_009595116.1|  PREDICTED: uncharacterized protein LOC104091...   1513   0.0      
emb|CDY32879.1|  BnaC09g33260D                                         1511   0.0      
ref|XP_008797886.1|  PREDICTED: uncharacterized protein LOC103712...   1510   0.0      
emb|CDY32763.1|  BnaA10g10860D                                         1509   0.0      
gb|KDO59294.1|  hypothetical protein CISIN_1g001831mg                  1509   0.0      
gb|AET05136.2|  peptidase M16 inactive domain protein                  1506   0.0      
dbj|BAD87946.1|  chloroplast processing enzyme-like protein            1499   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646001.1|  PREDICTED: uncharacterized protein LOC102701684   1490   0.0      
ref|XP_004968986.1|  PREDICTED: uncharacterized protein LOC101760...   1490   0.0      
ref|XP_002455798.1|  hypothetical protein SORBIDRAFT_03g025400         1483   0.0      Sorghum bicolor [broomcorn]
ref|XP_004157955.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...   1479   0.0      
ref|XP_010667310.1|  PREDICTED: uncharacterized protein LOC104884...   1477   0.0      
ref|XP_004503524.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...   1473   0.0      
gb|KCW82272.1|  hypothetical protein EUGRSUZ_C03689                    1466   0.0      
ref|NP_200484.1|  Insulinase (peptidase family M16) protein            1450   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHG23944.1|  putative zinc protease pqqL                            1449   0.0      
ref|XP_002866163.1|  peptidase M16 family protein                      1446   0.0      
ref|XP_007012923.1|  Mitochondrial-processing peptidase subunit b...   1442   0.0      
ref|XP_007012922.1|  Mitochondrial-processing peptidase subunit b...   1422   0.0      
ref|XP_010545332.1|  PREDICTED: uncharacterized protein LOC104817...   1399   0.0      
ref|XP_011093678.1|  PREDICTED: uncharacterized protein LOC105173...   1399   0.0      
ref|XP_010536848.1|  PREDICTED: uncharacterized protein LOC104811...   1396   0.0      
ref|XP_010911834.1|  PREDICTED: uncharacterized protein LOC105037...   1393   0.0      
ref|XP_010451413.1|  PREDICTED: uncharacterized protein LOC104733...   1384   0.0      
ref|XP_010443323.1|  PREDICTED: uncharacterized protein LOC104726...   1380   0.0      
ref|XP_010483150.1|  PREDICTED: uncharacterized protein LOC104761...   1377   0.0      
ref|XP_008459210.1|  PREDICTED: uncharacterized protein LOC103498...   1363   0.0      
gb|EYU41611.1|  hypothetical protein MIMGU_mgv1a020497mg               1342   0.0      
ref|XP_002985407.1|  hypothetical protein SELMODRAFT_181652            1330   0.0      
ref|XP_008797887.1|  PREDICTED: uncharacterized protein LOC103712...   1311   0.0      
ref|XP_009120183.1|  PREDICTED: uncharacterized protein LOC103845...   1300   0.0      
ref|XP_006401292.1|  hypothetical protein EUTSA_v10012682mg            1278   0.0      
ref|XP_002987175.1|  hypothetical protein SELMODRAFT_182881            1274   0.0      
ref|XP_001774258.1|  predicted protein                                 1246   0.0      
ref|XP_010688399.1|  PREDICTED: uncharacterized protein LOC104902...   1238   0.0      
tpg|DAA59001.1|  TPA: hypothetical protein ZEAMMB73_046584             1206   0.0      
ref|XP_009764558.1|  PREDICTED: uncharacterized protein LOC104216...   1067   0.0      
ref|XP_009595117.1|  PREDICTED: uncharacterized protein LOC104091...   1064   0.0      
ref|XP_006401291.1|  hypothetical protein EUTSA_v10012682mg            1035   0.0      
ref|XP_003630660.1|  Chloroplast processing enzyme-like protein         978   0.0      
ref|XP_010688402.1|  PREDICTED: uncharacterized protein LOC104902...    968   0.0      
gb|KHG10444.1|  putative zinc protease pqqL                             875   0.0      
gb|EMT28860.1|  Putative zinc protease pqqL                             845   0.0      
gb|EEE54808.1|  hypothetical protein OsJ_02226                          859   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010485190.1|  PREDICTED: uncharacterized protein LOC104763532    835   0.0      
gb|EMS58066.1|  putative zinc protease pqqL                             841   0.0      
ref|NP_001136725.1|  uncharacterized protein LOC100216862               789   0.0      Zea mays [maize]
ref|XP_005649759.1|  chloroplast processing enzyme-like protein         754   0.0      
ref|XP_002502523.1|  predicted protein                                  721   0.0      Micromonas commoda
ref|XP_003056917.1|  predicted protein                                  702   0.0      
ref|XP_002952218.1|  hypothetical protein VOLCADRAFT_105434             688   0.0      
tpg|DAA59000.1|  TPA: hypothetical protein ZEAMMB73_046584              674   0.0      
ref|XP_005826780.1|  hypothetical protein GUITHDRAFT_143191             669   0.0      
emb|CEF98053.1|  Metalloenzyme, LuxS/M16 peptidase-like                 651   0.0      
ref|XP_001417805.1|  predicted protein                                  635   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_003079435.1|  putative zinc protease PQQL (ISS)                  635   0.0      
gb|EMS58065.1|  hypothetical protein TRIUR3_26510                       606   0.0      
ref|XP_007513960.1|  predicted protein                                  629   0.0      
ref|XP_003630661.1|  Zinc protease PQQL-like protein                    580   0.0      
ref|XP_002448515.1|  hypothetical protein SORBIDRAFT_06g028295          550   3e-180   Sorghum bicolor [broomcorn]
ref|XP_009620904.1|  PREDICTED: uncharacterized protein LOC104112...    472   5e-144   
ref|WP_022817736.1|  peptidase M16                                      466   3e-142   
ref|WP_020532664.1|  hypothetical protein                               455   6e-138   
ref|WP_015334283.1|  peptidase M16 domain protein                       450   4e-136   
ref|XP_009620905.1|  PREDICTED: uncharacterized protein LOC104112...    448   2e-135   
ref|WP_010853439.1|  putative zinc protease                             447   5e-135   
ref|WP_014456599.1|  putative Zn-dependent peptidase                    447   6e-135   
ref|WP_038032229.1|  hypothetical protein                               442   3e-133   
ref|WP_037572693.1|  hypothetical protein                               438   2e-132   
ref|WP_012682228.1|  putative metallopeptidase                          438   9e-132   
ref|WP_012500445.1|  peptidase M16 domain-containing protein            437   3e-131   
gb|ADI23662.1|  predicted Zn-dependent peptidases                       436   4e-131   
ref|WP_002700665.1|  peptidase M16                                      436   5e-131   
ref|WP_009186036.1|  peptidase M16                                      434   2e-130   
ref|WP_005671270.1|  hypothetical protein                               432   3e-129   
ref|WP_008104727.1|  peptidase, M16 (pitrilysin) family                 431   4e-129   
ref|WP_022837550.1|  MULTISPECIES: peptidase M16                        431   5e-129   
ref|WP_009285031.1|  peptidase M16                                      431   7e-129   
ref|WP_019988600.1|  hypothetical protein                               429   3e-128   
ref|WP_036216474.1|  peptidase M16                                      429   6e-128   
ref|WP_026773810.1|  hypothetical protein                               427   7e-128   
ref|WP_036984505.1|  hypothetical protein                               427   9e-128   
ref|WP_027866174.1|  peptidase M16                                      428   1e-127   
ref|WP_018479433.1|  peptidase M16                                      427   1e-127   
ref|WP_026770341.1|  hypothetical protein                               426   2e-127   
ref|WP_013446016.1|  peptidase M16                                      425   5e-127   
ref|WP_020652642.1|  hypothetical protein                               425   1e-126   
ref|WP_036245117.1|  peptidase M16                                      424   2e-126   
ref|WP_036237660.1|  peptidase M16                                      422   8e-126   
ref|WP_014021800.1|  peptidase M16                                      422   2e-125   
ref|WP_026850055.1|  hypothetical protein                               421   2e-125   
ref|WP_012929860.1|  peptidase M16                                      421   2e-125   
ref|WP_006927433.1|  peptidase M16 domain protein                       421   3e-125   
ref|WP_013446024.1|  peptidase M16                                      420   4e-125   
ref|WP_015814355.1|  peptidase M16                                      420   5e-125   
ref|WP_026260373.1|  hypothetical protein                               419   1e-124   
ref|WP_026632348.1|  peptidase M16                                      417   6e-124   
ref|WP_009032964.1|  peptidase M16                                      414   1e-122   
ref|WP_020596692.1|  peptidase M16                                      414   1e-122   
ref|WP_037349103.1|  peptidase M16                                      412   3e-122   
ref|WP_007653940.1|  peptidase M16                                      412   4e-122   
ref|WP_014771850.1|  peptidase M16                                      409   4e-121   
ref|WP_008509548.1|  peptidase M16                                      409   5e-121   
ref|WP_027885255.1|  peptidase M16                                      409   5e-121   
ref|WP_020889274.1|  putative zinc protease pqqL                        408   9e-121   
ref|WP_020606917.1|  peptidase M16                                      407   3e-120   
ref|WP_013870505.1|  peptidase M16                                      407   4e-120   
emb|CEA16650.1|  hypothetical protein ING2E5B_1913                      407   4e-120   
ref|WP_019596147.1|  hypothetical protein                               405   8e-120   
ref|WP_037321148.1|  peptidase M16                                      405   2e-119   
ref|WP_034779297.1|  peptidase M16                                      404   4e-119   
ref|WP_036678440.1|  peptidase M16                                      402   7e-119   
ref|WP_016193785.1|  putative Zinc protease pqqL                        401   3e-118   
ref|WP_018621945.1|  peptidase M16                                      400   1e-117   
ref|WP_028607772.1|  peptidase M16                                      400   1e-117   
dbj|GAL75740.1|  probable zinc protease pqqL                            399   1e-117   
ref|WP_019942309.1|  peptidase M16                                      399   2e-117   
ref|WP_034749717.1|  peptidase M16                                      399   2e-117   
ref|WP_027880659.1|  peptidase M16                                      398   6e-117   
ref|WP_028290501.1|  peptidase M16                                      398   7e-117   
ref|WP_026838967.1|  peptidase M16                                      398   8e-117   
ref|WP_036173780.1|  peptidase M16                                      397   1e-116   
dbj|GAK94093.1|  probable zinc protease PqqL                            397   2e-116   
ref|WP_013452711.1|  peptidase M16                                      397   2e-116   
ref|WP_036585478.1|  peptidase M16                                      395   3e-116   
dbj|BAO56405.1|  probable zinc protease pqqL                            396   3e-116   
ref|WP_016193858.1|  putative Zinc protease                             395   5e-116   
ref|WP_038493568.1|  peptidase M16                                      395   5e-116   
ref|WP_035820302.1|  peptidase M16                                      395   7e-116   
gb|AHG90196.1|  peptidase M16 domain protein                            394   1e-115   
ref|WP_013445902.1|  peptidase m16 domain-containing protein            394   1e-115   
dbj|GAK90566.1|  probable zinc protease PqqL                            395   2e-115   
gb|ADE77112.1|  unknown                                                 372   2e-115   
gb|AHF14446.1|  peptidase M16                                           392   1e-114   
ref|WP_020896085.1|  putative Zinc protease pqqL                        391   2e-114   
ref|WP_026327018.1|  peptidase M16                                      391   2e-114   
ref|WP_035727097.1|  hypothetical protein                               390   2e-114   
ref|WP_026914815.1|  peptidase M16                                      390   3e-114   
ref|WP_028068907.1|  peptidase M16                                      391   3e-114   
ref|WP_006987279.1|  peptidase M16                                      390   4e-114   
ref|WP_018526805.1|  hypothetical protein                               391   1e-113   
ref|WP_028663749.1|  peptidase M16                                      389   1e-113   
ref|WP_039142542.1|  peptidase M16                                      389   1e-113   
ref|WP_008270970.1|  peptidase M16                                      389   1e-113   
ref|WP_020702247.1|  hypothetical protein                               388   2e-113   
ref|WP_028892645.1|  peptidase M16                                      388   2e-113   
ref|WP_035135023.1|  peptidase M16                                      388   3e-113   
ref|WP_011708720.1|  peptidase M16                                      388   4e-113   
ref|WP_012780235.1|  peptidase M16                                      385   2e-112   
ref|WP_028889299.1|  peptidase M16                                      384   7e-112   
ref|WP_015692628.1|  peptidase M16                                      385   8e-112   
ref|WP_027395655.1|  peptidase M16                                      384   8e-112   
ref|WP_028523129.1|  peptidase M16                                      383   1e-111   
ref|WP_025763593.1|  peptidase M16                                      382   2e-111   
gb|ETZ19524.1|  peptidase M16                                           382   3e-111   
ref|WP_002658415.1|  peptidase M16                                      383   4e-111   
ref|WP_025018449.1|  peptidase M16                                      382   4e-111   
ref|WP_032951224.1|  peptidase M16                                      382   4e-111   
ref|WP_016198467.1|  peptidase M16 domain-containing protein            382   4e-111   
ref|WP_016277918.1|  zinc protease                                      381   6e-111   
gb|EIY34189.1|  hypothetical protein HMPREF1065_03594                   381   6e-111   
ref|WP_018631205.1|  peptidase M16                                      381   7e-111   
ref|WP_010399558.1|  peptidase M16 domain-containing protein            381   8e-111   
ref|WP_015030544.1|  peptidase M16                                      381   9e-111   
ref|WP_031266645.1|  peptidase M16                                      380   1e-110   
ref|WP_036984999.1|  peptidase M16                                      380   1e-110   
gb|EFG19351.1|  peptidase M16 inactive domain protein                   380   1e-110   
gb|EOS04640.1|  zinc protease                                           380   1e-110   
ref|WP_002995276.1|  peptidase M16                                      381   1e-110   
dbj|GAE15600.1|  probable zinc protease pqqL                            380   1e-110   
gb|KDS26008.1|  peptidase M16 inactive domain protein                   380   2e-110   
ref|WP_024566159.1|  peptidase M16                                      380   2e-110   
ref|WP_032952413.1|  peptidase M16                                      380   2e-110   
ref|WP_008674754.1|  peptidase M16                                      380   2e-110   
ref|WP_032934802.1|  peptidase M16                                      380   2e-110   
ref|WP_005851750.1|  peptidase M16                                      380   2e-110   
gb|KDS32756.1|  peptidase M16 inactive domain protein                   380   2e-110   
ref|WP_012055788.1|  peptidase M16                                      380   2e-110   
ref|WP_022508219.1|  putative zinc protease                             380   2e-110   
ref|WP_032937694.1|  peptidase M16                                      380   2e-110   
dbj|GAE20485.1|  probable zinc protease pqqL                            379   2e-110   
ref|WP_008669483.1|  MULTISPECIES: peptidase M16                        380   2e-110   
ref|WP_035591217.1|  peptidase M16                                      380   3e-110   
ref|WP_038699199.1|  peptidase M16                                      380   3e-110   
ref|WP_027325359.1|  peptidase M16                                      379   4e-110   
gb|EEO46948.2|  peptidase M16 inactive domain protein                   379   6e-110   Bacteroides dorei 5_1_36/D4
ref|WP_021348278.1|  peptidase M16                                      379   6e-110   
ref|WP_038609857.1|  peptidase M16                                      379   6e-110   
ref|WP_008656067.1|  peptidase M16                                      379   7e-110   
gb|KFX73462.1|  peptidase M16                                           379   7e-110   
ref|WP_032948244.1|  peptidase M16                                      379   7e-110   
ref|WP_007833540.1|  peptidase M16                                      379   7e-110   
ref|WP_035758779.1|  peptidase M16                                      378   7e-110   
ref|WP_007850346.1|  peptidase M16                                      378   8e-110   
ref|WP_008507477.1|  peptidase M16                                      379   9e-110   
ref|WP_034845366.1|  peptidase M16                                      379   9e-110   
ref|WP_009089584.1|  peptidase M16                                      379   9e-110   
gb|KGT08758.1|  peptidase M16                                           378   1e-109   
ref|WP_022052387.1|  putative uncharacterized protein                   377   2e-109   
ref|WP_024567841.1|  peptidase M16                                      377   2e-109   
ref|WP_039134836.1|  peptidase M16                                      377   2e-109   
ref|WP_032535661.1|  MULTISPECIES: peptidase M16                        377   2e-109   
ref|WP_022011060.1|  putative uncharacterized protein                   377   2e-109   
ref|WP_003005602.1|  peptidase M16                                      377   3e-109   
ref|WP_036776511.1|  peptidase M16                                      375   4e-109   
ref|WP_005810040.1|  peptidase M16                                      376   4e-109   
ref|WP_006744409.1|  peptidase M16                                      376   5e-109   
ref|WP_027374706.1|  peptidase M16                                      376   7e-109   
ref|WP_035375120.1|  peptidase M16                                      375   8e-109   
ref|WP_032531804.1|  peptidase M16                                      375   9e-109   
ref|WP_014798076.1|  Zn-dependent peptidase                             376   1e-108   
ref|WP_022231868.1|  peptidase M16 inactive domain protein              375   1e-108   
ref|WP_026752023.1|  hypothetical protein                               375   1e-108   
ref|WP_031525868.1|  peptidase M16                                      375   2e-108   
ref|WP_008450137.1|  zinc protease PqqL                                 375   2e-108   
ref|WP_024268396.1|  putative zinc protease pqqL                        375   2e-108   
ref|WP_033562479.1|  peptidase M16                                      375   2e-108   
ref|WP_007558487.1|  peptidase M16                                      374   3e-108   
emb|CDS91307.1|  putative zinc protease                                 374   3e-108   
ref|WP_019920242.1|  hypothetical protein                               374   5e-108   
ref|WP_034735454.1|  peptidase M16                                      374   6e-108   
ref|WP_021931244.1|  putative uncharacterized protein                   373   6e-108   
ref|WP_005775755.1|  peptidase M16                                      373   7e-108   
ref|WP_005818638.1|  peptidase M16                                      372   1e-107   
ref|WP_022278305.1|  putative uncharacterized protein                   372   1e-107   
gb|KHM44955.1|  peptidase M16                                           372   2e-107   
ref|WP_018109708.1|  hypothetical protein                               371   2e-107   
ref|WP_036229493.1|  peptidase M16                                      371   3e-107   
ref|WP_021970950.1|  peptidase M16 inactive domain protein              371   3e-107   
ref|WP_037352188.1|  hypothetical protein                               371   3e-107   
ref|WP_022354570.1|  putative uncharacterized protein                   371   4e-107   
ref|WP_021643908.1|  peptidase M16 inactive domain protein              370   4e-107   
ref|WP_034696852.1|  peptidase M16                                      371   5e-107   
ref|WP_029904510.1|  peptidase M16                                      370   5e-107   
ref|WP_034543960.1|  peptidase M16                                      371   5e-107   
ref|WP_024981415.1|  peptidase M16                                      370   7e-107   
ref|WP_027379900.1|  peptidase M16                                      370   8e-107   
gb|ABM53554.1|  putative zinc protease                                  370   9e-107   
dbj|GAE23945.1|  probable zinc protease pqqL                            370   1e-106   
ref|WP_007094614.1|  peptidase M16                                      363   1e-106   
ref|WP_018710879.1|  peptidase M16                                      369   1e-106   
ref|WP_022506663.1|  uncharacterized protein                            369   3e-106   
ref|WP_034709926.1|  peptidase M16                                      368   4e-106   
ref|WP_005939320.1|  hypothetical protein                               368   5e-106   
ref|WP_006799571.1|  peptidase M16                                      368   5e-106   
ref|WP_038108153.1|  peptidase M16                                      368   5e-106   
ref|WP_034731501.1|  peptidase M16                                      368   6e-106   
ref|WP_022339422.1|  putative uncharacterized protein                   367   9e-106   
ref|WP_015809943.1|  peptidase M16                                      367   9e-106   
ref|WP_029294604.1|  peptidase M16                                      367   1e-105   
ref|WP_021069767.1|  hypothetical protein                               367   1e-105   
ref|WP_011109196.1|  peptidase M16                                      366   2e-105   
ref|WP_024994506.1|  peptidase M16                                      366   2e-105   
ref|WP_008759990.1|  MULTISPECIES: peptidase M16                        366   2e-105   
ref|WP_004324996.1|  peptidase M16                                      366   3e-105   
ref|WP_022455317.1|  peptidase M16 inactive domain protein              365   3e-105   
ref|WP_036175518.1|  peptidase M16                                      366   4e-105   
ref|WP_004309865.1|  MULTISPECIES: peptidase M16                        365   5e-105   
gb|EKD31889.1|  hypothetical protein ACD_77C00224G0009                  365   5e-105   
ref|WP_010536916.1|  MULTISPECIES: peptidase M16                        365   7e-105   
ref|WP_035694139.1|  peptidase M16                                      364   8e-105   
ref|WP_009000531.1|  peptidase M16                                      364   1e-104   
ref|WP_007566408.1|  peptidase M16                                      364   1e-104   
ref|WP_004304602.1|  MULTISPECIES: peptidase M16                        363   2e-104   
ref|WP_008650893.1|  peptidase M16                                      363   2e-104   
ref|WP_018279180.1|  hypothetical protein                               363   2e-104   
ref|WP_016272639.1|  zinc protease                                      363   3e-104   
ref|WP_026132438.1|  peptidase M16                                      363   3e-104   
ref|WP_009037041.1|  MULTISPECIES: peptidase M16                        362   4e-104   
ref|WP_039452296.1|  peptidase M16                                      362   4e-104   
ref|WP_022125976.1|  peptidase M16 inactive domain protein              362   6e-104   
ref|WP_022826704.1|  peptidase M16                                      362   6e-104   
ref|WP_004301800.1|  peptidase M16                                      362   6e-104   
ref|WP_014220703.1|  peptidase M16                                      362   6e-104   
ref|WP_028071416.1|  hypothetical protein                               362   7e-104   
ref|WP_026903875.1|  peptidase M16                                      362   8e-104   
ref|WP_013444355.1|  peptidase m16 domain-containing protein            362   9e-104   
ref|WP_013634131.1|  peptidase M16                                      361   1e-103   
ref|WP_034673204.1|  peptidase M16                                      361   1e-103   
ref|WP_031503918.1|  peptidase M16                                      361   2e-103   
ref|WP_034696854.1|  peptidase M16                                      361   2e-103   
gb|KDS58489.1|  peptidase M16 inactive domain protein                   360   2e-103   
ref|WP_027125308.1|  hypothetical protein                               360   2e-103   
ref|WP_005835498.1|  peptidase M16                                      360   2e-103   
ref|WP_005785348.1|  peptidase M16                                      360   3e-103   
dbj|GAE82434.1|  zinc protease PqqL                                     360   3e-103   
ref|WP_006842819.1|  peptidase M16                                      360   3e-103   
ref|WP_011202237.1|  peptidase M16                                      360   3e-103   
ref|WP_013547089.1|  peptidase M16                                      360   3e-103   
ref|WP_032569966.1|  peptidase M16                                      360   4e-103   
ref|WP_021892441.1|  putative uncharacterized protein                   360   4e-103   
ref|WP_025833285.1|  peptidase M16                                      360   4e-103   
ref|WP_009291681.1|  MULTISPECIES: peptidase M16                        360   4e-103   
ref|WP_008862237.1|  peptidase M16                                      360   4e-103   
ref|WP_010992245.1|  peptidase M16                                      360   4e-103   
ref|WP_022401684.1|  uncharacterized protein                            360   4e-103   
ref|WP_032579057.1|  peptidase M16                                      360   4e-103   
ref|WP_005813079.1|  peptidase M16                                      360   5e-103   
emb|CDA85149.1|  uncharacterized protein BN772_03472                    360   5e-103   
ref|WP_022274904.1|  uncharacterized protein                            360   5e-103   
dbj|GAK77567.1|  probable zinc protease pqqL                            356   5e-103   
ref|WP_008658826.1|  MULTISPECIES: peptidase M16                        359   5e-103   
ref|WP_023578509.1|  putative zinc protease pqqL                        359   6e-103   
ref|WP_032564318.1|  peptidase M16                                      358   9e-103   
ref|WP_032570606.1|  peptidase M16                                      358   1e-102   
ref|WP_032566237.1|  peptidase M16                                      358   1e-102   
ref|WP_008244674.1|  putative zinc protease                             358   1e-102   
ref|WP_032566285.1|  peptidase M16                                      358   1e-102   
ref|WP_032557971.1|  peptidase M16                                      358   1e-102   
ref|WP_005801229.1|  peptidase M16                                      358   1e-102   
ref|WP_015532468.1|  Predicted Zn-dependent peptidases                  358   1e-102   
ref|WP_008767995.1|  peptidase M16                                      358   2e-102   
ref|WP_008020904.1|  peptidase M16                                      358   2e-102   
ref|WP_032575449.1|  peptidase M16                                      358   2e-102   
ref|WP_008645655.1|  peptidase M16                                      358   2e-102   
ref|WP_020612360.1|  hypothetical protein                               358   2e-102   
ref|WP_032591524.1|  peptidase M16                                      357   3e-102   
ref|WP_026724261.1|  peptidase M16                                      357   3e-102   
ref|WP_037997130.1|  hypothetical protein                               357   3e-102   
ref|WP_022131113.1|  uncharacterized protein                            357   3e-102   
ref|WP_004316683.1|  MULTISPECIES: peptidase M16                        357   4e-102   
ref|WP_009039685.1|  peptidase M16                                      357   4e-102   
ref|WP_038011429.1|  hypothetical protein                               357   4e-102   
ref|WP_007765130.1|  peptidase M16                                      357   4e-102   
ref|WP_032582544.1|  peptidase M16                                      357   4e-102   
ref|WP_005795939.1|  peptidase M16                                      357   5e-102   
ref|WP_032595590.1|  peptidase M16                                      357   6e-102   
ref|WP_037984323.1|  hypothetical protein                               356   6e-102   
ref|WP_032559471.1|  peptidase M16                                      356   6e-102   
ref|WP_024996258.1|  peptidase M16                                      357   6e-102   
ref|WP_005828850.1|  MULTISPECIES: peptidase M16                        357   6e-102   
ref|WP_017260090.1|  hypothetical protein                               356   8e-102   
ref|WP_037997799.1|  hypothetical protein                               356   8e-102   
ref|WP_005677428.1|  peptidase M16                                      356   9e-102   
ref|WP_037984161.1|  hypothetical protein                               356   1e-101   
ref|WP_032575694.1|  peptidase M16                                      355   2e-101   
ref|WP_032532781.1|  peptidase M16                                      355   2e-101   
ref|WP_013927832.1|  peptidase M16                                      355   2e-101   
gb|EXY91799.1|  peptidase M16 inactive domain protein                   354   3e-101   
ref|WP_008246661.1|  peptidase M16                                      354   4e-101   
ref|WP_013616730.1|  peptidase M16                                      354   4e-101   
ref|WP_004289585.1|  MULTISPECIES: peptidase M16                        354   5e-101   
ref|WP_023570678.1|  putative zinc protease pqqL                        353   6e-101   
gb|EIY38967.1|  hypothetical protein HMPREF1062_00476                   354   6e-101   
ref|WP_029429355.1|  peptidase M16                                      353   7e-101   
gb|EFV29571.1|  peptidase M16 inactive domain-containing protein        353   7e-101   
ref|WP_026367861.1|  peptidase M16                                      353   8e-101   
ref|WP_034752321.1|  peptidase M16                                      353   8e-101   
ref|WP_023573428.1|  putative zinc protease pqqL                        353   9e-101   
ref|WP_029428731.1|  peptidase M16                                      353   9e-101   
ref|WP_022210294.1|  uncharacterized protein                            353   1e-100   
ref|WP_016661494.1|  zinc protease                                      352   2e-100   
ref|WP_021846540.1|  peptidase M16 inactive domain protein              352   2e-100   
ref|WP_013620790.1|  peptidase M16 domain-containing protein            352   3e-100   
ref|WP_005657877.1|  peptidase M16                                      352   3e-100   
ref|WP_026996286.1|  peptidase M16                                      351   3e-100   
ref|WP_008236154.1|  peptidase M16 domain-containing protein            351   4e-100   
ref|WP_007212748.1|  peptidase M16                                      352   4e-100   
ref|WP_034645727.1|  hypothetical protein                               351   4e-100   
ref|WP_013254279.1|  peptidase M16 domain-containing protein            352   4e-100   
ref|WP_034753947.1|  peptidase M16                                      352   4e-100   
ref|WP_026314807.1|  peptidase M16                                      351   6e-100   
ref|WP_033565338.1|  hypothetical protein                               350   1e-99    
ref|WP_025834953.1|  peptidase M16                                      350   1e-99    
ref|WP_039370688.1|  peptidase M16                                      350   1e-99    
ref|WP_012790704.1|  peptidase M16 domain-containing protein            349   2e-99    
ref|WP_035738796.1|  peptidase M16                                      349   2e-99    
ref|WP_009860612.1|  peptidase M16                                      349   2e-99    
gb|AHF11852.1|  peptidase M16                                           349   2e-99    
ref|WP_022394438.1|  peptidase M16 inactive domain protein              349   3e-99    
ref|WP_009129052.1|  hypothetical protein                               349   3e-99    
ref|WP_009129046.1|  hypothetical protein                               348   3e-99    
ref|WP_005925120.1|  hypothetical protein                               348   4e-99    
ref|WP_002559531.1|  MULTISPECIES: peptidase M16                        348   4e-99    
ref|WP_022162584.1|  putative uncharacterized protein                   348   4e-99    
ref|WP_013757390.1|  peptidase M16 domain-containing protein            348   5e-99    
ref|WP_022129185.1|  peptidase M16 inactive domain protein              348   6e-99    
ref|WP_010801300.1|  MULTISPECIES: hypothetical protein                 348   6e-99    
ref|WP_034721415.1|  peptidase M16                                      348   7e-99    
ref|WP_008507615.1|  peptidase M16 domain protein                       347   1e-98    
ref|WP_007478529.1|  peptidase M16                                      347   2e-98    
ref|WP_035640659.1|  peptidase M16                                      347   2e-98    
ref|WP_021935837.1|  uncharacterized protein                            347   2e-98    
gb|AGY52727.1|  putative zinc protease pqqL                             346   2e-98    
ref|WP_008156015.1|  peptidase M16                                      346   2e-98    
ref|WP_007757298.1|  peptidase, M16 family                              343   5e-98    
ref|WP_018338717.1|  hypothetical protein                               345   7e-98    
ref|WP_022020472.1|  peptidase M16 inactive domain protein              345   7e-98    
ref|WP_007666437.1|  MULTISPECIES: peptidase M16                        345   8e-98    
ref|WP_027199932.1|  peptidase M16                                      344   1e-97    
ref|WP_009860342.1|  peptidase M16                                      344   1e-97    
ref|WP_022321909.1|  peptidase M16 inactive domain protein              344   1e-97    
ref|WP_005645234.1|  peptidase M16                                      344   2e-97    
ref|WP_008146836.1|  hypothetical protein                               343   2e-97    
ref|WP_005639703.1|  peptidase M16                                      344   2e-97    
ref|WP_009319355.1|  peptidase M16                                      344   2e-97    
ref|WP_009124986.1|  peptidase M16                                      343   2e-97    
ref|WP_021861991.1|  peptidase M16 inactive domain protein              344   2e-97    
ref|WP_022390006.1|  putative uncharacterized protein                   343   2e-97    
ref|WP_010801078.1|  MULTISPECIES: zinc protease                        343   3e-97    
ref|WP_007666423.1|  peptidase M16                                      343   3e-97    
ref|WP_009122529.1|  peptidase M16                                      343   3e-97    
gb|ADD61469.1|  putative protein                                        343   4e-97    
ref|WP_022600987.1|  peptidase M16                                      343   5e-97    
ref|WP_007618331.1|  zinc protease                                      343   5e-97    
ref|WP_020212355.1|  hypothetical protein                               343   6e-97    
ref|WP_035641963.1|  peptidase M16                                      342   7e-97    
ref|WP_035123300.1|  peptidase M16                                      342   7e-97    
ref|WP_038262471.1|  hypothetical protein                               342   7e-97    
gb|ETN96433.1|  hypothetical protein P278_07010                         342   9e-97    
ref|WP_022146736.1|  peptidase M16 domain protein                       341   2e-96    
ref|WP_025843227.1|  peptidase M16                                      341   2e-96    
ref|WP_022219291.1|  peptidase M16 inactive domain protein              341   2e-96    
ref|WP_008123751.1|  peptidase M16                                      340   5e-96    
ref|WP_006044237.1|  peptidase M16                                      339   8e-96    
ref|WP_036787823.1|  peptidase M16                                      339   1e-95    
ref|WP_022149685.1|  peptidase M16 family                               338   1e-95    
ref|WP_021311302.1|  peptidase, M16 family                              338   1e-95    
ref|WP_007137621.1|  peptidase M16                                      338   2e-95    
ref|WP_036926090.1|  peptidase M16                                      337   4e-95    
ref|WP_022394432.1|  peptidase M16 inactive domain protein              337   4e-95    
ref|WP_028730177.1|  peptidase M16                                      337   4e-95    
ref|WP_025072170.1|  peptidase M16                                      337   5e-95    
ref|WP_023058543.1|  MULTISPECIES: peptidase, M16 family                337   5e-95    
ref|WP_013156932.1|  peptidase M16 domain-containing protein            336   9e-95    
ref|WP_005860271.1|  peptidase M16                                      336   1e-94    
ref|WP_022081875.1|  putative uncharacterized protein                   335   2e-94    
ref|WP_037561083.1|  hypothetical protein                               335   2e-94    
dbj|GAL64182.1|  probable zinc protease pqqL                            333   2e-94    
ref|WP_008236354.1|  peptidase M16 domain-containing protein            335   2e-94    
ref|WP_009016759.1|  peptidase M16                                      335   3e-94    
ref|WP_036862756.1|  peptidase M16                                      334   4e-94    
ref|WP_035899744.1|  hypothetical protein                               334   4e-94    
ref|WP_008620225.1|  peptidase M16                                      334   5e-94    
ref|WP_021981693.1|  peptidase M16 inactive domain protein              334   6e-94    
ref|WP_036630586.1|  peptidase M16                                      333   8e-94    
ref|WP_008778977.1|  MULTISPECIES: peptidase M16                        333   8e-94    
gb|ETS96562.1|  peptidase, M16 family                                   333   1e-93    
ref|WP_036925047.1|  peptidase M16                                      333   1e-93    
ref|WP_034531739.1|  peptidase M16                                      333   1e-93    
ref|WP_022932877.1|  hypothetical protein                               333   1e-93    
ref|WP_014225081.1|  peptidase M16 inactive domain-containing pro...    333   1e-93    
gb|EEY83857.1|  peptidase M16 inactive domain protein                   332   1e-93    
ref|WP_013611877.1|  peptidase M16                                      333   1e-93    
ref|WP_009433945.1|  peptidase M16                                      333   2e-93    
ref|WP_005863630.1|  MULTISPECIES: peptidase M16                        333   2e-93    
ref|WP_004356623.1|  peptidase M16                                      332   2e-93    



>ref|XP_009764556.1| PREDICTED: uncharacterized protein LOC104216239 isoform X1 [Nicotiana 
sylvestris]
Length=1010

 Score =  1835 bits (4753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1010 (88%), Positives = 956/1010 (95%), Gaps = 0/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAESSQ+LPKKHRFRSLKLVNVNM+EALS+TP GV+YG+L+NGLTYYVRSNSKPKM
Sbjct  1     MDLLPAESSQILPKKHRFRSLKLVNVNMDEALSETPQGVEYGKLENGLTYYVRSNSKPKM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAM  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  121   TSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSPDDLEKERGAVMEEYRGTRNANG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLE+VIRTVSPQ VKQFY+KWYHL+NMAVIAVGDFPDT
Sbjct  181   RMQDAHWVLMMEGSKYAERLPIGLERVIRTVSPQTVKQFYRKWYHLQNMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIKAHFG+K S  DPP +PYY VPSH EPRFSCFVESEAAGSAVMISCKMPV+EL
Sbjct  241   QSVVELIKAHFGHKISAVDPPLLPYYSVPSHNEPRFSCFVESEAAGSAVMISCKMPVEEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LL ESMFFHALNQRFFKISRKKDPPYYSCSAAAD LVRPVKAYIMTSSCKEK
Sbjct  301   KTVKDYRELLTESMFFHALNQRFFKISRKKDPPYYSCSAAADILVRPVKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTVEALESMLTEVARVR+HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTVEALESMLTEVARVRIHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISASEVSKY E+F TSSSCVIKTIEPRATA VDDL++V
Sbjct  421   LRNEPVVGIEYEAQLQKTLLPHISASEVSKYCEKFQTSSSCVIKTIEPRATAAVDDLKAV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V++IN+ E+++S+PPWD+ENIPEEIV  KP+PG I+QQ EY  +GA E  LSNGMRVCYK
Sbjct  481   VVRINSLEREKSLPPWDDENIPEEIVCAKPNPGHIVQQLEYSTIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG+FGYRP++LMDMLAGKRAE
Sbjct  541   STDFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGIFGYRPTILMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSP+DLETALQLVYQLFTT VEPGEEDV IVMQMAEEAI AQERD
Sbjct  601   VGTKLGAYMRTFSGDCSPTDLETALQLVYQLFTTTVEPGEEDVKIVMQMAEEAIRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  661   PYTAFANRVRELNYGNSYFFRPIKFGDLRKVNPYKACEYFNSCFKDPSTFTVVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PL+LQYLGGIPRP EP+LHF+RDDLKGLPF+FP++I REVV SPMVEAQCSVQLCF
Sbjct  721   SIACPLMLQYLGGIPRPPEPVLHFSRDDLKGLPFQFPTTITREVVRSPMVEAQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+E MMEDVHFVGFLSKLLETKIVQVLRFKYGQIY+AGVSVFLGGNKPSR+GNIRG
Sbjct  781   PVELKNEKMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYSAGVSVFLGGNKPSRLGNIRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDPDISSTLVDLALDEIL LQE+GPS++DV  VLEIEQRAHENGLQEN YWLD
Sbjct  841   DISINFSCDPDISSTLVDLALDEILHLQEEGPSNDDVMAVLEIEQRAHENGLQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGDVG+SF+VQD ARSKVR +LTPLTAQ+ALQRI+PFPCKKQYTVVILM
Sbjct  901   RILRSYQSRIYSGDVGNSFEVQDAARSKVRSILTPLTAQLALQRIMPFPCKKQYTVVILM  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQASR+K+LKSL+ S  K Y  DAKILAG AGV VL L+LW+YSRS+LKS
Sbjct  961   PQASRIKKLKSLMQSVSKSYSRDAKILAGIAGVTVLSLSLWKYSRSTLKS  1010



>ref|XP_009595115.1| PREDICTED: uncharacterized protein LOC104091476 isoform X1 [Nicotiana 
tomentosiformis]
Length=1010

 Score =  1832 bits (4746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 890/1010 (88%), Positives = 956/1010 (95%), Gaps = 0/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAESSQ+LPKKHRFRSLKLVNVNM+EALS+TP GV+YG+L+NGLTYYVRSNSKPKM
Sbjct  1     MDLLPAESSQILPKKHRFRSLKLVNVNMDEALSETPQGVEYGKLENGLTYYVRSNSKPKM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAM  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  121   TSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSPDDLEKERGAVMEEYRGTRNANG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLE+VIRTVSPQ VKQFY+KWYHL+NMAVIAVGDFPDT
Sbjct  181   RMQDAHWVLMMEGSKYAERLPIGLERVIRTVSPQTVKQFYRKWYHLQNMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIKAHFG+K S  DPP IPYY VPSH EPRFSCFVESEAAGSAVMISCKMPV+EL
Sbjct  241   QSVVELIKAHFGHKISAVDPPLIPYYSVPSHNEPRFSCFVESEAAGSAVMISCKMPVEEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LL ESMFFHALNQRFFKISRKKDPPYYSCSAAAD LVRPVKAYIMTSSCKEK
Sbjct  301   KTVKDYRELLTESMFFHALNQRFFKISRKKDPPYYSCSAAADILVRPVKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTVEALESMLTEVARVR+HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTVEALESMLTEVARVRIHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISASEVSKYSE+F TSSSCVIKTIEPRATA VDDL++V
Sbjct  421   LRNEPVVGIEYEAQLQKTLLPHISASEVSKYSEKFQTSSSCVIKTIEPRATAAVDDLKAV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V++IN+ E+++S+PPWD+E+IPEEIV  K +PG I+QQ EY  +GA E  LSNGMRVCYK
Sbjct  481   VVRINSLEREKSLPPWDDESIPEEIVCAKSNPGHIVQQLEYSTIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG+FGYRP++LMDMLAGKRAE
Sbjct  541   YTDFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGIFGYRPTILMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSP+DLETALQLVYQLFTT VEPGEEDV IVMQMAEEAI AQERD
Sbjct  601   VGTKLGAYMRTFSGDCSPTDLETALQLVYQLFTTTVEPGEEDVKIVMQMAEEAIRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  661   PYTAFANRVRELNYGNSYFFRPIKFGDLRKVNPYKACEYFNSCFKDPSTFTVVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PL+LQYLGGIPRP EP+LHF+RDDLKGLPF+FP++I REVV SPMVEAQCSVQLCF
Sbjct  721   SIACPLMLQYLGGIPRPPEPVLHFSRDDLKGLPFQFPTTITREVVRSPMVEAQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+E MMEDVHFVGFLSKLLETKIVQVLRFKYGQIY+AGVSVFLGGNKPSR+GNIRG
Sbjct  781   PVELKNEKMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYSAGVSVFLGGNKPSRLGNIRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDPDISSTLVDLALDEIL LQE+GPS++DV  VLEIEQRAHENGLQEN YWLD
Sbjct  841   DISINFSCDPDISSTLVDLALDEILHLQEEGPSNDDVMAVLEIEQRAHENGLQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGDVG+SF+VQD ARSKVR +LTPLTAQ+ALQRILPFPCKKQYTVVILM
Sbjct  901   RILRSYQSRIYSGDVGNSFEVQDAARSKVRSILTPLTAQLALQRILPFPCKKQYTVVILM  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQASR+K+LKSL+ S  K Y  DAKILAG AGV VL L+LW+YSRS+LKS
Sbjct  961   PQASRIKKLKSLMQSVSKSYSRDAKILAGIAGVTVLSLSLWKYSRSTLKS  1010



>ref|XP_006353514.1| PREDICTED: uncharacterized protein LOC102583098 [Solanum tuberosum]
Length=1010

 Score =  1829 bits (4737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1010 (88%), Positives = 952/1010 (94%), Gaps = 0/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAESS +LPKKHRFRSLKLVNVNM+E LS+TP GV+YG+L+NGLTYYVRSNSKPKM
Sbjct  1     MDLLPAESSPILPKKHRFRSLKLVNVNMDEVLSETPQGVEYGKLENGLTYYVRSNSKPKM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  121   TSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSLDDLEKERGAVMEEYRGTRNANG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLE+VIRTVSPQIVKQFY+KWYHL+NMAVIAVGDFPDT
Sbjct  181   RMQDAHWVLMMEGSKYAERLPIGLERVIRTVSPQIVKQFYRKWYHLQNMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HFG K S  DPP IPYY VPSH+EPRFSCFVESEAAGSAVMISCKMPV+EL
Sbjct  241   QSVVELIKTHFGQKISAVDPPLIPYYSVPSHDEPRFSCFVESEAAGSAVMISCKMPVEEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LL ESMFFHALNQRFFKISR KDPPYYSCSAAAD LVRPVKAYIMTSSCKEK
Sbjct  301   KTVKDYRELLTESMFFHALNQRFFKISRNKDPPYYSCSAAADILVRPVKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTVEALESMLTEVARVR+HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTVEALESMLTEVARVRIHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISASEVSKYSE+F TS+SCV+KTIEPRATA VDDL++V
Sbjct  421   LRNEPVVGIEYEAQLQKTLLPHISASEVSKYSEKFRTSTSCVVKTIEPRATAAVDDLKAV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V+KIN+ E+++S+PPWD+ENIPEEIV  KP PG I++Q EY N+GA E  LSNGMRVCYK
Sbjct  481   VMKINSLEREKSLPPWDDENIPEEIVCAKPDPGHIIEQLEYSNIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQVLFTGFSYGGLSELPE+EYFSCSMGSTIAGEIG+FGYRPSVLMDMLAGKRAE
Sbjct  541   STDFLDDQVLFTGFSYGGLSELPENEYFSCSMGSTIAGEIGIFGYRPSVLMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTT VEPGEEDV IVMQMAEEAI AQERD
Sbjct  601   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTTVEPGEEDVKIVMQMAEEAIRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  661   PYTAFANRVRELNYGNSYFFRPIKYNDLRKVNPYKACEYFNSCFKDPSTFTVVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PL+LQYLGGIPRP E +L F+RDDLKGLPF+FP++I REVV SPMVEAQCSVQLCF
Sbjct  721   SIACPLMLQYLGGIPRPPEAVLRFSRDDLKGLPFQFPTTITREVVRSPMVEAQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+E+MMEDVHFVGFLSKLLETKIVQVLRFKYGQIY+AGVSVFLGGNKPSRVGNIRG
Sbjct  781   PVELKNENMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYSAGVSVFLGGNKPSRVGNIRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDPDISSTLVDLAL+EIL LQE+GPS +DV  VLEIEQRAHENGLQEN YWLD
Sbjct  841   DISINFSCDPDISSTLVDLALEEILHLQEEGPSIDDVLAVLEIEQRAHENGLQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGD+G+SFK+QD ARSKVR +L PLTAQ+ALQRILPFPCKKQYTVVILM
Sbjct  901   RILRSYQSRIYSGDIGNSFKIQDAARSKVRSILMPLTAQLALQRILPFPCKKQYTVVILM  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQASR+KRLKSL+ S PK Y  DAKILAG AGV VL L+LW+YSRS+LKS
Sbjct  961   PQASRIKRLKSLMQSVPKSYSRDAKILAGIAGVMVLSLSLWKYSRSTLKS  1010



>ref|XP_004251655.1| PREDICTED: uncharacterized protein LOC101265006 [Solanum lycopersicum]
Length=1010

 Score =  1822 bits (4719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 883/1010 (87%), Positives = 951/1010 (94%), Gaps = 0/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAESS +LPKKHRFRSLKLVNVNM+E LS+TP GV+YG+L+NGLTYYVRSNSKPKM
Sbjct  1     MDLLPAESSPILPKKHRFRSLKLVNVNMDEVLSETPQGVEYGKLENGLTYYVRSNSKPKM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  121   TSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSPDDLEKERGAVMEEYRGTRNANG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLE+VIRTVSPQIVKQFY+KWYHL+NMA+IAVGDFPDT
Sbjct  181   RMQDAHWVLMMEGSKYAERLPIGLERVIRTVSPQIVKQFYRKWYHLQNMALIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HFG K S  DPP IPY+ VPSH+E RFSCFVESEAAGSAVMISCKMPV+EL
Sbjct  241   QSVVELIKTHFGQKISAVDPPLIPYFSVPSHDETRFSCFVESEAAGSAVMISCKMPVEEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LL ESMFFHALNQRFFKISR KDPPYYSCSAAAD LVRPVKAYIMTSSCKEK
Sbjct  301   KTVKDYRELLTESMFFHALNQRFFKISRNKDPPYYSCSAAADILVRPVKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTVEALESMLTEVARVR+HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTVEALESMLTEVARVRIHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISASEVSKYSE+F TS+SCV+KTIEPRATA VDDL++V
Sbjct  421   LRNEPVVGIEYEAQLQKTLLPHISASEVSKYSEKFRTSTSCVVKTIEPRATAAVDDLKAV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V+KIN+ E+++S+PPWD+ENIPEEIV  KP PG I++Q EY N+GA E  L+NGMRVCYK
Sbjct  481   VMKINSLEREKSLPPWDDENIPEEIVCAKPDPGHIIEQLEYPNIGATELILTNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQVLFTGFSYGGLSELPE+EYFSCSMGSTIAGEIG+FGYRPSVLMDMLAGKRAE
Sbjct  541   STDFLDDQVLFTGFSYGGLSELPENEYFSCSMGSTIAGEIGIFGYRPSVLMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTT VEPGEEDV IVMQMAEEAI AQERD
Sbjct  601   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTTVEPGEEDVKIVMQMAEEAIRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  661   PYTAFANRVRELNYGNSYFFRPIKYNDLRKVNPYKACEYFNSCFKDPSTFTVVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLILQYLGGIPRP E +L F+RDDLKGLPF+FP++I REVV SPMVEAQCSVQLCF
Sbjct  721   SIACPLILQYLGGIPRPPEAVLRFSRDDLKGLPFQFPTTITREVVRSPMVEAQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+E+MMEDVHFVGFLSKLLETKIVQVLRFKYGQIY+AGVSVFLGGNKPSRVGNIRG
Sbjct  781   PVELKNENMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYSAGVSVFLGGNKPSRVGNIRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDPDISSTLVDLAL+EIL LQE+GPS ED   VLEIEQRAHENGLQEN YWLD
Sbjct  841   DISINFSCDPDISSTLVDLALEEILHLQEEGPSIEDAMAVLEIEQRAHENGLQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGD+G+SFK+Q+ ARSKVR +LTPLTAQ+ALQ++LPFPCKKQYTVVILM
Sbjct  901   RILRSYQSRIYSGDIGNSFKIQEAARSKVRSILTPLTAQLALQKLLPFPCKKQYTVVILM  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQASR+KRLKSL+ S PK Y  DAKILAG AGV +L L+LW+YSRS+LKS
Sbjct  961   PQASRIKRLKSLMQSVPKSYSRDAKILAGIAGVTILSLSLWKYSRSTLKS  1010



>ref|XP_010656234.1| PREDICTED: uncharacterized protein LOC100245850 [Vitis vinifera]
 emb|CBI27954.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =  1727 bits (4474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 839/1010 (83%), Positives = 927/1010 (92%), Gaps = 1/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE  Q + K+H FRSLKL+NV+M++AL   P+GVDYGRL+NGL YYVRSNSKPKM
Sbjct  1     MDLLPAEIPQ-IAKRHGFRSLKLLNVDMDQALGDEPFGVDYGRLENGLHYYVRSNSKPKM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLES+GAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLESVGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+TVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  120   TSSDDTVYELFVPVDKPELLSQAISVLAEFSSEVRVSTDDLEKERGAVMEEYRGNRNANG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYA+RLPIGLEKVIRTV  ++VKQFY+KWYHL NMAVIAVGDF DT
Sbjct  180   RMQDAHWVLMMEGSKYADRLPIGLEKVIRTVPSEVVKQFYRKWYHLHNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELI+ HFG K+S  DP PIP++ VPSHEEPRFSCFVESEAAGSAVMIS KM VDEL
Sbjct  240   QSVVELIRTHFGPKSSAHDPLPIPHFPVPSHEEPRFSCFVESEAAGSAVMISYKMSVDEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+DLL ESMF +ALNQR FKISR+KDPPY+SCSAAAD LVRPVKAY++TSSCKEK
Sbjct  300   KTVKDYKDLLTESMFLYALNQRLFKISRRKDPPYFSCSAAADVLVRPVKAYMITSSCKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
              T+EALESML EVAR+RLHGFSEREISVVRALLMSE+ESAYLERDQMQS+SLRDEYLQHF
Sbjct  360   CTIEALESMLIEVARIRLHGFSEREISVVRALLMSEVESAYLERDQMQSSSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKT+LP ISASE+SKYSE+  TS SCVIKT+EP ATATVDDL++V
Sbjct  420   LRNEPVVGIEYEAQLQKTILPQISASEISKYSEKLQTSCSCVIKTMEPWATATVDDLKAV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V KIN+ E++ SI PWD+E+IPEEIVS+KP+PG I+Q+ E+ N+   E  LSNGMRVCYK
Sbjct  480   VSKINSLEEEGSISPWDDEHIPEEIVSIKPNPGNIVQELEFSNIEVTELILSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+F DDQVLFTGFSYGGLSELPE+EYFSCSMGSTIAGEIGVFGY+PSVLMDMLAGKRAE
Sbjct  540   CTDFFDDQVLFTGFSYGGLSELPENEYFSCSMGSTIAGEIGVFGYKPSVLMDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV+PGEE+V IVMQMAEEA+HAQERD
Sbjct  600   VGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVKPGEEEVKIVMQMAEEAVHAQERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPIRI DL+KV+P KAC+YFNNCFKDPSTFTVVIVGNIDP
Sbjct  660   PYTAFANRVRELNYGNSYFFRPIRISDLRKVDPLKACQYFNNCFKDPSTFTVVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             A A PLILQYLGGIP+P EPILHFNRDDL+GLPF FP+++IREVV SPMVEAQCSVQLCF
Sbjct  720   AIAGPLILQYLGGIPKPPEPILHFNRDDLRGLPFTFPATVIREVVRSPMVEAQCSVQLCF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+E MM+++HFVGFLSKLLETKI+QVLRFK+GQIY+AGVSVFLGGNKPSR G+IRG
Sbjct  780   PVELKNETMMQEIHFVGFLSKLLETKIMQVLRFKHGQIYSAGVSVFLGGNKPSRTGDIRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDPDISSTLVD+ALDEILR+QE+G SDEDVSTVLEIEQRAHENGLQEN YWLD
Sbjct  840   DISINFSCDPDISSTLVDIALDEILRVQEEGCSDEDVSTVLEIEQRAHENGLQENYYWLD  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSR+Y GDVG SF+VQDE RSKVR+LLTP TAQ+AL+RILPFPCKKQYTVVILM
Sbjct  900   RILRSYQSRVYFGDVGTSFEVQDEGRSKVRELLTPSTAQLALKRILPFPCKKQYTVVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR+K L SL  S    Y   AKIL G AG+ V  LTLWRYSR +LKS
Sbjct  960   PQTSRVKLLTSLFKSTDNSYSRKAKILVGVAGLTVFALTLWRYSRRTLKS  1009



>ref|XP_011093677.1| PREDICTED: uncharacterized protein LOC105173585 isoform X1 [Sesamum 
indicum]
Length=1011

 Score =  1721 bits (4458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 837/1011 (83%), Positives = 918/1011 (91%), Gaps = 1/1011 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPK-KHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPK  222
             MDLLP ES Q+L K K RFRSLKLVNVN ++ L +TPYGVDYGRL NGLTYYVRSNSKPK
Sbjct  1     MDLLPGESPQILSKSKQRFRSLKLVNVNDDDVLPETPYGVDYGRLTNGLTYYVRSNSKPK  60

Query  223   MRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA  402
             MRAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNA
Sbjct  61    MRAALALAVKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNA  120

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             VTSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRGSRNAN
Sbjct  121   VTSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSADDLEKERGAVLEEYRGSRNAN  180

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQDAHWVLMMEGSKYA+RLPIGLEKVIRTVSP IVKQFYKKWYHL+NMA+IAVGDFPD
Sbjct  181   GRMQDAHWVLMMEGSKYADRLPIGLEKVIRTVSPNIVKQFYKKWYHLQNMALIAVGDFPD  240

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             TQSVVELIK HF  K    DPP IP + VPSH E RFS  VESEAAGSAVMISCK+PVDE
Sbjct  241   TQSVVELIKTHFEDKIPVLDPPFIPRFTVPSHAESRFSSLVESEAAGSAVMISCKVPVDE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYR LLAESMFFHALNQRFFK+SRKKDPPY+SCSAAAD LVRP KAYIMTS+CK+
Sbjct  301   LKTVKDYRHLLAESMFFHALNQRFFKLSRKKDPPYFSCSAAADVLVRPTKAYIMTSACKQ  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT  ALESML EVARVR+HGFSEREIS+ RALLMSEIESAYLERDQMQST+LRDEY+QH
Sbjct  361   KGTTIALESMLIEVARVRMHGFSEREISISRALLMSEIESAYLERDQMQSTNLRDEYIQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FLRNEPV+GIEYEAQL KTLLP+ISASEVSKYSE F TS +CVIKTIEP+A ATVDDLR+
Sbjct  421   FLRNEPVVGIEYEAQLHKTLLPYISASEVSKYSENFRTSCNCVIKTIEPQAAATVDDLRT  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV ++N+FE++ SI PWD+E+IPEEIVSV+P+PG ++QQFEY ++GA E  LSNGMRVCY
Sbjct  481   VVSRVNSFEEEGSISPWDDESIPEEIVSVEPNPGHVVQQFEYSSIGATELILSNGMRVCY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+F DDQVLFTGFSYGGLSEL E EYFSCSMG TIAGEIGVFG+RPSVL DMLAGKRA
Sbjct  541   KCTDFFDDQVLFTGFSYGGLSELQECEYFSCSMGPTIAGEIGVFGHRPSVLSDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGT LGAYMRSFSGDCSPSDLETALQLVYQLF TN+EPGEEDV IVMQMAEE++ AQER
Sbjct  601   EVGTSLGAYMRSFSGDCSPSDLETALQLVYQLFVTNLEPGEEDVKIVMQMAEESVRAQER  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYTAFANRVRE+NYGNSYFFRPI+I DL+KV+P++ACEYFNNCFKDPSTFTVVIVGNID
Sbjct  661   DPYTAFANRVREINYGNSYFFRPIKIGDLRKVDPFRACEYFNNCFKDPSTFTVVIVGNID  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             PA A PLILQYLGGIPRP +PIL F RD+LKGLPF FPS++IRE+V SPMVEAQCSVQLC
Sbjct  721   PAIACPLILQYLGGIPRPPKPILSFKRDELKGLPFTFPSTVIREIVRSPMVEAQCSVQLC  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPVELK+E+MMEDVH  G +SKLLETKI+QVLRFK+GQIY+AGVSVFLGGN+PSRVGNIR
Sbjct  781   FPVELKNENMMEDVHLTGLISKLLETKILQVLRFKHGQIYSAGVSVFLGGNRPSRVGNIR  840

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISSTLV+LALDEILRLQE+GPSD+DVST+LEIEQRAHENGLQEN YWL
Sbjct  841   GDISVNFSCDPEISSTLVNLALDEILRLQEEGPSDDDVSTILEIEQRAHENGLQENYYWL  900

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             +RILRSYQSRIYS DVG SF++QDE RS+VR  LTPLTAQ ALQRI+PFPCK QYTVVIL
Sbjct  901   ERILRSYQSRIYSDDVGASFQIQDEGRSRVRSTLTPLTAQSALQRIIPFPCKNQYTVVIL  960

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ+SR K LKS + S P  Y  DAKILAG   + VL+ +LWRYS+ + KS
Sbjct  961   MPQSSRFKMLKSFISSIPVPYSRDAKILAGIGAITVLVFSLWRYSQRAAKS  1011



>emb|CDP03209.1| unnamed protein product [Coffea canephora]
Length=1014

 Score =  1718 bits (4449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 841/1014 (83%), Positives = 915/1014 (90%), Gaps = 4/1014 (0%)
 Frame = +1

Query  46    MDLLP----AESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNS  213
             MDLLP    A    M  +K  FRSLKLV V+M+  L++ P+GV YGRLDNGLTYYVRSN 
Sbjct  1     MDLLPPAEAASPDLMKKRKSGFRSLKLVEVDMDAVLAEEPFGVHYGRLDNGLTYYVRSNP  60

Query  214   KPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGAC  393
             KP+MRAALALAV+AGSVLEEEEERGVAHIVEHLAFSAT  YTNHDI+KFLESIGAEFGAC
Sbjct  61    KPRMRAALALAVKAGSVLEEEEERGVAHIVEHLAFSATTNYTNHDIIKFLESIGAEFGAC  120

Query  394   QNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSR  573
             QNAVTSADETVYELFVPIDKP LLSQAIS+LAEFS EVR S  DLEKERGAVMEEYRG+R
Sbjct  121   QNAVTSADETVYELFVPIDKPGLLSQAISVLAEFSMEVRVSMEDLEKERGAVMEEYRGNR  180

Query  574   NANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGD  753
             NANGRMQDAHW+LMMEGSKYAERLPIGLEKVIRTVSP+ VK+FY+KWYH +NM VIAVGD
Sbjct  181   NANGRMQDAHWILMMEGSKYAERLPIGLEKVIRTVSPETVKEFYRKWYHPQNMCVIAVGD  240

Query  754   FPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMP  933
             FPDTQ VV+LIKAHFG+K S   PP +PY+ VP HEEPRFSCFVESEAAGSAVMISCKM 
Sbjct  241   FPDTQGVVDLIKAHFGHKFSAAVPPVMPYFPVPCHEEPRFSCFVESEAAGSAVMISCKMA  300

Query  934   VDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSS  1113
             V+EL+TVKDYRDLLAESMFFHALNQRFFK+SRKKDPPY+SCSAAAD LV P KAYIMTSS
Sbjct  301   VEELRTVKDYRDLLAESMFFHALNQRFFKLSRKKDPPYFSCSAAADVLVHPCKAYIMTSS  360

Query  1114  CKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEY  1293
             CKEKGT+EAL+SMLTEVARVR+HGFSEREI+VVRALLMSEIESAYLERDQMQST+LRDEY
Sbjct  361   CKEKGTIEALKSMLTEVARVRMHGFSEREITVVRALLMSEIESAYLERDQMQSTNLRDEY  420

Query  1294  LQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDD  1473
             LQHFLRNEPV+GIEYEAQL KTLLP+I+AS+VS YSE F TS SCVIK IEP ATATVDD
Sbjct  421   LQHFLRNEPVVGIEYEAQLHKTLLPYITASDVSGYSENFMTSHSCVIKIIEPHATATVDD  480

Query  1474  LRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMR  1653
             L++VVLKIN+ E++  I  WD+E IPEEIVS KP+PG IMQQ EY N+ A E  LSNGMR
Sbjct  481   LKAVVLKINSLEKEGGISLWDDEYIPEEIVSTKPNPGSIMQQLEYSNIAATELVLSNGMR  540

Query  1654  VCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAG  1833
             VCYKCT+F DDQVLFTGFSYGGLSELPES+YFSCSMG TIAGEIGVFGYRPSVLMDMLAG
Sbjct  541   VCYKCTDFFDDQVLFTGFSYGGLSELPESDYFSCSMGPTIAGEIGVFGYRPSVLMDMLAG  600

Query  1834  KRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHA  2013
             KRA+VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTN+EPGEEDVNIVMQMAEEA+ A
Sbjct  601   KRADVGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNLEPGEEDVNIVMQMAEEAVRA  660

Query  2014  QERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVG  2193
             QERDPYTAFANRVRELNYGNSYFFRPIRI DL+KV+P+KAC++FNNCFKDPSTFTVVIVG
Sbjct  661   QERDPYTAFANRVRELNYGNSYFFRPIRISDLRKVDPFKACQFFNNCFKDPSTFTVVIVG  720

Query  2194  NIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSV  2373
             NI+PA A PLIL YLGGIPRP EPIL F+RD+LKGLPF FPS+IIREVVHSPMVEAQC V
Sbjct  721   NIEPAIALPLILLYLGGIPRPLEPILSFHRDELKGLPFTFPSTIIREVVHSPMVEAQCLV  780

Query  2374  QLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVG  2553
             QLCFPVELK+E+MMED H VGFLSKLLETKI+QVLRFK+GQIY+ GVSVFLGGNKPSRVG
Sbjct  781   QLCFPVELKNENMMEDAHLVGFLSKLLETKILQVLRFKHGQIYSVGVSVFLGGNKPSRVG  840

Query  2554  NIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENC  2733
             N+RGDI INFSCDPDISS LVDLAL EILRLQ++GPSD+DV ++LEIEQRAHENGLQEN 
Sbjct  841   NVRGDISINFSCDPDISSALVDLALAEILRLQDEGPSDDDVLSILEIEQRAHENGLQENF  900

Query  2734  YWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTV  2913
             YWLDRILRSYQSRIY GDVG SF+VQDE RSKVR  L PLTAQ+ALQRILPFPC KQYTV
Sbjct  901   YWLDRILRSYQSRIYCGDVGASFQVQDEGRSKVRNSLRPLTAQLALQRILPFPCIKQYTV  960

Query  2914  VILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             VILMPQASR KRLKS + S  K Y  DAK LAG AG+AVL L+LWRYSRS+ +S
Sbjct  961   VILMPQASRWKRLKSFIRSGRKHYGRDAKFLAGIAGLAVLGLSLWRYSRSTQRS  1014



>ref|XP_007012924.1| Mitochondrial-processing peptidase subunit beta, mitochondrial, 
putative [Theobroma cacao]
 gb|EOY30543.1| Mitochondrial-processing peptidase subunit beta, mitochondrial, 
putative [Theobroma cacao]
Length=1004

 Score =  1681 bits (4354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 810/1007 (80%), Positives = 909/1007 (90%), Gaps = 3/1007 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+SQ + KKH FRSLKLVNV +++     P+GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MDLLPTENSQ-IAKKHGFRSLKLVNVELDQEFQHEPFGVDYGRLDNGLVYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT++YTNHDIVKFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKRYTNHDIVKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSE+R S+ DL+KERGAVMEEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSQAISVLAEFSSEIRVSKDDLKKERGAVMEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW L+MEGSKYA RLPIGLEK+IRTVS + VKQFYKKWYHL NMAVIAVGDF DT
Sbjct  180   RMQDAHWTLLMEGSKYAVRLPIGLEKIIRTVSSETVKQFYKKWYHLHNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELI+ HFG K S  DPP IP + VPSHE PRFSCFVESEAAGSAVMIS KMP DEL
Sbjct  240   KSVVELIRTHFGEKNSATDPPIIPLFPVPSHEGPRFSCFVESEAAGSAVMISYKMPADEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYRD+LAESMF HALNQRFFKISR++DPPY+SCSAAAD LV P+KAYI++SSCKEK
Sbjct  300   KTVKDYRDMLAESMFLHALNQRFFKISRRRDPPYFSCSAAADALVHPLKAYIISSSCKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EA+ESML EVARVRLHGFSEREISVVRALLMSE+ESAYLERDQMQSTSLRDEY+QHF
Sbjct  360   GTLEAIESMLIEVARVRLHGFSEREISVVRALLMSEVESAYLERDQMQSTSLRDEYIQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             + NEPVIGIEYEAQLQK++LP+ISASEVSKY+E+  TS SCV+KTIEP+A AT+DDL+++
Sbjct  420   IHNEPVIGIEYEAQLQKSILPYISASEVSKYAEKLQTSCSCVLKTIEPQAFATIDDLKNI  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLK+N  E++ SI PWD+E IPEEIV++KPSPG+I++Q +Y N+GA E  LSNGMRVCYK
Sbjct  480   VLKLNNLEKEGSISPWDDEYIPEEIVNIKPSPGYIVEQIDYSNIGATELTLSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+F DDQVLFTGFSYGGLSELPE+EYFSCSMGSTIAGEIGVFG+ PSVLMDMLAGKR E
Sbjct  540   CTDFFDDQVLFTGFSYGGLSELPENEYFSCSMGSTIAGEIGVFGHSPSVLMDMLAGKRVE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEEA+HAQERD
Sbjct  600   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVTPGEEEVKIVMQMAEEAVHAQERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+ELNYGNSYFFRPIRI DL+KV+P KACEYFN CFKDPSTFTVVI GNIDP
Sbjct  660   PYTAFANRVKELNYGNSYFFRPIRISDLKKVDPVKACEYFNGCFKDPSTFTVVIAGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+  EPI H+NRDDLKGLPFKFP++IIREVV SPMVEAQCSVQLCF
Sbjct  720   TIALPLILQYLGGIPKSPEPIFHYNRDDLKGLPFKFPTTIIREVVRSPMVEAQCSVQLCF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++H VGFLSKLLETKI+QVLRFK+GQIY+AGVSVFLGGNKPSR G++RG
Sbjct  780   PVELKNGTMVEEIHCVGFLSKLLETKILQVLRFKHGQIYSAGVSVFLGGNKPSRTGDVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             D+ INFSCDP+ISS LVDLALDE++RLQE+GPSD+DVSTVLEIEQRAHENGLQEN YWL+
Sbjct  840   DMSINFSCDPEISSKLVDLALDEVVRLQEEGPSDQDVSTVLEIEQRAHENGLQENYYWLE  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGD G SFK+Q+E RS+VR+ LTP TAQ +LQRI+P+PCK QYTVVILM
Sbjct  900   RILRSYQSRIYSGDAGTSFKIQEEGRSRVRESLTPSTAQSSLQRIMPYPCKNQYTVVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             PQASR K L+SL       +  DAKILAG +G+ VL   LW+YSR S
Sbjct  960   PQASRFKSLRSLFQHTA--HGRDAKILAGISGLTVLAACLWKYSRKS  1004



>ref|XP_007204667.1| hypothetical protein PRUPE_ppa000776mg [Prunus persica]
 gb|EMJ05866.1| hypothetical protein PRUPE_ppa000776mg [Prunus persica]
Length=1007

 Score =  1670 bits (4325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/1005 (80%), Positives = 894/1005 (89%), Gaps = 0/1005 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+S+++ KKH FRSLKLVNV+M++ L + P GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MDLLPAETSKIVKKKHGFRSLKLVNVDMDQVLGEQPVGVDYGRLDNGLCYYVRCNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE ERGVAHIVEHLAFSATEKYTNHDI++FLESIGAEFGACQNAV
Sbjct  61    RAALALAVKVGSVLEEENERGVAHIVEHLAFSATEKYTNHDIIRFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DK ELLSQAIS+LAEFSSEVR S+ DLE+ERGAVMEEYRG+RNA G
Sbjct  121   TSADDTVYELFVPVDKHELLSQAISVLAEFSSEVRVSKDDLERERGAVMEEYRGNRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LMMEGS+YA+RLPIGLEKVIRTVS + VKQFY KWYHL NMAVIAVGDF DT
Sbjct  181   RMQDAHWILMMEGSQYADRLPIGLEKVIRTVSSETVKQFYSKWYHLSNMAVIAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HFG+K S P+ P IP Y VPSHEEPRFSCFVESEA GSAV+IS KM   EL
Sbjct  241   QSVVELIKNHFGHKISSPELPLIPRYTVPSHEEPRFSCFVESEATGSAVIISYKMAAGEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
              TV+DYRDLLAESMF +ALNQRFFKI+R+KDPPY+SCSA+AD LV P+KAYIMTSSCKEK
Sbjct  301   NTVRDYRDLLAESMFLYALNQRFFKIARRKDPPYFSCSASADVLVNPLKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARV+LHGFSERE+S+VRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTIEALESMLTEVARVQLHGFSEREVSIVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPVIGIEYEAQLQKTLLP I+ +E+SKY+ +  TS SCVIKTIEPRA+AT+ DL++V
Sbjct  421   LRNEPVIGIEYEAQLQKTLLPQITTAEISKYAVKLQTSCSCVIKTIEPRASATIGDLKNV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V  IN  E+K+ I PWD+E IPEEIV+ KP+PG I+Q+ EY  +G  E  LSNGMRVCYK
Sbjct  481   VSMINDLEEKRIISPWDDEQIPEEIVNSKPNPGNIVQELEYSKIGVTELVLSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CTNFLDDQV+FTGFSYGGLSELPESEYFSCSMG TIAGEIGV+GYRPSVLMDMLAGKRAE
Sbjct  541   CTNFLDDQVIFTGFSYGGLSELPESEYFSCSMGPTIAGEIGVYGYRPSVLMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             V TKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEE + AQ+RD
Sbjct  601   VSTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVTPGEEDVKIVMQMAEEVVRAQDRD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+ELNYGNSYFFRPIRI DL+KV+P KACEYFN CFKDPSTF++VIVGNIDP
Sbjct  661   PYTAFANRVKELNYGNSYFFRPIRISDLRKVDPLKACEYFNKCFKDPSTFSIVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLILQYLGGIP P EP+L +NRDDLKGLPF FP + IREVVHSPMVE QCSVQLCF
Sbjct  721   SIALPLILQYLGGIPNPPEPVLQYNRDDLKGLPFTFPKTRIREVVHSPMVEEQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL +  M+ED+H +GFLSKLLETKI+QVLRFK+GQIY  GVSVFLGGNKPSR  N+RG
Sbjct  781   PVELNNGTMVEDIHVIGFLSKLLETKIMQVLRFKHGQIYTVGVSVFLGGNKPSRTANVRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVDL LDEI RLQE+GPSDEDVST+LEIEQRAHENGLQEN YWLD
Sbjct  841   DISINFSCDPEISSKLVDLTLDEISRLQEEGPSDEDVSTILEIEQRAHENGLQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG  F++Q+E RSKVR+ LTP+TAQ+ALQ+ILPFPCKKQYTVVILM
Sbjct  901   RILHSYQSRVYSGDVGTCFEIQEEGRSKVRQSLTPVTAQLALQKILPFPCKKQYTVVILM  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSR  3060
             P+ S  K L+S   S    Y   AKILAG AG+ VL L+LWRYSR
Sbjct  961   PRTSHFKSLRSFFQSTETSYGRHAKILAGIAGLTVLALSLWRYSR  1005



>emb|CAN62001.1| hypothetical protein VITISV_007878 [Vitis vinifera]
Length=981

 Score =  1664 bits (4309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1010 (81%), Positives = 900/1010 (89%), Gaps = 29/1010 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE  Q + K+H FRSLKL+NV+M++AL   P+GVDYGRL+NGL YYVRSNSKPKM
Sbjct  1     MDLLPAEIPQ-IAKRHGFRSLKLLNVDMDQALGDEPFGVDYGRLENGLHYYVRSNSKPKM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLE +GAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLEXVGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+TVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  120   TSSDDTVYELFVPVDKPELLSQAISVLAEFSSEVRVSTDDLEKERGAVMEEYRGNRNANG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYA+RLPIGLEKVIRTV  ++VKQFY+KWYHL NMAVIAVGDF DT
Sbjct  180   RMQDAHWVLMMEGSKYADRLPIGLEKVIRTVPSEVVKQFYRKWYHLHNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELI+ HFG K+S  DP PIP++ VPSHEEPRFSCFVESEAAGSAVMIS KM VDEL
Sbjct  240   QSVVELIRTHFGPKSSAHDPLPIPHFPVPSHEEPRFSCFVESEAAGSAVMISYKMSVDEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+DLL ESMF +ALNQR FKISR+KDPPY+SCSAAAD L                
Sbjct  300   KTVKDYKDLLTESMFLYALNQRLFKISRRKDPPYFSCSAAADVL----------------  343

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                         VAR+RLHGFSEREISVVRALLMSE+ESAYLERDQMQS+SLRDEYLQHF
Sbjct  344   ------------VARIRLHGFSEREISVVRALLMSEVESAYLERDQMQSSSLRDEYLQHF  391

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKT+LP ISASE+SKYSE+  TS SCVIKT+EP ATATVDDL++V
Sbjct  392   LRNEPVVGIEYEAQLQKTILPQISASEISKYSEKLQTSCSCVIKTMEPWATATVDDLKAV  451

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V KIN+ E++ SI PWD+E+IPEEIVS+KP+PG I+Q+ E+ N+   E  LSNGMRVCYK
Sbjct  452   VSKINSLEEEGSISPWDDEHIPEEIVSIKPNPGNIVQELEFSNIEVTELILSNGMRVCYK  511

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+F DDQVLFTGFSYGGLSELPE+EYFSCSMGSTIAGEIGVFGY+PSVLMDMLAGKRAE
Sbjct  512   CTDFFDDQVLFTGFSYGGLSELPENEYFSCSMGSTIAGEIGVFGYKPSVLMDMLAGKRAE  571

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV+PGEE+V IVMQMAEEA+HAQERD
Sbjct  572   VGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVKPGEEEVKIVMQMAEEAVHAQERD  631

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPIRI DL+KV+P KAC+YFNNCFKDPSTFTVVIVGNIDP
Sbjct  632   PYTAFANRVRELNYGNSYFFRPIRISDLRKVDPLKACQYFNNCFKDPSTFTVVIVGNIDP  691

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             A A PLILQYLGGIP+P EPILHFNRDDL+GLPF FP+++IREVV SPMVEAQCSVQLCF
Sbjct  692   AIAGPLILQYLGGIPKPPEPILHFNRDDLRGLPFTFPATVIREVVRSPMVEAQCSVQLCF  751

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+E MM+++HFVGFLSKLLETKI+QVLRFK+GQIY+AGVSVFLGGNKPSR G+IRG
Sbjct  752   PVELKNETMMQEIHFVGFLSKLLETKIMQVLRFKHGQIYSAGVSVFLGGNKPSRTGDIRG  811

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDPDISSTLVD+ALDEILR+QE+G SDEDVSTVLEIEQRAHENGLQEN YWLD
Sbjct  812   DISINFSCDPDISSTLVDIALDEILRVQEEGCSDEDVSTVLEIEQRAHENGLQENYYWLD  871

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSR+Y GDVG SF+VQDE RSKVR+LLTP TAQ+AL+RILPFPCKKQYTVVILM
Sbjct  872   RILRSYQSRVYFGDVGTSFEVQDEGRSKVRELLTPSTAQLALKRILPFPCKKQYTVVILM  931

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR+K L SL  S    Y   AKIL G AG+ V  LTLWRYSR +LKS
Sbjct  932   PQTSRVKLLTSLFKSTDNSYSRKAKILVGVAGLTVFALTLWRYSRRTLKS  981



>ref|XP_009352601.1| PREDICTED: uncharacterized protein LOC103943948 [Pyrus x bretschneideri]
Length=1008

 Score =  1652 bits (4279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1008 (81%), Positives = 891/1008 (88%), Gaps = 1/1008 (0%)
 Frame = +1

Query  46    MDLLPAESS-QMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPK  222
             MDLLPAE++   + KKH FRSLKL+ V+M++ L   P GVDYGRLDNGL+YYVR NSKP+
Sbjct  1     MDLLPAETTTSKIVKKHGFRSLKLLTVDMDQELGDQPVGVDYGRLDNGLSYYVRCNSKPR  60

Query  223   MRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA  402
             MRAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIV+FLESIGAEFGACQNA
Sbjct  61    MRAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVRFLESIGAEFGACQNA  120

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             VTSAD+TVYELFVP+DK ELLS+AIS+LAEFSSEVR S+ DLE+ERGAVMEEYRG+RNA 
Sbjct  121   VTSADDTVYELFVPVDKLELLSEAISVLAEFSSEVRVSKDDLERERGAVMEEYRGNRNAT  180

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQDAHW+LMME SKYAERLPIGLEKVIRTVSP+ VKQFYKKWYHL NMAVIAVGDF D
Sbjct  181   GRMQDAHWILMMEDSKYAERLPIGLEKVIRTVSPETVKQFYKKWYHLSNMAVIAVGDFSD  240

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             TQ+VVELI+  FG K S PDPPPIP Y VPSHEEPRFSCFVESEA+GSAV+IS KM  DE
Sbjct  241   TQNVVELIRDQFGRKISAPDPPPIPSYPVPSHEEPRFSCFVESEASGSAVIISYKMAADE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTV+DYRDLLAESMF +ALNQRFFKISRK DPPY+SCSA+AD LV P+KAYIMTSSCKE
Sbjct  301   LKTVRDYRDLLAESMFLYALNQRFFKISRKTDPPYFSCSASADVLVNPLKAYIMTSSCKE  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGTVEALESML EVARVRLHGFSERE+S+VRALLMSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  361   KGTVEALESMLIEVARVRLHGFSEREVSIVRALLMSEIESAYLERDQMQSTSLRDEYLQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FLRNEPVIGIEYEAQLQKTLLPHI+A+EVSKY+ +  TS SCVIKTIEPRA+A  +DL+ 
Sbjct  421   FLRNEPVIGIEYEAQLQKTLLPHITAAEVSKYAVKLQTSCSCVIKTIEPRASAIANDLKH  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N  E+++ I PWDEE IPEEIV+ KP+PG I+QQ EY N+ A E  LSNGMRVCY
Sbjct  481   VVSKVNRLEEERIISPWDEEQIPEEIVNTKPNPGNIVQQVEYSNIEATELILSNGMRVCY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCTNFLDDQV+FTGFSYGGLSELPE EYFSCSMG TIAGEIGV+GYRPSVLMDMLAGKRA
Sbjct  541   KCTNFLDDQVIFTGFSYGGLSELPEREYFSCSMGPTIAGEIGVYGYRPSVLMDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EV  KLGAYMRSF GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEE + AQ+R
Sbjct  601   EVSPKLGAYMRSFVGDCSPSDLETALQLVYQLFTTNIIPGEEDVKIVMQMAEEVVRAQDR  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYTAFANRV+ELNYGNSYFFRPIRI DL+KV+P KACEYFN CFKDPSTF+VVIVGNID
Sbjct  661   DPYTAFANRVKELNYGNSYFFRPIRISDLRKVDPLKACEYFNKCFKDPSTFSVVIVGNID  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ A PLILQYLGGIP+P EP+L FNRDDLKGLPF FP + IREVV SPMVE QCSVQLC
Sbjct  721   PSIALPLILQYLGGIPKPPEPLLQFNRDDLKGLPFNFPKTRIREVVRSPMVEEQCSVQLC  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPVELK+  M+ED+H VGFLSKLLETKI+QVLRFK+GQIY  GVSVFLGGNKPSR  N+R
Sbjct  781   FPVELKNGTMVEDIHIVGFLSKLLETKIMQVLRFKHGQIYTVGVSVFLGGNKPSRTANVR  840

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDL LDEILRLQE+GPSDEDVST+LEIEQRAHENGLQEN YWL
Sbjct  841   GDISVNFSCDPEISSKLVDLTLDEILRLQEEGPSDEDVSTILEIEQRAHENGLQENYYWL  900

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRIL SYQSR YSGDVG  F++QDE RSKVR+ LTP TAQ ALQRILPFPCKKQYTVVIL
Sbjct  901   DRILHSYQSRAYSGDVGTCFEIQDEGRSKVRQSLTPTTAQSALQRILPFPCKKQYTVVIL  960

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             MP+ S  K LKS   S    Y     ILAG AG+ VL LTLWRYSR +
Sbjct  961   MPRTSPFKSLKSFFQSTESSYQRHTTILAGLAGLTVLGLTLWRYSRRT  1008



>ref|XP_010244340.1| PREDICTED: uncharacterized protein LOC104588199 [Nelumbo nucifera]
Length=1010

 Score =  1652 bits (4278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/1011 (79%), Positives = 903/1011 (89%), Gaps = 2/1011 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE  Q + ++H FRSLKLVN+N+EE L + P GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MDLLPAEVPQ-IAQRHGFRSLKLVNINLEEGLEERPVGVDYGRLDNGLYYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT+KY+NHDIVKFLESIGAEFGACQNA 
Sbjct  60    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKKYSNHDIVKFLESIGAEFGACQNAS  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADET+YEL VP+DKP+LLSQAISILAEFSSE+R   +DL+KERGAV+EEYR SRNANG
Sbjct  120   TSADETIYELLVPVDKPDLLSQAISILAEFSSEIRVLANDLDKERGAVLEEYRMSRNANG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSP+ VK+FY+KWYHL+NMAV+AVGDF DT
Sbjct  180   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPETVKRFYQKWYHLQNMAVVAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppip-YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             QSVVE+I+ HFG K S P PPP+  Y+ VPSH EPRFSCFVESEAAGSAVMISCKMPV E
Sbjct  240   QSVVEMIRTHFGQKVSMPSPPPLIPYFPVPSHNEPRFSCFVESEAAGSAVMISCKMPVGE  299

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDY+D LAE+MF  ALNQRFFKISR+KDPP++SC +AAD LVRP+KAY++TS+CK+
Sbjct  300   LKTVKDYKDSLAEAMFHCALNQRFFKISRRKDPPFFSCYSAADVLVRPMKAYVITSTCKQ  359

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGTVEA+ESML EVARVRL GFSEREIS+VRAL+MSEIESAYLERDQ  STSLRDEYLQH
Sbjct  360   KGTVEAMESMLMEVARVRLQGFSEREISIVRALMMSEIESAYLERDQRPSTSLRDEYLQH  419

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F  NEPV+GIEYEAQLQKT+LP ISA EVS+YSE F TS SCVIKT+EPRATATVD+L++
Sbjct  420   FFHNEPVVGIEYEAQLQKTILPQISAEEVSRYSENFRTSCSCVIKTVEPRATATVDNLKA  479

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              V KIN  E+++SI PWD+E+IPEEIV+ KP PG I+QQ EY ++   E  LSNGM++CY
Sbjct  480   AVQKINFLEEERSISPWDDEHIPEEIVNTKPIPGDIIQQREYPDIDVTELLLSNGMKICY  539

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQVLFTGF+YGGLSEL ES YFSCSMGSTIAGEIGVFGY+PSVLMDMLAGKRA
Sbjct  540   KCTDFLDDQVLFTGFTYGGLSELSESRYFSCSMGSTIAGEIGVFGYKPSVLMDMLAGKRA  599

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEEAI AQER
Sbjct  600   EVGTKIGAYMRTFSGDCSPSDLETALQLVYQLFTTNVVPGEEEVKIVMQMAEEAIRAQER  659

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYTAFANRVRE+NYGNSYFFRPIRI DLQKV+P +ACEYFNNCFKDPSTFTVVIVGN++
Sbjct  660   DPYTAFANRVREVNYGNSYFFRPIRISDLQKVDPIRACEYFNNCFKDPSTFTVVIVGNLN  719

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLILQYLGGIP+P +P+LHFNRDDLKGLPF FP +IIREVV SPMVEAQCSVQL 
Sbjct  720   PDVARPLILQYLGGIPKPPQPVLHFNRDDLKGLPFTFPGTIIREVVRSPMVEAQCSVQLS  779

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPVELK+E+MME++HFVGFLSKLLETKI+QVLRFK+GQIY+AGV+VFLGGNKPS+  ++R
Sbjct  780   FPVELKNENMMEEIHFVGFLSKLLETKIMQVLRFKHGQIYSAGVTVFLGGNKPSKTEDVR  839

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI INFSCDPDIS  LVDLALDEI  LQE+GPS++DV T+LEIEQRAHENGLQEN YWL
Sbjct  840   GDISINFSCDPDISRMLVDLALDEIFCLQEEGPSEQDVLTILEIEQRAHENGLQENYYWL  899

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILR YQSR YSGDV  SF+VQD+ R+KVRK L P TAQ+ALQRILP+PC+KQY+VVIL
Sbjct  900   DRILRCYQSRAYSGDVSASFEVQDQGRTKVRKSLEPSTAQLALQRILPYPCRKQYSVVIL  959

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ S +K LKS   S  KRY  DAKIL+G A V +L  +LWRYSRSSLKS
Sbjct  960   MPQISCLKLLKSYFQSTQKRYSKDAKILSGIAAVVILTFSLWRYSRSSLKS  1010



>gb|KDO59292.1| hypothetical protein CISIN_1g001831mg [Citrus sinensis]
Length=1008

 Score =  1650 bits (4274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/1010 (79%), Positives = 903/1010 (89%), Gaps = 2/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPAE SQ + KKH FRSLKLV+ ++ E L + P+GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MELLPAEGSQ-IAKKHGFRSLKLVSFDLNEELGEQPFGVDYGRLDNGLFYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE ERGVAHIVEHLAFSATEKYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEHERGVAHIVEHLAFSATEKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLS+AIS+LAEFS+EVR S+ DLEKERGAV+EEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSRAISVLAEFSTEVRVSKDDLEKERGAVLEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAE LPIGLEKVIRTVS   VK+FY+KWY L+NMAVIAVGDFPDT
Sbjct  180   RMQDAHWVLMMEGSKYAECLPIGLEKVIRTVSSDTVKRFYQKWYRLQNMAVIAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             + VVELI  HFG K S  DPP IP + VPSH+EPRFSCF+ESEA GSAV++S KMPV+EL
Sbjct  240   KGVVELINTHFGQKKSATDPPVIPKFPVPSHQEPRFSCFIESEAGGSAVIVSYKMPVNEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KT+KDY+++L ESMF HALNQRFFK+SR+KDPPY+SCSA+AD LVRP+KAYIM+SSCKE+
Sbjct  300   KTIKDYKEMLTESMFLHALNQRFFKLSRRKDPPYFSCSASADDLVRPLKAYIMSSSCKER  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT++ALESML EVARVRLHGFSERE+SV RALLMSE+ESAYLERDQMQST+LRDE LQHF
Sbjct  360   GTLKALESMLIEVARVRLHGFSEREVSVARALLMSEVESAYLERDQMQSTNLRDECLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L  EP+IGIEYEA+LQKTLLPHISA EVS+YSE+  TS SCVIKTIEP+  +T+DDL+++
Sbjct  420   LCKEPIIGIEYEARLQKTLLPHISALEVSRYSEKLQTSCSCVIKTIEPQTFSTIDDLKNI  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLKI   E+K +I PWDEENIPEEIVS KPSPG I+QQFEY+N+GA E  LSNGMRVCYK
Sbjct  480   VLKIKNLEEK-NISPWDEENIPEEIVSTKPSPGNIVQQFEYENLGATELVLSNGMRVCYK  538

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIGVFGYRPS+LMDMLAGKR E
Sbjct  539   CTDFLDDQVLFTGFSYGGLSELPESEYLSCSMGSTIAGEIGVFGYRPSMLMDMLAGKRVE  598

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
              GTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEE I AQERD
Sbjct  599   GGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVAPGEEEVEIVMQMAEEVIRAQERD  658

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+E+NYGNSYFFRPIRI DLQKV+P KAC+YFN+CFKDPSTFTVVIVGNIDP
Sbjct  659   PYTAFANRVKEINYGNSYFFRPIRISDLQKVDPLKACDYFNSCFKDPSTFTVVIVGNIDP  718

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             +   PLILQYLGGIP+P EPILHFNRD+LKGLPF FPSSIIREVV SPMVEAQCSVQLCF
Sbjct  719   SNGIPLILQYLGGIPKPPEPILHFNRDNLKGLPFTFPSSIIREVVRSPMVEAQCSVQLCF  778

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++++VGFLSKLLETK++QVLRFK+GQIY+A VSVFLGGNK SR G++RG
Sbjct  779   PVELKNGTMVEEINYVGFLSKLLETKMMQVLRFKHGQIYSASVSVFLGGNKHSRTGDVRG  838

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+IS  LVDLALDEI RLQ++GPSDEDVST+LE+EQRAHE GLQEN +WLD
Sbjct  839   DISINFSCDPEISFKLVDLALDEISRLQKEGPSDEDVSTILELEQRAHETGLQENYHWLD  898

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SFK+QDEARSKVRK L PLT Q+ALQRI+P+PC KQ+TVVILM
Sbjct  899   RILCSYQSRVYSGDVGTSFKIQDEARSKVRKSLQPLTLQLALQRIMPYPCNKQFTVVILM  958

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR K L+SL       +  DAK LA  AG+  L  +LWRYSR +LKS
Sbjct  959   PQVSRFKFLRSLFRHNQTYHLGDAKALAAVAGLTFLAFSLWRYSRRTLKS  1008



>ref|XP_006475387.1| PREDICTED: uncharacterized protein LOC102615135 [Citrus sinensis]
Length=1008

 Score =  1649 bits (4269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/1010 (79%), Positives = 902/1010 (89%), Gaps = 2/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPAE SQ + KKH FRSLKLV+ ++ E L + P+GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MELLPAEGSQ-IAKKHGFRSLKLVSFDLNEELGEQPFGVDYGRLDNGLFYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE ERGVAHIVEHLAFSATEKYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEHERGVAHIVEHLAFSATEKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLS+AIS+LAEFS+EVR S+ DLEKERGAV+EEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSRAISVLAEFSTEVRVSKDDLEKERGAVLEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAE LPIGLEKVIRTVS   VK+FY+KWY L+NMAVIAVGDFPDT
Sbjct  180   RMQDAHWVLMMEGSKYAECLPIGLEKVIRTVSSDTVKRFYQKWYRLQNMAVIAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             + VVELI  HFG K S  DPP IP + VPSH+EP FSCF+ESEA GSAV++S KMPV+EL
Sbjct  240   KGVVELINTHFGQKKSATDPPVIPKFPVPSHQEPHFSCFIESEAGGSAVIVSYKMPVNEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KT+KDY+++L ESMF HALNQRFFK+SR+KDPPY+SCSA+AD LVRP+KAYIM+SSCKE+
Sbjct  300   KTIKDYKEMLTESMFLHALNQRFFKLSRRKDPPYFSCSASADDLVRPLKAYIMSSSCKER  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT++ALESML EVARVRLHGFSERE+SV RALLMSE+ESAYLERDQMQST+LRDE LQHF
Sbjct  360   GTLKALESMLIEVARVRLHGFSEREVSVARALLMSEVESAYLERDQMQSTNLRDECLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L  EP+IGIEYEA+LQKTLLPHISA EVS+YSE+  TS SCVIKTIEP+  +T+DDL+++
Sbjct  420   LCKEPIIGIEYEARLQKTLLPHISALEVSRYSEKLQTSCSCVIKTIEPQTFSTIDDLKNI  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLKI   E+K +I PWDEENIPEEIVS KPSPG I+QQFEY+N+GA E  LSNGMRVCYK
Sbjct  480   VLKIKNLEEK-NISPWDEENIPEEIVSTKPSPGNIVQQFEYENLGATELVLSNGMRVCYK  538

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIGVFGYRPS+LMDMLAGKR E
Sbjct  539   CTDFLDDQVLFTGFSYGGLSELPESEYLSCSMGSTIAGEIGVFGYRPSMLMDMLAGKRVE  598

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
              GTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEE I AQERD
Sbjct  599   GGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVAPGEEEVEIVMQMAEEVIRAQERD  658

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+E+NYGNSYFFRPIRI DLQKV+P KAC+YFN+CFKDPSTFTVVIVGNIDP
Sbjct  659   PYTAFANRVKEINYGNSYFFRPIRISDLQKVDPLKACDYFNSCFKDPSTFTVVIVGNIDP  718

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             +   PLILQYLGGIP+P EPILHFNRD+LKGLPF FPSSIIREVV SPMVEAQCSVQLCF
Sbjct  719   SNGIPLILQYLGGIPKPPEPILHFNRDNLKGLPFTFPSSIIREVVRSPMVEAQCSVQLCF  778

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++++VGFLSKLLETK++QVLRFK+GQIY+A VSVFLGGNK SR G++RG
Sbjct  779   PVELKNGTMVEEINYVGFLSKLLETKMMQVLRFKHGQIYSASVSVFLGGNKHSRTGDVRG  838

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+IS  LVDLALDEI RLQ++GPSDEDVST+LE+EQRAHE GLQEN +WLD
Sbjct  839   DISINFSCDPEISFKLVDLALDEISRLQKEGPSDEDVSTILELEQRAHETGLQENYHWLD  898

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SFK+QDEARSKVRK L PLT Q+ALQRI+P+PC KQ+TVVILM
Sbjct  899   RILCSYQSRVYSGDVGTSFKIQDEARSKVRKSLQPLTLQLALQRIMPYPCNKQFTVVILM  958

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR K L+SL       +  DAK LA  AG+  L  +LWRYSR +LKS
Sbjct  959   PQVSRFKFLRSLFRHNQTYHLGDAKALAAVAGLTFLAFSLWRYSRRTLKS  1008



>gb|KGN60551.1| hypothetical protein Csa_2G000590 [Cucumis sativus]
Length=1007

 Score =  1646 bits (4263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/1006 (79%), Positives = 900/1006 (89%), Gaps = 8/1006 (1%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+S  +  KHRFRSLKLV +++   LS+ PYGV YG+L NGL+YYVRSNSKP+M
Sbjct  1     MDLLPAETSHAI--KHRFRSLKLVTIDLNATLSEHPYGVRYGQLHNGLSYYVRSNSKPRM  58

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNA 
Sbjct  59    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAA  118

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DKP LLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA G
Sbjct  119   TSADDTVYELFVPVDKPGLLSQAISILAEFSSEIRVSQDDLEKERGAVMEEYRGNRNATG  178

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW LMMEGSKYA+RLPIGLEKVI+TVS + VK+FY+KWY L NMAVIAVGDF DT
Sbjct  179   RMQDAHWALMMEGSKYADRLPIGLEKVIKTVSAETVKKFYRKWYDLHNMAVIAVGDFSDT  238

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVE+IK HFG+  S  +PP +P + +PS EEPRFSCFVESEAAGSAVMIS KMP DEL
Sbjct  239   ESVVEMIKEHFGHIQSACEPPHVPTFPIPSREEPRFSCFVESEAAGSAVMISYKMPADEL  298

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTV+DYR+LL ESMF  ALNQRFFKISR KDPP++SCSAAAD +V P+KA+IM+SSCKEK
Sbjct  299   KTVRDYRNLLVESMFLQALNQRFFKISRGKDPPFFSCSAAADPVVLPLKAFIMSSSCKEK  358

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTV+ALESMLTEVARVRLHGFSEREIS+VRALLMSEIESAYLERDQMQST+LRDEYLQHF
Sbjct  359   GTVKALESMLTEVARVRLHGFSEREISIVRALLMSEIESAYLERDQMQSTNLRDEYLQHF  418

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISA+EVSKYS +  +  SCVIK IEPRA+AT+DDL++V
Sbjct  419   LRNEPVVGIEYEAQLQKTLLPHISATEVSKYSAKLTSLCSCVIKIIEPRASATIDDLKNV  478

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V+ I   E+++ I PWDEENIPEEIVS  P+PG I+QQ EY N+GA E  LSNGMRVCYK
Sbjct  479   VMNITCLEKERGITPWDEENIPEEIVSTMPNPGNIVQQKEYPNIGATEIFLSNGMRVCYK  538

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQV+FTGFSYG LSELPE EY SCSMGSTIAGEIGVFGYRPSVLMD+LAGKRAE
Sbjct  539   CTDFLDDQVIFTGFSYGALSELPEREYSSCSMGSTIAGEIGVFGYRPSVLMDILAGKRAE  598

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEEA+ AQERD
Sbjct  599   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVIPGEEDVKIVMQMAEEAVRAQERD  658

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+ELNYGNSYFFRPIR+ DL+KVNP +ACEYFN CF+DPS FTVV+VGNI+P
Sbjct  659   PYTAFANRVKELNYGNSYFFRPIRLSDLKKVNPQRACEYFNKCFRDPSNFTVVVVGNINP  718

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLI QYLGGIP+P EPI++FNRDDLKGLPFKFP+SI+REVV+SPMVEAQCSVQLCF
Sbjct  719   SIALPLIQQYLGGIPKPPEPIMNFNRDDLKGLPFKFPTSIVREVVYSPMVEAQCSVQLCF  778

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL +  M+E++H+VGFLSKLLET+++QVLRFK+GQIY+AGVSVFLGGNKPSR+G +RG
Sbjct  779   PVELTNGTMVEEIHYVGFLSKLLETRMIQVLRFKHGQIYSAGVSVFLGGNKPSRIGPVRG  838

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVDLAL+EILRLQE+GP+D+DVS++LEIEQRAHENGLQEN YWLD
Sbjct  839   DISINFSCDPEISSKLVDLALNEILRLQEEGPTDQDVSSILEIEQRAHENGLQENYYWLD  898

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGDVG SF++QDE R  VR  LTPLTAQ+ALQRILPFPC KQYT VIL+
Sbjct  899   RILRSYQSRIYSGDVGSSFEIQDEGRLNVRNSLTPLTAQLALQRILPFPCTKQYTAVILL  958

Query  2926  PQASRMKRLKSLV---CSAPKRYCTDAKIlagtagvavllltlWRY  3054
             P + R ++LKS +    S P R   D+KIL G A VAVL  +LWRY
Sbjct  959   PASYRFRKLKSFLRLGLSNPGR---DSKILVGLASVAVLTFSLWRY  1001



>ref|XP_008459201.1| PREDICTED: uncharacterized protein LOC103498391 isoform X1 [Cucumis 
melo]
Length=1007

 Score =  1644 bits (4258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 798/1006 (79%), Positives = 901/1006 (90%), Gaps = 8/1006 (1%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+SQ +  KHRFRSLKLV +++   LS+ PYGV YG+LDNGL+YYVR NSKP+M
Sbjct  1     MDLLPAETSQAI--KHRFRSLKLVTIDLNATLSEHPYGVHYGQLDNGLSYYVRCNSKPRM  58

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNA 
Sbjct  59    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAA  118

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DKP LLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA G
Sbjct  119   TSADDTVYELFVPVDKPGLLSQAISILAEFSSEIRVSQDDLEKERGAVMEEYRGNRNATG  178

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW LMMEGSKYA+RLPIGLEKVI+TVS + VK+FY+KWY L NMAVIAVGDF DT
Sbjct  179   RMQDAHWALMMEGSKYADRLPIGLEKVIKTVSAETVKKFYRKWYDLHNMAVIAVGDFSDT  238

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELIK HFG+  S  +PP +P + +PS ++P FSCFVESEAAGSAVMIS KMP DEL
Sbjct  239   ESVVELIKEHFGHIPSACEPPHVPTFPIPSRDQPCFSCFVESEAAGSAVMISYKMPADEL  298

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTV+DYR+LL ESMF  ALNQRFFKISR KDPP++SCSAAAD +V P+KA+IM+SSCKEK
Sbjct  299   KTVRDYRNLLVESMFLQALNQRFFKISRGKDPPFFSCSAAADPVVLPLKAFIMSSSCKEK  358

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTV+ALESMLTEVARVRLHGFSEREIS+VRALLMSEIESAYLERDQMQST+LRDEYLQHF
Sbjct  359   GTVKALESMLTEVARVRLHGFSEREISIVRALLMSEIESAYLERDQMQSTNLRDEYLQHF  418

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISA+EVSKYS +  +  SCVIK IEPRA+AT+DDL++V
Sbjct  419   LRNEPVVGIEYEAQLQKTLLPHISATEVSKYSAKLTSLCSCVIKIIEPRASATIDDLKNV  478

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V+ I   E+++SIPPWDEENIPEEIVS  P+PG I+QQ EY N+GA E  LSNGMRVCYK
Sbjct  479   VMNITCLEKERSIPPWDEENIPEEIVSTMPNPGNIVQQKEYPNIGATEIFLSNGMRVCYK  538

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQV+FTGFSYG LSELPE EY SCSMGSTIAGEIGVFGYRPSVLMD+LAGKRAE
Sbjct  539   CTDFLDDQVIFTGFSYGALSELPEREYSSCSMGSTIAGEIGVFGYRPSVLMDILAGKRAE  598

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEEA+ AQERD
Sbjct  599   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVTPGEEDVKIVMQMAEEAVRAQERD  658

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+ELNYGNSYFFRPIR+RDL+KV+P +ACEYFN CF+DPS FTVV+VGNI+P
Sbjct  659   PYTAFANRVKELNYGNSYFFRPIRLRDLKKVDPQRACEYFNKCFRDPSNFTVVVVGNINP  718

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLI QYLGGIP+P EPI++FNRDDLKGLPFKFP+ I+REVV+SPMVEAQCSVQLCF
Sbjct  719   SIALPLIQQYLGGIPKPPEPIMNFNRDDLKGLPFKFPTRIVREVVYSPMVEAQCSVQLCF  778

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL +  M+E++H+VGFLSKLLET+++QVLRFK+GQIY+AGVSVFLGGNKPSR G +RG
Sbjct  779   PVELTNGTMVEEIHYVGFLSKLLETRMMQVLRFKHGQIYSAGVSVFLGGNKPSRSGPVRG  838

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVDLAL+EILRLQE+GP+D+DVS++LEIEQRAHENGLQEN YWLD
Sbjct  839   DISINFSCDPEISSKLVDLALNEILRLQEEGPTDQDVSSILEIEQRAHENGLQENYYWLD  898

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGDVG SF++QDE R  VR  LTPLTAQ+ALQRILPFPC KQYT VIL+
Sbjct  899   RILRSYQSRIYSGDVGSSFEIQDEGRLNVRNSLTPLTAQLALQRILPFPCTKQYTAVILL  958

Query  2926  PQASRMKRLKS---LVCSAPKRYCTDAKIlagtagvavllltlWRY  3054
             P + R ++LKS   L  S+P R   D KIL G A VAVL  +LWRY
Sbjct  959   PASYRFRKLKSFFRLGLSSPGR---DTKILVGLASVAVLTFSLWRY  1001



>ref|XP_002514172.1| Mitochondrial-processing peptidase subunit beta, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF48126.1| Mitochondrial-processing peptidase subunit beta, mitochondrial 
precursor, putative [Ricinus communis]
Length=981

 Score =  1633 bits (4229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/1010 (79%), Positives = 884/1010 (88%), Gaps = 29/1010 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP+E+SQ + KKHRFRSLKLVN+++++ L   P+G +YGRLDNGL YYVR NSKP+M
Sbjct  1     MDLLPSETSQ-IAKKHRFRSLKLVNIDLDQVLEGEPFGAEYGRLDNGLFYYVRLNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS++AEFS+EVR S+ DLEKERGAVMEEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSQAISVMAEFSTEVRVSKDDLEKERGAVMEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYA+RLPIGLEKVIRTVS + VKQFY+KWYHL NMAVIAVGDF DT
Sbjct  180   RMQDAHWVLMMEGSKYADRLPIGLEKVIRTVSAETVKQFYRKWYHLHNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELIK HFG K S  DPP IP + VPSHEEPRFSCFVESEAAGSAVMIS KMPVDEL
Sbjct  240   KSVVELIKMHFGQKVSERDPPQIPVFQVPSHEEPRFSCFVESEAAGSAVMISYKMPVDEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+D+L ESMF +ALNQRFFK+SR+KDPPY+SCSAAAD LV               
Sbjct  300   KTVKDYKDMLLESMFLYALNQRFFKLSRRKDPPYFSCSAAADALV---------------  344

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                          ARVRLHGFSEREIS+VRALLM+EIESAYLERDQMQST+LRDEYLQHF
Sbjct  345   -------------ARVRLHGFSEREISIVRALLMAEIESAYLERDQMQSTNLRDEYLQHF  391

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKT+LP ISA EVSKYSE+  TS SCVIKTIEP+A+ATVDDL+ V
Sbjct  392   LRNEPVVGIEYEAQLQKTILPQISALEVSKYSEKLQTSCSCVIKTIEPQASATVDDLKKV  451

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             +LKIN  E + SI PWD+ENIPEEIV+ KP+PG ++ Q EY N+GA E  LSNGMR+CYK
Sbjct  452   LLKINALEAEGSISPWDDENIPEEIVATKPNPGSVLHQLEYSNIGASELILSNGMRICYK  511

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSE+PES+YFSCSMGSTIAGEIGVFGYRP VLMDMLAGKR E
Sbjct  512   CTDFLDDQVLFTGFSYGGLSEIPESDYFSCSMGSTIAGEIGVFGYRPPVLMDMLAGKRVE  571

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEEA+ AQERD
Sbjct  572   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVTPGEEDVKIVMQMAEEAVRAQERD  631

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFA+RV+ELNYGNSYFFRPIRI DLQKV+P KACEYFN+CFKDPSTFTVVIVGN+DP
Sbjct  632   PYTAFADRVKELNYGNSYFFRPIRINDLQKVDPMKACEYFNSCFKDPSTFTVVIVGNLDP  691

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+PSEPILHFNRDDLKGLPF FP+SIIREVV SPMVEAQCSVQL F
Sbjct  692   TIAVPLILQYLGGIPKPSEPILHFNRDDLKGLPFTFPTSIIREVVRSPMVEAQCSVQLSF  751

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV LK+  M+E++H +GFLSKLLETKI+QVLRFK+GQIY+AGVSVFLGGN+PSR G+IRG
Sbjct  752   PVVLKNGTMVEEIHRIGFLSKLLETKIMQVLRFKHGQIYSAGVSVFLGGNRPSRTGDIRG  811

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP ISS LVDLALDEILRLQE+GP D+DV TVLE+EQRAHENGLQEN YWL+
Sbjct  812   DISINFSCDPGISSKLVDLALDEILRLQEEGPKDQDVLTVLELEQRAHENGLQENFYWLE  871

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIY+G++G +F++QDE RS VR+ LT    Q+ LQRILP PCKKQYT VILM
Sbjct  872   RILRSYQSRIYNGELGTAFEIQDEGRSNVRQSLTTSAVQLTLQRILPCPCKKQYTAVILM  931

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR++ L+S   S    Y  DAKI+A  AG  VL LT WRYSRSSL+S
Sbjct  932   PQTSRIQLLRSFFQSTRTSYARDAKIIASIAGCTVLALTFWRYSRSSLRS  981



>ref|XP_009412236.1| PREDICTED: uncharacterized protein LOC103993779 [Musa acuminata 
subsp. malaccensis]
Length=1012

 Score =  1630 bits (4221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/1012 (77%), Positives = 894/1012 (88%), Gaps = 2/1012 (0%)
 Frame = +1

Query  46    MDLLPAES-SQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPK  222
             MDLLPAE  S M  ++  FRSLKL  V M+E L++ P GVDYG LDNGLTYYVR N KP+
Sbjct  1     MDLLPAEGPSSMGARRQGFRSLKLATVAMDEPLAEKPVGVDYGVLDNGLTYYVRCNPKPR  60

Query  223   MRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA  402
             MRAALALAV+ GSVLE+E+ERGVAHIVEHLAFSAT+KY NHDIVKFLESIGAEFGACQNA
Sbjct  61    MRAALALAVKVGSVLEDEDERGVAHIVEHLAFSATKKYNNHDIVKFLESIGAEFGACQNA  120

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA 
Sbjct  121   LTSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSSEDLEKERGAVLEEYRGGRNAA  180

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQDAHWVLM +GSKYAERLPIGLEKVIRTV+P+ VKQFY+KWYHL NMAV+AVGDF D
Sbjct  181   GRMQDAHWVLMFQGSKYAERLPIGLEKVIRTVTPETVKQFYQKWYHLGNMAVVAVGDFAD  240

Query  763   TQSVVELIKAHFGYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             +QSVVELIK+HFG K S   PPP+   + VPSH+EPR+SCFVESEAAGSAVM+SCK+PVD
Sbjct  241   SQSVVELIKSHFGQKNSNCIPPPVIPDFPVPSHKEPRYSCFVESEAAGSAVMVSCKIPVD  300

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             E++TVKDYRD LAE+MF  ALNQRFFKISR+ DPPY+SCS+AAD LVRPVKAYIMTSSC+
Sbjct  301   EMRTVKDYRDSLAEAMFHCALNQRFFKISRRTDPPYFSCSSAADALVRPVKAYIMTSSCR  360

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             E+GT+EALE+MLTEVARVRLHGFSEREIS+VRAL+MSEIESAYLER+QMQSTSLRDEYLQ
Sbjct  361   ERGTIEALEAMLTEVARVRLHGFSEREISIVRALMMSEIESAYLEREQMQSTSLRDEYLQ  420

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HF R EPV+G+EYEAQLQKTLLPHIS +EVSK++  F T+ SCVIK +EPRA AT+DDLR
Sbjct  421   HFFRKEPVVGVEYEAQLQKTLLPHISPAEVSKFAANFCTTCSCVIKIVEPRAGATLDDLR  480

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             + V KI+T E+++ I PWD+E++PEEIV+ KP PG I+ Q ++  +G  E  LSNGM+VC
Sbjct  481   AAVFKISTLEEERRISPWDDEHVPEEIVTDKPIPGSIINQIDFSPIGVTELLLSNGMKVC  540

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YKCT+FLDDQV+FTGF+YGGLSELPE+EY SCSMGSTI+GEIG+FGY+PS+LMDMLAGKR
Sbjct  541   YKCTDFLDDQVIFTGFAYGGLSELPEAEYISCSMGSTISGEIGIFGYKPSMLMDMLAGKR  600

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
             AEV TK+GAYMR+FSGDCSP+DLETALQLVYQLFT NV PG E+V IVMQMAEEAI AQE
Sbjct  601   AEVSTKVGAYMRTFSGDCSPTDLETALQLVYQLFTRNVAPGHEEVKIVMQMAEEAIRAQE  660

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYTAF NRVRE+NYGNSYFFRPIRI +L+KVNP +ACEYFNNCFKDPS+FTVVIVGNI
Sbjct  661   RDPYTAFTNRVREINYGNSYFFRPIRISELKKVNPIRACEYFNNCFKDPSSFTVVIVGNI  720

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DPA++ PL+LQYLGGIPRPSEP+L  NRDDLKGLPFKFP+SI+RE+V SPMVEAQCSVQL
Sbjct  721   DPASSLPLVLQYLGGIPRPSEPVLQLNRDDLKGLPFKFPASIVREIVRSPMVEAQCSVQL  780

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
              FPV LKS  MME++H+VGFLSKLLET+I+QVLRFK+GQIY+  VSVFLGGNKPSR G++
Sbjct  781   AFPVVLKSTSMMEEIHYVGFLSKLLETRIMQVLRFKHGQIYSVSVSVFLGGNKPSRTGDV  840

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI + FSCDPDISS LVDLAL+EIL LQ+ GPSD+DVSTVLEIEQRAHENGLQEN YW
Sbjct  841   RGDISVYFSCDPDISSRLVDLALEEILYLQDHGPSDQDVSTVLEIEQRAHENGLQENYYW  900

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILRSYQSR Y GDV DSFK+QDE R+KVRK LTPLT Q+ALQRILPFPCKKQYTVVI
Sbjct  901   LDRILRSYQSRAYFGDVSDSFKIQDEGRTKVRKDLTPLTMQLALQRILPFPCKKQYTVVI  960

Query  2920  LMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             LMPQ S +  LKSL+  +   +  + KIL G AG  VL ++LWRYSRS+L S
Sbjct  961   LMPQISHLSFLKSLILLSSDGFTRNVKILVGAAGAMVLAVSLWRYSRSALNS  1012



>gb|KHN16670.1| Putative zinc protease pqqL [Glycine soja]
Length=1016

 Score =  1617 bits (4187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/1007 (78%), Positives = 889/1007 (88%), Gaps = 1/1007 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPA S+  + KK  FRSLKLVN +M++ LS  P GVDYG LDNGL YYVR NSKP+M
Sbjct  1     MELLPA-SAPPISKKQGFRSLKLVNADMDQLLSDQPVGVDYGTLDNGLRYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV AGSVLEEE+ERGVAHIVEHLAFSAT+K TNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVWAGSVLEEEDERGVAHIVEHLAFSATKKSTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYEL VP+DKPELLSQAIS+LAEFSSE+R S+ DLEKERGAVMEEYRGSRNA G
Sbjct  120   TSADDTVYELLVPVDKPELLSQAISVLAEFSSEIRVSKDDLEKERGAVMEEYRGSRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW+LMMEGSKYAERLPIGLE+VIRTVS + VK FYKKWYHL NMAVIAVGDF D 
Sbjct  180   RLQDAHWMLMMEGSKYAERLPIGLERVIRTVSSETVKHFYKKWYHLCNMAVIAVGDFSDA  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             Q VVELIK HFG K   PDPP IP   VPSH+EPRFSCFVESEAAGSAVMIS KMP DEL
Sbjct  240   QDVVELIKTHFGQKIPDPDPPLIPTIQVPSHDEPRFSCFVESEAAGSAVMISYKMPADEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY +LLAESMF +ALNQRFFKI+R+ DPPY+SCSAAAD LVRP+KA IMTSSCK K
Sbjct  300   KTVKDYCNLLAESMFLYALNQRFFKIARRNDPPYFSCSAAADVLVRPLKANIMTSSCKRK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVAR RLHGFSEREISVVRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  360   GTIEALESMLIEVARARLHGFSEREISVVRALLMSEIESAYLERDQIQSTSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHIS  EVSK SE+  TS SCVIKTIEP+  A +DDL++V
Sbjct  420   LHNEPVVGIEYEAQLQKTLLPHISTLEVSKCSEKLRTSCSCVIKTIEPQPFAVLDDLKNV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I PWD+E++PEEIV+ KP+ G ++Q+ EY N+GA E  LSNGMR+CYK
Sbjct  480   VKKVNLLEEEGRISPWDDEHVPEEIVTTKPNMGHVVQELEYSNIGATELILSNGMRICYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTG+SYGGLSELPE+EYFSCSMG TIAGEIGVFGYRPSVLMDMLAGKRAE
Sbjct  540   RTDFLDDQVIFTGYSYGGLSELPENEYFSCSMGPTIAGEIGVFGYRPSVLMDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+F GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEEA+ AQ+RD
Sbjct  600   VGTKIGAYMRTFYGDCSPSDLETALQLVYQLFTTNLTPGEEDVKIVMQMAEEAVSAQDRD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRV+ELNYGNSYFFRPIR  DLQKV+P KACE+F+ CFKDPSTFT+VIVGNIDP
Sbjct  660   PYTAFTNRVKELNYGNSYFFRPIRKSDLQKVDPRKACEFFSTCFKDPSTFTIVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P EPI+HFNRD+LKGLPF FP+SI REVV SPMVEAQC VQ+CF
Sbjct  720   TIAMPLILQYLGGIPKPPEPIMHFNRDELKGLPFTFPTSIHREVVWSPMVEAQCLVQICF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++HFVGFLSKLLETKI+QVLRFK GQIY+ GVSVFLGGNKPSR+G++RG
Sbjct  780   PVELKNGTMVEEIHFVGFLSKLLETKIMQVLRFKLGQIYSVGVSVFLGGNKPSRIGDVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVD+ALDE+LRLQE+GPS++DVST+LEIEQRAHENGLQEN YWLD
Sbjct  840   DISINFSCDPEISSKLVDIALDEMLRLQEEGPSEQDVSTILEIEQRAHENGLQENYYWLD  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SF++QDE RSKVR  LTP TAQ AL+RILPFP K +YTVVILM
Sbjct  900   RILHSYQSRVYSGDVGTSFEIQDEGRSKVRSSLTPSTAQFALKRILPFPSKNKYTVVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             P+AS ++ LKS++ SA   Y  +AKILAG  G+AVL  +LWR ++++
Sbjct  960   PKASPLQLLKSVIQSARTNYGREAKILAGVTGLAVLAFSLWRRAQNN  1006



>ref|XP_010911803.1| PREDICTED: uncharacterized protein LOC105037879 isoform X1 [Elaeis 
guineensis]
Length=1011

 Score =  1612 bits (4175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/1011 (77%), Positives = 896/1011 (89%), Gaps = 1/1011 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+  +  ++  FRSLKLV+V M+E L++ P GV YG LDNGLTYYVRSN KP+M
Sbjct  1     MDLLPTEAPSIGGRRQGFRSLKLVSVAMDEPLAEEPVGVVYGVLDNGLTYYVRSNPKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAL  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  121   TSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LM EGSKYAERLPIGLEKVIRTV+P+ VKQFY+KWYHL+NMAV+AVGDF DT
Sbjct  181   RMQDAHWILMFEGSKYAERLPIGLEKVIRTVTPETVKQFYQKWYHLQNMAVVAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppip-YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             +SVVELI+AHFG K S   PPP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE
Sbjct  241   KSVVELIRAHFGQKVSISGPPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             ++TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY+SCS+AAD LVRP+KAYIMTSSC+E
Sbjct  301   MRTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFSCSSAADALVRPIKAYIMTSSCRE  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             +GT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  361   RGTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F R EPV+GIEYEAQLQKTLLP+IS +EVSK++  F T+ SCVIK +EPRA AT++DL++
Sbjct  421   FFRKEPVVGIEYEAQLQKTLLPYISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKA  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              VLK+N  E+++ I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CY
Sbjct  481   SVLKVNALEEEKKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQV+FTGFSYGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRA
Sbjct  541   KCTDFLDDQVIFTGFSYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQER
Sbjct  601   EVGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQER  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YF++CFKDPSTFTVVIVGNID
Sbjct  661   DPYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFSDCFKDPSTFTVVIVGNID  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL 
Sbjct  721   PSVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLA  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV LK+  MME++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++R
Sbjct  781   FPVVLKNMSMMEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRTGDVR  840

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDPDISS LVDLAL+E++ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWL
Sbjct  841   GDISVNFSCDPDISSKLVDLALEELMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWL  900

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILRSYQSR Y GDV  SFK+QDE R+KVRK LTP T Q+ALQRILPFPCKKQYT VIL
Sbjct  901   DRILRSYQSRAYFGDVSASFKIQDEGRTKVRKALTPSTVQLALQRILPFPCKKQYTAVIL  960

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ S +K LKSL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  961   MPQLSHLKLLKSLLQLRSDGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  1011



>ref|XP_010049573.1| PREDICTED: uncharacterized protein LOC104438184 [Eucalyptus grandis]
 gb|KCW82270.1| hypothetical protein EUGRSUZ_C03689 [Eucalyptus grandis]
Length=1010

 Score =  1608 bits (4165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 776/1010 (77%), Positives = 885/1010 (88%), Gaps = 0/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+SQ L +KH FRSLKL  V+M +AL   P+G +YGRL NGL YYVR NSKP+M
Sbjct  1     MDLLPAETSQQLGRKHGFRSLKLAAVDMADALGDQPFGTEYGRLPNGLAYYVRPNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALAL V+ GSVLEE++E GVAHI+EHLAFSAT +YTNHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALVVKVGSVLEEDDELGVAHIIEHLAFSATNRYTNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+T+YELFVP+DKPELLSQAISILAEFSSEVR S+ DLEKERGAV+EEYR +RNA G
Sbjct  121   TSSDQTIYELFVPVDKPELLSQAISILAEFSSEVRVSKDDLEKERGAVLEEYRSNRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+L+MEGSKYAERLPIG E VIRTVS + VKQFY+KWY L +MAVIAVGDFPDT
Sbjct  181   RMQDAHWLLLMEGSKYAERLPIGTEAVIRTVSAETVKQFYQKWYQLCHMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVV++IK HFG K + PD  PIP Y VPSH+EPRFS FVE EAAGS +MIS KMP D+L
Sbjct  241   QSVVDMIKTHFGQKGAVPDLQPIPTYSVPSHDEPRFSYFVEREAAGSFIMISYKMPADDL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+DLL ES+F HALNQRFFK SR+ DPPY+SCSA +D LVRP+KAY++T+SCKE 
Sbjct  301   KTVKDYKDLLTESVFLHALNQRFFKQSRRNDPPYFSCSADSDVLVRPLKAYVITASCKEG  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARVR+HGFSEREIS+VRALL+SEIESAYLERDQMQSTSLRDE +QHF
Sbjct  361   GTMEALESMLTEVARVRIHGFSEREISIVRALLLSEIESAYLERDQMQSTSLRDELIQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LR EPVIGIEYEAQLQKT+LPHIS+ +VSKY+E+  TSSSCVIK IEP+ +A VDDLRSV
Sbjct  421   LRGEPVIGIEYEAQLQKTILPHISSLDVSKYAEKLLTSSSCVIKAIEPQVSAKVDDLRSV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLK+N  E+ + IPPWDEE IPEEIV +KP+PG+I QQ EY N+GA E  LSNGMRVCYK
Sbjct  481   VLKVNFLEEAKQIPPWDEELIPEEIVPLKPNPGYITQQLEYSNIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSE+ E+EYFSCSMGSTIAGEIGV+GYRPSV MDMLAGKRAE
Sbjct  541   CTDFLDDQVLFTGFSYGGLSEVSENEYFSCSMGSTIAGEIGVYGYRPSVQMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMRSFSGDCSPSDLETALQLVYQLF T+VEPGEEDV IVMQMAE A+ AQERD
Sbjct  601   VGTKIGAYMRSFSGDCSPSDLETALQLVYQLFATSVEPGEEDVKIVMQMAEAAVRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRVRELNYGNSYFFRPI+  DL++V+P +ACEYF+ CFKDPSTFTVVIVG+I P
Sbjct  661   PYTAFVNRVRELNYGNSYFFRPIKTSDLKRVDPRRACEYFSRCFKDPSTFTVVIVGSISP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIPRP EPIL ++RDDLKGLP   P+ I+REVV SPMV+AQCSVQ+CF
Sbjct  721   TIAVPLILQYLGGIPRPPEPILRYSRDDLKGLPVTSPTKIVREVVRSPMVQAQCSVQICF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++H +GFLSKLLETK++QVLRFK+GQIY+ GV+VFLG N+PSR G++RG
Sbjct  781   PVELKNGTMVEEIHSIGFLSKLLETKLMQVLRFKHGQIYSTGVTVFLGSNRPSRTGDVRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+IS  LVDL LDEI RLQE GPS+EDV T+LEIEQRAHE+G+QEN YWLD
Sbjct  841   DISINFSCDPEISLKLVDLTLDEIQRLQEQGPSEEDVLTILEIEQRAHEDGVQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             +ILRSYQSR+YSGDVG SFKVQDE RSKVR+ L P TAQ ALQRI+PFPCKKQYT+VIL+
Sbjct  901   KILRSYQSRVYSGDVGTSFKVQDEGRSKVRESLAPSTAQSALQRIIPFPCKKQYTLVILL  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR++ LKSL   +   +  DAKILAG A +AVL L+LWR+SR S  S
Sbjct  961   PQRSRLQMLKSLFGFSRITHARDAKILAGVAAMAVLALSLWRHSRRSANS  1010



>gb|EYU41612.1| hypothetical protein MIMGU_mgv1a000803mg [Erythranthe guttata]
Length=981

 Score =  1608 bits (4164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 786/1011 (78%), Positives = 879/1011 (87%), Gaps = 31/1011 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPK-KHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPK  222
             MDLLP ESSQ+L K K RFRSLKLVN N ++ L+ TPY VDYGRL NGLTYYVR+NSKPK
Sbjct  1     MDLLPGESSQILSKTKLRFRSLKLVNYNEDDILAATPYAVDYGRLSNGLTYYVRANSKPK  60

Query  223   MRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA  402
             MRAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KY+NHDIVKFLESIGAEFGACQNA
Sbjct  61    MRAALALAVKVGSVLEEEEERGVAHIVEHLAFSATKKYSNHDIVKFLESIGAEFGACQNA  120

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +TSADETVYELFVPIDKP++LSQ+IS+LAEFSSEVR S  DLEKERGAV+EEYRGSRNAN
Sbjct  121   MTSADETVYELFVPIDKPDILSQSISVLAEFSSEVRVSVDDLEKERGAVLEEYRGSRNAN  180

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQDAHWVLMMEGSKYAERLPIGLEKVIR VSP+IVK+FY KWYH++NMA+I VGDFPD
Sbjct  181   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRAVSPEIVKRFYNKWYHMQNMALIIVGDFPD  240

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             TQSVVE+IK HF  K    DPPPIP + VPSHEEPRFS FVESEAAGSAVMISCK+PV E
Sbjct  241   TQSVVEMIKTHFEDKKPELDPPPIPQFTVPSHEEPRFSSFVESEAAGSAVMISCKVPVGE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYR+LLAESMFFHALNQRFFK+SRK DPPY+SCS AAD LVR  KAYIMTSSCK+
Sbjct  301   LKTVKDYRNLLAESMFFHALNQRFFKLSRKNDPPYFSCSTAADVLVRATKAYIMTSSCKQ  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
              GT  ALESMLTEVARVR+HGFSEREISV RALLMSEIESAYLERDQMQS++LRDEY+QH
Sbjct  361   NGTTVALESMLTEVARVRVHGFSEREISVARALLMSEIESAYLERDQMQSSNLRDEYIQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FLRNEPV+GIEYEAQL KT+LPHIS SEVS+YSE F T+ SCVIKTIEPRAT TVDDL++
Sbjct  421   FLRNEPVVGIEYEAQLHKTILPHISVSEVSQYSENFRTTCSCVIKTIEPRATVTVDDLKT  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VVL++NT E+   I PWDEE+IPEEIVS++P+PG ++QQ EY ++GA E  LSNGMRVCY
Sbjct  481   VVLRVNTLEEDGGISPWDEESIPEEIVSIEPNPGHVVQQVEYSSIGATELILSNGMRVCY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+F DDQVLFTGFSYGGLSEL +S+YFSCSMG TIAGEIGVFG+RP+VL DMLA    
Sbjct  541   KCTDFFDDQVLFTGFSYGGLSELQDSDYFSCSMGPTIAGEIGVFGHRPTVLTDMLA----  596

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
                                 DLETALQLVYQLF T  EPGEEDV IVMQMAEE++ AQER
Sbjct  597   --------------------DLETALQLVYQLFVTKPEPGEEDVKIVMQMAEESVRAQER  636

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRVRE+NYGNSYFFRPI+I DL+KV+P+ ACEYFNNCFKDPSTFTV IVGNID
Sbjct  637   DPYTVFANRVREINYGNSYFFRPIKINDLRKVDPFTACEYFNNCFKDPSTFTVAIVGNID  696

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ A PLILQYLGGIPRP  PI++F RD+LKGLPF FPS++IREVV SPMV+AQCSVQLC
Sbjct  697   PSIACPLILQYLGGIPRPPTPIMNFKRDELKGLPFTFPSTVIREVVRSPMVQAQCSVQLC  756

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPVELK+E+MMED+H  G +SKLLETKI+QVLRFK+GQIY+AGVSVFLGGNKPS+VGNIR
Sbjct  757   FPVELKNENMMEDIHLTGLMSKLLETKILQVLRFKHGQIYSAGVSVFLGGNKPSKVGNIR  816

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISSTLV+LALDEIL LQE+GPSD+DV+ +LEIEQRAHENGLQEN YWL
Sbjct  817   GDISVNFSCDPEISSTLVNLALDEILHLQEEGPSDDDVAAILEIEQRAHENGLQENYYWL  876

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             +R+LR YQSRIYSGD+  SFK+QDE R  VR  LTPLTAQ AL+RI+PFPCKKQYTVVIL
Sbjct  877   ERVLRCYQSRIYSGDIDASFKIQDEGRKGVRNRLTPLTAQSALRRIIPFPCKKQYTVVIL  936

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ+SR  +LKS + S       D+KIL G AG  VL L+LWRYSR + KS
Sbjct  937   MPQSSRFTKLKSFITSK------DSKILVGIAGSVVLALSLWRYSRRATKS  981



>gb|KDP33755.1| hypothetical protein JCGZ_07326 [Jatropha curcas]
Length=981

 Score =  1606 bits (4159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/1010 (77%), Positives = 878/1010 (87%), Gaps = 29/1010 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP+E+S+ +  KHRFRSLKLVNV++++ L   P+G DYGRLDNGL YYVR NSKP+M
Sbjct  1     MDLLPSETSK-IANKHRFRSLKLVNVDLDQVLDDQPFGADYGRLDNGLFYYVRRNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFS+EVR S+ DLEKERGAVMEEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSQAISVLAEFSTEVRVSKDDLEKERGAVMEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LMM+GSKYA+RLPIGLEKVIRTVS + VKQFY+KWYHL NMAVIAVGDF DT
Sbjct  180   RMQDAHWILMMQGSKYADRLPIGLEKVIRTVSAETVKQFYRKWYHLHNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELIK HFG K S P+PP IP + VPSHEE R+SCFVESEAAGSAVMIS KMP DEL
Sbjct  240   KSVVELIKMHFGAKYSEPEPPQIPIFQVPSHEESRYSCFVESEAAGSAVMISYKMPADEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTV+DY+D+L ESMF +ALNQRFFK+SR+KDPPY+SCSAAAD LV               
Sbjct  300   KTVRDYKDMLVESMFLYALNQRFFKLSRRKDPPYFSCSAAADALV---------------  344

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                          ARVRLHGFS+REIS+VR+LLM+EIESAYLERDQ QSTSLRDE+LQHF
Sbjct  345   -------------ARVRLHGFSDREISIVRSLLMAEIESAYLERDQTQSTSLRDEFLQHF  391

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKT+LP ISA EVS+YSE+  TS SCVIKTIEPRA+ATVDDL+ V
Sbjct  392   LRNEPVVGIEYEAQLQKTILPQISALEVSQYSEKLRTSCSCVIKTIEPRASATVDDLKKV  451

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             +LKIN  E ++SIPPWDEE IPEEIV+  P+PG I++Q EY N+GA E  LSNGMRVCYK
Sbjct  452   LLKINILEGERSIPPWDEEKIPEEIVATMPNPGSILRQLEYSNIGATELILSNGMRVCYK  511

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSE+PES+YFSCSMGSTIAGEIG+FGYRPSVLMDMLAGKR E
Sbjct  512   CTDFLDDQVLFTGFSYGGLSEIPESDYFSCSMGSTIAGEIGIFGYRPSVLMDMLAGKRVE  571

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLF TNV PGEEDVNIVMQMAEEA+ AQERD
Sbjct  572   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFITNVIPGEEDVNIVMQMAEEAVRAQERD  631

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFA+RV+ELNYGNSYFFRPIRI DL+KV+P KACEYFN+CF+DPSTFTVVIVGN+DP
Sbjct  632   PYTAFADRVKELNYGNSYFFRPIRISDLRKVDPLKACEYFNSCFRDPSTFTVVIVGNLDP  691

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PL+LQYLGGIP P EPILHFNRDDL GLPF FP+ IIREVV SPMVEAQCSVQL F
Sbjct  692   TIALPLMLQYLGGIPEPPEPILHFNRDDLTGLPFTFPTRIIREVVRSPMVEAQCSVQLSF  751

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV LK+  M+E++H +GFLSKLLETKI+QVLRFK+GQIY+AGVSVFLGGN+PSR G+IRG
Sbjct  752   PVVLKNGTMVEEIHCIGFLSKLLETKIMQVLRFKHGQIYSAGVSVFLGGNRPSRTGDIRG  811

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI I FSCDP ISS L DLALDEILRLQE+GPSDEDV TVLE+EQRAHE GLQEN YWL+
Sbjct  812   DISIIFSCDPRISSKLADLALDEILRLQEEGPSDEDVLTVLELEQRAHETGLQENFYWLE  871

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIY+GD+ ++F++QDE RS VR+ LT  T Q+ LQRILP+PCKKQYT VILM
Sbjct  872   RILRSYQSRIYNGDLSNAFEIQDEGRSNVRQSLTTSTVQLTLQRILPYPCKKQYTSVILM  931

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR + L S   S    Y  DAKI+A  AG+ VL L+ WRYSRS+L+S
Sbjct  932   PQTSRFQLLTSFFQSTQTSYARDAKIIASVAGLTVLALSFWRYSRSALRS  981



>ref|XP_006584795.1| PREDICTED: uncharacterized protein LOC100783565 [Glycine max]
Length=1016

 Score =  1605 bits (4157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/1007 (78%), Positives = 885/1007 (88%), Gaps = 1/1007 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPA S+  + KK  FRSLKLVN +M++ LS  P GVDYG LDNGL YYVR NSKP+M
Sbjct  1     MELLPA-SAPPISKKQGFRSLKLVNADMDQLLSDQPVGVDYGTLDNGLRYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVWAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYEL VP+DKPELLSQAIS+LAEFSSE+R S+ DLEKERGAVMEEYRGSRNA G
Sbjct  120   TSADDTVYELLVPVDKPELLSQAISVLAEFSSEIRVSKDDLEKERGAVMEEYRGSRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW+LMMEGSKYAERLPIGLE+VIRTVS + VK FYKKWYHL NMAVIAVGDF D 
Sbjct  180   RLQDAHWMLMMEGSKYAERLPIGLERVIRTVSSETVKHFYKKWYHLCNMAVIAVGDFSDA  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             Q VVELIK HFG K   PDPP IP   VPSH+EPRFSCFVESEAAGSAVMIS KMP DEL
Sbjct  240   QDVVELIKTHFGQKIPDPDPPLIPTIQVPSHDEPRFSCFVESEAAGSAVMISYKMPADEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LLAESMF +ALNQRFFKI+R+ DPPY+SCSAAAD LVRP+KA IMTSSCK K
Sbjct  300   KTVKDYRNLLAESMFLYALNQRFFKIARRNDPPYFSCSAAADVLVRPLKANIMTSSCKRK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVAR RLHGFSEREISVVRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  360   GTIEALESMLIEVARARLHGFSEREISVVRALLMSEIESAYLERDQIQSTSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHIS  E+SK SE+  TS SCVIKTIEP+  A +DDL++V
Sbjct  420   LHNEPVVGIEYEAQLQKTLLPHISTLEISKCSEKLRTSCSCVIKTIEPQPFAVLDDLKNV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I PWD+E++PEEIV+ KP+ G ++Q+ EY N+GA E  LSNGMR+CYK
Sbjct  480   VKKVNLLEEEGRISPWDDEHVPEEIVTTKPNMGHVVQELEYSNIGATELILSNGMRICYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTG+SYGGLSELPE+EYFSCSMG TIAGEIGVFGYRPSVLMDMLAGKRAE
Sbjct  540   RTDFLDDQVIFTGYSYGGLSELPENEYFSCSMGPTIAGEIGVFGYRPSVLMDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+F GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEEA+ AQ+RD
Sbjct  600   VGTKIGAYMRTFYGDCSPSDLETALQLVYQLFTTNLTPGEEDVKIVMQMAEEAVSAQDRD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRV+ELNYGNSYFFRPIR  DLQKV+P KACE+F+ CFKDPSTFT+VIVGNIDP
Sbjct  660   PYTAFTNRVKELNYGNSYFFRPIRKSDLQKVDPRKACEFFSTCFKDPSTFTIVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P EPI+HFNRD+LKGLPF FP+SI REVV SPMV+ Q   Q+CF
Sbjct  720   TIAMPLILQYLGGIPKPPEPIMHFNRDELKGLPFTFPTSIHREVVWSPMVKPQFLGQICF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             P E K    +E++HFVGFLSKLLETKI+QVLRFK GQIY+ GVSVFLGGNKPSR+G++RG
Sbjct  780   PGEGKKGRQVEEIHFVGFLSKLLETKIMQVLRFKLGQIYSVGVSVFLGGNKPSRIGDVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVD+ALDE+LRLQE+GPS++DVST+LEIEQRAHENGLQEN YWLD
Sbjct  840   DISINFSCDPEISSKLVDIALDEMLRLQEEGPSEQDVSTILEIEQRAHENGLQENYYWLD  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SF++QDE RSKVR  LTP TAQ AL+RILPFPCK +YTVVILM
Sbjct  900   RILHSYQSRVYSGDVGTSFEIQDEGRSKVRSSLTPSTAQFALKRILPFPCKNKYTVVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             P+AS ++ LKS++ SA   Y  +AKILAG  G+AVL  +LWR ++++
Sbjct  960   PKASPLQLLKSVIQSARTNYGREAKILAGVTGLAVLAFSLWRRAQNN  1006



>ref|XP_007160251.1| hypothetical protein PHAVU_002G305500g [Phaseolus vulgaris]
 gb|ESW32245.1| hypothetical protein PHAVU_002G305500g [Phaseolus vulgaris]
Length=1016

 Score =  1603 bits (4152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/1007 (79%), Positives = 893/1007 (89%), Gaps = 1/1007 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPA ++  + KK  FRSLKLVN +ME+ LS  P GVDYG LDNGL YYVR NSKP+M
Sbjct  1     MELLPA-AAPPISKKKGFRSLKLVNADMEQLLSDQPVGVDYGTLDNGLRYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAVRAGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVRAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYEL VP+DKPELLSQAISILAEFSSE+R S+ DL KERGAVMEEYRGSRNA G
Sbjct  120   TSADDTVYELLVPVDKPELLSQAISILAEFSSEIRVSKDDLAKERGAVMEEYRGSRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW+LMMEGSKYAERLPIGLEKVIRTVS + VK FYKKWYHL NMAVIAVGDF DT
Sbjct  180   RLQDAHWILMMEGSKYAERLPIGLEKVIRTVSSETVKHFYKKWYHLCNMAVIAVGDFNDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             Q VVELIK HFG K   PDPP IP + VPSH+EPRFSCFVESEAAGSAVMIS K PVDEL
Sbjct  240   QGVVELIKTHFGQKIPDPDPPLIPTFQVPSHDEPRFSCFVESEAAGSAVMISYKAPVDEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LLAESMF +ALNQRFFKI+R+ DPPY+SCSAA D LVRP+KA IMTSSCK K
Sbjct  300   KTVKDYRNLLAESMFLYALNQRFFKIARRNDPPYFSCSAAGDVLVRPLKANIMTSSCKRK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVARVRLHGFS+REISVVRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  360   GTIEALESMLIEVARVRLHGFSDREISVVRALLMSEIESAYLERDQIQSTSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L +EPV+GIEYEAQLQKTLLPHIS  E+SK SE+  TS SCVIKTIEP+  A +DDL++V
Sbjct  420   LHSEPVVGIEYEAQLQKTLLPHISTLEISKCSEKLRTSCSCVIKTIEPQPFAVLDDLKNV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I  WD+E++PEEIV+ KP+ G ++Q+ EY N+GA E  LSNGMR+CYK
Sbjct  480   VKKVNLLEEEGRISSWDDEHVPEEIVTTKPNMGHVVQELEYSNIGATELVLSNGMRICYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTG+SYGGLSELPESEYFSCSMG TIAGEIGVFGYRPSVLMDMLAGKRAE
Sbjct  540   RTDFLDDQVIFTGYSYGGLSELPESEYFSCSMGPTIAGEIGVFGYRPSVLMDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+F GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEEA+ AQ+RD
Sbjct  600   VGTKIGAYMRTFYGDCSPSDLETALQLVYQLFTTNLTPGEEDVKIVMQMAEEAVSAQDRD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRV+ELNYGNSYFFRPIR  DLQKV+P+KACE+F+ CFKDPSTF+VVIVGNIDP
Sbjct  660   PYTAFTNRVKELNYGNSYFFRPIRKSDLQKVDPWKACEFFSTCFKDPSTFSVVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             A A PLILQYLGGIP+P EPI+ FNRD+LKGLPF FP++I REVV SPMVEAQC VQ+CF
Sbjct  720   AIAMPLILQYLGGIPKPPEPIMQFNRDELKGLPFTFPTAIHREVVRSPMVEAQCLVQICF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL++  M+E++H+VGFLSKLLETKI+QVLRFK+GQIY+ GVSVFLGGNKPSRVG+IRG
Sbjct  780   PVELRNGTMVEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVGVSVFLGGNKPSRVGDIRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             D+ INFSCDPDISS LVD+ALDE+LRLQE+GPS++DVST+LEIEQRAHENGLQEN YWLD
Sbjct  840   DVSINFSCDPDISSKLVDIALDEMLRLQEEGPSEQDVSTMLEIEQRAHENGLQENYYWLD  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             +IL SYQSR+Y+GD G SF+VQDE RSKVR  LTP TAQ+AL+RILPFPCK +YTVVILM
Sbjct  900   KILHSYQSRVYAGDAGTSFEVQDEGRSKVRSSLTPSTAQLALKRILPFPCKNKYTVVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             P+AS  + LKS+  SA   Y  + KILAG AG+AVL  +LWR+ RS+
Sbjct  960   PKASPFQLLKSVFQSARTNYGKETKILAGVAGLAVLAFSLWRHGRSN  1006



>ref|XP_006451387.1| hypothetical protein CICLE_v10010146mg [Citrus clementina]
 gb|ESR64627.1| hypothetical protein CICLE_v10010146mg [Citrus clementina]
Length=1000

 Score =  1601 bits (4146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/1010 (77%), Positives = 887/1010 (88%), Gaps = 10/1010 (1%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPAE SQ + KKH FRSLKLV+ ++ E L + P+GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MELLPAEGSQ-IAKKHGFRSLKLVSFDLNEELGEQPFGVDYGRLDNGLFYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE ERGVAHIVEHLAFSATEKYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEHERGVAHIVEHLAFSATEKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLS+AIS+LAEFS+EVR S+ DLEKERGAV+EEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSRAISVLAEFSTEVRVSKDDLEKERGAVLEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAE LPIGLEKVIRTV    VK+FY+KWY L+NMAVIAVGDFPDT
Sbjct  180   RMQDAHWVLMMEGSKYAECLPIGLEKVIRTVFSDTVKRFYQKWYRLQNMAVIAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             + VVELI  HFG K S  DPP IP + VPSH+EPRFSCF+ESEA GSAV++S KMPV+EL
Sbjct  240   KGVVELINTHFGQKKSATDPPVIPKFPVPSHQEPRFSCFIESEAGGSAVIVSYKMPVNEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KT+KDY+++L ESMF HALNQRFFK+SR+KDPPY+SCSA+AD LVRP+KAYIM+SSCKE+
Sbjct  300   KTIKDYKEMLTESMFLHALNQRFFKLSRRKDPPYFSCSASADDLVRPLKAYIMSSSCKER  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT++ALESML EVARVRLHGFSERE+SV RALLMSE+ESAYLERDQMQST+LRDE LQHF
Sbjct  360   GTLKALESMLIEVARVRLHGFSEREVSVARALLMSEVESAYLERDQMQSTNLRDECLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L  EP+IGIEYEA+LQKTLLPHISA EVS+YSE+  TS SCVIKTIEP+  +T+DDL+++
Sbjct  420   LCKEPIIGIEYEARLQKTLLPHISALEVSRYSEKLQTSCSCVIKTIEPQTFSTIDDLKNI  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLKI   E+K+ +    +  + +           I+QQFEY+N+GA E  LSNGMRVCYK
Sbjct  480   VLKIKNLEEKKFLLGMRKTYLKKL---------NIVQQFEYENLGATELVLSNGMRVCYK  530

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIGVFGYRPS+LMDMLAGKR E
Sbjct  531   CTDFLDDQVLFTGFSYGGLSELPESEYLSCSMGSTIAGEIGVFGYRPSMLMDMLAGKRVE  590

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
              GTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEE I AQERD
Sbjct  591   GGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVAPGEEEVKIVMQMAEEVIRAQERD  650

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+E+NYGNSYFFRPIRI DLQKV+P KAC+YFN+CFKDPSTFTVVIVGNIDP
Sbjct  651   PYTAFANRVKEINYGNSYFFRPIRISDLQKVDPLKACDYFNSCFKDPSTFTVVIVGNIDP  710

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             +   PLILQYLGGIP+P EPILHFNRD+LKGLPF FPSSIIREVV SPMVEAQCSVQLCF
Sbjct  711   SNGIPLILQYLGGIPKPPEPILHFNRDNLKGLPFTFPSSIIREVVRSPMVEAQCSVQLCF  770

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++++VGFLSKLLETK++QVLRFK+GQIY+A VSVFLGGNK SR G++RG
Sbjct  771   PVELKNGTMVEEINYVGFLSKLLETKMMQVLRFKHGQIYSASVSVFLGGNKHSRTGDVRG  830

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+IS  LVDLALDEI RLQ++GPSDEDVST+LE+EQRAHE GLQEN +WLD
Sbjct  831   DISINFSCDPEISFKLVDLALDEISRLQKEGPSDEDVSTILELEQRAHETGLQENYHWLD  890

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SFK+QDEARSKVRK L PLT Q+ALQRI+P+PC KQ+TVVILM
Sbjct  891   RILCSYQSRVYSGDVGTSFKIQDEARSKVRKSLQPLTLQLALQRIMPYPCNKQFTVVILM  950

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR K L+SL       +  DAK LA  AG+  L  +LWRYSR +LKS
Sbjct  951   PQVSRFKFLRSLFRHNQTYHLGDAKALAAVAGLTFLAFSLWRYSRRTLKS  1000



>ref|XP_010667309.1| PREDICTED: uncharacterized protein LOC104884367 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1007

 Score =  1600 bits (4144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1008 (76%), Positives = 886/1008 (88%), Gaps = 5/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+ + L KKH FRSLKL+ ++ME+ L+  PYGVDYGRLDNGLTYYVRSNSKPKM
Sbjct  1     MDLLPAETPE-LAKKHGFRSLKLLTIDMEQPLADKPYGVDYGRLDNGLTYYVRSNSKPKM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALAL V+AGSVLEEE+ERGVAHIVEHLAF+AT KYTNHDIVKFLESIGAEFGACQNA+
Sbjct  60    RAALALVVKAGSVLEEEDERGVAHIVEHLAFNATTKYTNHDIVKFLESIGAEFGACQNAM  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DKPELLS+AIS+LAEFS+E+R S  DLEKERGAVMEEYRGSRNANG
Sbjct  120   TSADDTVYELFVPVDKPELLSEAISVLAEFSTEIRVSAEDLEKERGAVMEEYRGSRNANG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQD+HW LMM GSKYAERLPIG EKVIRTVS   VKQFYKKWYHL++MA+IAVGDFP T
Sbjct  180   RMQDSHWALMMGGSKYAERLPIGTEKVIRTVSAATVKQFYKKWYHLQHMALIAVGDFPST  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELI+ HFG K+S  +P  +P++ VPSH+EPRFSCF+ESEAAGSAVMISCKMP  +L
Sbjct  240   ESVVELIRMHFGQKSSALEPVNLPHFPVPSHDEPRFSCFIESEAAGSAVMISCKMPARQL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KT+KDYRDLL ESMF  ALNQR FK+SR++DPP+YSCSAAAD LV P+KAYIMTSSCKE 
Sbjct  300   KTIKDYRDLLVESMFLQALNQRLFKVSRRRDPPFYSCSAAADDLVSPIKAYIMTSSCKES  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALE+M+ E+AR+ LHGFS+REIS+VRALL+SEIESAYLERDQ+QSTSLRDEY+QHF
Sbjct  360   GTIEALEAMVMELARIHLHGFSDREISIVRALLLSEIESAYLERDQIQSTSLRDEYVQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIE+EAQLQKTLLP ISA+EV+ ++++F T+S+CVIK IEP+AT T+D+L++ 
Sbjct  420   LCNEPVVGIEFEAQLQKTLLPSISATEVATFAQKFCTTSNCVIKAIEPQATVTLDELKNA  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+   E+ + IP WDEE IPE+IV+++P+ G I Q  EY ++ A E  LSNGMRVCYK
Sbjct  480   VSKVTCLEEGRRIPAWDEEQIPEDIVAIEPNSGSIDQLQEYSDIKATELILSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVL +G+SYGGLSEL E++YFSCSMGSTIAGEIG+FG++PS+LMDMLAGKRAE
Sbjct  540   CTDFLDDQVLISGYSYGGLSELSETDYFSCSMGSTIAGEIGIFGHKPSLLMDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLG YMR+FS DCSP+DLETALQLVYQLF TNVEP EE+   VM+MAEEA+ AQERD
Sbjct  600   VGTKLGPYMRTFSADCSPTDLETALQLVYQLFMTNVEPIEEEARKVMEMAEEAVRAQERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRE+NYGNSYFFRPIRI DL+KV+ +KAC+YF+NCFKDPSTFTVVIVGNIDP
Sbjct  660   PYTAFANRVREINYGNSYFFRPIRISDLKKVDAFKACKYFSNCFKDPSTFTVVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             A A PLILQYLGGIP+P  PIL FNRDDLKGLPF  P  IIRE+V  PMVEAQCSVQLCF
Sbjct  720   AIASPLILQYLGGIPKPPTPILQFNRDDLKGLPFTLPDKIIREIVRRPMVEAQCSVQLCF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++HFVGFLSKLLETK++QVLRFK+GQIY+AGVSVFLGGNKPSR G++RG
Sbjct  780   PVELKNGAMIEEIHFVGFLSKLLETKMMQVLRFKHGQIYSAGVSVFLGGNKPSRTGDVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP +SSTLVDLALDEIL LQ++GP+DED+S++LEIEQRAHENGLQEN YWLD
Sbjct  840   DISINFSCDPSMSSTLVDLALDEILHLQKEGPTDEDISSILEIEQRAHENGLQENYYWLD  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSR+YSGD+G SF++QDEAR KVR  LTP   + ALQRILP PC K+YTVVILM
Sbjct  900   RILRSYQSRVYSGDLGSSFQIQDEARVKVRASLTPTATKSALQRILPLPCSKKYTVVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSL  3069
             PQA R K L S      +    + K+L G AG+ +L +TLWRYSRSS+
Sbjct  960   PQAKRCKLLNSCFWETFQ----NTKVLIGIAGLTILTVTLWRYSRSSI  1003



>ref|XP_006853937.1| hypothetical protein AMTR_s00036p00205320 [Amborella trichopoda]
 gb|ERN15404.1| hypothetical protein AMTR_s00036p00205320 [Amborella trichopoda]
Length=988

 Score =  1600 bits (4143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/987 (78%), Positives = 874/987 (89%), Gaps = 2/987 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE +  + ++H FRSLKL+NV+M+EALS+ PYGV+YG LDNGL YYVR NSKP+M
Sbjct  1     MDLLPAEIAS-ITRRHGFRSLKLLNVHMDEALSEEPYGVEYGSLDNGLHYYVRVNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALAL V+ GSVLE EEERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNA 
Sbjct  60    RAALALGVKVGSVLEVEEERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAS  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADET+YEL VP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  120   TSADETIYELLVPVDKPELLSQAISVLAEFSSEVRVSASDLEKERGAVLEEYRGGRNAAG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQ+AHWVLMMEGS+YA+R PIGLEKVIRTVSP+ VK FY KWYHL NMAV+AVGDFPDT
Sbjct  180   RMQEAHWVLMMEGSRYADRQPIGLEKVIRTVSPETVKGFYDKWYHLHNMAVVAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSpp-dpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             +SVVELI+ HFG K S   +PP IP + VPSHEEPRFSCFVESEA GSAVMISCK+PV E
Sbjct  240   KSVVELIRTHFGQKVSASIEPPVIPVFPVPSHEEPRFSCFVESEAGGSAVMISCKIPVFE  299

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             +KTVKDYRD LAE+MF  AL+QR FKI+R+KDPP++SC +AAD L+RPVKA I+TS+CKE
Sbjct  300   MKTVKDYRDSLAEAMFHCALSQRLFKIARRKDPPFFSCGSAADVLIRPVKACIVTSTCKE  359

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
              G +EALESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  360   GGIIEALESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQMQSTSLRDEYLQH  419

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F R EPV+GIEYEAQLQKT+LPHISA EVS ++E F ++ SCVIK +EPRA +T++DL++
Sbjct  420   FFRKEPVVGIEYEAQLQKTILPHISAKEVSSFAENFRSTCSCVIKIVEPRARSTIEDLKA  479

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              V KI++ E+  +IP WD+E+IPEEIVSVKP PG I+QQ  + NVG  E  +SNGMRVCY
Sbjct  480   AVSKISSMEECGAIPDWDDEHIPEEIVSVKPDPGDIVQQTSFPNVGVTELVMSNGMRVCY  539

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQVLFTGFSYGGLSEL ESEY SCSMGSTIAGEIGVFGY+PS+LMDMLAGKRA
Sbjct  540   KCTDFLDDQVLFTGFSYGGLSELSESEYLSCSMGSTIAGEIGVFGYKPSILMDMLAGKRA  599

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAY+R+FSGDCSPSDLETALQLVYQLFTTNV PG+E+V IVMQM EEAI AQER
Sbjct  600   EVGTKVGAYLRTFSGDCSPSDLETALQLVYQLFTTNVVPGDEEVKIVMQMTEEAILAQER  659

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DP+TAFANRVRELNYGNSYFF+PIR+ DL+KV+P +ACEYFNNCFKDPSTFTVVIVGNID
Sbjct  660   DPFTAFANRVRELNYGNSYFFKPIRVPDLRKVDPIRACEYFNNCFKDPSTFTVVIVGNID  719

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             PA A PLILQ+LGGIP+P+EP+LH NRDDLKGLPF FP +I+REVV SPMVEAQCSVQL 
Sbjct  720   PAIALPLILQFLGGIPKPAEPVLHCNRDDLKGLPFTFPETIVREVVRSPMVEAQCSVQLT  779

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPVELK+  MME++HFVGF+SKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR GN+R
Sbjct  780   FPVELKNVQMMEEIHFVGFVSKLLETKIMQVLRFKHGQIYSVSVSVFLGGNKPSRTGNVR  839

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDPD S  LVD++LDEIL LQE GPS EDVST+LEIEQRAHENGLQEN YWL
Sbjct  840   GDIAVNFSCDPDSSWKLVDISLDEILCLQEKGPSQEDVSTILEIEQRAHENGLQENHYWL  899

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILRSYQSR+YS D+G SF+ QDE RSKVR+ L P TAQ+A QRILPFPC  QY+VV+L
Sbjct  900   DRILRSYQSRVYSCDLGASFEAQDEGRSKVRECLNPSTAQLASQRILPFPCTSQYSVVVL  959

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKI  3003
             MPQ+SR++ LKSL+ SA  R  T+AK+
Sbjct  960   MPQSSRIRFLKSLLQSAQNRTGTEAKM  986



>ref|XP_010545331.1| PREDICTED: uncharacterized protein LOC104817747 isoform X1 [Tarenaya 
hassleriana]
Length=1006

 Score =  1597 bits (4135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 770/1006 (77%), Positives = 882/1006 (88%), Gaps = 2/1006 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDL+  ESS+ + KKH FRSLKLVNV++E+ LS+ P+GVDYGRLDNGL YYVRSNSKP+M
Sbjct  1     MDLIAGESSK-IAKKHGFRSLKLVNVDLEQELSEEPFGVDYGRLDNGLVYYVRSNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT++YTNHDIVKFLES+GAEFG CQNA+
Sbjct  60    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKRYTNHDIVKFLESVGAEFGPCQNAM  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             T+ADET+YELFVP+DKPELLSQAISILAEFS EVR S+ DLEKERGAV+EEYRG+RNA+G
Sbjct  120   TTADETIYELFVPVDKPELLSQAISILAEFSCEVRVSKEDLEKERGAVLEEYRGTRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW LMM GSKYAERLPIGLEKVIR+VS + VKQFY+KWYHL NMAVIAVGDFPD+
Sbjct  180   RMQDAHWQLMMAGSKYAERLPIGLEKVIRSVSAETVKQFYQKWYHLCNMAVIAVGDFPDS  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             ++VV+LIK HF  KTS  +PP +P + +PSHEE RFSCFVESEAAGSAVMIS KMPV++L
Sbjct  240   KTVVDLIKVHFEGKTSSSEPPEMPIFPIPSHEETRFSCFVESEAAGSAVMISYKMPVNDL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYRD+LAESMF HALNQRFFK+SRKKDPP++SCSAAAD LV P+KAYIM+SSCKEK
Sbjct  300   KTVKDYRDMLAESMFLHALNQRFFKLSRKKDPPFFSCSAAADVLVSPLKAYIMSSSCKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+ +LESML EVARVRLHGF EREIS+VRAL+MSEIESAYLERDQ+QSTSLRDEY+QHF
Sbjct  360   GTLASLESMLLEVARVRLHGFFEREISIVRALIMSEIESAYLERDQVQSTSLRDEYIQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L  EPV+GIE+EAQLQKTLLP I AS+VSKY+E+  TS  CVIKTIEPR++AT+DDLR+ 
Sbjct  420   LHKEPVVGIEFEAQLQKTLLPQILASDVSKYAEKLKTSCGCVIKTIEPRSSATIDDLRNT  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V  IN  E+++ I PWD+E+IPEEI+SVKP PG I+ Q EY +VG  E  LSNGMRVCYK
Sbjct  480   VANINRLEEEKKIAPWDDEHIPEEIISVKPDPGNIIHQLEYPDVGVTELTLSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT++ DDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIG+FGY PSVLMDMLAGKR E
Sbjct  540   CTDYFDDQVLFTGFSYGGLSELPESEYISCSMGSTIAGEIGIFGYSPSVLMDMLAGKRVE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ AQERD
Sbjct  600   VGTKLGAYMRTFSCDCSPTDLETALQLVYQLFTTNVIPQEEEVRIVMQMAEEAVRAQERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYT FANRV+E+NYGNSYFFRPIRI DL+KV+P KACEYFN  F DPSTFTVVIVGN+DP
Sbjct  660   PYTVFANRVKEINYGNSYFFRPIRISDLRKVDPLKACEYFNRSFTDPSTFTVVIVGNVDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I REVV SPMVEAQCSVQLCF
Sbjct  720   TMALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITREVVRSPMVEAQCSVQLCF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV+L +  M+E++H VGFLSKLLETKI+Q LRFK+GQIY+A VSVFLGGNKPSR   +RG
Sbjct  780   PVQLTNGTMIEEIHRVGFLSKLLETKIIQFLRFKHGQIYSAEVSVFLGGNKPSRTAEVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED++T+LEIEQRAHENGLQEN YWL+
Sbjct  840   DISVNFSCDPEISSKLVDLALNEIIRLQEEGPSQEDIATILEIEQRAHENGLQENYYWLE  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILR YQSR+Y+GD+G SFK+Q+E R ++R+ L P +AQ ALQRILPFPCKKQYT VILM
Sbjct  900   RILRGYQSRVYAGDLGVSFKIQEEGRLRLRESLAPQSAQEALQRILPFPCKKQYTAVILM  959

Query  2926  PQASRMKRLKSLVCSAPK-RYCTDAKIlagtagvavllltlWRYSR  3060
             P+  R   L SL  S    R+  DAK+L G A +AV    LWRYSR
Sbjct  960   PRKPRFGFLTSLFVSPESCRHGRDAKVLVGVAVLAVACFGLWRYSR  1005



>ref|XP_006580490.1| PREDICTED: uncharacterized protein LOC100797999 [Glycine max]
Length=1019

 Score =  1597 bits (4135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/1010 (78%), Positives = 893/1010 (88%), Gaps = 4/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPA  +  + KK  FRSLKLVNV+M++ LS  P GVDYG LDNGL YYVR NSKP+M
Sbjct  1     MELLPA-GTPPISKKQGFRSLKLVNVDMDQLLSDQPVGVDYGILDNGLRYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAVRAGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVRAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYEL VP+DKPELLS+AIS+LAEFSSE+R S+ DLEKERGAVMEEYRGSRNA G
Sbjct  120   TSADDTVYELLVPVDKPELLSRAISVLAEFSSEIRVSKDDLEKERGAVMEEYRGSRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW+LMMEGSKYAERLPIGLE+VIRTVS + VK FYKKWYHL NMAVIAVGDF DT
Sbjct  180   RLQDAHWILMMEGSKYAERLPIGLERVIRTVSSETVKHFYKKWYHLCNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             Q VVELIK HFG K   PDPP IP   VPSH+EPRFSCFVESEAAGSAVMIS K+P DEL
Sbjct  240   QGVVELIKTHFGQKIPDPDPPLIPTIQVPSHDEPRFSCFVESEAAGSAVMISYKIPTDEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY +LLAESMF +ALNQRFFKI+R+ DPPY+SCSAAAD LVRP+KA IMTSSCK K
Sbjct  300   KTVKDYCNLLAESMFLYALNQRFFKIARRNDPPYFSCSAAADVLVRPLKANIMTSSCKRK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVARVRLHGFSEREISVVRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  360   GTIEALESMLIEVARVRLHGFSEREISVVRALLMSEIESAYLERDQIQSTSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHIS  EVSK SE+  TS SCVIKTIEP+  A +DDL++V
Sbjct  420   LHNEPVVGIEYEAQLQKTLLPHISTLEVSKCSEKLRTSCSCVIKTIEPQPFAVLDDLKNV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I PWD+E++PEEIV+ KP+ G ++Q+ +Y N+GA E  LSNGMR+CYK
Sbjct  480   VKKVNLLEEEGRISPWDDEHVPEEIVTTKPNMGHVVQELKYSNIGATELILSNGMRICYK  539

Query  1666  CTNFL---DDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGK  1836
              T+FL   DDQV+FTG+SYGGLSELPE+EYFSCSMG TIAGEIGVFGYRPSVLMDMLAGK
Sbjct  540   HTDFLDFHDDQVIFTGYSYGGLSELPENEYFSCSMGPTIAGEIGVFGYRPSVLMDMLAGK  599

Query  1837  RAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQ  2016
             RAEVGTK+GAYMR+F GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEEA+ AQ
Sbjct  600   RAEVGTKIGAYMRTFYGDCSPSDLETALQLVYQLFTTNLTPGEEDVKIVMQMAEEAVSAQ  659

Query  2017  ERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGN  2196
             +RDPYTAF NRV+ELNYGNSYFFRPIR  DLQKV+P KACE+F+ CFKDPS FTVVIVGN
Sbjct  660   DRDPYTAFTNRVKELNYGNSYFFRPIRKSDLQKVDPRKACEFFSTCFKDPSAFTVVIVGN  719

Query  2197  IDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQ  2376
             IDP  A PLILQYLGGIP+P EP++HFNRD+LKGLPF FP+SI REVV SPMVEAQC VQ
Sbjct  720   IDPTIAMPLILQYLGGIPKPPEPVMHFNRDELKGLPFTFPTSIHREVVRSPMVEAQCLVQ  779

Query  2377  LCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGN  2556
             +CFPVELK+  M+E++HFVGFLSKLLETKI+QVLRFK+GQIY+ GVSVFLGGNKPSR+G+
Sbjct  780   ICFPVELKNGTMVEEIHFVGFLSKLLETKIMQVLRFKHGQIYSVGVSVFLGGNKPSRIGD  839

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
             IRGDI INFSCDP+ISS LVD+ALDE+LRLQE+GPS++DVST+LEIEQRAHENGLQEN Y
Sbjct  840   IRGDISINFSCDPEISSKLVDIALDEMLRLQEEGPSEQDVSTILEIEQRAHENGLQENYY  899

Query  2737  WLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVV  2916
             WLDRIL SYQSR+YSGDVG SF++QDE RSKVR  LT LTAQ+AL+RILPFPCK +YTVV
Sbjct  900   WLDRILHSYQSRVYSGDVGTSFEIQDEGRSKVRSSLTTLTAQLALKRILPFPCKNKYTVV  959

Query  2917  ILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             ILMP+AS  + LKS+  SA   Y  +AKILAG  G+AVL  +LWR ++++
Sbjct  960   ILMPKASPFQLLKSVFQSARTNYGREAKILAGVTGLAVLAFSLWRRAQNN  1009



>ref|XP_008242442.1| PREDICTED: uncharacterized protein LOC103340775 [Prunus mume]
Length=979

 Score =  1596 bits (4133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1005 (77%), Positives = 865/1005 (86%), Gaps = 28/1005 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+S  + KKH FRSLKLVNV+M++ L + P GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MDLLPAETSNTVKKKHGFRSLKLVNVDMDQVLGEQPVGVDYGRLDNGLCYYVRCNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSATEKYTNHDI++FLESIGAEFGACQNAV
Sbjct  61    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATEKYTNHDIIRFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DK ELLSQAIS+LAEFSSEVR S+ DLE+ERGAVMEEYRG+RNA G
Sbjct  121   TSADDTVYELFVPVDKHELLSQAISVLAEFSSEVRVSKDDLERERGAVMEEYRGNRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LMMEGS+YA+RLPIGLEKVIRTVS + VKQFY KWYHL NMAVIAVGDF DT
Sbjct  181   RMQDAHWILMMEGSQYADRLPIGLEKVIRTVSSETVKQFYSKWYHLSNMAVIAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HFG+K S P+ P IP Y VPSHEEPRFSCFVESEA GSAV+IS KM   EL
Sbjct  241   QSVVELIKNHFGHKISSPEQPLIPRYTVPSHEEPRFSCFVESEATGSAVIISYKMAAGEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
              TV+DYRDLLAESMF +ALNQRFFKI+R+KDPPY+SCSA+AD LV               
Sbjct  301   DTVRDYRDLLAESMFLYALNQRFFKIARRKDPPYFSCSASADVLV---------------  345

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                          ARV+LHGFSERE+S+VRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  346   -------------ARVQLHGFSEREVSIVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  392

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPVIGIEYEAQLQKTLLP I+A+E+SKY+ +  TS SCVIKTIEPRA+AT+ DL++V
Sbjct  393   LRNEPVIGIEYEAQLQKTLLPQITAAEISKYAAKLQTSCSCVIKTIEPRASATIGDLKNV  452

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V  IN  E+K+ I PWD+E IPEEIV+ KP+PG I+Q+ EY  +G  E  LSNGMRVCYK
Sbjct  453   VSMINDLEEKRIISPWDDEQIPEEIVNTKPNPGNIVQELEYSKIGVTELVLSNGMRVCYK  512

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CTNFLDDQV+FTGFSYGGLSELPESEYFSCSMG TIAGEIGV+GYRPSVLMDMLAGKRAE
Sbjct  513   CTNFLDDQVIFTGFSYGGLSELPESEYFSCSMGPTIAGEIGVYGYRPSVLMDMLAGKRAE  572

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             V TKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEE + AQ+RD
Sbjct  573   VSTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVTPGEEDVKIVMQMAEEVVRAQDRD  632

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+ELNYGNSYFFRPIRI DL+KV+P KACEYFN CFKDPSTF++VIVGNIDP
Sbjct  633   PYTAFANRVKELNYGNSYFFRPIRISDLRKVDPLKACEYFNKCFKDPSTFSIVIVGNIDP  692

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLILQYLGGIP P EP+L +NRDDLKGLPF FP + IREVV SPMVE QCSVQLCF
Sbjct  693   SIALPLILQYLGGIPNPPEPLLQYNRDDLKGLPFTFPKTRIREVVRSPMVEEQCSVQLCF  752

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL +  M+ED+H +GFLSKLLETKI+QVLRFK+GQIY  GVSVFLGGNKPSR  N+RG
Sbjct  753   PVELNNGTMVEDIHIIGFLSKLLETKIMQVLRFKHGQIYTVGVSVFLGGNKPSRTANVRG  812

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVDL LDEI RLQE+GPSDEDV T+LEIEQRAHENGLQEN YWLD
Sbjct  813   DISINFSCDPEISSKLVDLTLDEISRLQEEGPSDEDVLTILEIEQRAHENGLQENYYWLD  872

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG  F++Q+E RSKVR+ LTP+TAQ+ALQ+ILPFPCKK+YTVVILM
Sbjct  873   RILHSYQSRVYSGDVGTCFEIQEEGRSKVRQSLTPVTAQLALQKILPFPCKKKYTVVILM  932

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSR  3060
             P+ S  K L+S   S    Y   AKILAG AG+ VL L+LWRYSR
Sbjct  933   PRTSHFKSLRSFFQSTEISYGRHAKILAGIAGLTVLALSLWRYSR  977



>gb|KCW82271.1| hypothetical protein EUGRSUZ_C03689 [Eucalyptus grandis]
Length=989

 Score =  1596 bits (4133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 760/986 (77%), Positives = 867/986 (88%), Gaps = 0/986 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+SQ L +KH FRSLKL  V+M +AL   P+G +YGRL NGL YYVR NSKP+M
Sbjct  1     MDLLPAETSQQLGRKHGFRSLKLAAVDMADALGDQPFGTEYGRLPNGLAYYVRPNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALAL V+ GSVLEE++E GVAHI+EHLAFSAT +YTNHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALVVKVGSVLEEDDELGVAHIIEHLAFSATNRYTNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+T+YELFVP+DKPELLSQAISILAEFSSEVR S+ DLEKERGAV+EEYR +RNA G
Sbjct  121   TSSDQTIYELFVPVDKPELLSQAISILAEFSSEVRVSKDDLEKERGAVLEEYRSNRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+L+MEGSKYAERLPIG E VIRTVS + VKQFY+KWY L +MAVIAVGDFPDT
Sbjct  181   RMQDAHWLLLMEGSKYAERLPIGTEAVIRTVSAETVKQFYQKWYQLCHMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVV++IK HFG K + PD  PIP Y VPSH+EPRFS FVE EAAGS +MIS KMP D+L
Sbjct  241   QSVVDMIKTHFGQKGAVPDLQPIPTYSVPSHDEPRFSYFVEREAAGSFIMISYKMPADDL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+DLL ES+F HALNQRFFK SR+ DPPY+SCSA +D LVRP+KAY++T+SCKE 
Sbjct  301   KTVKDYKDLLTESVFLHALNQRFFKQSRRNDPPYFSCSADSDVLVRPLKAYVITASCKEG  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARVR+HGFSEREIS+VRALL+SEIESAYLERDQMQSTSLRDE +QHF
Sbjct  361   GTMEALESMLTEVARVRIHGFSEREISIVRALLLSEIESAYLERDQMQSTSLRDELIQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LR EPVIGIEYEAQLQKT+LPHIS+ +VSKY+E+  TSSSCVIK IEP+ +A VDDLRSV
Sbjct  421   LRGEPVIGIEYEAQLQKTILPHISSLDVSKYAEKLLTSSSCVIKAIEPQVSAKVDDLRSV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLK+N  E+ + IPPWDEE IPEEIV +KP+PG+I QQ EY N+GA E  LSNGMRVCYK
Sbjct  481   VLKVNFLEEAKQIPPWDEELIPEEIVPLKPNPGYITQQLEYSNIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSE+ E+EYFSCSMGSTIAGEIGV+GYRPSV MDMLAGKRAE
Sbjct  541   CTDFLDDQVLFTGFSYGGLSEVSENEYFSCSMGSTIAGEIGVYGYRPSVQMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMRSFSGDCSPSDLETALQLVYQLF T+VEPGEEDV IVMQMAE A+ AQERD
Sbjct  601   VGTKIGAYMRSFSGDCSPSDLETALQLVYQLFATSVEPGEEDVKIVMQMAEAAVRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRVRELNYGNSYFFRPI+  DL++V+P +ACEYF+ CFKDPSTFTVVIVG+I P
Sbjct  661   PYTAFVNRVRELNYGNSYFFRPIKTSDLKRVDPRRACEYFSRCFKDPSTFTVVIVGSISP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIPRP EPIL ++RDDLKGLP   P+ I+REVV SPMV+AQCSVQ+CF
Sbjct  721   TIAVPLILQYLGGIPRPPEPILRYSRDDLKGLPVTSPTKIVREVVRSPMVQAQCSVQICF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++H +GFLSKLLETK++QVLRFK+GQIY+ GV+VFLG N+PSR G++RG
Sbjct  781   PVELKNGTMVEEIHSIGFLSKLLETKLMQVLRFKHGQIYSTGVTVFLGSNRPSRTGDVRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+IS  LVDL LDEI RLQE GPS+EDV T+LEIEQRAHE+G+QEN YWLD
Sbjct  841   DISINFSCDPEISLKLVDLTLDEIQRLQEQGPSEEDVLTILEIEQRAHEDGVQENYYWLD  900

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             +ILRSYQSR+YSGDVG SFKVQDE RSKVR+ L P TAQ ALQRI+PFPCKKQYT+VIL+
Sbjct  901   KILRSYQSRVYSGDVGTSFKVQDEGRSKVRESLAPSTAQSALQRIIPFPCKKQYTLVILL  960

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKI  3003
             PQ SR++ LKSL   +   +  DAK+
Sbjct  961   PQRSRLQMLKSLFGFSRITHARDAKV  986



>ref|XP_008797884.1| PREDICTED: uncharacterized protein LOC103712947 isoform X1 [Phoenix 
dactylifera]
Length=1011

 Score =  1590 bits (4117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 777/1011 (77%), Positives = 891/1011 (88%), Gaps = 1/1011 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+  +  ++ RFRSLKL +V M+E L++ P GV YG LDNGLTYYVRSN KP+M
Sbjct  1     MDLLPTEAPSIGGRRQRFRSLKLASVAMDEPLAEEPVGVAYGVLDNGLTYYVRSNPKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALA + GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+
Sbjct  61    RAALALAAKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAL  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  121   TSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLM EGSKYAERLPIGLEKVIRTV+P+ V++FY+KWYHL+NMAV+AVGDF DT
Sbjct  181   RMQDAHWVLMFEGSKYAERLPIGLEKVIRTVTPETVRRFYRKWYHLQNMAVVAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppip-YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             QSVVELI++HFG K S    PP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE
Sbjct  241   QSVVELIRSHFGQKVSLSGLPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             ++TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY++CS+AAD LVRPVKAYIMTSSC+E
Sbjct  301   MRTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFACSSAADALVRPVKAYIMTSSCRE  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  361   KGTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F R EPV+GIEYEAQLQKTLLPHIS +EVSK++  F T+ SCVIK +EPRA AT++DL++
Sbjct  421   FFRKEPVVGIEYEAQLQKTLLPHISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKA  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              VLK+N  E++  I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CY
Sbjct  481   SVLKVNALEEENKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQV+FTGF+YGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRA
Sbjct  541   KCTDFLDDQVIFTGFAYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQER
Sbjct  601   EVGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQER  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YFN+CFKDPSTFTVVIVGN D
Sbjct  661   DPYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFNDCFKDPSTFTVVIVGNFD  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL 
Sbjct  721   PSVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLA  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV LK+  MME++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++R
Sbjct  781   FPVVLKNMSMMEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRSGDVR  840

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GD  +NFSCDPDI+S LVD+AL+EI+ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWL
Sbjct  841   GDTSVNFSCDPDIASKLVDIALEEIMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWL  900

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILRSYQSR Y GDV  SF++QDE R+KVRK LTP T Q+ALQRILPFPCK QYT VIL
Sbjct  901   DRILRSYQSRAYFGDVSASFEIQDEGRTKVRKALTPSTIQLALQRILPFPCKMQYTAVIL  960

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ SR+K LKSL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  961   MPQLSRLKLLKSLLQFRSNGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  1011



>ref|XP_010536847.1| PREDICTED: uncharacterized protein LOC104811734 isoform X1 [Tarenaya 
hassleriana]
Length=1004

 Score =  1587 bits (4108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 757/1005 (75%), Positives = 877/1005 (87%), Gaps = 2/1005 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDL+  ESS++   K RFRSLKLV+V++E+ L + P+GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MDLIAGESSKI--AKKRFRSLKLVSVDLEQELGEEPFGVDYGRLDNGLVYYVRCNSKPRM  58

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT++YTNHDIVKFLESIGAEFG CQNA+
Sbjct  59    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKRYTNHDIVKFLESIGAEFGPCQNAM  118

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             T+ADET+YELFVPIDKPELLSQAISILAEFSSEVR S  DLEKERGAV+EE+RG+RNA+G
Sbjct  119   TTADETIYELFVPIDKPELLSQAISILAEFSSEVRVSREDLEKERGAVLEEFRGTRNASG  178

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW LMM G+KYAERLPIGLEKVIR+V  + VK FY+KWYHL NMAVI VGDF DT
Sbjct  179   RLQDAHWQLMMAGTKYAERLPIGLEKVIRSVPAETVKHFYQKWYHLCNMAVIVVGDFSDT  238

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             ++VV+LIK HF  KTS      IP + +PSHEE RFSCFVESEAAGSAVMIS KMPV++L
Sbjct  239   KTVVDLIKMHFEGKTSRSKFLEIPVFPIPSHEETRFSCFVESEAAGSAVMISYKMPVNDL  298

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYRD+LAESMF HALNQRFFK+SRKKDPP++SCSAAAD LV P+KAYIM+SSCKEK
Sbjct  299   KTVKDYRDMLAESMFLHALNQRFFKLSRKKDPPFFSCSAAADVLVSPLKAYIMSSSCKEK  358

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             G + +LESML E+ARVRLHGFSEREIS+VRAL+MSEIESAYLERDQ+QSTSLRDEY+QHF
Sbjct  359   GALVSLESMLLEIARVRLHGFSEREISIVRALIMSEIESAYLERDQVQSTSLRDEYIQHF  418

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L  EPVIGIE+EAQLQKTLLP I AS+VSKY+E+  TS  CVIK IEPR++AT+DDLR+V
Sbjct  419   LHKEPVIGIEFEAQLQKTLLPQILASDVSKYAEKLRTSCGCVIKIIEPRSSATIDDLRNV  478

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V KI   E+++ I PWD+E+IPEEIVSVKP PG I+ Q EY  V A E  LSNGM+VCYK
Sbjct  479   VAKITRLEEEKKIAPWDDEHIPEEIVSVKPDPGHIVHQLEYPEVEATELTLSNGMQVCYK  538

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT++ DDQ+LFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGYRPSVLMDMLAGKR E
Sbjct  539   CTDYFDDQILFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYRPSVLMDMLAGKRVE  598

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FS DCSP+DLETALQLVYQLFTTNV+P EE+V +VMQMAEEA+ AQERD
Sbjct  599   VGTKLGAYMRTFSCDCSPTDLETALQLVYQLFTTNVKPQEEEVRLVMQMAEEAVCAQERD  658

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYT FANRV+E+NYGNSYFFRPIRI DL+K++P KACEYFN+CF DPSTFTVVIVGN+DP
Sbjct  659   PYTVFANRVKEINYGNSYFFRPIRISDLRKIDPLKACEYFNSCFTDPSTFTVVIVGNVDP  718

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ + REVV SPMVEAQCSVQLCF
Sbjct  719   TMALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKMTREVVRSPMVEAQCSVQLCF  778

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV+L +  M+E++H VGFLSKL+ETKI+Q LRFK+GQIY+A VSVFLGGNKPSR  ++RG
Sbjct  779   PVQLTNGTMVEEIHSVGFLSKLIETKIIQFLRFKHGQIYSADVSVFLGGNKPSRTADVRG  838

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI +NFSCDP+ISS LVDLALDEI+RLQE+GP+ ED+ST+LEIEQRAHE GLQEN YWL+
Sbjct  839   DISVNFSCDPEISSKLVDLALDEIVRLQEEGPTQEDISTILEIEQRAHETGLQENYYWLE  898

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILR YQSR+Y+GD+G S K+Q+E R ++R+ L+P TAQ ALQRILP+PCK QYT VILM
Sbjct  899   RILRGYQSRVYAGDLGASLKIQEEGRLRLRESLSPQTAQGALQRILPYPCKNQYTAVILM  958

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSR  3060
             P+ SR   L SL+ S   R+  DAK+L G A +AV+   LWRYSR
Sbjct  959   PRNSRFGYLNSLLISPESRFVRDAKVLGGFAALAVVGFGLWRYSR  1003



>ref|XP_008337631.1| PREDICTED: uncharacterized protein LOC103400750 [Malus domestica]
Length=980

 Score =  1586 bits (4106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/1008 (78%), Positives = 865/1008 (86%), Gaps = 29/1008 (3%)
 Frame = +1

Query  46    MDLLPAE-SSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPK  222
             MDLLPAE ++  + KKH FRSLKL+ V+M++ L   P GVDYGRLDNGL+YYVR NSKP+
Sbjct  1     MDLLPAEXTTSKIVKKHGFRSLKLLTVDMDQELGDQPVGVDYGRLDNGLSYYVRCNSKPR  60

Query  223   MRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA  402
             MRAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIV+FLESIGAEFGACQNA
Sbjct  61    MRAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVRFLESIGAEFGACQNA  120

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             VTSAD+TVYELFVP+DK ELLS+AIS+LAEFSSEVR S+ DLE+ERGAVMEEYRG+RNA 
Sbjct  121   VTSADDTVYELFVPVDKLELLSEAISVLAEFSSEVRVSKDDLERERGAVMEEYRGNRNAT  180

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQDAHW+LMME SKYAERLPIGLEKVIRTVSP+ VKQFYKKWYHL NMAVIAVGDF D
Sbjct  181   GRMQDAHWILMMEDSKYAERLPIGLEKVIRTVSPETVKQFYKKWYHLSNMAVIAVGDFSD  240

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             TQ+VVELI+  FG K S PDPPPIP Y VPSHEEPRFSCFVESEA+GSAV+IS KM  DE
Sbjct  241   TQNVVELIRDQFGXKISAPDPPPIPSYPVPSHEEPRFSCFVESEASGSAVIISYKMAADE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTV+DYRDLLAESMF +ALNQRFFKISR+KDPPY+SCSA+AD LV              
Sbjct  301   LKTVRDYRDLLAESMFLYALNQRFFKISRRKDPPYFSCSASADVLV--------------  346

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
                           ARVRLHGFSERE+S+VRALLMSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  347   --------------ARVRLHGFSEREVSIVRALLMSEIESAYLERDQMQSTSLRDEYLQH  392

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FLRNEPVIGIEYEAQLQKTLLPHI+A+EVSKY+ +  TS SCVIKTIEPRA+A  +DL+ 
Sbjct  393   FLRNEPVIGIEYEAQLQKTLLPHITAAEVSKYAVKLQTSCSCVIKTIEPRASAIANDLKH  452

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N  E+++ I PWDEE IPEEIV+ KP+PG I+QQ EY N+ A E  LSNGMRVCY
Sbjct  453   VVSKVNRLEEERIISPWDEEQIPEEIVNTKPNPGNIVQQVEYSNIEATELILSNGMRVCY  512

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCTNFLDDQV+FTGFSYGGLSELPESEYFSCSMG TIAGEIGV+GYRPSVLMDMLAGKRA
Sbjct  513   KCTNFLDDQVIFTGFSYGGLSELPESEYFSCSMGPTIAGEIGVYGYRPSVLMDMLAGKRA  572

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EV  KLGAYMRSF GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEE + AQ+R
Sbjct  573   EVSPKLGAYMRSFVGDCSPSDLETALQLVYQLFTTNIIPGEEDVKIVMQMAEEVVRAQDR  632

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYTAFANRV+ELNYGNSYFFRPIRI DL+KV+P KACEYFN CFKDPSTF+VVIVGNID
Sbjct  633   DPYTAFANRVKELNYGNSYFFRPIRISDLRKVDPLKACEYFNKCFKDPSTFSVVIVGNID  692

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ A PLILQYLGGIP+P EP+L FNRDDLKGLPF FP + IREVV S MVE QCSVQLC
Sbjct  693   PSIALPLILQYLGGIPKPPEPLLQFNRDDLKGLPFTFPKTRIREVVRSQMVEEQCSVQLC  752

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPVELK+  M+ED+H VGFLSKLLETKI+QVLRFK+GQIY  GVSVFLGGNKPSR  N+R
Sbjct  753   FPVELKNGTMVEDIHIVGFLSKLLETKIMQVLRFKHGQIYTVGVSVFLGGNKPSRTANVR  812

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDL LDEILRLQE+GPSDEDVST+LEIEQRAHENGLQEN YWL
Sbjct  813   GDISVNFSCDPEISSKLVDLTLDEILRLQEEGPSDEDVSTILEIEQRAHENGLQENYYWL  872

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRIL SYQSR YSGDVG  F++QDE RS VR+ LTP TAQ ALQRILPFPCKKQYTVVIL
Sbjct  873   DRILHSYQSRAYSGDVGTCFEIQDEGRSTVRQSLTPTTAQSALQRILPFPCKKQYTVVIL  932

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             MP+ S  K LKS   S    Y    KILAG AG+ VL L LWRYSR +
Sbjct  933   MPRTSPFKSLKSFFQSTETSYQRHTKILAGLAGLTVLGLCLWRYSRRT  980



>ref|XP_004141166.1| PREDICTED: probable zinc protease PqqL-like [Cucumis sativus]
Length=979

 Score =  1585 bits (4105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 776/1006 (77%), Positives = 874/1006 (87%), Gaps = 36/1006 (4%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+S  +  KHRFRSLKLV +++   LS+ PYGV YG+L NGL+YYVRSNSKP+M
Sbjct  1     MDLLPAETSHAI--KHRFRSLKLVTIDLNATLSEHPYGVRYGQLHNGLSYYVRSNSKPRM  58

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNA 
Sbjct  59    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAA  118

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DKP LLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA G
Sbjct  119   TSADDTVYELFVPVDKPGLLSQAISILAEFSSEIRVSQDDLEKERGAVMEEYRGNRNATG  178

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW LMMEGSKYA+RLPIGLEKVI+TVS + VK+FY+KWY L NMAVIAVGDF DT
Sbjct  179   RMQDAHWALMMEGSKYADRLPIGLEKVIKTVSAETVKKFYRKWYDLHNMAVIAVGDFSDT  238

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVE+IK HFG+  S  +PP +P + +PS EEPRFSCFVESEAAGSAVMIS KMP DEL
Sbjct  239   ESVVEMIKEHFGHIQSACEPPHVPTFPIPSREEPRFSCFVESEAAGSAVMISYKMPADEL  298

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTV+DYR+LL ESMF  ALNQRFFKISR KDPP++SCSAAAD    PV            
Sbjct  299   KTVRDYRNLLVESMFLQALNQRFFKISRGKDPPFFSCSAAAD----PV------------  342

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                         VARVRLHGFSEREIS+VRALLMSEIESAYLERDQMQST+LRDEYLQHF
Sbjct  343   ------------VARVRLHGFSEREISIVRALLMSEIESAYLERDQMQSTNLRDEYLQHF  390

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISA+EVSKYS +  +  SCVIK IEPRA+AT+DDL++V
Sbjct  391   LRNEPVVGIEYEAQLQKTLLPHISATEVSKYSAKLTSLCSCVIKIIEPRASATIDDLKNV  450

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V+ I   E+++ I PWDEENIPEEIVS  P+PG I+QQ EY N+GA E  LSNGMRVCYK
Sbjct  451   VMNITCLEKERGITPWDEENIPEEIVSTMPNPGNIVQQKEYPNIGATEIFLSNGMRVCYK  510

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQV+FTGFSYG LSELPE EY SCSMGSTIAGEIGVFGYRPSVLMD+LAGKRAE
Sbjct  511   CTDFLDDQVIFTGFSYGALSELPEREYSSCSMGSTIAGEIGVFGYRPSVLMDILAGKRAE  570

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEEA+ AQERD
Sbjct  571   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVIPGEEDVKIVMQMAEEAVRAQERD  630

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+ELNYGNSYFFRPIR+ DL+KVNP +ACEYFN CF+DPS FTVV+VGNI+P
Sbjct  631   PYTAFANRVKELNYGNSYFFRPIRLSDLKKVNPQRACEYFNKCFRDPSNFTVVVVGNINP  690

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLI QYLGGIP+P EPI++FNRDDLKGLPFKFP+SI+REVV+SPMVEAQCSVQLCF
Sbjct  691   SIALPLIQQYLGGIPKPPEPIMNFNRDDLKGLPFKFPTSIVREVVYSPMVEAQCSVQLCF  750

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL +  M+E++H+VGFLSKLLET+++QVLRFK+GQIY+AGVSVFLGGNKPSR+G +RG
Sbjct  751   PVELTNGTMVEEIHYVGFLSKLLETRMIQVLRFKHGQIYSAGVSVFLGGNKPSRIGPVRG  810

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVDLAL+EILRLQE+GP+D+DVS++LEIEQRAHENGLQEN YWLD
Sbjct  811   DISINFSCDPEISSKLVDLALNEILRLQEEGPTDQDVSSILEIEQRAHENGLQENYYWLD  870

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSRIYSGDVG SF++QDE R  VR  LTPLTAQ+ALQRILPFPC KQYT VIL+
Sbjct  871   RILRSYQSRIYSGDVGSSFEIQDEGRLNVRNSLTPLTAQLALQRILPFPCTKQYTAVILL  930

Query  2926  PQASRMKRLKSLV---CSAPKRYCTDAKIlagtagvavllltlWRY  3054
             P + R ++LKS +    S P R   D+KIL G A VAVL  +LWRY
Sbjct  931   PASYRFRKLKSFLRLGLSNPGR---DSKILVGLASVAVLTFSLWRY  973



>ref|XP_010911811.1| PREDICTED: uncharacterized protein LOC105037879 isoform X2 [Elaeis 
guineensis]
Length=998

 Score =  1578 bits (4087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 771/1011 (76%), Positives = 884/1011 (87%), Gaps = 14/1011 (1%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+  +  ++  FRSLKLV+V M+E L++ P GV YG LDNGLTYYVRSN KP+M
Sbjct  1     MDLLPTEAPSIGGRRQGFRSLKLVSVAMDEPLAEEPVGVVYGVLDNGLTYYVRSNPKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAL  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  121   TSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LM EGSKYAERLPIGLEKVIRTV+P+ VKQFY+KWYHL+NMAV+AVGDF DT
Sbjct  181   RMQDAHWILMFEGSKYAERLPIGLEKVIRTVTPETVKQFYQKWYHLQNMAVVAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppip-YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             +SVVELI+AHFG K S   PPP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE
Sbjct  241   KSVVELIRAHFGQKVSISGPPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             ++TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY+SCS+AAD LVRP+KAYIMTSSC+E
Sbjct  301   MRTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFSCSSAADALVRPIKAYIMTSSCRE  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             +GT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  361   RGTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F R EPV+GIEYEAQLQKTLLP+IS +EVSK++  F T+ SCVIK +EPRA AT++DL++
Sbjct  421   FFRKEPVVGIEYEAQLQKTLLPYISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKA  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              VLK+N  E+++ I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CY
Sbjct  481   SVLKVNALEEEKKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQV+FTGFSYGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRA
Sbjct  541   KCTDFLDDQVIFTGFSYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQER
Sbjct  601   EVGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQER  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YF++CFKDPSTFTVVIVGNID
Sbjct  661   DPYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFSDCFKDPSTFTVVIVGNID  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL 
Sbjct  721   PSVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLA  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV LK+  MME++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++R
Sbjct  781   FPVVLKNMSMMEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRTGDVR  840

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI              VDLAL+E++ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWL
Sbjct  841   GDIS-------------VDLALEELMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWL  887

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILRSYQSR Y GDV  SFK+QDE R+KVRK LTP T Q+ALQRILPFPCKKQYT VIL
Sbjct  888   DRILRSYQSRAYFGDVSASFKIQDEGRTKVRKALTPSTVQLALQRILPFPCKKQYTAVIL  947

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ S +K LKSL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  948   MPQLSHLKLLKSLLQLRSDGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  998



>ref|XP_010451407.1| PREDICTED: uncharacterized protein LOC104733533 isoform X1 [Camelina 
sativa]
Length=1009

 Score =  1568 bits (4059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 754/1008 (75%), Positives = 871/1008 (86%), Gaps = 3/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS+ + +KH FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKKVLRKHGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  60

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLES+GAEFG CQN
Sbjct  61    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESVGAEFGPCQN  120

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA
Sbjct  121   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNA  180

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  181   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  240

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ 
Sbjct  241   DTKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPIS  300

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  301   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADALVSPLKAYIMSSSCK  360

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  361   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  420

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR
Sbjct  421   HFLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLR  480

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E+++ I PWDEE IPEE+VS KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  481   NVVSKVNSLEEEKMIAPWDEEKIPEEVVSEKPTPGEVTHQLEYPEVGVTELTLSNGMQVC  540

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR
Sbjct  541   YKSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKR  600

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
              EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  601   VEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  660

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  661   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNL  720

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP  A PLILQYLGGIP+P +P+LHFNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  721   DPTIALPLILQYLGGIPKPPQPVLHFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  780

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++
Sbjct  781   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADL  840

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN +W
Sbjct  841   RGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYHW  900

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VI
Sbjct  901   LDRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVI  960

Query  2920  LMPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S  +  Y  D KILAG A +AVL+  +WRYSR
Sbjct  961   LMPQRSRFGFLSSIFASRSETPYIRDTKILAGIASLAVLVFGIWRYSR  1008



>ref|XP_010443322.1| PREDICTED: uncharacterized protein LOC104726216 isoform X1 [Camelina 
sativa]
Length=1009

 Score =  1564 bits (4050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/1008 (75%), Positives = 871/1008 (86%), Gaps = 3/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS+ + +KH FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKKVLRKHGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  60

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLES+GAEFG CQN
Sbjct  61    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESVGAEFGPCQN  120

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA
Sbjct  121   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNA  180

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  181   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  240

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ 
Sbjct  241   DTKTVVDLIKTHFEDKRSSSEPPHIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPIS  300

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  301   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  360

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  361   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  420

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR
Sbjct  421   HFLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLR  480

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E+++ I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  481   NVVSKVNSLEEEKMIAPWDEEKIPEEVVNEKPTPGEVTHQLEYPEVGVTELTLSNGMQVC  540

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR
Sbjct  541   YKSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKR  600

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
              EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  601   VEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  660

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  661   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNL  720

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  721   DPTIALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  780

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++
Sbjct  781   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADL  840

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YW
Sbjct  841   RGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYW  900

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VI
Sbjct  901   LDRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVI  960

Query  2920  LMPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S  +  Y  D KILAG A +AVL+  +WRYSR
Sbjct  961   LMPQRSRFGFLSSIFASRSETPYIRDTKILAGIASLAVLVFGIWRYSR  1008



>gb|KFK27236.1| hypothetical protein AALP_AA8G355300 [Arabis alpina]
Length=1008

 Score =  1564 bits (4050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 761/1008 (75%), Positives = 873/1008 (87%), Gaps = 4/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L +K  FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLITGESSKVL-RKQGFRSLKLMSVDMEKELGNEPEPFGADYGRLDNGLVYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESIGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQDAHW LMMEGSKYAERLPIGLEKVIR+V    VKQFY KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDAHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYHKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMPV 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSEPPEIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPVS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISRKKDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKISRKKDPPFFACSVAADVLVSPLKAYIMSSSCK  359

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  360   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  419

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+VSKYSE+  TS  CVIKT+EPR+ ATVDD+R
Sbjct  420   HFLHKEPVIGIEYEAQLQKTLLPQISASDVSKYSEKLRTSCGCVIKTMEPRSAATVDDMR  479

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E+++ I PWDEE IPEE+VS KP+PG I+ Q EY  VG  E  LSNGM+VC
Sbjct  480   NVVSKVNSLEEEKIIAPWDEEKIPEEVVSEKPTPGDIIHQLEYPEVGVTELTLSNGMQVC  539

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGFSYGGLSELPE +Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR
Sbjct  540   YKSTDFLDDQVLFTGFSYGGLSELPEKDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKR  599

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
              EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  600   VEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  659

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KAC+YFN+CF+DPSTFTVVIVGN+
Sbjct  660   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACDYFNSCFRDPSTFTVVIVGNL  719

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I RE+V SPMVEAQCSVQL
Sbjct  720   DPTIAVPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITRELVPSPMVEAQCSVQL  779

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++
Sbjct  780   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADL  839

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YW
Sbjct  840   RGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYW  899

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VI
Sbjct  900   LDRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVI  959

Query  2920  LMPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S P+  Y  D KILAG AG+AVL+  +WRYSR
Sbjct  960   LMPQRSRFGFLSSIFVSRPETPYIRDTKILAGIAGLAVLVFGIWRYSR  1007



>ref|XP_009120182.1| PREDICTED: uncharacterized protein LOC103845102 isoform X1 [Brassica 
rapa]
Length=1008

 Score =  1563 bits (4048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 754/1008 (75%), Positives = 877/1008 (87%), Gaps = 4/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L +K  FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLISGESSKVL-RKQGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLE+E++RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEDEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESIGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLEKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VK+FY+KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKKFYQKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP++ VPSHE+ RFSCFVESEAAGSAVMIS KMPV 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSNPPEIPFFPVPSHEDTRFSCFVESEAAGSAVMISYKMPVS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  359

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  360   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQIQSTSLRDEYIQ  419

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQK+LLP ISAS+VS+YSE+  TS  CVIKT+EPR+ ATVDD+R
Sbjct  420   HFLHKEPVIGIEYEAQLQKSLLPQISASDVSRYSEKLRTSCGCVIKTMEPRSNATVDDMR  479

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E++  I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  480   NVVSKVNSLEEEMKIAPWDEEKIPEEVVNEKPTPGDVTHQLEYPEVGVTELTLSNGMQVC  539

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGF+YGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR
Sbjct  540   YKSTDFLDDQVLFTGFAYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKR  599

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
              EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  600   VEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  659

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  660   RDPYTVFANRVKELNYGNSYFFRPIRINELRKVDPVKACEYFNSCFRDPSTFTVVIVGNL  719

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP+ A PLILQYLGGIP+P +PIL+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  720   DPSIALPLILQYLGGIPKPPQPILNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  779

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++
Sbjct  780   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADL  839

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YW
Sbjct  840   RGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYW  899

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILR YQSR+Y+GD+G S ++ +E R ++R+ L P TAQ ALQRILP PCKKQYT VI
Sbjct  900   LDRILRGYQSRVYAGDLGASCQILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVI  959

Query  2920  LMPQASRMKRLKSLVCSAPK-RYCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S+P+ R+  D KILAG AG+AVL+ ++WRYSR
Sbjct  960   LMPQRSRFGFLSSIFASSPETRFIRDTKILAGIAGLAVLVFSIWRYSR  1007



>ref|XP_006279942.1| hypothetical protein CARUB_v10025806mg [Capsella rubella]
 gb|EOA12840.1| hypothetical protein CARUB_v10025806mg [Capsella rubella]
Length=1008

 Score =  1561 bits (4042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 755/1008 (75%), Positives = 871/1008 (86%), Gaps = 4/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L KKH FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKVL-KKHGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLES+GAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESVGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPIS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FK+SR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKLSRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  359

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  360   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  419

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR
Sbjct  420   HFLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLR  479

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E+++ I PWDEE IPEE+VS KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  480   NVVSKVNSLEEEKMIAPWDEEKIPEEVVSEKPTPGEVTHQLEYPEVGVTELTLSNGMQVC  539

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR
Sbjct  540   YKSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKR  599

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
              EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  600   VEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  659

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  660   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNL  719

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP  A PLILQYLGGI +P +P+L+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  720   DPTIALPLILQYLGGISKPPQPVLNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  779

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++
Sbjct  780   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADL  839

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YW
Sbjct  840   RGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYW  899

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILR YQSR+YSGD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VI
Sbjct  900   LDRILRGYQSRVYSGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVI  959

Query  2920  LMPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S  +  Y  D KILAG A +AVL+  +WRYSR
Sbjct  960   LMPQKSRFGFLSSIFGSRSETPYIRDTKILAGIASLAVLVFGIWRYSR  1007



>ref|XP_010483149.1| PREDICTED: uncharacterized protein LOC104761734 isoform X1 [Camelina 
sativa]
Length=1009

 Score =  1561 bits (4041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/1008 (75%), Positives = 868/1008 (86%), Gaps = 3/1008 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS+ + +KH FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKKVLRKHGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  60

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLES+GAEFG CQN
Sbjct  61    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESVGAEFGPCQN  120

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA
Sbjct  121   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNA  180

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  181   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  240

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ 
Sbjct  241   DTKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPIS  300

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  301   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  360

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  361   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  420

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR
Sbjct  421   HFLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLR  480

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E ++ I PWDEE IPEE+V  KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  481   NVVSKVNSLEDEKMIAPWDEEKIPEEVVDEKPTPGEVTHQLEYPEVGVTELTLSNGMQVC  540

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR
Sbjct  541   YKSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKR  600

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
              EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  601   VEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  660

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  661   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNL  720

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  721   DPTIALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  780

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++
Sbjct  781   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADL  840

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YW
Sbjct  841   RGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYW  900

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCK+QYT VI
Sbjct  901   LDRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKEQYTAVI  960

Query  2920  LMPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S  +  Y  D KILAG A + VL+  +WRYSR
Sbjct  961   LMPQRSRFGFLSSIFASRSETPYIRDTKILAGIASLVVLVFGIWRYSR  1008



>ref|XP_004968985.1| PREDICTED: uncharacterized protein LOC101760569 isoform X1 [Setaria 
italica]
Length=1024

 Score =  1555 bits (4026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/992 (76%), Positives = 861/992 (87%), Gaps = 1/992 (0%)
 Frame = +1

Query  103   SLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEE  282
             SLKLV+V M+E L   P G  YGRL NGLTYYVRSN KP+MRAAL+LAV+ GSV+EEE+E
Sbjct  33    SLKLVSVAMDEPLPVDPVGATYGRLPNGLTYYVRSNPKPRMRAALSLAVKVGSVVEEEDE  92

Query  283   RGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPEL  462
             RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA+TS+DET+YEL VP+DKP L
Sbjct  93    RGVAHIVEHLAFSATSRYTNHDIVKFLESIGAEFGACQNALTSSDETIYELLVPVDKPGL  152

Query  463   LSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAER  642
             LSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYAER
Sbjct  153   LSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNATGRMQDSHWALLFEGSKYAER  212

Query  643   LPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppd  822
             LPIG EKVIRTV  + VK+FY+KWYHL NMAV AVGDFPDTQ+VVELIK HFG K   P 
Sbjct  213   LPIGTEKVIRTVPHETVKRFYQKWYHLSNMAVFAVGDFPDTQAVVELIKEHFGQKAPAPL  272

Query  823   pppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHA  999
             PPP    + VPSHEEPRFSCFVESEAAGSAV+ISCKMP  E+KTVKDY+D LAESMF  A
Sbjct  273   PPPAIPEFRVPSHEEPRFSCFVESEAAGSAVVISCKMPAGEIKTVKDYKDSLAESMFHCA  332

Query  1000  LNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRL  1179
             LNQR FKISR KDPPY+SCS+AAD LVRPVKAYIMTSSC+E+GTVEALESML EVARVRL
Sbjct  333   LNQRLFKISRGKDPPYFSCSSAADALVRPVKAYIMTSSCRERGTVEALESMLLEVARVRL  392

Query  1180  HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKT  1359
             HGFS+REIS+VRAL+MSE+ESAYLERDQMQSTSLRDE+LQHFLR EPV+GIEYEAQLQKT
Sbjct  393   HGFSDREISIVRALMMSEMESAYLERDQMQSTSLRDEFLQHFLREEPVVGIEYEAQLQKT  452

Query  1360  LLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDE  1539
             LLPHIS++EV+K++E F T+SSCVIK +EPRA A+++DL++VVLK+N+ E+++SIPPWDE
Sbjct  453   LLPHISSAEVAKFAENFSTASSCVIKIVEPRAHASLEDLKAVVLKVNSLEEEKSIPPWDE  512

Query  1540  ENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGG  1719
             E IPEEIV+  P PG I+ + E+  + A E  LSNGMR+CYK T+FLDDQV+FTGF+YGG
Sbjct  513   EQIPEEIVAEAPEPGSIIDKVEHPGIVATEMILSNGMRICYKYTDFLDDQVVFTGFAYGG  572

Query  1720  LSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSP  1899
             LSEL E+EY SCSMGSTIAGEIG FGYRPSVLMDMLAGKRAEVGTK+GAYMR+FSGDCSP
Sbjct  573   LSELSEAEYTSCSMGSTIAGEIGTFGYRPSVLMDMLAGKRAEVGTKVGAYMRTFSGDCSP  632

Query  1900  SDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSY  2079
             SDLETALQLVYQLF TNVEP EE+V IVMQMAEEAI+AQERDPYTAFANRVRE+NYGNSY
Sbjct  633   SDLETALQLVYQLFITNVEPREEEVKIVMQMAEEAIYAQERDPYTAFANRVREINYGNSY  692

Query  2080  FFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS  2259
             FF+PIRI DL+KV+P +ACEYFNNCFKDPS FTVVIVG IDPA + PLILQYLGGIPR  
Sbjct  693   FFKPIRISDLKKVDPIRACEYFNNCFKDPSAFTVVIVGKIDPAISLPLILQYLGGIPRVQ  752

Query  2260  EPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGF  2439
             +     +RDDL+GLPFKFP++IIREVV SPMVEAQC VQL FPV LK+  M ED+H+VGF
Sbjct  753   DAAQPLSRDDLRGLPFKFPATIIREVVRSPMVEAQCFVQLAFPVVLKNTMMTEDIHYVGF  812

Query  2440  LSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVD  2619
             LSKLLETKI+QVLRFKYGQ+Y+  V+VFLGGNKPSR G++RGDI +NFSCDPDISS LVD
Sbjct  813   LSKLLETKIMQVLRFKYGQVYSVNVAVFLGGNKPSRTGDVRGDISVNFSCDPDISSKLVD  872

Query  2620  LALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDS  2799
               L+EI  LQ +GPS+EDV T+LEIEQRAHENGLQEN +WLDRILRSYQSR++SGD+G +
Sbjct  873   FVLEEISYLQAEGPSEEDVLTILEIEQRAHENGLQENYFWLDRILRSYQSRLFSGDIGST  932

Query  2800  FKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPK  2979
             F  Q+E R KVR+ LTP T Q ALQR+LPFPC+ QYTVVILMP++S    +KS++  +  
Sbjct  933   FAFQEEGRMKVREALTPQTMQSALQRVLPFPCRNQYTVVILMPKSSCWASVKSMLSWSSN  992

Query  2980  RYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
                 DAKILAG AG  VL ++LWRYSRS+LKS
Sbjct  993   GVSRDAKILAGIAGALVLAVSLWRYSRSTLKS  1024



>ref|XP_010231921.1| PREDICTED: uncharacterized protein LOC100828786 [Brachypodium 
distachyon]
Length=1021

 Score =  1553 bits (4022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1021 (75%), Positives = 869/1021 (85%), Gaps = 11/1021 (1%)
 Frame = +1

Query  46    MDLLPAES----------SQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTY  195
             MDLLP  S           + L +   FRSLKLV V M+EAL   P GV YGRL NGLTY
Sbjct  1     MDLLPPPSEAPAGGGAVAGRGLRRGVGFRSLKLVTVAMDEALPAEPVGVAYGRLPNGLTY  60

Query  196   YVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIG  375
             YVRSN KP+MRAAL+LAV+ GSV+EEE+ERGVAHIVEHLAFSAT +YTNHDIVKFLESIG
Sbjct  61    YVRSNPKPRMRAALSLAVKVGSVVEEEDERGVAHIVEHLAFSATSRYTNHDIVKFLESIG  120

Query  376   AEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVME  555
             AEFGACQNA+TS+DET+YEL VP+DKP LLSQAIS+LAEFSSEVR S  DL+KERGAV+E
Sbjct  121   AEFGACQNALTSSDETIYELLVPVDKPGLLSQAISVLAEFSSEVRVSAEDLDKERGAVLE  180

Query  556   EYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMA  735
             EYRG RNA GRMQD+HW L+ EGSKYAERLPIG EKVIRTV+ + V+QFY+KWYHL NMA
Sbjct  181   EYRGGRNATGRMQDSHWALLFEGSKYAERLPIGTEKVIRTVTHETVRQFYQKWYHLSNMA  240

Query  736   VIAVGDFPDTQSVVELIKAHFGYKT-SppdpppipYYLVPSHEEPRFSCFVESEAAGSAV  912
             V AVGDFPDTQ+VVELIK HFG K+ +   PP IP + VPSH EPRFSCFVESEAAGSAV
Sbjct  241   VFAVGDFPDTQAVVELIKEHFGQKSPAAYPPPLIPEFPVPSHIEPRFSCFVESEAAGSAV  300

Query  913   MISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVK  1092
             +ISCKMP  E+KTVKDYRD LAESMF  ALNQR FKISR++DPPY+SCS+AAD LV PVK
Sbjct  301   VISCKMPAGEIKTVKDYRDSLAESMFHCALNQRLFKISRRRDPPYFSCSSAADALVNPVK  360

Query  1093  AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQS  1272
             AYIMTSSC+E+GTVEALESML EVAR RLHGFSEREIS+VRAL+MSEIESAYLERDQMQS
Sbjct  361   AYIMTSSCRERGTVEALESMLLEVARARLHGFSEREISIVRALMMSEIESAYLERDQMQS  420

Query  1273  TSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPR  1452
             TSLRDEYLQHFLR EPV+GIEYEAQLQKTLLP+IS++EV K++E F T+SSCVIK +EPR
Sbjct  421   TSLRDEYLQHFLREEPVVGIEYEAQLQKTLLPYISSAEVIKFAENFSTTSSCVIKIVEPR  480

Query  1453  ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEF  1632
             A A ++DL++VVLK+NT E++++IPPW EE IPEEIV   P PG I+ Q E+  +GA E 
Sbjct  481   AHACLEDLKAVVLKVNTLEEQKAIPPWAEEQIPEEIVGQSPEPGNIVDQVEHPGIGATEM  540

Query  1633  DLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSV  1812
              LSNGMRVCYKCT+FLDDQV+FTGF+YGGLSEL E EY SC+MGSTIAGEIG+FGYRPSV
Sbjct  541   ILSNGMRVCYKCTDFLDDQVVFTGFAYGGLSELSEEEYSSCTMGSTIAGEIGIFGYRPSV  600

Query  1813  LMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQM  1992
             LMDMLAGKRAEVGTK+GAYMRSFSGDCSPSDLET LQLVYQLFTT VEP +E+V IVMQM
Sbjct  601   LMDMLAGKRAEVGTKVGAYMRSFSGDCSPSDLETGLQLVYQLFTTKVEPRDEEVKIVMQM  660

Query  1993  AEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPST  2172
             AEEAI+AQERDPYTAFANR RE+NYGNSYFF+PIRI DL+KV+P +ACEYFNNCFKDPS 
Sbjct  661   AEEAIYAQERDPYTAFANRTREINYGNSYFFKPIRISDLKKVDPIRACEYFNNCFKDPSA  720

Query  2173  FTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPM  2352
             FTVVIVGNIDPA + PLILQYLGGIP+  + +    RDDLKGLPFKFP +IIREVV SPM
Sbjct  721   FTVVIVGNIDPAISIPLILQYLGGIPKVKDTVQPLCRDDLKGLPFKFPETIIREVVRSPM  780

Query  2353  VEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGG  2532
             VEAQC VQL FPV LKS  M ED+H+VGFLSKLLETKI+QVLRFKYGQ+Y+  V VFLGG
Sbjct  781   VEAQCFVQLGFPVVLKSTMMTEDIHYVGFLSKLLETKIMQVLRFKYGQVYSVNVGVFLGG  840

Query  2533  NKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHE  2712
             NKPSR G++RGDI +NFSCDPD+SS LVD  L+EI  LQ +GPS+EDV T+LEIEQRAHE
Sbjct  841   NKPSRSGDVRGDISVNFSCDPDMSSKLVDFVLEEISYLQTEGPSEEDVLTILEIEQRAHE  900

Query  2713  NGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFP  2892
             NGLQEN YWLDRILRSYQSRIYSGDVG +FKVQDE R KVR++LTP   QMALQR++ FP
Sbjct  901   NGLQENYYWLDRILRSYQSRIYSGDVGSTFKVQDEGRLKVREVLTPQAMQMALQRVISFP  960

Query  2893  CKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLK  3072
             CKKQYTVVILMP++SR   L SL   +   +  DAKILA   G  VL ++LWRYSR +L+
Sbjct  961   CKKQYTVVILMPKSSRWNSLISLFSCSSGGFSRDAKILAAMGGALVLAVSLWRYSRGALR  1020

Query  3073  S  3075
             S
Sbjct  1021  S  1021



>gb|KDO59293.1| hypothetical protein CISIN_1g001831mg [Citrus sinensis]
Length=962

 Score =  1548 bits (4009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/949 (79%), Positives = 849/949 (89%), Gaps = 2/949 (0%)
 Frame = +1

Query  229   AALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVT  408
             A L+L++ +  VLEEE ERGVAHIVEHLAFSATEKYTNHDI+KFLESIGAEFGACQNAVT
Sbjct  16    ALLSLSL-SKPVLEEEHERGVAHIVEHLAFSATEKYTNHDIIKFLESIGAEFGACQNAVT  74

Query  409   SADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGR  588
             SADETVYELFVP+DKPELLS+AIS+LAEFS+EVR S+ DLEKERGAV+EEYRG+RNA+GR
Sbjct  75    SADETVYELFVPVDKPELLSRAISVLAEFSTEVRVSKDDLEKERGAVLEEYRGNRNASGR  134

Query  589   MQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQ  768
             MQDAHWVLMMEGSKYAE LPIGLEKVIRTVS   VK+FY+KWY L+NMAVIAVGDFPDT+
Sbjct  135   MQDAHWVLMMEGSKYAECLPIGLEKVIRTVSSDTVKRFYQKWYRLQNMAVIAVGDFPDTK  194

Query  769   SVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELK  948
              VVELI  HFG K S  DPP IP + VPSH+EPRFSCF+ESEA GSAV++S KMPV+ELK
Sbjct  195   GVVELINTHFGQKKSATDPPVIPKFPVPSHQEPRFSCFIESEAGGSAVIVSYKMPVNELK  254

Query  949   TVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKG  1128
             T+KDY+++L ESMF HALNQRFFK+SR+KDPPY+SCSA+AD LVRP+KAYIM+SSCKE+G
Sbjct  255   TIKDYKEMLTESMFLHALNQRFFKLSRRKDPPYFSCSASADDLVRPLKAYIMSSSCKERG  314

Query  1129  TVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFL  1308
             T++ALESML EVARVRLHGFSERE+SV RALLMSE+ESAYLERDQMQST+LRDE LQHFL
Sbjct  315   TLKALESMLIEVARVRLHGFSEREVSVARALLMSEVESAYLERDQMQSTNLRDECLQHFL  374

Query  1309  RNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVV  1488
               EP+IGIEYEA+LQKTLLPHISA EVS+YSE+  TS SCVIKTIEP+  +T+DDL+++V
Sbjct  375   CKEPIIGIEYEARLQKTLLPHISALEVSRYSEKLQTSCSCVIKTIEPQTFSTIDDLKNIV  434

Query  1489  LKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKC  1668
             LKI   E+K +I PWDEENIPEEIVS KPSPG I+QQFEY+N+GA E  LSNGMRVCYKC
Sbjct  435   LKIKNLEEK-NISPWDEENIPEEIVSTKPSPGNIVQQFEYENLGATELVLSNGMRVCYKC  493

Query  1669  TNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEV  1848
             T+FLDDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIGVFGYRPS+LMDMLAGKR E 
Sbjct  494   TDFLDDQVLFTGFSYGGLSELPESEYLSCSMGSTIAGEIGVFGYRPSMLMDMLAGKRVEG  553

Query  1849  GTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDP  2028
             GTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEE I AQERDP
Sbjct  554   GTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVAPGEEEVEIVMQMAEEVIRAQERDP  613

Query  2029  YTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPA  2208
             YTAFANRV+E+NYGNSYFFRPIRI DLQKV+P KAC+YFN+CFKDPSTFTVVIVGNIDP+
Sbjct  614   YTAFANRVKEINYGNSYFFRPIRISDLQKVDPLKACDYFNSCFKDPSTFTVVIVGNIDPS  673

Query  2209  TAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFP  2388
                PLILQYLGGIP+P EPILHFNRD+LKGLPF FPSSIIREVV SPMVEAQCSVQLCFP
Sbjct  674   NGIPLILQYLGGIPKPPEPILHFNRDNLKGLPFTFPSSIIREVVRSPMVEAQCSVQLCFP  733

Query  2389  VELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGD  2568
             VELK+  M+E++++VGFLSKLLETK++QVLRFK+GQIY+A VSVFLGGNK SR G++RGD
Sbjct  734   VELKNGTMVEEINYVGFLSKLLETKMMQVLRFKHGQIYSASVSVFLGGNKHSRTGDVRGD  793

Query  2569  IGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDR  2748
             I INFSCDP+IS  LVDLALDEI RLQ++GPSDEDVST+LE+EQRAHE GLQEN +WLDR
Sbjct  794   ISINFSCDPEISFKLVDLALDEISRLQKEGPSDEDVSTILELEQRAHETGLQENYHWLDR  853

Query  2749  ILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMP  2928
             IL SYQSR+YSGDVG SFK+QDEARSKVRK L PLT Q+ALQRI+P+PC KQ+TVVILMP
Sbjct  854   ILCSYQSRVYSGDVGTSFKIQDEARSKVRKSLQPLTLQLALQRIMPYPCNKQFTVVILMP  913

Query  2929  QASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             Q SR K L+SL       +  DAK LA  AG+  L  +LWRYSR +LKS
Sbjct  914   QVSRFKFLRSLFRHNQTYHLGDAKALAAVAGLTFLAFSLWRYSRRTLKS  962



>ref|XP_010090003.1| putative zinc protease pqqL [Morus notabilis]
 gb|EXB38800.1| putative zinc protease pqqL [Morus notabilis]
Length=1006

 Score =  1547 bits (4005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 763/1010 (76%), Positives = 868/1010 (86%), Gaps = 4/1010 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLP E  + + KK  FRSLKL+NV++E+ + + P+GVDYGRLDNGL YYVRSN KP+M
Sbjct  1     MNLLPPEDPK-IAKKQGFRSLKLLNVDLEQVIGEQPFGVDYGRLDNGLFYYVRSNPKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE+ERGVAHIVEHLAFSAT KYTNHDI+KFLESIG+EFG CQNA+
Sbjct  60    RAALALAVKAGSVLEEEDERGVAHIVEHLAFSATTKYTNHDIIKFLESIGSEFGPCQNAM  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DKP LLSQAIS+LAEFS+EVR S+ DL+KERG VMEEYR  RNA G
Sbjct  120   TSADDTVYELFVPVDKPGLLSQAISVLAEFSTEVRISKEDLDKERGPVMEEYREGRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R  DA+WVLMMEGSKYAERLPIGLEKVI TVS +  K+FYKKWYHL NMAVIAVGDF DT
Sbjct  180   RTVDANWVLMMEGSKYAERLPIGLEKVIWTVSAETAKRFYKKWYHLSNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HFG+KTS P+PP IP + VPSHEEPRFSCFVESEAA S V+IS KM V EL
Sbjct  240   QSVVELIKTHFGHKTSEPEPPLIPAFSVPSHEEPRFSCFVESEAAASEVVISYKMAVVEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTV+D RDLLAESMF HALN RFFKISR+KDPPY+SCSA+AD LV P+KAYIMTSSCKEK
Sbjct  300   KTVRDCRDLLAESMFLHALNLRFFKISRRKDPPYFSCSASADNLVHPLKAYIMTSSCKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT++ALESMLTE+AR+RLHGFSE EIS+VRA LMS+IESAYL+RDQMQSTSLRDEYLQHF
Sbjct  360   GTIKALESMLTEIARIRLHGFSECEISIVRAELMSDIESAYLKRDQMQSTSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRN PV GIEY AQLQKTLLPHISAS++SKY+E+  TS SCVIKTIEPRA A VDDL++V
Sbjct  420   LRNNPVSGIEYMAQLQKTLLPHISASDLSKYAEKLRTSCSCVIKTIEPRAFAVVDDLKNV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V KIN  E++  I PWDE+ IPEEIV++KP+PG+++QQFEY N+GA E  LSNGMRVCYK
Sbjct  480   VSKINNLEKENKILPWDEDQIPEEIVTLKPNPGYVVQQFEYSNIGAVELLLSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+F  DQV+F GFSYGGLSELPES YFSCSM   IA EIG +GY+PSVL+DMLAGKRAE
Sbjct  540   CTDFFVDQVVFAGFSYGGLSELPESNYFSCSMAEAIAAEIGEYGYKPSVLVDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             V   + AYMR F GDCSP+DLETALQLVYQLFTTNV P +E V +V+Q +EE I AQERD
Sbjct  600   VDNTIDAYMRLFYGDCSPTDLETALQLVYQLFTTNVTPEDEVVKLVLQRSEEEIRAQERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             P+T FANRV EL YG SYF+RP RI DL+KV+P KACEYFN+CFKDPS+FTVV+VGNIDP
Sbjct  660   PHTVFANRVTELKYGMSYFYRPTRISDLRKVDPLKACEYFNSCFKDPSSFTVVVVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQ+LGGIP PS+P+LHFNR+DLKGLPF FP +IIRE V+SPMVEAQCSVQ+ F
Sbjct  720   TIALPLILQHLGGIPEPSKPVLHFNREDLKGLPFTFPRTIIRESVYSPMVEAQCSVQISF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++HFVGFLSKLLETKI QVLRFK+GQIY+A VSVFLGGNK SR G+IRG
Sbjct  780   PVELKTGAMIEEIHFVGFLSKLLETKITQVLRFKHGQIYSADVSVFLGGNKFSRTGDIRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI +NFSCDP+ISS LVDL LDEILRLQ++GPSDEDVS +LEIEQRAHENGL+EN YWL 
Sbjct  840   DISVNFSCDPEISSNLVDLTLDEILRLQKEGPSDEDVSAILEIEQRAHENGLEENYYWLA  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
              IL SYQS +YSGD+G SF++QD ARSKVRK LTP T Q+ALQRILPFPCKKQY  VILM
Sbjct  900   MILNSYQSELYSGDLGASFEIQDVARSKVRKSLTPSTTQLALQRILPFPCKKQYMAVILM  959

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR+K L S   S+     T AKILAG AG+ VL+L L RYSR + KS
Sbjct  960   PQKSRLKSLTSFFRSS---QTTQAKILAGLAGLTVLVLGLRRYSRITRKS  1006



>ref|XP_010911827.1| PREDICTED: uncharacterized protein LOC105037879 isoform X4 [Elaeis 
guineensis]
Length=965

 Score =  1538 bits (3981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/1010 (74%), Positives = 859/1010 (85%), Gaps = 45/1010 (4%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+  +  ++  FRSLKLV+V M+E L++ P GV YG LDNGLTYYVRSN KP+M
Sbjct  1     MDLLPTEAPSIGGRRQGFRSLKLVSVAMDEPLAEEPVGVVYGVLDNGLTYYVRSNPKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAL  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  121   TSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LM EGSKYAERLPIGLEKVIRTV+P+ VKQFY+KWYHL+NMAV+AVGDF DT
Sbjct  181   RMQDAHWILMFEGSKYAERLPIGLEKVIRTVTPETVKQFYQKWYHLQNMAVVAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +S                                             AVMISCK+PVDE+
Sbjct  241   KS---------------------------------------------AVMISCKIPVDEM  255

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             +TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY+SCS+AAD LVRP+KAYIMTSSC+E+
Sbjct  256   RTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFSCSSAADALVRPIKAYIMTSSCRER  315

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  316   GTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQHF  375

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
              R EPV+GIEYEAQLQKTLLP+IS +EVSK++  F T+ SCVIK +EPRA AT++DL++ 
Sbjct  376   FRKEPVVGIEYEAQLQKTLLPYISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKAS  435

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLK+N  E+++ I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CYK
Sbjct  436   VLKVNALEEEKKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICYK  495

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQV+FTGFSYGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRAE
Sbjct  496   CTDFLDDQVIFTGFSYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRAE  555

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQERD
Sbjct  556   VGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQERD  615

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YF++CFKDPSTFTVVIVGNIDP
Sbjct  616   PYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFSDCFKDPSTFTVVIVGNIDP  675

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL F
Sbjct  676   SVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLAF  735

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV LK+  MME++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++RG
Sbjct  736   PVVLKNMSMMEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRTGDVRG  795

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI +NFSCDPDISS LVDLAL+E++ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWLD
Sbjct  796   DISVNFSCDPDISSKLVDLALEELMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWLD  855

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSR Y GDV  SFK+QDE R+KVRK LTP T Q+ALQRILPFPCKKQYT VILM
Sbjct  856   RILRSYQSRAYFGDVSASFKIQDEGRTKVRKALTPSTVQLALQRILPFPCKKQYTAVILM  915

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ S +K LKSL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  916   PQLSHLKLLKSLLQLRSDGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  965



>ref|XP_008797885.1| PREDICTED: uncharacterized protein LOC103712947 isoform X2 [Phoenix 
dactylifera]
Length=983

 Score =  1525 bits (3949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 754/1011 (75%), Positives = 863/1011 (85%), Gaps = 29/1011 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+  +  ++ RFRSLKL +V M+E L++ P GV YG LDNGLTYYVRSN KP+M
Sbjct  1     MDLLPTEAPSIGGRRQRFRSLKLASVAMDEPLAEEPVGVAYGVLDNGLTYYVRSNPKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALA + GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+
Sbjct  61    RAALALAAKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAL  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  121   TSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLM EGSKYAERLPIGLEKVIRTV+P+ V++FY+KWYHL+NMAV+AVGDF DT
Sbjct  181   RMQDAHWVLMFEGSKYAERLPIGLEKVIRTVTPETVRRFYRKWYHLQNMAVVAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             QSVVELI++HFG K S    PP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE
Sbjct  241   QSVVELIRSHFGQKVSLSGLPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             ++TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY++CS+AAD LVRPVKAYIMTSSC+E
Sbjct  301   MRTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFACSSAADALVRPVKAYIMTSSCRE  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  361   KGTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F R EPV+GIEYEAQLQKTLLPHIS +EVSK++  F T+ SCVIK +EPRA AT++DL++
Sbjct  421   FFRKEPVVGIEYEAQLQKTLLPHISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKA  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              VLK+N  E++  I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CY
Sbjct  481   SVLKVNALEEENKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQV+FTGF+YGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRA
Sbjct  541   KCTDFLDDQVIFTGFAYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQER
Sbjct  601   EVGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQER  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YFN+CFKDPSTFTVVIVGN D
Sbjct  661   DPYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFNDCFKDPSTFTVVIVGNFD  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL 
Sbjct  721   PSVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLA  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV LK+  M                            IY+  VSVFLGGNKPSR G++R
Sbjct  781   FPVVLKNMSM----------------------------IYSVNVSVFLGGNKPSRSGDVR  812

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GD  +NFSCDPDI+S LVD+AL+EI+ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWL
Sbjct  813   GDTSVNFSCDPDIASKLVDIALEEIMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWL  872

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILRSYQSR Y GDV  SF++QDE R+KVRK LTP T Q+ALQRILPFPCK QYT VIL
Sbjct  873   DRILRSYQSRAYFGDVSASFEIQDEGRTKVRKALTPSTIQLALQRILPFPCKMQYTAVIL  932

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             MPQ SR+K LKSL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  933   MPQLSRLKLLKSLLQFRSNGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  983



>ref|XP_010911819.1| PREDICTED: uncharacterized protein LOC105037879 isoform X3 [Elaeis 
guineensis]
Length=969

 Score =  1519 bits (3933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 736/940 (78%), Positives = 840/940 (89%), Gaps = 1/940 (0%)
 Frame = +1

Query  259   SVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF  438
             SVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+TS+DET+YEL 
Sbjct  30    SVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNALTSSDETIYELL  89

Query  439   VPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMM  618
             VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQDAHW+LM 
Sbjct  90    VPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAGRMQDAHWILMF  149

Query  619   EGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHF  798
             EGSKYAERLPIGLEKVIRTV+P+ VKQFY+KWYHL+NMAV+AVGDF DT+SVVELI+AHF
Sbjct  150   EGSKYAERLPIGLEKVIRTVTPETVKQFYQKWYHLQNMAVVAVGDFSDTKSVVELIRAHF  209

Query  799   GYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLL  975
             G K S   PPP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE++TVKDYRD L
Sbjct  210   GQKVSISGPPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDEMRTVKDYRDSL  269

Query  976   AESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESML  1155
             AE+MF  ALNQRFFKISR+KDPPY+SCS+AAD LVRP+KAYIMTSSC+E+GT+EALESML
Sbjct  270   AEAMFHCALNQRFFKISRRKDPPYFSCSSAADALVRPIKAYIMTSSCRERGTIEALESML  329

Query  1156  TEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIE  1335
              EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQHF R EPV+GIE
Sbjct  330   MEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQHFFRKEPVVGIE  389

Query  1336  YEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQK  1515
             YEAQLQKTLLP+IS +EVSK++  F T+ SCVIK +EPRA AT++DL++ VLK+N  E++
Sbjct  390   YEAQLQKTLLPYISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKASVLKVNALEEE  449

Query  1516  QSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVL  1695
             + I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CYKCT+FLDDQV+
Sbjct  450   KKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICYKCTDFLDDQVI  509

Query  1696  FTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMR  1875
             FTGFSYGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRAEVGTK+GAYMR
Sbjct  510   FTGFSYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRAEVGTKVGAYMR  569

Query  1876  SFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVR  2055
             +FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQERDPYT FANRVR
Sbjct  570   TFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQERDPYTVFANRVR  629

Query  2056  ELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQY  2235
             E+NYGNSYFFRPIRI DL+KV+P +AC+YF++CFKDPSTFTVVIVGNIDP+ + PLILQY
Sbjct  630   EVNYGNSYFFRPIRISDLRKVDPIRACKYFSDCFKDPSTFTVVIVGNIDPSVSLPLILQY  689

Query  2236  LGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMM  2415
             LGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL FPV LK+  MM
Sbjct  690   LGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLAFPVVLKNMSMM  749

Query  2416  EDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDP  2595
             E++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++RGDI +NFSCDP
Sbjct  750   EEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRTGDVRGDISVNFSCDP  809

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRI  2775
             DISS LVDLAL+E++ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWLDRILRSYQSR 
Sbjct  810   DISSKLVDLALEELMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWLDRILRSYQSRA  869

Query  2776  YSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLK  2955
             Y GDV  SFK+QDE R+KVRK LTP T Q+ALQRILPFPCKKQYT VILMPQ S +K LK
Sbjct  870   YFGDVSASFKIQDEGRTKVRKALTPSTVQLALQRILPFPCKKQYTAVILMPQLSHLKLLK  929

Query  2956  SLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             SL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  930   SLLQLRSDGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  969



>ref|XP_009764557.1| PREDICTED: uncharacterized protein LOC104216239 isoform X2 [Nicotiana 
sylvestris]
Length=840

 Score =  1515 bits (3923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/815 (89%), Positives = 777/815 (95%), Gaps = 0/815 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAESSQ+LPKKHRFRSLKLVNVNM+EALS+TP GV+YG+L+NGLTYYVRSNSKPKM
Sbjct  1     MDLLPAESSQILPKKHRFRSLKLVNVNMDEALSETPQGVEYGKLENGLTYYVRSNSKPKM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAM  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  121   TSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSPDDLEKERGAVMEEYRGTRNANG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLE+VIRTVSPQ VKQFY+KWYHL+NMAVIAVGDFPDT
Sbjct  181   RMQDAHWVLMMEGSKYAERLPIGLERVIRTVSPQTVKQFYRKWYHLQNMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIKAHFG+K S  DPP +PYY VPSH EPRFSCFVESEAAGSAVMISCKMPV+EL
Sbjct  241   QSVVELIKAHFGHKISAVDPPLLPYYSVPSHNEPRFSCFVESEAAGSAVMISCKMPVEEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LL ESMFFHALNQRFFKISRKKDPPYYSCSAAAD LVRPVKAYIMTSSCKEK
Sbjct  301   KTVKDYRELLTESMFFHALNQRFFKISRKKDPPYYSCSAAADILVRPVKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTVEALESMLTEVARVR+HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTVEALESMLTEVARVRIHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISASEVSKY E+F TSSSCVIKTIEPRATA VDDL++V
Sbjct  421   LRNEPVVGIEYEAQLQKTLLPHISASEVSKYCEKFQTSSSCVIKTIEPRATAAVDDLKAV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V++IN+ E+++S+PPWD+ENIPEEIV  KP+PG I+QQ EY  +GA E  LSNGMRVCYK
Sbjct  481   VVRINSLEREKSLPPWDDENIPEEIVCAKPNPGHIVQQLEYSTIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG+FGYRP++LMDMLAGKRAE
Sbjct  541   STDFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGIFGYRPTILMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSP+DLETALQLVYQLFTT VEPGEEDV IVMQMAEEAI AQERD
Sbjct  601   VGTKLGAYMRTFSGDCSPTDLETALQLVYQLFTTTVEPGEEDVKIVMQMAEEAIRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  661   PYTAFANRVRELNYGNSYFFRPIKFGDLRKVNPYKACEYFNSCFKDPSTFTVVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PL+LQYLGGIPRP EP+LHF+RDDLKGLPF+FP++I REVV SPMVEAQCSVQLCF
Sbjct  721   SIACPLMLQYLGGIPRPPEPVLHFSRDDLKGLPFQFPTTITREVVRSPMVEAQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
             PVELK+E MMEDVHFVGFLSKLLETKIVQVLRFK+
Sbjct  781   PVELKNEKMMEDVHFVGFLSKLLETKIVQVLRFKF  815



>gb|KHM99834.1| Putative zinc protease pqqL [Glycine soja]
Length=977

 Score =  1514 bits (3919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 760/1007 (75%), Positives = 857/1007 (85%), Gaps = 40/1007 (4%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPA  +  + KK  FRSLKLVNV+M++ LS  P GVDYG LDNGL YYVR NSKP+M
Sbjct  1     MELLPA-GTPPISKKQGFRSLKLVNVDMDQLLSDQPVGVDYGILDNGLRYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAVRAGSVLEEE+ERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVRAGSVLEEEDERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYEL VP+DKPELLS+AIS+LAEFSSE+R S+ DLEKERGAVMEEYRGSRNA G
Sbjct  120   TSADDTVYELLVPVDKPELLSRAISVLAEFSSEIRVSKDDLEKERGAVMEEYRGSRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW+LMMEGSKYAERLPIGLE+VIRTVS + VK FYKKWYHL NMAVIAVGDF DT
Sbjct  180   RLQDAHWILMMEGSKYAERLPIGLERVIRTVSSETVKHFYKKWYHLCNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             Q VVELIK HFG K   PDPP IP   VPSH+EPRFSCFVESEAAGSAVMIS K+P DEL
Sbjct  240   QGVVELIKTHFGQKIPDPDPPLIPTIQVPSHDEPRFSCFVESEAAGSAVMISYKIPTDEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY +LLAESMF +ALNQRFFKI+R+ DPPY+SCSAAAD LVRP+KA IMTSSCK K
Sbjct  300   KTVKDYCNLLAESMFLYALNQRFFKIARRNDPPYFSCSAAADVLVRPLKANIMTSSCKRK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVARVRLHGFSEREISVVRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  360   GTIEALESMLIEVARVRLHGFSEREISVVRALLMSEIESAYLERDQIQSTSLRDEYLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHIS  EVSK SE+  TS SCVIKTIEP+  A +DDL++V
Sbjct  420   LHNEPVVGIEYEAQLQKTLLPHISTLEVSKCSEKLRTSCSCVIKTIEPQPFAVLDDLKNV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I PWD+E++PEEIV+ KP+ G ++Q+ +Y N+GA E  LSNGMR+CYK
Sbjct  480   VKKVNLLEEEGRISPWDDEHVPEEIVTTKPNMGHVVQELKYSNIGATELILSNGMRICYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTG+SYGGLSELPE+EYFSCSMG TIAGEIGVFGYRPSVLMDMLAGKRAE
Sbjct  540   HTDFLDDQVIFTGYSYGGLSELPENEYFSCSMGPTIAGEIGVFGYRPSVLMDMLAGKRAE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+F GDCSPSDLETALQLVYQLFTTN+ PGEEDV IVMQMAEEA+ AQ+RD
Sbjct  600   VGTKIGAYMRTFYGDCSPSDLETALQLVYQLFTTNLTPGEEDVKIVMQMAEEAVSAQDRD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRV+ELNYGNSYFFRPIR  DLQKV+P KACE+F+ CFKDPS FTVVIVGNIDP
Sbjct  660   PYTAFTNRVKELNYGNSYFFRPIRKSDLQKVDPRKACEFFSTCFKDPSAFTVVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P EP++HFNRD+LKGLPF FP+SI REVV SPMVEAQC VQ+CF
Sbjct  720   TIAMPLILQYLGGIPKPPEPVMHFNRDELKGLPFTFPTSIHREVVWSPMVEAQCLVQICF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++HFVGFLSKLLETKI+QVLRFK+GQ                       
Sbjct  780   PVELKNGTMVEEIHFVGFLSKLLETKIMQVLRFKHGQ-----------------------  816

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
                             VD+ALDE+LRLQE+GPS++DVST+LEIEQRAHENGLQEN YWLD
Sbjct  817   ----------------VDIALDEMLRLQEEGPSEQDVSTILEIEQRAHENGLQENYYWLD  860

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SF++QDE RSKVR  LT LTAQ+AL+RILPFPCK +YTVVILM
Sbjct  861   RILHSYQSRVYSGDVGTSFEIQDEGRSKVRSSLTTLTAQLALKRILPFPCKNKYTVVILM  920

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             P+AS  + LKS+  SA   Y  +AKILAG  G+AVL  +LWR ++++
Sbjct  921   PKASPFQLLKSVFQSARTNYGREAKILAGVTGLAVLAFSLWRRAQNN  967



>ref|XP_004287512.1| PREDICTED: probable zinc protease PqqL-like [Fragaria vesca subsp. 
vesca]
Length=954

 Score =  1514 bits (3919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/1007 (75%), Positives = 839/1007 (83%), Gaps = 54/1007 (5%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP  SS M+ KK  FRSLKLVNV+M++ L   P GVDYGRLDNGL+YYVR NSKPKM
Sbjct  1     MDLLPGGSSSMV-KKTGFRSLKLVNVDMDQVLGDKPVGVDYGRLDNGLSYYVRCNSKPKM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDIV+FLESIGAEFGACQNAV
Sbjct  60    RAALALAVKVGSVLEEEEERGVAHIVEHLAFSATQKYTNHDIVRFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVP+DK ELLS+AIS+LAEFSSE+R S  DLE+ERGAVMEEYRG+RNA G
Sbjct  120   TSADDTVYELFVPVDKHELLSEAISVLAEFSSEIRVSRDDLERERGAVMEEYRGNRNATG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LMM GSKYAERLPIGLEKVIRTVSP+ VKQFY+KWYHL NMAVIAVGDFPDT
Sbjct  180   RMQDAHWLLMMAGSKYAERLPIGLEKVIRTVSPETVKQFYQKWYHLSNMAVIAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELIK  FG+K S P+   IP Y VPSHEEPR+SCF+ESEA GSAV+IS K P DEL
Sbjct  240   ESVVELIKNQFGHKISAPERALIPTYQVPSHEEPRYSCFIESEATGSAVIISYKTPADEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
              TV+DYRDLLAESMF +ALNQRFFKI+R+KDPP++SCS +AD LV               
Sbjct  300   NTVRDYRDLLAESMFLYALNQRFFKIARRKDPPFFSCSTSADVLV---------------  344

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                          ARVRLHGFSERE+S VRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  345   -------------ARVRLHGFSEREVSTVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  391

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPVIGIEYEAQLQKTLLP I+A+E+SK++E+  TS SCVIKTIEPRA+A VDDL++V
Sbjct  392   LRNEPVIGIEYEAQLQKTLLPSITAAEISKFAEKLQTSCSCVIKTIEPRASAIVDDLKNV  451

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V KI+  E+++ I PWDEE+IPEEIVS KP+PG I+QQ EY N+GA E  LSNGMRVCYK
Sbjct  452   VSKISALEEERIISPWDEEHIPEEIVSTKPNPGNIVQQCEYPNIGATELVLSNGMRVCYK  511

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTGFSYGGLSEL ESEYFSCSMG TIAGEIGV+GYRPSVLMDMLA     
Sbjct  512   STDFLDDQVIFTGFSYGGLSELVESEYFSCSMGPTIAGEIGVYGYRPSVLMDMLA-----  566

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
                                DLETALQLVYQLFTT+V PGEEDV IVMQMAEE +  Q+RD
Sbjct  567   -------------------DLETALQLVYQLFTTHVTPGEEDVKIVMQMAEEMVRNQDRD  607

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PY AFANRV+ELNYGNSYFFRP R+RDLQKV+P KACEYFN CFKDPSTF++VIVGNIDP
Sbjct  608   PYAAFANRVKELNYGNSYFFRPTRLRDLQKVDPMKACEYFNKCFKDPSTFSMVIVGNIDP  667

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PLILQYLGGIP+P EP++ +NRDDL GLPF FP +IIREVV SPMVE QCSVQLCF
Sbjct  668   SIAVPLILQYLGGIPKPPEPLMQYNRDDLTGLPFTFPKTIIREVVRSPMVEEQCSVQLCF  727

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVEL +  M+ED+H VGFLSKLLETKI+QVLRFK+GQIY  GVSVFLGGNKPSR  N+RG
Sbjct  728   PVELNNGTMVEDIHLVGFLSKLLETKIMQVLRFKHGQIYTVGVSVFLGGNKPSRTANVRG  787

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVDL LDEILRLQE+GPS EDVSTVLEIEQRAHENG+QEN YWL+
Sbjct  788   DISINFSCDPEISSKLVDLTLDEILRLQEEGPSTEDVSTVLEIEQRAHENGIQENYYWLE  847

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSRIYSGDVG  F+ Q+E R KVR+ LTP TAQ+ALQ ILP+PCKKQYTVVILM
Sbjct  848   RILHSYQSRIYSGDVGTCFETQEEGRLKVRQSLTPGTAQLALQNILPYPCKKQYTVVILM  907

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             P+ SR K L S   S    +  DAKILAG AG+ VL L+LWR SRS+
Sbjct  908   PRTSRFKLLHSFFRSTTS-FGRDAKILAGLAGLTVLGLSLWRRSRSA  953



>ref|XP_009595116.1| PREDICTED: uncharacterized protein LOC104091476 isoform X2 [Nicotiana 
tomentosiformis]
Length=840

 Score =  1513 bits (3917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/815 (89%), Positives = 777/815 (95%), Gaps = 0/815 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAESSQ+LPKKHRFRSLKLVNVNM+EALS+TP GV+YG+L+NGLTYYVRSNSKPKM
Sbjct  1     MDLLPAESSQILPKKHRFRSLKLVNVNMDEALSETPQGVEYGKLENGLTYYVRSNSKPKM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAM  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLSQAIS+LAEFSSEVR S  DLEKERGAVMEEYRG+RNANG
Sbjct  121   TSADETVYELFVPVDKPELLSQAISVLAEFSSEVRVSPDDLEKERGAVMEEYRGTRNANG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAERLPIGLE+VIRTVSPQ VKQFY+KWYHL+NMAVIAVGDFPDT
Sbjct  181   RMQDAHWVLMMEGSKYAERLPIGLERVIRTVSPQTVKQFYRKWYHLQNMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIKAHFG+K S  DPP IPYY VPSH EPRFSCFVESEAAGSAVMISCKMPV+EL
Sbjct  241   QSVVELIKAHFGHKISAVDPPLIPYYSVPSHNEPRFSCFVESEAAGSAVMISCKMPVEEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+LL ESMFFHALNQRFFKISRKKDPPYYSCSAAAD LVRPVKAYIMTSSCKEK
Sbjct  301   KTVKDYRELLTESMFFHALNQRFFKISRKKDPPYYSCSAAADILVRPVKAYIMTSSCKEK  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GTVEALESMLTEVARVR+HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  361   GTVEALESMLTEVARVRIHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LRNEPV+GIEYEAQLQKTLLPHISASEVSKYSE+F TSSSCVIKTIEPRATA VDDL++V
Sbjct  421   LRNEPVVGIEYEAQLQKTLLPHISASEVSKYSEKFQTSSSCVIKTIEPRATAAVDDLKAV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V++IN+ E+++S+PPWD+E+IPEEIV  K +PG I+QQ EY  +GA E  LSNGMRVCYK
Sbjct  481   VVRINSLEREKSLPPWDDESIPEEIVCAKSNPGHIVQQLEYSTIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG+FGYRP++LMDMLAGKRAE
Sbjct  541   YTDFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGIFGYRPTILMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSP+DLETALQLVYQLFTT VEPGEEDV IVMQMAEEAI AQERD
Sbjct  601   VGTKLGAYMRTFSGDCSPTDLETALQLVYQLFTTTVEPGEEDVKIVMQMAEEAIRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  661   PYTAFANRVRELNYGNSYFFRPIKFGDLRKVNPYKACEYFNSCFKDPSTFTVVIVGNIDP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + A PL+LQYLGGIPRP EP+LHF+RDDLKGLPF+FP++I REVV SPMVEAQCSVQLCF
Sbjct  721   SIACPLMLQYLGGIPRPPEPVLHFSRDDLKGLPFQFPTTITREVVRSPMVEAQCSVQLCF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
             PVELK+E MMEDVHFVGFLSKLLETKIVQVLRFK+
Sbjct  781   PVELKNEKMMEDVHFVGFLSKLLETKIVQVLRFKF  815



>emb|CDY32879.1| BnaC09g33260D [Brassica napus]
Length=985

 Score =  1511 bits (3912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 739/1009 (73%), Positives = 857/1009 (85%), Gaps = 29/1009 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L +K  FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLISGESSKVL-RKQGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLE+E++RGVAHIVEHLAFSAT KYTNHDIVKFLESIGAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEDEDQRGVAHIVEHLAFSATTKYTNHDIVKFLESIGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLEKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VK+FY+KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKKFYQKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP++ VPSHE+ RFSCFVESEAAGSAVMIS KMPV 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSNPPEIPFFPVPSHEDTRFSCFVESEAAGSAVMISYKMPVS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  359

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFS+REISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  360   EKGTLASLESMLLEVARVRLHGFSDREISVVRALMMSEIESAYLERDQIQSTSLRDEYIQ  419

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQK+LLP ISAS+VS+YSE+  TS  CVIKT+EPR+ ATVDD+R
Sbjct  420   HFLHKEPVIGIEYEAQLQKSLLPQISASDVSRYSEKLRTSCGCVIKTMEPRSAATVDDMR  479

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+  ++  I PWDEE IPEE+V  KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  480   NVVSKVNSLGEEMKIAPWDEEKIPEEVVDEKPTPGDVTHQLEYPEVGVTELTLSNGMQVC  539

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGF+YGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLA   
Sbjct  540   YKSTDFLDDQVLFTGFAYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLA---  596

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
                                  DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  597   ---------------------DLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  635

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  636   RDPYTVFANRVKELNYGNSYFFRPIRINELRKVDPVKACEYFNSCFRDPSTFTVVIVGNL  695

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP+ A PLILQYLGGIP+PS+PIL+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  696   DPSIALPLILQYLGGIPKPSQPILNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  755

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYG-QIYNAGVSVFLGGNKPSRVGN  2556
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +G QIY+A VSVFLGGNKPSR  +
Sbjct  756   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQQIYSAEVSVFLGGNKPSRTAD  815

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
             +RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN Y
Sbjct  816   LRGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYY  875

Query  2737  WLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVV  2916
             WLDRILR YQSR+Y+GD+G S ++ +E R ++R+ L P TAQ ALQRILP PCKKQYT V
Sbjct  876   WLDRILRGYQSRVYAGDLGASCQILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAV  935

Query  2917  ILMPQASRMKRLKSLVCSAPK-RYCTDAKIlagtagvavllltlWRYSR  3060
             ILMPQ SR   L S+  S+P+ RY  D KILAG AG+AVL+ ++WRYSR
Sbjct  936   ILMPQRSRFGFLSSIFASSPETRYIRDTKILAGIAGLAVLVFSIWRYSR  984



>ref|XP_008797886.1| PREDICTED: uncharacterized protein LOC103712947 isoform X3 [Phoenix 
dactylifera]
Length=969

 Score =  1510 bits (3909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/940 (78%), Positives = 836/940 (89%), Gaps = 1/940 (0%)
 Frame = +1

Query  259   SVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF  438
             SVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+TS+DET+YEL 
Sbjct  30    SVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNALTSSDETIYELL  89

Query  439   VPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMM  618
             VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQDAHWVLM 
Sbjct  90    VPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAGRMQDAHWVLMF  149

Query  619   EGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHF  798
             EGSKYAERLPIGLEKVIRTV+P+ V++FY+KWYHL+NMAV+AVGDF DTQSVVELI++HF
Sbjct  150   EGSKYAERLPIGLEKVIRTVTPETVRRFYRKWYHLQNMAVVAVGDFSDTQSVVELIRSHF  209

Query  799   GYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLL  975
             G K S    PP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE++TVKDYRD L
Sbjct  210   GQKVSLSGLPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDEMRTVKDYRDSL  269

Query  976   AESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESML  1155
             AE+MF  ALNQRFFKISR+KDPPY++CS+AAD LVRPVKAYIMTSSC+EKGT+EALESML
Sbjct  270   AEAMFHCALNQRFFKISRRKDPPYFACSSAADALVRPVKAYIMTSSCREKGTIEALESML  329

Query  1156  TEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIE  1335
              EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQHF R EPV+GIE
Sbjct  330   MEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQHFFRKEPVVGIE  389

Query  1336  YEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQK  1515
             YEAQLQKTLLPHIS +EVSK++  F T+ SCVIK +EPRA AT++DL++ VLK+N  E++
Sbjct  390   YEAQLQKTLLPHISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKASVLKVNALEEE  449

Query  1516  QSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVL  1695
               I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CYKCT+FLDDQV+
Sbjct  450   NKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICYKCTDFLDDQVI  509

Query  1696  FTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMR  1875
             FTGF+YGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRAEVGTK+GAYMR
Sbjct  510   FTGFAYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRAEVGTKVGAYMR  569

Query  1876  SFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVR  2055
             +FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQERDPYT FANRVR
Sbjct  570   TFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQERDPYTVFANRVR  629

Query  2056  ELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQY  2235
             E+NYGNSYFFRPIRI DL+KV+P +AC+YFN+CFKDPSTFTVVIVGN DP+ + PLILQY
Sbjct  630   EVNYGNSYFFRPIRISDLRKVDPIRACKYFNDCFKDPSTFTVVIVGNFDPSVSLPLILQY  689

Query  2236  LGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMM  2415
             LGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL FPV LK+  MM
Sbjct  690   LGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLAFPVVLKNMSMM  749

Query  2416  EDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDP  2595
             E++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++RGD  +NFSCDP
Sbjct  750   EEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRSGDVRGDTSVNFSCDP  809

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRI  2775
             DI+S LVD+AL+EI+ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWLDRILRSYQSR 
Sbjct  810   DIASKLVDIALEEIMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWLDRILRSYQSRA  869

Query  2776  YSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLK  2955
             Y GDV  SF++QDE R+KVRK LTP T Q+ALQRILPFPCK QYT VILMPQ SR+K LK
Sbjct  870   YFGDVSASFEIQDEGRTKVRKALTPSTIQLALQRILPFPCKMQYTAVILMPQLSRLKLLK  929

Query  2956  SLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             SL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  930   SLLQFRSNGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  969



>emb|CDY32763.1| BnaA10g10860D [Brassica napus]
Length=985

 Score =  1509 bits (3907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1009 (73%), Positives = 858/1009 (85%), Gaps = 29/1009 (3%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L +K  FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLISGESSKVL-RKQGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLE+E++RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEDEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESIGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLEKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VK+FY+KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKKFYQKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP++ VPSHE+ RFSCFVESEAAGSAVMIS KMPV 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSNPPDIPFFPVPSHEDTRFSCFVESEAAGSAVMISYKMPVS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  359

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  360   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQIQSTSLRDEYIQ  419

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQK+LLP ISAS+VS+YSE+  TS  CVIKT+EPR+ ATVDD+R
Sbjct  420   HFLHKEPVIGIEYEAQLQKSLLPQISASDVSRYSEKLRTSCGCVIKTMEPRSNATVDDMR  479

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             + V K+N+ E++  I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E  LSNGM+VC
Sbjct  480   NAVSKVNSLEEEMKIAPWDEEKIPEEVVNEKPTPGDVTHQLEYPEVGVTELTLSNGMQVC  539

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGF+YGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLA   
Sbjct  540   YKSTDFLDDQVLFTGFAYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLA---  596

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
                                  DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  597   ---------------------DLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  635

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  636   RDPYTVFANRVKELNYGNSYFFRPIRINELRKVDPVKACEYFNSCFRDPSTFTVVIVGNL  695

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP+ A PLILQYLGGIP+P +PIL+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQL
Sbjct  696   DPSIALPLILQYLGGIPKPPQPILNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQL  755

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYG-QIYNAGVSVFLGGNKPSRVGN  2556
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF +G QIY+A VSVFLGGNKPSR  +
Sbjct  756   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQQIYSAEVSVFLGGNKPSRTAD  815

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
             +RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN Y
Sbjct  816   LRGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYY  875

Query  2737  WLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVV  2916
             WLDRILR YQSR+Y+GD+G S ++ +E R ++R+ L P TAQ ALQRILP PCKKQYT V
Sbjct  876   WLDRILRGYQSRVYAGDLGASCQILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAV  935

Query  2917  ILMPQASRMKRLKSLVCSAPK-RYCTDAKIlagtagvavllltlWRYSR  3060
             ILMPQ SR   L S+  S+P+ R+  D KILAG AG+AVL+L++WRYSR
Sbjct  936   ILMPQRSRFGFLSSIFASSPETRFIRDTKILAGIAGLAVLVLSIWRYSR  984



>gb|KDO59294.1| hypothetical protein CISIN_1g001831mg [Citrus sinensis]
Length=892

 Score =  1509 bits (3907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 724/893 (81%), Positives = 813/893 (91%), Gaps = 2/893 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLPAE SQ + KKH FRSLKLV+ ++ E L + P+GVDYGRLDNGL YYVR NSKP+M
Sbjct  1     MELLPAEGSQ-IAKKHGFRSLKLVSFDLNEELGEQPFGVDYGRLDNGLFYYVRCNSKPRM  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+AGSVLEEE ERGVAHIVEHLAFSATEKYTNHDI+KFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKAGSVLEEEHERGVAHIVEHLAFSATEKYTNHDIIKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSADETVYELFVP+DKPELLS+AIS+LAEFS+EVR S+ DLEKERGAV+EEYRG+RNA+G
Sbjct  120   TSADETVYELFVPVDKPELLSRAISVLAEFSTEVRVSKDDLEKERGAVLEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHWVLMMEGSKYAE LPIGLEKVIRTVS   VK+FY+KWY L+NMAVIAVGDFPDT
Sbjct  180   RMQDAHWVLMMEGSKYAECLPIGLEKVIRTVSSDTVKRFYQKWYRLQNMAVIAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             + VVELI  HFG K S  DPP IP + VPSH+EPRFSCF+ESEA GSAV++S KMPV+EL
Sbjct  240   KGVVELINTHFGQKKSATDPPVIPKFPVPSHQEPRFSCFIESEAGGSAVIVSYKMPVNEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KT+KDY+++L ESMF HALNQRFFK+SR+KDPPY+SCSA+AD LVRP+KAYIM+SSCKE+
Sbjct  300   KTIKDYKEMLTESMFLHALNQRFFKLSRRKDPPYFSCSASADDLVRPLKAYIMSSSCKER  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT++ALESML EVARVRLHGFSERE+SV RALLMSE+ESAYLERDQMQST+LRDE LQHF
Sbjct  360   GTLKALESMLIEVARVRLHGFSEREVSVARALLMSEVESAYLERDQMQSTNLRDECLQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L  EP+IGIEYEA+LQKTLLPHISA EVS+YSE+  TS SCVIKTIEP+  +T+DDL+++
Sbjct  420   LCKEPIIGIEYEARLQKTLLPHISALEVSRYSEKLQTSCSCVIKTIEPQTFSTIDDLKNI  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLKI   E+K +I PWDEENIPEEIVS KPSPG I+QQFEY+N+GA E  LSNGMRVCYK
Sbjct  480   VLKIKNLEEK-NISPWDEENIPEEIVSTKPSPGNIVQQFEYENLGATELVLSNGMRVCYK  538

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIGVFGYRPS+LMDMLAGKR E
Sbjct  539   CTDFLDDQVLFTGFSYGGLSELPESEYLSCSMGSTIAGEIGVFGYRPSMLMDMLAGKRVE  598

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
              GTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEE I AQERD
Sbjct  599   GGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVAPGEEEVEIVMQMAEEVIRAQERD  658

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+E+NYGNSYFFRPIRI DLQKV+P KAC+YFN+CFKDPSTFTVVIVGNIDP
Sbjct  659   PYTAFANRVKEINYGNSYFFRPIRISDLQKVDPLKACDYFNSCFKDPSTFTVVIVGNIDP  718

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             +   PLILQYLGGIP+P EPILHFNRD+LKGLPF FPSSIIREVV SPMVEAQCSVQLCF
Sbjct  719   SNGIPLILQYLGGIPKPPEPILHFNRDNLKGLPFTFPSSIIREVVRSPMVEAQCSVQLCF  778

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++++VGFLSKLLETK++QVLRFK+GQIY+A VSVFLGGNK SR G++RG
Sbjct  779   PVELKNGTMVEEINYVGFLSKLLETKMMQVLRFKHGQIYSASVSVFLGGNKHSRTGDVRG  838

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQ  2724
             DI INFSCDP+IS  LVDLALDEI RLQ++GPSDEDVST+LE+EQRAHE GLQ
Sbjct  839   DISINFSCDPEISFKLVDLALDEISRLQKEGPSDEDVSTILELEQRAHETGLQ  891



>gb|AET05136.2| peptidase M16 inactive domain protein [Medicago truncatula]
Length=978

 Score =  1506 bits (3899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/1006 (74%), Positives = 851/1006 (85%), Gaps = 42/1006 (4%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLP+E++  + +K  FRSLKLV+ +M + LS  P GVD+G LDNGL YYVR NSKP+M
Sbjct  1     MELLPSEAAAPISRKQGFRSLKLVSTDMNQLLSDQPVGVDFGTLDNGLRYYVRCNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAVR GSVLEEE+ERGVAHIVEHLAFSAT++Y NHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALAVRVGSVLEEEDERGVAHIVEHLAFSATKRYNNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+TVYEL VP+DKPELLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRGSRNA G
Sbjct  121   TSSDDTVYELLVPVDKPELLSQAISILAEFSSEIRVSKDDLEKERGAVMEEYRGSRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW L+MEGSKYAERLPIGLEKVIRTVSP+ V+ FYKKWYHL NMAVIAVG     
Sbjct  181   RLQDAHWTLLMEGSKYAERLPIGLEKVIRTVSPETVRHFYKKWYHLCNMAVIAVG-----  235

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
              SVVELIK HFG K   PDPPPIP + VPSH++PRFSCFVESEAAGSAVMIS KMP +EL
Sbjct  236   -SVVELIKVHFGQKIPAPDPPPIPTFQVPSHDDPRFSCFVESEAAGSAVMISYKMPANEL  294

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             K                                    + +AD LVRPVK  I+TSSC+ K
Sbjct  295   K------------------------------------NTSADVLVRPVKTNIITSSCRGK  318

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARVRLHGFSERE+S+VRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  319   GTLEALESMLTEVARVRLHGFSEREVSIVRALLMSEIESAYLERDQVQSTSLRDEYLQHF  378

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHISA EVSKYSE+  TS SCVIKT+EPRA A  DDL++V
Sbjct  379   LHNEPVVGIEYEAQLQKTLLPHISALEVSKYSEKLRTSCSCVIKTMEPRAFAVFDDLKNV  438

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I  WD+++IPEEIV+ KP+ G ++++ EY N+GA E  LSNGMR+CYK
Sbjct  439   VKKVNLLEEEGGISLWDDDHIPEEIVTTKPNMGHVVKELEYSNIGATELILSNGMRICYK  498

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTG+SYGGLSELPESEYFSCSMG TIAGEIGVFGYRPSVLMDMLAGKRAE
Sbjct  499   RTDFLDDQVIFTGYSYGGLSELPESEYFSCSMGPTIAGEIGVFGYRPSVLMDMLAGKRAE  558

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+F GDCSPSDLET LQLVYQLFTTN+ P EE+V IVMQMAEEA+ AQ+RD
Sbjct  559   VGTKIGAYMRTFYGDCSPSDLETGLQLVYQLFTTNLTPDEENVKIVMQMAEEAVCAQDRD  618

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRV+ELNYGNSYFFRPI+  DLQKV+P +ACEYF+ CF+DPS FTVVIVGNIDP
Sbjct  619   PYTAFTNRVKELNYGNSYFFRPIKKCDLQKVDPLEACEYFSKCFRDPSAFTVVIVGNIDP  678

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P EPI+HFNRDDLKGLPF FP++I REVV SPMVEAQC VQ+CF
Sbjct  679   TIALPLILQYLGGIPKPPEPIMHFNRDDLKGLPFTFPTAIHREVVRSPMVEAQCLVQICF  738

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++HFVGFLSKLLETKI+QVLRFK+GQIY+ GVSVFLGGNKPSR G +RG
Sbjct  739   PVELKNGTMVEEIHFVGFLSKLLETKIMQVLRFKHGQIYSVGVSVFLGGNKPSRTGIVRG  798

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVD+ALDE+LRLQ++GP+++DVSTVLEIEQRAHENGLQEN YWLD
Sbjct  799   DISINFSCDPEISSKLVDIALDEMLRLQDEGPTEQDVSTVLEIEQRAHENGLQENYYWLD  858

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGDVG SF++Q E RSKVR  LTP TAQ+ALQRILP+PCKKQYT VILM
Sbjct  859   RILHSYQSRVYSGDVGTSFEIQGEGRSKVRSSLTPSTAQLALQRILPYPCKKQYTAVILM  918

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRS  3063
             P++S  K LKS+  S       +AKILAG AG+AVL L+LWR+SRS
Sbjct  919   PKSSPFKFLKSVFQSTRINGGREAKILAGIAGLAVLALSLWRHSRS  964



>dbj|BAD87946.1| chloroplast processing enzyme-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD87661.1| chloroplast processing enzyme-like protein [Oryza sativa Japonica 
Group]
 gb|EEC70886.1| hypothetical protein OsI_02423 [Oryza sativa Indica Group]
Length=1000

 Score =  1499 bits (3880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 731/994 (74%), Positives = 832/994 (84%), Gaps = 28/994 (3%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEE  276
             FRSLK+V+V+M+E L   P GV YGRL NGL YYVRSN KP+MRAAL+LAV+ GSV+EEE
Sbjct  34    FRSLKMVSVSMDEPLPAEPVGVAYGRLANGLAYYVRSNPKPRMRAALSLAVKVGSVVEEE  93

Query  277   EERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKP  456
             +ERGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA+TS+DET+YEL VP+DKP
Sbjct  94    DERGVAHIVEHLAFSATSRYTNHDIVKFLESIGAEFGACQNALTSSDETIYELLVPVDKP  153

Query  457   ELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYA  636
              LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYA
Sbjct  154   GLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNATGRMQDSHWALLFEGSKYA  213

Query  637   ERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSp  816
             ERLPIG EKVIRTV  + V+ FY KWYHL NMAV AVGDFPDTQ+VVE+IK HFG K  P
Sbjct  214   ERLPIGTEKVIRTVPHETVRHFYHKWYHLSNMAVFAVGDFPDTQAVVEMIKEHFGQKAPP  273

Query  817   pdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFF  993
               PPP+   + VPSH EPRFSCFVESEAAGSAV++SCKMP D +KTV DYRD LAESMF 
Sbjct  274   SCPPPVIPDFPVPSHVEPRFSCFVESEAAGSAVVVSCKMPADRIKTVTDYRDSLAESMFH  333

Query  994   HALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARV  1173
              ALNQR FKISR+ DPPY+SCS+AAD LVRPVKAYIMTSSC+E+GTVEALESML EVARV
Sbjct  334   CALNQRLFKISRRNDPPYFSCSSAADALVRPVKAYIMTSSCRERGTVEALESMLLEVARV  393

Query  1174  RLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQ  1353
             RLHGFSEREIS+ RAL+MS+IESAYLERDQMQST+LRDE+LQHFL  +PV+GIEYEAQLQ
Sbjct  394   RLHGFSEREISIARALMMSDIESAYLERDQMQSTTLRDEFLQHFLHEDPVVGIEYEAQLQ  453

Query  1354  KTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPW  1533
             KTLLPHIS++EV K++  F T SSCVIK +EP A A+++DL++VVLK+NT EQ  +IPPW
Sbjct  454   KTLLPHISSAEVVKFAANFSTISSCVIKVVEPHAHASLEDLKAVVLKVNTLEQDNAIPPW  513

Query  1534  DEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSY  1713
             DEE IPEEIVS  P PG I+ + E+  +GA E  LSNGMR+CYKCT+FLDDQV+FTGF+Y
Sbjct  514   DEEQIPEEIVSQSPEPGSILDKVEHPGIGATEMILSNGMRICYKCTDFLDDQVVFTGFAY  573

Query  1714  GGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDC  1893
             GGLSEL E EY SCSMGSTIAGEIG+FGYRPSVLMDMLAGKRAEVGTK+GAYMRSFSGDC
Sbjct  574   GGLSELSEDEYTSCSMGSTIAGEIGIFGYRPSVLMDMLAGKRAEVGTKVGAYMRSFSGDC  633

Query  1894  SPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGN  2073
             SPSDLETALQLVYQLFTT VEP EE+V IVMQMAEEAI+AQERDPYTAFANR RE+NYGN
Sbjct  634   SPSDLETALQLVYQLFTTKVEPREEEVKIVMQMAEEAIYAQERDPYTAFANRAREINYGN  693

Query  2074  SYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPR  2253
             SYFF+PIRI DL+KV+P +ACEYFNNCFKDPS FTVVIVGNIDP+ + PLILQYLGGIP 
Sbjct  694   SYFFKPIRISDLKKVDPIRACEYFNNCFKDPSAFTVVIVGNIDPSISVPLILQYLGGIPN  753

Query  2254  PSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFV  2433
                 +L   RDDLKGLPFKFP +IIREVV SPMVEAQC VQL FPV LKS  M ED+H+V
Sbjct  754   VGNAVLPLTRDDLKGLPFKFPETIIREVVRSPMVEAQCFVQLGFPVVLKSTTMTEDIHYV  813

Query  2434  GFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTL  2613
             GFLSKLLETKI+QVLRFKYGQ+Y+  V VFLGGNKPSR G+IRGDI +NFSCDPD+SS L
Sbjct  814   GFLSKLLETKIMQVLRFKYGQVYSVNVGVFLGGNKPSRSGDIRGDISVNFSCDPDMSSKL  873

Query  2614  VDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVG  2793
             VD  L+EI  LQ +GPS+EDV T+LEIEQRAHENGLQ                       
Sbjct  874   VDFVLEEISFLQNEGPSEEDVLTILEIEQRAHENGLQ-----------------------  910

Query  2794  DSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSA  2973
                 +QDE R KVR+ LTP + QMALQR++PFPC+KQ+TVVILMP++S     K+L+  +
Sbjct  911   ----IQDEGRLKVREALTPQSMQMALQRVVPFPCRKQFTVVILMPKSSCWNSFKALLTWS  966

Query  2974  PKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             P  +  DAKILAG AG  VL ++LWRYSRS+L+S
Sbjct  967   PGGFSRDAKILAGMAGAIVLAVSLWRYSRSTLRS  1000



>ref|XP_006646001.1| PREDICTED: uncharacterized protein LOC102701684 [Oryza brachyantha]
Length=952

 Score =  1490 bits (3858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/952 (75%), Positives = 823/952 (86%), Gaps = 1/952 (0%)
 Frame = +1

Query  223   MRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNA  402
             MRAAL+LAV+ GSV+EEE+ERGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA
Sbjct  1     MRAALSLAVKVGSVVEEEDERGVAHIVEHLAFSATSRYTNHDIVKFLESIGAEFGACQNA  60

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +TS+DET+YEL VP+DKP LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA 
Sbjct  61    LTSSDETIYELLVPVDKPGLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAT  120

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQD+HW L+ EGSKYAERLPIG EKVIRTV  + V+QFY KWYHL NMAV AVGDFPD
Sbjct  121   GRMQDSHWALLFEGSKYAERLPIGTEKVIRTVPHETVRQFYHKWYHLSNMAVFAVGDFPD  180

Query  763   TQSVVELIKAHFGYKT-SppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             TQ+VVE+IK HFG K  +   PP IP + VPSH EPRFSCFVESEAAGSAV++SCKMP D
Sbjct  181   TQAVVEMIKEHFGQKIPASCPPPAIPDFPVPSHIEPRFSCFVESEAAGSAVVVSCKMPAD  240

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
              +KTV DYRD LAESMF  ALNQRFFKISR+ DPPY+SCS+AA+ LVRPVKAYIMTSSC+
Sbjct  241   RIKTVNDYRDSLAESMFHWALNQRFFKISRRNDPPYFSCSSAAEALVRPVKAYIMTSSCR  300

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             E+GTVEALESML EVARVRLHGFS+REIS+ RAL+MS+IESAYLERDQMQST+LRDE+LQ
Sbjct  301   ERGTVEALESMLLEVARVRLHGFSDREISIARALMMSDIESAYLERDQMQSTTLRDEFLQ  360

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  +PV+GIEYEAQLQKTLLPHIS++EV K++  F T+SSCVIK +EPRA A+++DL+
Sbjct  361   HFLHEDPVVGIEYEAQLQKTLLPHISSAEVVKFAANFSTTSSCVIKVVEPRAHASLEDLK  420

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             ++VLKINT E+  +IPPWDEE IPEEIVS  P PG I+ + E+  +GA E  LSNGMR+C
Sbjct  421   AIVLKINTLEKDNAIPPWDEEQIPEEIVSQSPEPGSILDKVEHPGIGATEMILSNGMRIC  480

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YKCT+FLDDQV+FTGF+YGGLSEL E EY SCSMGSTIAGEIG+FGYRPSVLMDMLAGKR
Sbjct  481   YKCTDFLDDQVVFTGFAYGGLSELSEDEYTSCSMGSTIAGEIGIFGYRPSVLMDMLAGKR  540

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
             AEVGTK+GAYMRSFSGDCSPSDLETALQLVYQLF T VEP EE+V IVMQMAEEAI+AQE
Sbjct  541   AEVGTKVGAYMRSFSGDCSPSDLETALQLVYQLFATKVEPREEEVKIVMQMAEEAIYAQE  600

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYTAFANR RE+NYGNSYFF+PI+I DL+KV+P +ACEYFNNCFKDPS+FTVVIVGNI
Sbjct  601   RDPYTAFANRAREINYGNSYFFKPIKISDLKKVDPIRACEYFNNCFKDPSSFTVVIVGNI  660

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP+ + PLILQYLGGIP   + +    RDDLKGLPFKFP +IIREVV SPMVEAQC VQL
Sbjct  661   DPSISVPLILQYLGGIPNVRDAVQPLTRDDLKGLPFKFPETIIREVVRSPMVEAQCFVQL  720

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
              FPV LKS  M ED+H+VGFL KLLET+I+QVLRFKYGQIY+  V VFLGGNKPSR G++
Sbjct  721   GFPVVLKSAAMTEDIHYVGFLIKLLETRIMQVLRFKYGQIYSVNVGVFLGGNKPSRSGDV  780

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDPD+SS LV   L+EI  LQ +GPS+EDV T+LEIEQRAHENGLQEN YW
Sbjct  781   RGDISVNFSCDPDMSSKLVGFVLEEISYLQNEGPSEEDVLTILEIEQRAHENGLQENYYW  840

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRILRSYQSR+YSGDVG +F++QDE R KVR  LTP   Q+ALQR++PFPC+KQ+TVVI
Sbjct  841   LDRILRSYQSRVYSGDVGSTFEIQDEGRLKVRDALTPEAMQLALQRVVPFPCRKQFTVVI  900

Query  2920  LMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             LMP++S     K+L+  +   +  DAKILAG AG  VL +TLWRYSRS+L+S
Sbjct  901   LMPKSSCWDSFKTLLTWSSGGFSRDAKILAGMAGAVVLAVTLWRYSRSALRS  952



>ref|XP_004968986.1| PREDICTED: uncharacterized protein LOC101760569 isoform X2 [Setaria 
italica]
Length=996

 Score =  1490 bits (3857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/992 (73%), Positives = 834/992 (84%), Gaps = 29/992 (3%)
 Frame = +1

Query  103   SLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEE  282
             SLKLV+V M+E L   P G  YGRL NGLTYYVRSN KP+MRAAL+LAV+ GSV+EEE+E
Sbjct  33    SLKLVSVAMDEPLPVDPVGATYGRLPNGLTYYVRSNPKPRMRAALSLAVKVGSVVEEEDE  92

Query  283   RGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPEL  462
             RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA+TS+DET+YEL VP+DKP L
Sbjct  93    RGVAHIVEHLAFSATSRYTNHDIVKFLESIGAEFGACQNALTSSDETIYELLVPVDKPGL  152

Query  463   LSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAER  642
             LSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYAER
Sbjct  153   LSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNATGRMQDSHWALLFEGSKYAER  212

Query  643   LPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppd  822
             LPIG EKVIRTV  + VK+FY+KWYHL NMAV AVGDFPDTQ+VVELIK HFG K   P 
Sbjct  213   LPIGTEKVIRTVPHETVKRFYQKWYHLSNMAVFAVGDFPDTQAVVELIKEHFGQKAPAPL  272

Query  823   pppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHA  999
             PPP    + VPSHEEPRFSCFVESEAAGSAV+ISCKMP  E+KTVKDY+D LAESMF  A
Sbjct  273   PPPAIPEFRVPSHEEPRFSCFVESEAAGSAVVISCKMPAGEIKTVKDYKDSLAESMFHCA  332

Query  1000  LNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRL  1179
             LNQR FKISR KDPPY+SCS+AAD LV                            ARVRL
Sbjct  333   LNQRLFKISRGKDPPYFSCSSAADALV----------------------------ARVRL  364

Query  1180  HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKT  1359
             HGFS+REIS+VRAL+MSE+ESAYLERDQMQSTSLRDE+LQHFLR EPV+GIEYEAQLQKT
Sbjct  365   HGFSDREISIVRALMMSEMESAYLERDQMQSTSLRDEFLQHFLREEPVVGIEYEAQLQKT  424

Query  1360  LLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDE  1539
             LLPHIS++EV+K++E F T+SSCVIK +EPRA A+++DL++VVLK+N+ E+++SIPPWDE
Sbjct  425   LLPHISSAEVAKFAENFSTASSCVIKIVEPRAHASLEDLKAVVLKVNSLEEEKSIPPWDE  484

Query  1540  ENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGG  1719
             E IPEEIV+  P PG I+ + E+  + A E  LSNGMR+CYK T+FLDDQV+FTGF+YGG
Sbjct  485   EQIPEEIVAEAPEPGSIIDKVEHPGIVATEMILSNGMRICYKYTDFLDDQVVFTGFAYGG  544

Query  1720  LSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSP  1899
             LSEL E+EY SCSMGSTIAGEIG FGYRPSVLMDMLAGKRAEVGTK+GAYMR+FSGDCSP
Sbjct  545   LSELSEAEYTSCSMGSTIAGEIGTFGYRPSVLMDMLAGKRAEVGTKVGAYMRTFSGDCSP  604

Query  1900  SDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSY  2079
             SDLETALQLVYQLF TNVEP EE+V IVMQMAEEAI+AQERDPYTAFANRVRE+NYGNSY
Sbjct  605   SDLETALQLVYQLFITNVEPREEEVKIVMQMAEEAIYAQERDPYTAFANRVREINYGNSY  664

Query  2080  FFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS  2259
             FF+PIRI DL+KV+P +ACEYFNNCFKDPS FTVVIVG IDPA + PLILQYLGGIPR  
Sbjct  665   FFKPIRISDLKKVDPIRACEYFNNCFKDPSAFTVVIVGKIDPAISLPLILQYLGGIPRVQ  724

Query  2260  EPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGF  2439
             +     +RDDL+GLPFKFP++IIREVV SPMVEAQC VQL FPV LK+  M ED+H+VGF
Sbjct  725   DAAQPLSRDDLRGLPFKFPATIIREVVRSPMVEAQCFVQLAFPVVLKNTMMTEDIHYVGF  784

Query  2440  LSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVD  2619
             LSKLLETKI+QVLRFKYGQ+Y+  V+VFLGGNKPSR G++RGDI +NFSCDPDISS LVD
Sbjct  785   LSKLLETKIMQVLRFKYGQVYSVNVAVFLGGNKPSRTGDVRGDISVNFSCDPDISSKLVD  844

Query  2620  LALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDS  2799
               L+EI  LQ +GPS+EDV T+LEIEQRAHENGLQEN +WLDRILRSYQSR++SGD+G +
Sbjct  845   FVLEEISYLQAEGPSEEDVLTILEIEQRAHENGLQENYFWLDRILRSYQSRLFSGDIGST  904

Query  2800  FKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPK  2979
             F  Q+E R KVR+ LTP T Q ALQR+LPFPC+ QYTVVILMP++S    +KS++  +  
Sbjct  905   FAFQEEGRMKVREALTPQTMQSALQRVLPFPCRNQYTVVILMPKSSCWASVKSMLSWSSN  964

Query  2980  RYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
                 DAKILAG AG  VL ++LWRYSRS+LKS
Sbjct  965   GVSRDAKILAGIAGALVLAVSLWRYSRSTLKS  996



>ref|XP_002455798.1| hypothetical protein SORBIDRAFT_03g025400 [Sorghum bicolor]
 gb|EES00918.1| hypothetical protein SORBIDRAFT_03g025400 [Sorghum bicolor]
Length=978

 Score =  1483 bits (3838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/991 (72%), Positives = 826/991 (83%), Gaps = 45/991 (5%)
 Frame = +1

Query  103   SLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEE  282
             SLKLV+V M+E L   P G  YGRL NGLTYYVRSN KP+MRAAL+LAV+ GSV+EEE+E
Sbjct  33    SLKLVSVAMDETLPVDPVGATYGRLANGLTYYVRSNPKPRMRAALSLAVKVGSVVEEEDE  92

Query  283   RGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPEL  462
             RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA+TS+DET+YEL VP+DKP L
Sbjct  93    RGVAHIVEHLAFSATSRYTNHDIVKFLESIGAEFGACQNALTSSDETIYELLVPVDKPGL  152

Query  463   LSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAER  642
             LSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYAER
Sbjct  153   LSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAGRMQDSHWALLFEGSKYAER  212

Query  643   LPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppd  822
             LPIG EKVIRTV+ + VK+FY+KWYHL NMAV AVGDFPDTQS                 
Sbjct  213   LPIGTEKVIRTVTHETVKRFYQKWYHLSNMAVFAVGDFPDTQS-----------------  255

Query  823   pppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHAL  1002
                                         AV+ISCKMP   +KTVKDY+D LAESMF  AL
Sbjct  256   ----------------------------AVVISCKMPAGGIKTVKDYKDSLAESMFHCAL  287

Query  1003  NQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLH  1182
             NQR FKISR+KDPPY+SCS+AAD LV PVKAYIMTSSC+E+GTVEALESML EVARVRLH
Sbjct  288   NQRLFKISRRKDPPYFSCSSAADALVCPVKAYIMTSSCRERGTVEALESMLLEVARVRLH  347

Query  1183  GFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTL  1362
             GFS+REIS+VRAL+MSE+ESAYLERDQMQSTSLRDE+LQHFLR EPV+GIEYEAQLQKTL
Sbjct  348   GFSDREISIVRALMMSEMESAYLERDQMQSTSLRDEFLQHFLREEPVVGIEYEAQLQKTL  407

Query  1363  LPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEE  1542
             LPHIS++EV+K++E F T+SSCVIK +EPRA A+++DL++VVLK+N+ E+++SIPPWDEE
Sbjct  408   LPHISSAEVAKFAENFSTASSCVIKIVEPRAHASLEDLKAVVLKVNSLEEEKSIPPWDEE  467

Query  1543  NIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGL  1722
              IPEEIV+  P PG I+ + E+  +GA E  LSNGMR+CYK T+FLDDQV+FTGF+YGGL
Sbjct  468   QIPEEIVAQAPEPGTIIDKVEHPGIGATEMILSNGMRICYKYTDFLDDQVVFTGFAYGGL  527

Query  1723  SELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPS  1902
             SEL E+EY SCSMGSTIAGEIG FGYRPSVLMDMLAGKRAEVGTK+GAYMR+FSGDCSPS
Sbjct  528   SELSEAEYTSCSMGSTIAGEIGTFGYRPSVLMDMLAGKRAEVGTKVGAYMRTFSGDCSPS  587

Query  1903  DLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYF  2082
             DLETALQLVYQLFTTNVEP EE+V IVMQMAEEAI+AQERDPYTAFANRVRE+NYGNSYF
Sbjct  588   DLETALQLVYQLFTTNVEPREEEVKIVMQMAEEAIYAQERDPYTAFANRVREINYGNSYF  647

Query  2083  FRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSE  2262
             F+PIRI DL+KV+P +ACEYFNNCFKDPS FTVVIVG IDPA + PL+LQYLGGIPR  +
Sbjct  648   FKPIRISDLKKVDPIRACEYFNNCFKDPSAFTVVIVGKIDPAISLPLVLQYLGGIPRVQD  707

Query  2263  PILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFL  2442
                  +RDDL+GLPFKFP++IIREVV SPMVEAQC VQL FPV LK+  M ED+H+VGFL
Sbjct  708   ATQPLSRDDLRGLPFKFPATIIREVVRSPMVEAQCFVQLAFPVVLKNTMMTEDIHYVGFL  767

Query  2443  SKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDL  2622
             SKLLET+I+QVLRFKYGQIY+  V+VFLGGNKPSR G++RGDI +NFSCDPDISS LVD 
Sbjct  768   SKLLETRIMQVLRFKYGQIYSVNVAVFLGGNKPSRTGDVRGDISVNFSCDPDISSKLVDF  827

Query  2623  ALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSF  2802
              L+EI  LQ +GPS+EDV T+LEIEQRAHENGLQEN +WLDRILRSYQSR++SGD+G +F
Sbjct  828   VLEEISYLQVEGPSEEDVLTILEIEQRAHENGLQENYFWLDRILRSYQSRLFSGDIGSTF  887

Query  2803  KVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKR  2982
               Q+E R KVR  LTP T Q ALQR++PFPC+ QYTVVILMP++S    +KS++      
Sbjct  888   AFQEEGRIKVRDALTPQTMQSALQRVIPFPCRNQYTVVILMPKSSCWASVKSMLSWTSNG  947

Query  2983  YCTDAKIlagtagvavllltlWRYSRSSLKS  3075
                DAKILAG AG  VL ++LWRYSRS+LKS
Sbjct  948   VSRDAKILAGMAGALVLAVSLWRYSRSALKS  978



>ref|XP_004157955.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc protease PqqL-like 
[Cucumis sativus]
Length=927

 Score =  1479 bits (3830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/935 (78%), Positives = 813/935 (87%), Gaps = 34/935 (4%)
 Frame = +1

Query  259   SVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF  438
             SVLEEE+ERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNA TSAD+TVYELF
Sbjct  18    SVLEEEDERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAATSADDTVYELF  77

Query  439   VPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMM  618
             VP+DKP LLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA GRMQDAHW LMM
Sbjct  78    VPVDKPGLLSQAISILAEFSSEIRVSQDDLEKERGAVMEEYRGNRNATGRMQDAHWALMM  137

Query  619   EGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHF  798
             EGSKYA+RLPIGLEKVI+TVS + VK+FY+KWY L NMAVIAVGDF DT+SVVE+IK HF
Sbjct  138   EGSKYADRLPIGLEKVIKTVSAETVKKFYRKWYDLHNMAVIAVGDFSDTESVVEMIKEHF  197

Query  799   GYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLA  978
             G+  S  +PP +P + +PS EEPRFSCFVESEAAGSAVMIS KMP DELKTV+DYR+LL 
Sbjct  198   GHIQSACEPPHVPTFPIPSREEPRFSCFVESEAAGSAVMISYKMPADELKTVRDYRNLLV  257

Query  979   ESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLT  1158
             ESMF  ALNQRFFKISR KDPP++ CSAAAD    PV                       
Sbjct  258   ESMFLQALNQRFFKISRGKDPPFFXCSAAAD----PV-----------------------  290

Query  1159  EVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEY  1338
              VARVRLHGFSEREIS+VRALLMSEIESAYLERDQMQST+LRDEYLQHFLRNEPV+GIEY
Sbjct  291   -VARVRLHGFSEREISIVRALLMSEIESAYLERDQMQSTNLRDEYLQHFLRNEPVVGIEY  349

Query  1339  EAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQ  1518
             EAQLQKTLLPHISA+EVSKYS +  +  SCVIK IEPRA+AT+DDL++VV+ I   E+++
Sbjct  350   EAQLQKTLLPHISATEVSKYSAKLTSLCSCVIKIIEPRASATIDDLKNVVMNITCLEKER  409

Query  1519  SIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLF  1698
              I PWDEENIPEEIVS  P+PG I+QQ EY N+GA E  LSNGMRVCYKCT+FLDDQV+F
Sbjct  410   GITPWDEENIPEEIVSTMPNPGNIVQQKEYPNIGATEIFLSNGMRVCYKCTDFLDDQVIF  469

Query  1699  TGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRS  1878
             TGFSYG LSELPE EY SCSMGSTIAGEIGVFGYRPSVLMD+LAGKRAEVGTKLGAYMR+
Sbjct  470   TGFSYGALSELPEREYSSCSMGSTIAGEIGVFGYRPSVLMDILAGKRAEVGTKLGAYMRT  529

Query  1879  FSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE  2058
             FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQMAEEA+ AQERDPYTAFANRV+E
Sbjct  530   FSGDCSPSDLETALQLVYQLFTTNVIPGEEDVKIVMQMAEEAVRAQERDPYTAFANRVKE  589

Query  2059  LNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYL  2238
             LNYGNSYFFRPIR+ DL+KVNP +ACEYFN CF+DPS FTVV+VGNI+P+ A PLI QYL
Sbjct  590   LNYGNSYFFRPIRLSDLKKVNPQRACEYFNKCFRDPSNFTVVVVGNINPSIALPLIQQYL  649

Query  2239  GGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMME  2418
             GGIP+P EPI++FNRDDLKGLPFKFP+SI+REVV+SPMVEAQCSVQLCFPVEL +  M+E
Sbjct  650   GGIPKPPEPIMNFNRDDLKGLPFKFPTSIVREVVYSPMVEAQCSVQLCFPVELTNGTMVE  709

Query  2419  DVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPD  2598
             ++H+VGFLSKLLET+++QVLRFK+GQIY+AGVSVFLGGNKPSR+G +RGDI INFSCDP+
Sbjct  710   EIHYVGFLSKLLETRMIQVLRFKHGQIYSAGVSVFLGGNKPSRIGPVRGDISINFSCDPE  769

Query  2599  ISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIY  2778
             ISS LVDLAL+EILRLQE+GP+D+DVS++LEIEQRAHENGLQEN YWLDRILRSYQSRIY
Sbjct  770   ISSKLVDLALNEILRLQEEGPTDQDVSSILEIEQRAHENGLQENYYWLDRILRSYQSRIY  829

Query  2779  SGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKS  2958
             SGDVG SF++QDE R  VR  LTPLTAQ+ALQRILPFPC KQYT VIL+P + R ++LKS
Sbjct  830   SGDVGSSFEIQDEGRLNVRNSLTPLTAQLALQRILPFPCTKQYTAVILLPASYRFRKLKS  889

Query  2959  LV---CSAPKRYCTDAKIlagtagvavllltlWRY  3054
              +    S P R   D+KIL G A VAVL  +LWRY
Sbjct  890   FLRLGLSNPGR---DSKILVGLASVAVLTFSLWRY  921



>ref|XP_010667310.1| PREDICTED: uncharacterized protein LOC104884367 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=961

 Score =  1477 bits (3824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/929 (75%), Positives = 816/929 (88%), Gaps = 4/929 (0%)
 Frame = +1

Query  283   RGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPEL  462
             RGVAHIVEHLAF+AT KYTNHDIVKFLESIGAEFGACQNA+TSAD+TVYELFVP+DKPEL
Sbjct  33    RGVAHIVEHLAFNATTKYTNHDIVKFLESIGAEFGACQNAMTSADDTVYELFVPVDKPEL  92

Query  463   LSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAER  642
             LS+AIS+LAEFS+E+R S  DLEKERGAVMEEYRGSRNANGRMQD+HW LMM GSKYAER
Sbjct  93    LSEAISVLAEFSTEIRVSAEDLEKERGAVMEEYRGSRNANGRMQDSHWALMMGGSKYAER  152

Query  643   LPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppd  822
             LPIG EKVIRTVS   VKQFYKKWYHL++MA+IAVGDFP T+SVVELI+ HFG K+S  +
Sbjct  153   LPIGTEKVIRTVSAATVKQFYKKWYHLQHMALIAVGDFPSTESVVELIRMHFGQKSSALE  212

Query  823   pppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHAL  1002
             P  +P++ VPSH+EPRFSCF+ESEAAGSAVMISCKMP  +LKT+KDYRDLL ESMF  AL
Sbjct  213   PVNLPHFPVPSHDEPRFSCFIESEAAGSAVMISCKMPARQLKTIKDYRDLLVESMFLQAL  272

Query  1003  NQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLH  1182
             NQR FK+SR++DPP+YSCSAAAD LV P+KAYIMTSSCKE GT+EALE+M+ E+AR+ LH
Sbjct  273   NQRLFKVSRRRDPPFYSCSAAADDLVSPIKAYIMTSSCKESGTIEALEAMVMELARIHLH  332

Query  1183  GFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTL  1362
             GFS+REIS+VRALL+SEIESAYLERDQ+QSTSLRDEY+QHFL NEPV+GIE+EAQLQKTL
Sbjct  333   GFSDREISIVRALLLSEIESAYLERDQIQSTSLRDEYVQHFLCNEPVVGIEFEAQLQKTL  392

Query  1363  LPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEE  1542
             LP ISA+EV+ ++++F T+S+CVIK IEP+AT T+D+L++ V K+   E+ + IP WDEE
Sbjct  393   LPSISATEVATFAQKFCTTSNCVIKAIEPQATVTLDELKNAVSKVTCLEEGRRIPAWDEE  452

Query  1543  NIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGL  1722
              IPE+IV+++P+ G I Q  EY ++ A E  LSNGMRVCYKCT+FLDDQVL +G+SYGGL
Sbjct  453   QIPEDIVAIEPNSGSIDQLQEYSDIKATELILSNGMRVCYKCTDFLDDQVLISGYSYGGL  512

Query  1723  SELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPS  1902
             SEL E++YFSCSMGSTIAGEIG+FG++PS+LMDMLAGKRAEVGTKLG YMR+FS DCSP+
Sbjct  513   SELSETDYFSCSMGSTIAGEIGIFGHKPSLLMDMLAGKRAEVGTKLGPYMRTFSADCSPT  572

Query  1903  DLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYF  2082
             DLETALQLVYQLF TNVEP EE+   VM+MAEEA+ AQERDPYTAFANRVRE+NYGNSYF
Sbjct  573   DLETALQLVYQLFMTNVEPIEEEARKVMEMAEEAVRAQERDPYTAFANRVREINYGNSYF  632

Query  2083  FRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSE  2262
             FRPIRI DL+KV+ +KAC+YF+NCFKDPSTFTVVIVGNIDPA A PLILQYLGGIP+P  
Sbjct  633   FRPIRISDLKKVDAFKACKYFSNCFKDPSTFTVVIVGNIDPAIASPLILQYLGGIPKPPT  692

Query  2263  PILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFL  2442
             PIL FNRDDLKGLPF  P  IIRE+V  PMVEAQCSVQLCFPVELK+  M+E++HFVGFL
Sbjct  693   PILQFNRDDLKGLPFTLPDKIIREIVRRPMVEAQCSVQLCFPVELKNGAMIEEIHFVGFL  752

Query  2443  SKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDL  2622
             SKLLETK++QVLRFK+GQIY+AGVSVFLGGNKPSR G++RGDI INFSCDP +SSTLVDL
Sbjct  753   SKLLETKMMQVLRFKHGQIYSAGVSVFLGGNKPSRTGDVRGDISINFSCDPSMSSTLVDL  812

Query  2623  ALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSF  2802
             ALDEIL LQ++GP+DED+S++LEIEQRAHENGLQEN YWLDRILRSYQSR+YSGD+G SF
Sbjct  813   ALDEILHLQKEGPTDEDISSILEIEQRAHENGLQENYYWLDRILRSYQSRVYSGDLGSSF  872

Query  2803  KVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKR  2982
             ++QDEAR KVR  LTP   + ALQRILP PC K+YTVVILMPQA R K L S      + 
Sbjct  873   QIQDEARVKVRASLTPTATKSALQRILPLPCSKKYTVVILMPQAKRCKLLNSCFWETFQ-  931

Query  2983  YCTDAKIlagtagvavllltlWRYSRSSL  3069
                + K+L G AG+ +L +TLWRYSRSS+
Sbjct  932   ---NTKVLIGIAGLTILTVTLWRYSRSSI  957



>ref|XP_004503524.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc protease PqqL-like 
[Cicer arietinum]
Length=963

 Score =  1473 bits (3814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 730/1006 (73%), Positives = 837/1006 (83%), Gaps = 52/1006 (5%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLP+E++  + +K  F+SLKLV+ +M++ L+  P GVD+G LDNGL YYVR NSKP+M
Sbjct  1     MELLPSEAAATIFRKQGFQSLKLVHADMDQLLTDLPVGVDFGTLDNGLRYYVRCNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT++Y NHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKRYDNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             T++D+TVYEL VP+DKPELLSQAIS+LAEFSSE+R S+ DL+KERGAVMEEYRGSRNA G
Sbjct  121   TTSDDTVYELLVPVDKPELLSQAISVLAEFSSEIRVSKDDLKKERGAVMEEYRGSRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW+L+MEGSKYAERLPIGLE VIRTVSP+ V+ FY KWYHL NMAVIAVGDF DT
Sbjct  181   RLQDAHWMLLMEGSKYAERLPIGLEAVIRTVSPETVRHFYNKWYHLCNMAVIAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HFG K   PDPPP+P + VPSH+EPRFSCFVESEAAGSAVMIS KMP +EL
Sbjct  241   QSVVELIKTHFGQKVPAPDPPPVPTFQVPSHDEPRFSCFVESEAAGSAVMISYKMPANEL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+DLLAESMF +ALNQRFFKISR+KDPPY+SCSA+AD LV               
Sbjct  301   KTVKDYKDLLAESMFLYALNQRFFKISRRKDPPYFSCSASADVLV---------------  345

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                          ARVRLHGFSE EIS+VRALLMSEIESAYLERDQ+QSTSLR+EYLQHF
Sbjct  346   -------------ARVRLHGFSEHEISIVRALLMSEIESAYLERDQIQSTSLREEYLQHF  392

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHISA EVSK SE+  TS SCVIKTIEPRA A  DDL++V
Sbjct  393   LHNEPVVGIEYEAQLQKTLLPHISALEVSKCSEKLRTSCSCVIKTIEPRAFAVFDDLKNV  452

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E+   I PWD+E++P EIV+ KP+ G ++++ EY N+GA E  LSNGMRVCYK
Sbjct  453   VKKVNLLEEGGRISPWDDEHVPAEIVTAKPNMGHVVKELEYSNIGATELILSNGMRVCYK  512

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+FLDDQV+FTG+SYGGLS+LPESEYFSCSMG TIAGEIGVFGYRPSVLMDMLA     
Sbjct  513   RTDFLDDQVIFTGYSYGGLSQLPESEYFSCSMGPTIAGEIGVFGYRPSVLMDMLA-----  567

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
                                DLET LQLVYQLFTTN+ P EEDV IVMQMAEE++ AQ+RD
Sbjct  568   -------------------DLETGLQLVYQLFTTNLTPNEEDVKIVMQMAEESVCAQDRD  608

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRV+ELNYG SYFFRPI+  DLQKV+P KACEYF+ CF+DP TFTVVIVGNIDP
Sbjct  609   PYTAFTNRVKELNYGKSYFFRPIKKCDLQKVDPLKACEYFSKCFRDPXTFTVVIVGNIDP  668

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PL+LQYLGGIP+P EPI+ FNRD+LKGLPF FP+ I REVV SPMVEAQC VQ+CF
Sbjct  669   TIALPLMLQYLGGIPKPPEPIMDFNRDELKGLPFTFPTVIHREVVRSPMVEAQCLVQICF  728

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELKS  M+E+VHFVGFLSKLLETKI+QVLRFK+GQIY+ GVSVFLGGNKPS+   +RG
Sbjct  729   PVELKSRTMVEEVHFVGFLSKLLETKIMQVLRFKHGQIYSVGVSVFLGGNKPSKTRVVRG  788

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+ISS LVD+ALDE+LRLQ++GPS++DVSTVLEIEQRAHENGLQEN YWLD
Sbjct  789   DISINFSCDPEISSKLVDIALDEMLRLQKEGPSEQDVSTVLEIEQRAHENGLQENYYWLD  848

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSR+YSGD G SF++QDE R KV+  LTP TAQ+ALQRILP+PCKKQYTVVILM
Sbjct  849   RILHSYQSRVYSGDAGTSFEIQDEGRLKVKSSLTPSTAQLALQRILPYPCKKQYTVVILM  908

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRS  3063
             P++S  K LKS++ S       +AKILAG AG+ VL L++WR+SRS
Sbjct  909   PKSSPFKFLKSVLQSTRTNCGREAKILAGIAGLTVLALSVWRHSRS  954



>gb|KCW82272.1| hypothetical protein EUGRSUZ_C03689 [Eucalyptus grandis]
Length=906

 Score =  1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/905 (77%), Positives = 794/905 (88%), Gaps = 0/905 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLPAE+SQ L +KH FRSLKL  V+M +AL   P+G +YGRL NGL YYVR NSKP+M
Sbjct  1     MDLLPAETSQQLGRKHGFRSLKLAAVDMADALGDQPFGTEYGRLPNGLAYYVRPNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALAL V+ GSVLEE++E GVAHI+EHLAFSAT +YTNHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALVVKVGSVLEEDDELGVAHIIEHLAFSATNRYTNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+T+YELFVP+DKPELLSQAISILAEFSSEVR S+ DLEKERGAV+EEYR +RNA G
Sbjct  121   TSSDQTIYELFVPVDKPELLSQAISILAEFSSEVRVSKDDLEKERGAVLEEYRSNRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+L+MEGSKYAERLPIG E VIRTVS + VKQFY+KWY L +MAVIAVGDFPDT
Sbjct  181   RMQDAHWLLLMEGSKYAERLPIGTEAVIRTVSAETVKQFYQKWYQLCHMAVIAVGDFPDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVV++IK HFG K + PD  PIP Y VPSH+EPRFS FVE EAAGS +MIS KMP D+L
Sbjct  241   QSVVDMIKTHFGQKGAVPDLQPIPTYSVPSHDEPRFSYFVEREAAGSFIMISYKMPADDL  300

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDY+DLL ES+F HALNQRFFK SR+ DPPY+SCSA +D LVRP+KAY++T+SCKE 
Sbjct  301   KTVKDYKDLLTESVFLHALNQRFFKQSRRNDPPYFSCSADSDVLVRPLKAYVITASCKEG  360

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARVR+HGFSEREIS+VRALL+SEIESAYLERDQMQSTSLRDE +QHF
Sbjct  361   GTMEALESMLTEVARVRIHGFSEREISIVRALLLSEIESAYLERDQMQSTSLRDELIQHF  420

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             LR EPVIGIEYEAQLQKT+LPHIS+ +VSKY+E+  TSSSCVIK IEP+ +A VDDLRSV
Sbjct  421   LRGEPVIGIEYEAQLQKTILPHISSLDVSKYAEKLLTSSSCVIKAIEPQVSAKVDDLRSV  480

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLK+N  E+ + IPPWDEE IPEEIV +KP+PG+I QQ EY N+GA E  LSNGMRVCYK
Sbjct  481   VLKVNFLEEAKQIPPWDEELIPEEIVPLKPNPGYITQQLEYSNIGATELILSNGMRVCYK  540

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQVLFTGFSYGGLSE+ E+EYFSCSMGSTIAGEIGV+GYRPSV MDMLAGKRAE
Sbjct  541   CTDFLDDQVLFTGFSYGGLSEVSENEYFSCSMGSTIAGEIGVYGYRPSVQMDMLAGKRAE  600

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMRSFSGDCSPSDLETALQLVYQLF T+VEPGEEDV IVMQMAE A+ AQERD
Sbjct  601   VGTKIGAYMRSFSGDCSPSDLETALQLVYQLFATSVEPGEEDVKIVMQMAEAAVRAQERD  660

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAF NRVRELNYGNSYFFRPI+  DL++V+P +ACEYF+ CFKDPSTFTVVIVG+I P
Sbjct  661   PYTAFVNRVRELNYGNSYFFRPIKTSDLKRVDPRRACEYFSRCFKDPSTFTVVIVGSISP  720

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIPRP EPIL ++RDDLKGLP   P+ I+REVV SPMV+AQCSVQ+CF
Sbjct  721   TIAVPLILQYLGGIPRPPEPILRYSRDDLKGLPVTSPTKIVREVVRSPMVQAQCSVQICF  780

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PVELK+  M+E++H +GFLSKLLETK++QVLRFK+GQIY+ GV+VFLG N+PSR G++RG
Sbjct  781   PVELKNGTMVEEIHSIGFLSKLLETKLMQVLRFKHGQIYSTGVTVFLGSNRPSRTGDVRG  840

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI INFSCDP+IS  LVDL LDEI RLQE GPS+EDV T+LEIEQRAHE+G+Q       
Sbjct  841   DISINFSCDPEISLKLVDLTLDEIQRLQEQGPSEEDVLTILEIEQRAHEDGVQVKVKLFL  900

Query  2746  RILRS  2760
              IL S
Sbjct  901   EILHS  905



>ref|NP_200484.1| Insulinase (peptidase family M16) protein [Arabidopsis thaliana]
 dbj|BAB09891.1| zinc protease PQQL-like protein [Arabidopsis thaliana]
 gb|AED96801.1| Insulinase (peptidase family M16) protein [Arabidopsis thaliana]
Length=956

 Score =  1450 bits (3753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/1008 (71%), Positives = 828/1008 (82%), Gaps = 56/1008 (6%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQT--PYGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L +K  FRSLKL++V+ME+ L     P+G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKVL-RKQGFRSLKLMSVDMEQELGNELEPFGADYGRLDNGLIYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESIGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLEKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMPV 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPVS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD L              
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVL--------------  345

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
                           VARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  346   --------------VARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  391

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+VS+YSE+  TS  CVIK++EP++ AT+D +R
Sbjct  392   HFLHKEPVIGIEYEAQLQKTLLPQISASDVSRYSEKLRTSCGCVIKSMEPKSAATIDHMR  451

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E+++ I PWDEENIPEEIVS KP+PG I  Q EY  VG  E  LSNGM+VC
Sbjct  452   NVVSKVNSLEEEKMIAPWDEENIPEEIVSEKPTPGDITHQLEYPEVGVTELTLSNGMQVC  511

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PSVLMDMLA   
Sbjct  512   YKSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSVLMDMLA---  568

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
                                  DLETALQLVYQLFTTNV P EE+V IVMQMAEE++ A+E
Sbjct  569   ---------------------DLETALQLVYQLFTTNVMPQEEEVGIVMQMAEESVRARE  607

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  608   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNL  667

Query  2200  DPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQL  2379
             DP  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I +E V SPMVEAQCSVQL
Sbjct  668   DPTIALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITKEFVRSPMVEAQCSVQL  727

Query  2380  CFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI  2559
             CFPV+L +  M+E++H +GFL KLLETKI+Q LRF++GQIY+A VSVFLGGNKPSR  ++
Sbjct  728   CFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFEHGQIYSAEVSVFLGGNKPSRTADL  787

Query  2560  RGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             RGDI +NFSCDP+ISS LVDLAL+EI+RLQ++GPS ED+S +LEIEQRAHENG+QEN YW
Sbjct  788   RGDISVNFSCDPEISSKLVDLALEEIVRLQKEGPSQEDISAILEIEQRAHENGMQENYYW  847

Query  2740  LDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVI  2919
             LDRI+R YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VI
Sbjct  848   LDRIIRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVI  907

Query  2920  LMPQASRMKRLKSLVCS-APKRYCTDAKIlagtagvavllltlWRYSR  3060
             LMPQ SR   L S+  S +   Y  D KILAG AG+ V++  +WRYSR
Sbjct  908   LMPQRSRFGFLSSIFSSRSEGPYIRDTKILAGIAGLGVVVFGIWRYSR  955



>gb|KHG23944.1| putative zinc protease pqqL [Gossypium arboreum]
Length=872

 Score =  1449 bits (3750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/921 (77%), Positives = 789/921 (86%), Gaps = 55/921 (6%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP ++SQ + KKH FRSLKLVNV++++     P+GVDYGRLDNGLTYYVRSN KP++
Sbjct  1     MDLLPIDNSQ-IAKKHGFRSLKLVNVDLDQEFQHQPFGVDYGRLDNGLTYYVRSNPKPRL  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE ERGVAHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGACQNAV
Sbjct  60    RAALALAVKVGSVLEEEGERGVAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TSAD+TVYELFVPID+PELLSQAIS+LAEFSSE+R S+ DLEKERGAVMEEYRG+RNA+G
Sbjct  120   TSADDTVYELFVPIDRPELLSQAISVLAEFSSEIRVSKDDLEKERGAVMEEYRGNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW LMMEGSKYAERLPIGLEKVIRTVS + VKQFYKKWYHL NMAVIAVGDFPDT
Sbjct  180   RMQDAHWALMMEGSKYAERLPIGLEKVIRTVSSETVKQFYKKWYHLHNMAVIAVGDFPDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SVVELI+ HF  K S PDPP IP + VPSHE+PRFSCFVESEAAGSAVMIS KMP DEL
Sbjct  240   ESVVELIRTHFEGKNSGPDPPIIPSFPVPSHEDPRFSCFVESEAAGSAVMISYKMPADEL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
              TVKDYRD+L ESMF HALNQRFFKISR+KDPPY+SCSAA+D LV P+KAYIM+S+CKEK
Sbjct  300   NTVKDYRDMLVESMFLHALNQRFFKISRRKDPPYFSCSAASDALVSPLKAYIMSSTCKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT++ALESML EVARVRLHGFSERE+SVVRALLMSEIESAYLERDQMQSTSLRDEY+QHF
Sbjct  360   GTLQALESMLIEVARVRLHGFSEREVSVVRALLMSEIESAYLERDQMQSTSLRDEYIQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             + NEPVI               ISASEVSKY+E+  TS SCV+KTIEP+A+ATVDDL+ V
Sbjct  420   IHNEPVI--------------DISASEVSKYAEKLQTSCSCVLKTIEPQASATVDDLKKV  465

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLKIN  E++ SI PWD+E IPEEIV++KP PG+I++Q EY N+GA E  LSNGMR    
Sbjct  466   VLKINNLEKEGSIAPWDDEYIPEEIVNIKPDPGYIVEQIEYSNIGATELTLSNGMR----  521

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
                     VLFTGFSYGGLSELPES+YFSCSMGSTIAGEIGVFG++PSVLM+MLAGKR E
Sbjct  522   --------VLFTGFSYGGLSELPESDYFSCSMGSTIAGEIGVFGHKPSVLMEMLAGKRVE  573

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEE+V IVMQMAEEA+ AQERD
Sbjct  574   VGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVIPGEEEVKIVMQMAEEAVRAQERD  633

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANRV+E+NYGNSYFFRPIR+ DL+KV+P KACEYFN CFKDPSTFTVVI GNIDP
Sbjct  634   PYTAFANRVKEINYGNSYFFRPIRLSDLRKVDPVKACEYFNRCFKDPSTFTVVITGNIDP  693

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+  E I H+NRDDLKGLPFKFP +IIR+VV SPMVEAQCSVQLCF
Sbjct  694   TIALPLILQYLGGIPKSPEAIFHYNRDDLKGLPFKFPKTIIRDVVRSPMVEAQCSVQLCF  753

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV LK+  M                            IY+A VSVFLGGNKPSR G++RG
Sbjct  754   PVVLKNGTM----------------------------IYSACVSVFLGGNKPSRTGDVRG  785

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             D+ INFSCDP+ISS LVDLALDE++ LQE+GP+D+DVSTVLEIEQRAHENGLQEN YWL+
Sbjct  786   DVSINFSCDPEISSKLVDLALDEVVHLQEEGPTDQDVSTVLEIEQRAHENGLQENYYWLE  845

Query  2746  RILRSYQSRIYSGDVGDSFKV  2808
             RILRSYQSRIYSGDVG SFKV
Sbjct  846   RILRSYQSRIYSGDVGTSFKV  866



>ref|XP_002866163.1| peptidase M16 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42422.1| peptidase M16 family protein [Arabidopsis lyrata subsp. lyrata]
Length=957

 Score =  1446 bits (3742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1009 (71%), Positives = 826/1009 (82%), Gaps = 57/1009 (6%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS++L +K  FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKVL-RKQGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  59

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFG CQN
Sbjct  60    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESIGAEFGPCQN  119

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S  DLEKERGAVMEEYRG+RNA
Sbjct  120   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSNEDLEKERGAVMEEYRGNRNA  179

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  180   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  239

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMPV 
Sbjct  240   DTKTVVDLIKTHFEDKRSSSEPPEIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPVS  299

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD L              
Sbjct  300   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVL--------------  345

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
                           VARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  346   --------------VARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  391

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+VSKYSE+  TS  CVIK++EP++ AT+DD+R
Sbjct  392   HFLHKEPVIGIEYEAQLQKTLLPQISASDVSKYSEKLRTSCGCVIKSMEPKSAATIDDMR  451

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVC  1659
             +VV K+N+ E+++ I PWDEE IPEE+VS KP+PG+I  Q EY  VG  E  LSNGM+VC
Sbjct  452   NVVSKVNSLEEEKMIAPWDEEKIPEEVVSEKPTPGYITHQLEYPEVGVTELTLSNGMQVC  511

Query  1660  YKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKR  1839
             YK T+FLDDQ+LFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLA   
Sbjct  512   YKSTDFLDDQILFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLA---  568

Query  1840  AEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQE  2019
                                  DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+E
Sbjct  569   ---------------------DLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARE  607

Query  2020  RDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNI  2199
             RDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+
Sbjct  608   RDPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNL  667

Query  2200  DPATAFPLILQYL-GGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQ  2376
             DP  A PLILQYL  GIP+P +P+L+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQ
Sbjct  668   DPTIALPLILQYLVSGIPKPPQPVLNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQ  727

Query  2377  LCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGN  2556
             LCFPV+L +  M+E++H +GFL KLLETKI+Q LRF++GQIY+A VSVFLGGNKPSR  +
Sbjct  728   LCFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFEHGQIYSAEVSVFLGGNKPSRTAD  787

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
             +RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN Y
Sbjct  788   LRGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYY  847

Query  2737  WLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVV  2916
             WLDRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP P KKQYT V
Sbjct  848   WLDRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPSKKQYTAV  907

Query  2917  ILMPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             ILMPQ SR   L S+  S  +  Y  D KILAG AG+ VL+  +WRYSR
Sbjct  908   ILMPQRSRFGFLPSIFSSRSETPYIRDTKILAGVAGLGVLVFGIWRYSR  956



>ref|XP_007012923.1| Mitochondrial-processing peptidase subunit beta, mitochondrial, 
putative [Theobroma cacao]
 gb|EOY30542.1| Mitochondrial-processing peptidase subunit beta, mitochondrial, 
putative [Theobroma cacao]
Length=1002

 Score =  1442 bits (3734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/1007 (71%), Positives = 840/1007 (83%), Gaps = 5/1007 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M  L AE S    K   FRSL+L+N+++ + ++Q P+GVDYGRLDNGL YYVR N KP+ 
Sbjct  1     MGSLLAEKSS-FAKMQSFRSLELLNLSLIQEVNQQPFGVDYGRLDNGLVYYVRCNPKPRT  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE ERGVAHIVEHLAFSAT+KYTNH+IVKFLESIGAEFG C NA+
Sbjct  60    RAALALAVKVGSVLEEENERGVAHIVEHLAFSATKKYTNHNIVKFLESIGAEFGPCHNAL  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             T  DETVYELF+PIDKPELLS+AI +LAEFSSE+R S+ DLEKERGAVMEEYRG RNA+G
Sbjct  120   TYFDETVYELFIPIDKPELLSEAILVLAEFSSEIRLSKEDLEKERGAVMEEYRGGRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R++DAHW LMMEGSKYAERLPIGLEKVI+ VS + +KQFY+KWYHL+NMAVIAVGDFP T
Sbjct  180   RIEDAHWALMMEGSKYAERLPIGLEKVIQMVSSETLKQFYQKWYHLQNMAVIAVGDFPGT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             + VVELI+ HFG+KTS PD PPIP++ VPSHEEPRFS FVE EAAGS+VMIS KM   +L
Sbjct  240   KGVVELIRTHFGHKTSMPDLPPIPHFPVPSHEEPRFSYFVEPEAAGSSVMISYKMQAGQL  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KT+KDYRD+L ESMF  ALNQRFFKIS++KDPPY+SCSAA D LVR  KAY+MTS  KEK
Sbjct  300   KTIKDYRDMLVESMFEKALNQRFFKISKRKDPPYFSCSAATDYLVRQSKAYMMTSYSKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARVRLHGFSEREISVVRALL+S IESAYLERDQM+ST+LR+EY+QHF
Sbjct  360   GTLEALESMLTEVARVRLHGFSEREISVVRALLLSSIESAYLERDQMESTNLRNEYVQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             + ++PV+GIEYEAQLQKT+LPHISASEVSKY+E+  TS SCVIK +EP+A+A ++DL+ V
Sbjct  420   IHDKPVVGIEYEAQLQKTILPHISASEVSKYAEKLWTSCSCVIKIVEPQASAKINDLKKV  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V+KIN  E+++SI PWDEE++PEEIV+ KP+ G I+Q+ EY N+GA E  LSNGMRVCYK
Sbjct  480   VMKINKLEKERSITPWDEEDVPEEIVNSKPNAGNILQRLEYSNIGATELILSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+F DD+VLF+GFSYGGLSELP+S+YFS  MGS IAGE+G+FG+RPSVLMDMLAGKR  
Sbjct  540   CTDFSDDEVLFSGFSYGGLSELPKSKYFSSLMGSRIAGEVGMFGHRPSVLMDMLAGKRVG  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             V   +G YMR+F G CSP  LETALQLVYQLFTT+V P EE V  VMQ+ +EA+ AQERD
Sbjct  600   VDVDVGKYMRTFHGYCSPLSLETALQLVYQLFTTDVTPVEEVVKRVMQVEKEAVLAQERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             P+TAF NRV E+NYGNSYFF+PIRI +L+KV+P KACEYFN+CFKDPSTF+VVIVGNID 
Sbjct  660   PFTAFTNRVIEINYGNSYFFKPIRISNLRKVDPLKACEYFNSCFKDPSTFSVVIVGNIDT  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIP+P EPI H N D +K L F +P++I REVVHSPMVEAQC V +C 
Sbjct  720   TVALPLILQYLGGIPKPPEPIFHSNSDYIKELRFAYPTTIAREVVHSPMVEAQCGVHVCI  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             P+ELK   M+E++ ++ FL KLL+ KI+Q+LRFK+GQIY A V  FL G  P    ++RG
Sbjct  780   PIELKKGTMVEEIQYIEFLKKLLDNKILQLLRFKHGQIYGASVYDFLDGYLPCIATDVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI I FSCDP I+S LVDLALDEILRLQE+GPSD+DVST+LEIEQRAHENGLQEN YWL+
Sbjct  840   DISIYFSCDPKIASKLVDLALDEILRLQEEGPSDQDVSTILEIEQRAHENGLQENGYWLE  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSRIYSGDVG SFK+ DE RSKVR+ LTPLT Q+ALQRI+PF  K Q+TVVIL 
Sbjct  900   RILYSYQSRIYSGDVGASFKILDEGRSKVRESLTPLTIQLALQRIVPF--KNQHTVVILK  957

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             PQ S  K L S+    P  +  DAKILAG AG  VL LT  RYS  S
Sbjct  958   PQLSWFKWLGSISQWTP--HGRDAKILAGIAGFTVLALTFRRYSHRS  1002



>ref|XP_007012922.1| Mitochondrial-processing peptidase subunit beta, mitochondrial, 
putative [Theobroma cacao]
 gb|EOY30541.1| Mitochondrial-processing peptidase subunit beta, mitochondrial, 
putative [Theobroma cacao]
Length=1002

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/1007 (71%), Positives = 848/1007 (84%), Gaps = 5/1007 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M LL A+SSQ   K+  FR+L++V+++M++   Q P+GVDYGRL+NGL YYV+ NSKPK 
Sbjct  1     MPLLSADSSQT-TKRQSFRTLEMVSMDMDKEFDQQPFGVDYGRLENGLVYYVKCNSKPKK  59

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEE+ERGVAHIVEHLAFSAT+KYTNH+IVKFLESIGAEFG CQNAV
Sbjct  60    RAALALAVKVGSVLEEEDERGVAHIVEHLAFSATKKYTNHNIVKFLESIGAEFGPCQNAV  119

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS DETVY+L VPIDKPELLS+AI +L+EFSSE+R S+ DLEKERGAVMEEYR +RNA+G
Sbjct  120   TSFDETVYKLLVPIDKPELLSEAIQVLSEFSSEIRLSKDDLEKERGAVMEEYRDNRNASG  179

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+ DA+W LMMEGSKYAERLPIGLE VI+TVS Q +KQFY+KWYHL NMAVIAVGDF DT
Sbjct  180   RIFDAYWTLMMEGSKYAERLPIGLENVIKTVSSQTLKQFYQKWYHLCNMAVIAVGDFSDT  239

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             +SV+ELI+ HFG+K S  DPPPIP++L+PSHE+PRFS FVE EAAGSAV I  KM VDE+
Sbjct  240   KSVIELIRTHFGHKYSASDPPPIPHFLLPSHEDPRFSYFVEPEAAGSAVRIGYKMQVDEV  299

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR++L +SMF +ALN+RFFKISR+KDPPY+SCS AA  LV   KAYIMTSSCKEK
Sbjct  300   KTVKDYREMLVKSMFRNALNRRFFKISRRKDPPYFSCSIAAYVLVHESKAYIMTSSCKEK  359

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             G +EALESML EVARVRLHGFSEREISVVRAL+MS IESAYLERDQ++S+ LR EY QHF
Sbjct  360   GILEALESMLIEVARVRLHGFSEREISVVRALMMSRIESAYLERDQVESSCLRYEYSQHF  419

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
               N+P+IGIEYEAQLQK++LP I ASEVSK++E+  T  SCVI+ +EP+A+AT+DDL+++
Sbjct  420   TDNKPIIGIEYEAQLQKSILPDILASEVSKFAEKLWTPCSCVIQIVEPQASATIDDLKNI  479

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             + KIN  E+++SI PWD+E+IPEEIV+ KP+ G I+QQ E+ N+GA E  LSNGMRVCYK
Sbjct  480   LKKINKLEKERSISPWDDEHIPEEIVNSKPNTGNIVQQLEHLNIGATELILSNGMRVCYK  539

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+F +DQVLF+GFSYGGLSELPES+YFS SMGSTIA EIG+FG+RPSVLMDMLAGKR E
Sbjct  540   CTDFFNDQVLFSGFSYGGLSELPESKYFSSSMGSTIAEEIGMFGHRPSVLMDMLAGKRVE  599

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             V  ++ AY R+F GDCSP  LETALQLVYQLFTTNV P +E +  VMQ+ E+AI A+ERD
Sbjct  600   VDVEIRAYKRTFYGDCSPLYLETALQLVYQLFTTNVTPDDEVIKRVMQVKEQAILARERD  659

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYTAFANR RE+NYGNSYFFRP R  DLQKVNP KACEYFN+CFKDPSTFTVVIVGNIDP
Sbjct  660   PYTAFANRAREINYGNSYFFRPFRKSDLQKVNPLKACEYFNSCFKDPSTFTVVIVGNIDP  719

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGI +P+EPI  FN D +KGLPFKFP +I REVV SPMVEAQC V+LCF
Sbjct  720   TIALPLILQYLGGIQKPNEPIFPFNCDYIKGLPFKFPKTITREVVCSPMVEAQCMVRLCF  779

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             P ELK   M E++H++GFLS+LLETK++Q+LRFK+GQIY+A VS F+ G+ P   G++RG
Sbjct  780   PTELKRGKMEEEIHYIGFLSRLLETKLLQLLRFKHGQIYSASVSEFIDGDLPCVTGDVRG  839

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             DI I+FSCDP IS  LVDLAL EILRL+E+GPSD+DV+T+LEIEQRAHENGLQEN YWL 
Sbjct  840   DIRIDFSCDPKISLKLVDLALSEILRLREEGPSDQDVTTILEIEQRAHENGLQENYYWLS  899

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RIL SYQSRIY+GD+G SF++ DE RSKVRK LTPLT Q+ALQRI+P   K Q+TVVIL+
Sbjct  900   RILCSYQSRIYAGDIGTSFEILDEGRSKVRKSLTPLTMQLALQRIMPH--KNQHTVVILV  957

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             P  S  +RL+S   S       D KILA  AG+ VL L+L RYSR S
Sbjct  958   PHVSWFQRLRSF--SQWTLNGIDVKILAAIAGLTVLALSLQRYSRKS  1002



>ref|XP_010545332.1| PREDICTED: uncharacterized protein LOC104817747 isoform X2 [Tarenaya 
hassleriana]
Length=888

 Score =  1399 bits (3622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/887 (76%), Positives = 773/887 (87%), Gaps = 1/887 (0%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVP+DKPELLSQAISILAEFS EVR S+ DLEKERGAV+EEYRG+RNA+
Sbjct  1     MTTADETIYELFVPVDKPELLSQAISILAEFSCEVRVSKEDLEKERGAVLEEYRGTRNAS  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQDAHW LMM GSKYAERLPIGLEKVIR+VS + VKQFY+KWYHL NMAVIAVGDFPD
Sbjct  61    GRMQDAHWQLMMAGSKYAERLPIGLEKVIRSVSAETVKQFYQKWYHLCNMAVIAVGDFPD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             +++VV+LIK HF  KTS  +PP +P + +PSHEE RFSCFVESEAAGSAVMIS KMPV++
Sbjct  121   SKTVVDLIKVHFEGKTSSSEPPEMPIFPIPSHEETRFSCFVESEAAGSAVMISYKMPVND  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQRFFK+SRKKDPP++SCSAAAD LV P+KAYIM+SSCKE
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRFFKLSRKKDPPFFSCSAAADVLVSPLKAYIMSSSCKE  240

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT+ +LESML EVARVRLHGF EREIS+VRAL+MSEIESAYLERDQ+QSTSLRDEY+QH
Sbjct  241   KGTLASLESMLLEVARVRLHGFFEREISIVRALIMSEIESAYLERDQVQSTSLRDEYIQH  300

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL  EPV+GIE+EAQLQKTLLP I AS+VSKY+E+  TS  CVIKTIEPR++AT+DDLR+
Sbjct  301   FLHKEPVVGIEFEAQLQKTLLPQILASDVSKYAEKLKTSCGCVIKTIEPRSSATIDDLRN  360

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              V  IN  E+++ I PWD+E+IPEEI+SVKP PG I+ Q EY +VG  E  LSNGMRVCY
Sbjct  361   TVANINRLEEEKKIAPWDDEHIPEEIISVKPDPGNIIHQLEYPDVGVTELTLSNGMRVCY  420

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT++ DDQVLFTGFSYGGLSELPESEY SCSMGSTIAGEIG+FGY PSVLMDMLAGKR 
Sbjct  421   KCTDYFDDQVLFTGFSYGGLSELPESEYISCSMGSTIAGEIGIFGYSPSVLMDMLAGKRV  480

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTKLGAYMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ AQER
Sbjct  481   EVGTKLGAYMRTFSCDCSPTDLETALQLVYQLFTTNVIPQEEEVRIVMQMAEEAVRAQER  540

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+E+NYGNSYFFRPIRI DL+KV+P KACEYFN  F DPSTFTVVIVGN+D
Sbjct  541   DPYTVFANRVKEINYGNSYFFRPIRISDLRKVDPLKACEYFNRSFTDPSTFTVVIVGNVD  600

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I REVV SPMVEAQCSVQLC
Sbjct  601   PTMALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITREVVRSPMVEAQCSVQLC  660

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV+L +  M+E++H VGFLSKLLETKI+Q LRFK+GQIY+A VSVFLGGNKPSR   +R
Sbjct  661   FPVQLTNGTMIEEIHRVGFLSKLLETKIIQFLRFKHGQIYSAEVSVFLGGNKPSRTAEVR  720

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED++T+LEIEQRAHENGLQEN YWL
Sbjct  721   GDISVNFSCDPEISSKLVDLALNEIIRLQEEGPSQEDIATILEIEQRAHENGLQENYYWL  780

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             +RILR YQSR+Y+GD+G SFK+Q+E R ++R+ L P +AQ ALQRILPFPCKKQYT VIL
Sbjct  781   ERILRGYQSRVYAGDLGVSFKIQEEGRLRLRESLAPQSAQEALQRILPFPCKKQYTAVIL  840

Query  2923  MPQASRMKRLKSLVCSAPK-RYCTDAKIlagtagvavllltlWRYSR  3060
             MP+  R   L SL  S    R+  DAK+L G A +AV    LWRYSR
Sbjct  841   MPRKPRFGFLTSLFVSPESCRHGRDAKVLVGVAVLAVACFGLWRYSR  887



>ref|XP_011093678.1| PREDICTED: uncharacterized protein LOC105173585 isoform X2 [Sesamum 
indicum]
Length=829

 Score =  1399 bits (3621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/829 (82%), Positives = 749/829 (90%), Gaps = 0/829 (0%)
 Frame = +1

Query  589   MQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQ  768
             MQDAHWVLMMEGSKYA+RLPIGLEKVIRTVSP IVKQFYKKWYHL+NMA+IAVGDFPDTQ
Sbjct  1     MQDAHWVLMMEGSKYADRLPIGLEKVIRTVSPNIVKQFYKKWYHLQNMALIAVGDFPDTQ  60

Query  769   SVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELK  948
             SVVELIK HF  K    DPP IP + VPSH E RFS  VESEAAGSAVMISCK+PVDELK
Sbjct  61    SVVELIKTHFEDKIPVLDPPFIPRFTVPSHAESRFSSLVESEAAGSAVMISCKVPVDELK  120

Query  949   TVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKG  1128
             TVKDYR LLAESMFFHALNQRFFK+SRKKDPPY+SCSAAAD LVRP KAYIMTS+CK+KG
Sbjct  121   TVKDYRHLLAESMFFHALNQRFFKLSRKKDPPYFSCSAAADVLVRPTKAYIMTSACKQKG  180

Query  1129  TVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFL  1308
             T  ALESML EVARVR+HGFSEREIS+ RALLMSEIESAYLERDQMQST+LRDEY+QHFL
Sbjct  181   TTIALESMLIEVARVRMHGFSEREISISRALLMSEIESAYLERDQMQSTNLRDEYIQHFL  240

Query  1309  RNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVV  1488
             RNEPV+GIEYEAQL KTLLP+ISASEVSKYSE F TS +CVIKTIEP+A ATVDDLR+VV
Sbjct  241   RNEPVVGIEYEAQLHKTLLPYISASEVSKYSENFRTSCNCVIKTIEPQAAATVDDLRTVV  300

Query  1489  LKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKC  1668
              ++N+FE++ SI PWD+E+IPEEIVSV+P+PG ++QQFEY ++GA E  LSNGMRVCYKC
Sbjct  301   SRVNSFEEEGSISPWDDESIPEEIVSVEPNPGHVVQQFEYSSIGATELILSNGMRVCYKC  360

Query  1669  TNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEV  1848
             T+F DDQVLFTGFSYGGLSEL E EYFSCSMG TIAGEIGVFG+RPSVL DMLAGKRAEV
Sbjct  361   TDFFDDQVLFTGFSYGGLSELQECEYFSCSMGPTIAGEIGVFGHRPSVLSDMLAGKRAEV  420

Query  1849  GTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDP  2028
             GT LGAYMRSFSGDCSPSDLETALQLVYQLF TN+EPGEEDV IVMQMAEE++ AQERDP
Sbjct  421   GTSLGAYMRSFSGDCSPSDLETALQLVYQLFVTNLEPGEEDVKIVMQMAEESVRAQERDP  480

Query  2029  YTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPA  2208
             YTAFANRVRE+NYGNSYFFRPI+I DL+KV+P++ACEYFNNCFKDPSTFTVVIVGNIDPA
Sbjct  481   YTAFANRVREINYGNSYFFRPIKIGDLRKVDPFRACEYFNNCFKDPSTFTVVIVGNIDPA  540

Query  2209  TAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFP  2388
              A PLILQYLGGIPRP +PIL F RD+LKGLPF FPS++IRE+V SPMVEAQCSVQLCFP
Sbjct  541   IACPLILQYLGGIPRPPKPILSFKRDELKGLPFTFPSTVIREIVRSPMVEAQCSVQLCFP  600

Query  2389  VELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGD  2568
             VELK+E+MMEDVH  G +SKLLETKI+QVLRFK+GQIY+AGVSVFLGGN+PSRVGNIRGD
Sbjct  601   VELKNENMMEDVHLTGLISKLLETKILQVLRFKHGQIYSAGVSVFLGGNRPSRVGNIRGD  660

Query  2569  IGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDR  2748
             I +NFSCDP+ISSTLV+LALDEILRLQE+GPSD+DVST+LEIEQRAHENGLQEN YWL+R
Sbjct  661   ISVNFSCDPEISSTLVNLALDEILRLQEEGPSDDDVSTILEIEQRAHENGLQENYYWLER  720

Query  2749  ILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMP  2928
             ILRSYQSRIYS DVG SF++QDE RS+VR  LTPLTAQ ALQRI+PFPCK QYTVVILMP
Sbjct  721   ILRSYQSRIYSDDVGASFQIQDEGRSRVRSTLTPLTAQSALQRIIPFPCKNQYTVVILMP  780

Query  2929  QASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             Q+SR K LKS + S P  Y  DAKILAG   + VL+ +LWRYS+ + KS
Sbjct  781   QSSRFKMLKSFISSIPVPYSRDAKILAGIGAITVLVFSLWRYSQRAAKS  829



>ref|XP_010536848.1| PREDICTED: uncharacterized protein LOC104811734 isoform X2 [Tarenaya 
hassleriana]
Length=887

 Score =  1396 bits (3614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/886 (75%), Positives = 771/886 (87%), Gaps = 0/886 (0%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVPIDKPELLSQAISILAEFSSEVR S  DLEKERGAV+EE+RG+RNA+
Sbjct  1     MTTADETIYELFVPIDKPELLSQAISILAEFSSEVRVSREDLEKERGAVLEEFRGTRNAS  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GR+QDAHW LMM G+KYAERLPIGLEKVIR+V  + VK FY+KWYHL NMAVI VGDF D
Sbjct  61    GRLQDAHWQLMMAGTKYAERLPIGLEKVIRSVPAETVKHFYQKWYHLCNMAVIVVGDFSD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             T++VV+LIK HF  KTS      IP + +PSHEE RFSCFVESEAAGSAVMIS KMPV++
Sbjct  121   TKTVVDLIKMHFEGKTSRSKFLEIPVFPIPSHEETRFSCFVESEAAGSAVMISYKMPVND  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQRFFK+SRKKDPP++SCSAAAD LV P+KAYIM+SSCKE
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRFFKLSRKKDPPFFSCSAAADVLVSPLKAYIMSSSCKE  240

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KG + +LESML E+ARVRLHGFSEREIS+VRAL+MSEIESAYLERDQ+QSTSLRDEY+QH
Sbjct  241   KGALVSLESMLLEIARVRLHGFSEREISIVRALIMSEIESAYLERDQVQSTSLRDEYIQH  300

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL  EPVIGIE+EAQLQKTLLP I AS+VSKY+E+  TS  CVIK IEPR++AT+DDLR+
Sbjct  301   FLHKEPVIGIEFEAQLQKTLLPQILASDVSKYAEKLRTSCGCVIKIIEPRSSATIDDLRN  360

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV KI   E+++ I PWD+E+IPEEIVSVKP PG I+ Q EY  V A E  LSNGM+VCY
Sbjct  361   VVAKITRLEEEKKIAPWDDEHIPEEIVSVKPDPGHIVHQLEYPEVEATELTLSNGMQVCY  420

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT++ DDQ+LFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGYRPSVLMDMLAGKR 
Sbjct  421   KCTDYFDDQILFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYRPSVLMDMLAGKRV  480

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTKLGAYMR+FS DCSP+DLETALQLVYQLFTTNV+P EE+V +VMQMAEEA+ AQER
Sbjct  481   EVGTKLGAYMRTFSCDCSPTDLETALQLVYQLFTTNVKPQEEEVRLVMQMAEEAVCAQER  540

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+E+NYGNSYFFRPIRI DL+K++P KACEYFN+CF DPSTFTVVIVGN+D
Sbjct  541   DPYTVFANRVKEINYGNSYFFRPIRISDLRKIDPLKACEYFNSCFTDPSTFTVVIVGNVD  600

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ + REVV SPMVEAQCSVQLC
Sbjct  601   PTMALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKMTREVVRSPMVEAQCSVQLC  660

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV+L +  M+E++H VGFLSKL+ETKI+Q LRFK+GQIY+A VSVFLGGNKPSR  ++R
Sbjct  661   FPVQLTNGTMVEEIHSVGFLSKLIETKIIQFLRFKHGQIYSADVSVFLGGNKPSRTADVR  720

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDLALDEI+RLQE+GP+ ED+ST+LEIEQRAHE GLQEN YWL
Sbjct  721   GDISVNFSCDPEISSKLVDLALDEIVRLQEEGPTQEDISTILEIEQRAHETGLQENYYWL  780

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             +RILR YQSR+Y+GD+G S K+Q+E R ++R+ L+P TAQ ALQRILP+PCK QYT VIL
Sbjct  781   ERILRGYQSRVYAGDLGASLKIQEEGRLRLRESLSPQTAQGALQRILPYPCKNQYTAVIL  840

Query  2923  MPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSR  3060
             MP+ SR   L SL+ S   R+  DAK+L G A +AV+   LWRYSR
Sbjct  841   MPRNSRFGYLNSLLISPESRFVRDAKVLGGFAALAVVGFGLWRYSR  886



>ref|XP_010911834.1| PREDICTED: uncharacterized protein LOC105037879 isoform X5 [Elaeis 
guineensis]
Length=861

 Score =  1393 bits (3605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/843 (78%), Positives = 759/843 (90%), Gaps = 1/843 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             MDLLP E+  +  ++  FRSLKLV+V M+E L++ P GV YG LDNGLTYYVRSN KP+M
Sbjct  1     MDLLPTEAPSIGGRRQGFRSLKLVSVAMDEPLAEEPVGVVYGVLDNGLTYYVRSNPKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAV+ GSVLEEEEERGVAHIVEHLAFSAT+KYTNHDI+KFLESIGAEFGACQNA+
Sbjct  61    RAALALAVKVGSVLEEEEERGVAHIVEHLAFSATKKYTNHDIIKFLESIGAEFGACQNAL  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+DET+YEL VP+DKP+LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA G
Sbjct  121   TSSDETIYELLVPVDKPDLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RMQDAHW+LM EGSKYAERLPIGLEKVIRTV+P+ VKQFY+KWYHL+NMAV+AVGDF DT
Sbjct  181   RMQDAHWILMFEGSKYAERLPIGLEKVIRTVTPETVKQFYQKWYHLQNMAVVAVGDFSDT  240

Query  766   QSVVELIKAHFGYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             +SVVELI+AHFG K S   PPP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE
Sbjct  241   KSVVELIRAHFGQKVSISGPPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDE  300

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             ++TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY+SCS+AAD LVRP+KAYIMTSSC+E
Sbjct  301   MRTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFSCSSAADALVRPIKAYIMTSSCRE  360

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             +GT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQH
Sbjct  361   RGTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQH  420

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             F R EPV+GIEYEAQLQKTLLP+IS +EVSK++  F T+ SCVIK +EPRA AT++DL++
Sbjct  421   FFRKEPVVGIEYEAQLQKTLLPYISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKA  480

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
              VLK+N  E+++ I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CY
Sbjct  481   SVLKVNALEEEKKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICY  540

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             KCT+FLDDQV+FTGFSYGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRA
Sbjct  541   KCTDFLDDQVIFTGFSYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRA  600

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EVGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQER
Sbjct  601   EVGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQER  660

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YF++CFKDPSTFTVVIVGNID
Sbjct  661   DPYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFSDCFKDPSTFTVVIVGNID  720

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P+ + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL 
Sbjct  721   PSVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLA  780

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV LK+  MME++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++R
Sbjct  781   FPVVLKNMSMMEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRTGDVR  840

Query  2563  GDI  2571
             GDI
Sbjct  841   GDI  843



>ref|XP_010451413.1| PREDICTED: uncharacterized protein LOC104733533 isoform X2 [Camelina 
sativa]
Length=888

 Score =  1384 bits (3581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/887 (75%), Positives = 767/887 (86%), Gaps = 1/887 (0%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA 
Sbjct  1     MTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNAT  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFPD
Sbjct  61    GRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFPD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             T++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ +
Sbjct  121   TKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPISD  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCKE
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADALVSPLKAYIMSSSCKE  240

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+QH
Sbjct  241   KGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQH  300

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR+
Sbjct  301   FLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLRN  360

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N+ E+++ I PWDEE IPEE+VS KP+PG +  Q EY  VG  E  LSNGM+VCY
Sbjct  361   VVSKVNSLEEEKMIAPWDEEKIPEEVVSEKPTPGEVTHQLEYPEVGVTELTLSNGMQVCY  420

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             K T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR 
Sbjct  421   KSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKRV  480

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+ER
Sbjct  481   EVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARER  540

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+D
Sbjct  541   DPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNLD  600

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLILQYLGGIP+P +P+LHFNRDDLKGLPF FP+ I RE V SPMVEAQCSVQLC
Sbjct  601   PTIALPLILQYLGGIPKPPQPVLHFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQLC  660

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++R
Sbjct  661   FPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADLR  720

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN +WL
Sbjct  721   GDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYHWL  780

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VIL
Sbjct  781   DRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVIL  840

Query  2923  MPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             MPQ SR   L S+  S  +  Y  D KILAG A +AVL+  +WRYSR
Sbjct  841   MPQRSRFGFLSSIFASRSETPYIRDTKILAGIASLAVLVFGIWRYSR  887



>ref|XP_010443323.1| PREDICTED: uncharacterized protein LOC104726216 isoform X2 [Camelina 
sativa]
Length=888

 Score =  1380 bits (3571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/887 (75%), Positives = 767/887 (86%), Gaps = 1/887 (0%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA 
Sbjct  1     MTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNAT  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFPD
Sbjct  61    GRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFPD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             T++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ +
Sbjct  121   TKTVVDLIKTHFEDKRSSSEPPHIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPISD  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCKE
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCKE  240

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+QH
Sbjct  241   KGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQH  300

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR+
Sbjct  301   FLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLRN  360

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N+ E+++ I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E  LSNGM+VCY
Sbjct  361   VVSKVNSLEEEKMIAPWDEEKIPEEVVNEKPTPGEVTHQLEYPEVGVTELTLSNGMQVCY  420

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             K T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR 
Sbjct  421   KSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKRV  480

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+ER
Sbjct  481   EVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARER  540

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+D
Sbjct  541   DPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNLD  600

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQLC
Sbjct  601   PTIALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQLC  660

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++R
Sbjct  661   FPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADLR  720

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YWL
Sbjct  721   GDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYWL  780

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCKKQYT VIL
Sbjct  781   DRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVIL  840

Query  2923  MPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             MPQ SR   L S+  S  +  Y  D KILAG A +AVL+  +WRYSR
Sbjct  841   MPQRSRFGFLSSIFASRSETPYIRDTKILAGIASLAVLVFGIWRYSR  887



>ref|XP_010483150.1| PREDICTED: uncharacterized protein LOC104761734 isoform X2 [Camelina 
sativa]
Length=888

 Score =  1377 bits (3564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/887 (75%), Positives = 764/887 (86%), Gaps = 1/887 (0%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA 
Sbjct  1     MTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNAT  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFPD
Sbjct  61    GRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFPD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             T++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ +
Sbjct  121   TKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPISD  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCKE
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCKE  240

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
             KGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+QH
Sbjct  241   KGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQH  300

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR+
Sbjct  301   FLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLRN  360

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N+ E ++ I PWDEE IPEE+V  KP+PG +  Q EY  VG  E  LSNGM+VCY
Sbjct  361   VVSKVNSLEDEKMIAPWDEEKIPEEVVDEKPTPGEVTHQLEYPEVGVTELTLSNGMQVCY  420

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             K T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS+LMDMLAGKR 
Sbjct  421   KSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSMLMDMLAGKRV  480

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
             EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+ER
Sbjct  481   EVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARER  540

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+D
Sbjct  541   DPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNLD  600

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLILQYLGGIP+P +P+L+FNRDDLKGLPF FP+ I RE V SPMVEAQCSVQLC
Sbjct  601   PTIALPLILQYLGGIPKPPQPVLNFNRDDLKGLPFTFPTKITREFVRSPMVEAQCSVQLC  660

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++R
Sbjct  661   FPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADLR  720

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAHENGLQEN YWL
Sbjct  721   GDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAHENGLQENYYWL  780

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILR YQSR+Y+GD+G S K+ +E R ++R+ L P TAQ ALQRILP PCK+QYT VIL
Sbjct  781   DRILRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRILPHPCKEQYTAVIL  840

Query  2923  MPQASRMKRLKSLVCSAPKR-YCTDAKIlagtagvavllltlWRYSR  3060
             MPQ SR   L S+  S  +  Y  D KILAG A + VL+  +WRYSR
Sbjct  841   MPQRSRFGFLSSIFASRSETPYIRDTKILAGIASLVVLVFGIWRYSR  887



>ref|XP_008459210.1| PREDICTED: uncharacterized protein LOC103498391 isoform X2 [Cucumis 
melo]
Length=841

 Score =  1363 bits (3528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/838 (79%), Positives = 747/838 (89%), Gaps = 6/838 (1%)
 Frame = +1

Query  550   MEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRN  729
             MEEYRG+RNA GRMQDAHW LMMEGSKYA+RLPIGLEKVI+TVS + VK+FY+KWY L N
Sbjct  1     MEEYRGNRNATGRMQDAHWALMMEGSKYADRLPIGLEKVIKTVSAETVKKFYRKWYDLHN  60

Query  730   MAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSA  909
             MAVIAVGDF DT+SVVELIK HFG+  S  +PP +P + +PS ++P FSCFVESEAAGSA
Sbjct  61    MAVIAVGDFSDTESVVELIKEHFGHIPSACEPPHVPTFPIPSRDQPCFSCFVESEAAGSA  120

Query  910   VMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPV  1089
             VMIS KMP DELKTV+DYR+LL ESMF  ALNQRFFKISR KDPP++SCSAAAD +V P+
Sbjct  121   VMISYKMPADELKTVRDYRNLLVESMFLQALNQRFFKISRGKDPPFFSCSAAADPVVLPL  180

Query  1090  KAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQ  1269
             KA+IM+SSCKEKGTV+ALESMLTEVARVRLHGFSEREIS+VRALLMSEIESAYLERDQMQ
Sbjct  181   KAFIMSSSCKEKGTVKALESMLTEVARVRLHGFSEREISIVRALLMSEIESAYLERDQMQ  240

Query  1270  STSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEP  1449
             ST+LRDEYLQHFLRNEPV+GIEYEAQLQKTLLPHISA+EVSKYS +  +  SCVIK IEP
Sbjct  241   STNLRDEYLQHFLRNEPVVGIEYEAQLQKTLLPHISATEVSKYSAKLTSLCSCVIKIIEP  300

Query  1450  RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFE  1629
             RA+AT+DDL++VV+ I   E+++SIPPWDEENIPEEIVS  P+PG I+QQ EY N+GA E
Sbjct  301   RASATIDDLKNVVMNITCLEKERSIPPWDEENIPEEIVSTMPNPGNIVQQKEYPNIGATE  360

Query  1630  FDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPS  1809
               LSNGMRVCYKCT+FLDDQV+FTGFSYG LSELPE EY SCSMGSTIAGEIGVFGYRPS
Sbjct  361   IFLSNGMRVCYKCTDFLDDQVIFTGFSYGALSELPEREYSSCSMGSTIAGEIGVFGYRPS  420

Query  1810  VLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQ  1989
             VLMD+LAGKRAEVGTKLGAYMR+FSGDCSPSDLETALQLVYQLFTTNV PGEEDV IVMQ
Sbjct  421   VLMDILAGKRAEVGTKLGAYMRTFSGDCSPSDLETALQLVYQLFTTNVTPGEEDVKIVMQ  480

Query  1990  MAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPS  2169
             MAEEA+ AQERDPYTAFANRV+ELNYGNSYFFRPIR+RDL+KV+P +ACEYFN CF+DPS
Sbjct  481   MAEEAVRAQERDPYTAFANRVKELNYGNSYFFRPIRLRDLKKVDPQRACEYFNKCFRDPS  540

Query  2170  TFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSP  2349
              FTVV+VGNI+P+ A PLI QYLGGIP+P EPI++FNRDDLKGLPFKFP+ I+REVV+SP
Sbjct  541   NFTVVVVGNINPSIALPLIQQYLGGIPKPPEPIMNFNRDDLKGLPFKFPTRIVREVVYSP  600

Query  2350  MVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLG  2529
             MVEAQCSVQLCFPVEL +  M+E++H+VGFLSKLLET+++QVLRFK+GQIY+AGVSVFLG
Sbjct  601   MVEAQCSVQLCFPVELTNGTMVEEIHYVGFLSKLLETRMMQVLRFKHGQIYSAGVSVFLG  660

Query  2530  GNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAH  2709
             GNKPSR G +RGDI INFSCDP+ISS LVDLAL+EILRLQE+GP+D+DVS++LEIEQRAH
Sbjct  661   GNKPSRSGPVRGDISINFSCDPEISSKLVDLALNEILRLQEEGPTDQDVSSILEIEQRAH  720

Query  2710  ENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPF  2889
             ENGLQEN YWLDRILRSYQSRIYSGDVG SF++QDE R  VR  LTPLTAQ+ALQRILPF
Sbjct  721   ENGLQENYYWLDRILRSYQSRIYSGDVGSSFEIQDEGRLNVRNSLTPLTAQLALQRILPF  780

Query  2890  PCKKQYTVVILMPQASRMKRLKS---LVCSAPKRYCTDAKIlagtagvavllltlWRY  3054
             PC KQYT VIL+P + R ++LKS   L  S+P R   D KIL G A VAVL  +LWRY
Sbjct  781   PCTKQYTAVILLPASYRFRKLKSFFRLGLSSPGR---DTKILVGLASVAVLTFSLWRY  835



>gb|EYU41611.1| hypothetical protein MIMGU_mgv1a020497mg [Erythranthe guttata]
Length=940

 Score =  1342 bits (3472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/962 (68%), Positives = 775/962 (81%), Gaps = 25/962 (3%)
 Frame = +1

Query  49    DLLPAESSQMLPK-KHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             +LLP ESS++L K K RFRSLKLV+ N +E L++TPYG DYGRL NGLTYYV +NS PK 
Sbjct  3     NLLPGESSKILSKTKLRFRSLKLVDFNEDENLAETPYGADYGRLSNGLTYYVSTNSTPKK  62

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAAL+L V  GSVLEEEEERGVAHIVEHLAFSAT+ YTNHDIVKF+ESIGAEFG CQNA 
Sbjct  63    RAALSLVVNVGSVLEEEEERGVAHIVEHLAFSATKNYTNHDIVKFVESIGAEFGPCQNAS  122

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             T+ DET+YELFVPIDKPEL+SQ+IS+LAEFSSE+R S  DLE ERGAV+EEYRG R+A+G
Sbjct  123   TTEDETIYELFVPIDKPELISQSISVLAEFSSEIRVSVDDLETERGAVLEEYRGRRDADG  182

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             RM DAHW +M+EGSKYAERLPIGLE VIRTVSP+IVK+FY KWY ++NMA+I VGDFPDT
Sbjct  183   RMNDAHWAVMLEGSKYAERLPIGLENVIRTVSPEIVKRFYNKWYQMQNMALIIVGDFPDT  242

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             QSVVELIK HF  KT   DP PIP + VPSHEEPRFS FVESEAAGS V I+ K+P + +
Sbjct  243   QSVVELIKTHFEDKTPKLDPTPIPRFTVPSHEEPRFSVFVESEAAGSVVGITFKIPTNWM  302

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYR+ +AE MFF+A+NQR FK+S KKDPPY+SCSAA++ LVR  KAY MTSSCK  
Sbjct  303   KTVKDYRNFMAEDMFFNAMNQRLFKLSHKKDPPYFSCSAASNGLVRATKAYTMTSSCKHN  362

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             G +E+LESML E+ARVR +GFSEREIS+ RA+ MSE+ES YLERDQ+QS+ +R  Y  HF
Sbjct  363   GIIESLESMLIELARVRKYGFSEREISIARAVSMSEMESEYLERDQIQSSLIRTYYTLHF  422

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
                 PV+  EYEA+L KT+LP++SASEVS++SE F TS +CVIKTIEP+ATAT+DDLRSV
Sbjct  423   FGKLPVVDPEYEAKLFKTILPYVSASEVSQFSEYFRTSFNCVIKTIEPQATATLDDLRSV  482

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VL++N  E++ SI PW++E+  EEIV V+P+PG ++QQ EY  + A E  LSNGMRVC K
Sbjct  483   VLRVNALEEEGSIFPWEDESTVEEIVRVEPTPGHVVQQLEYPIIDATELILSNGMRVCCK  542

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+F DDQVLFTGFSYGGLSEL ES+YFSC MGS IA + G+FG+R  VL DMLA     
Sbjct  543   STDFFDDQVLFTGFSYGGLSELKESDYFSCLMGSDIAEQTGLFGHRAEVLTDMLA-----  597

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
                                DLE ALQLVYQLF TN++P E+DV IVMQ  EE+IHA+ERD
Sbjct  598   -------------------DLEIALQLVYQLFITNMQPEEDDVKIVMQKDEESIHAEERD  638

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             P+T F NRV E+NYGNS FFR +++ DL++V+P K CEYFNN FKDPSTFTVVI+G I+P
Sbjct  639   PHTVFTNRVLEINYGNSIFFRTMKMDDLKEVDPVKGCEYFNNSFKDPSTFTVVIIGKIEP  698

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
               A PLILQYLGGIPRP+ PI +F   DL  LP  +PS++IREVV SPMVEAQ SV LCF
Sbjct  699   TIASPLILQYLGGIPRPTTPIFNFEHFDLTSLPCTYPSTVIREVVRSPMVEAQSSVHLCF  758

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
              VELK E MMED H + F+SKLLETKI+QVLRFK+GQIY+ GVS+F GGNKPSRVG++RG
Sbjct  759   LVELKEETMMEDKHLIQFMSKLLETKILQVLRFKHGQIYSTGVSMFFGGNKPSRVGDVRG  818

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             D+ + FSCDP ISSTLVDL LDEILRLQ +GPSD+DVS +LEIEQR +E  LQ+N YWL+
Sbjct  819   DLNVYFSCDPVISSTLVDLVLDEILRLQVEGPSDDDVSAILEIEQRTYEIELQDNYYWLE  878

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
              I+ SYQSR YSGD+  SFK+ DEAR+ VR  LTP TAQ  LQR+LPFPCK+QYTVVILM
Sbjct  879   MIMSSYQSRNYSGDIDASFKILDEARNNVRNTLTPSTAQATLQRMLPFPCKEQYTVVILM  938

Query  2926  PQ  2931
             PQ
Sbjct  939   PQ  940



>ref|XP_002985407.1| hypothetical protein SELMODRAFT_181652 [Selaginella moellendorffii]
 gb|EFJ13537.1| hypothetical protein SELMODRAFT_181652 [Selaginella moellendorffii]
Length=998

 Score =  1330 bits (3443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/967 (65%), Positives = 786/967 (81%), Gaps = 3/967 (0%)
 Frame = +1

Query  79    LPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAG  258
             +P    F+SLK + +  E+ L  TP GV YG LDNG+ YYVR N+KP+ RAALAL VR G
Sbjct  1     MPSNLSFKSLKPLELREEDLLPSTPVGVVYGTLDNGMCYYVRQNAKPRARAALALGVRIG  60

Query  259   SVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF  438
             SV+EEEEERGVAHI+EHLAFSAT KYTNHDIVKFLESIGAEFGACQNA+TSADET+YEL 
Sbjct  61    SVMEEEEERGVAHILEHLAFSATTKYTNHDIVKFLESIGAEFGACQNAMTSADETIYELL  120

Query  439   VPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMM  618
             VP+DKPELLSQAIS+LAEFS+ +RAS+ DLEKERGAVMEEYRG RNA GRMQ AHW+L+M
Sbjct  121   VPVDKPELLSQAISVLAEFSAGIRASQEDLEKERGAVMEEYRGDRNALGRMQQAHWLLLM  180

Query  619   EGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHF  798
             +GSKYA+RLPIGLE VIR VS + V+ FY KWYH ++MA +AVGDF DT+SVVELIK HF
Sbjct  181   QGSKYADRLPIGLENVIRNVSAETVRNFYHKWYHPKHMAFVAVGDFEDTESVVELIKLHF  240

Query  799   GYKT---SppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRD  969
               K           +P Y VPSHEEPRFSCF E+EA GSAV+ S K+P  ++ TV DYR 
Sbjct  241   QEKDPVFEKRAYNELPLYHVPSHEEPRFSCFAETEAGGSAVVASWKIPSRQIVTVADYRY  300

Query  970   LLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALES  1149
              +AE MF  ALNQRFFK+SR+++PP++SC++  D LVRPVKAY +T+SCKEKGT+EA+ES
Sbjct  301   TVAEGMFHSALNQRFFKLSRQQEPPFFSCASVDDNLVRPVKAYTITASCKEKGTLEAVES  360

Query  1150  MLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIG  1329
             +LTEVAR+RLHGFSERE+++VRA L +++ESAYLERDQMQSTS R+EY++HFL NEPV+G
Sbjct  361   ILTEVARIRLHGFSERELAMVRAFLTTDMESAYLERDQMQSTSYREEYMEHFLHNEPVVG  420

Query  1330  IEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFE  1509
             IEYEA+LQK +LP I+A+EV+  +       SC+IKTIEPR + TV DL++V+ K+   E
Sbjct  421   IEYEARLQKAVLPGITATEVADIAHLLKARLSCIIKTIEPRVSVTVKDLKNVIAKVQALE  480

Query  1510  QKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQ  1689
              + SIPPW+EE++PEE+V  KP PG I++   Y+  GA E  LSNG+RVCYK T+FLDDQ
Sbjct  481   DEGSIPPWNEEDVPEEVVENKPEPGVILETTVYEEFGATELVLSNGLRVCYKPTDFLDDQ  540

Query  1690  VLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAY  1869
             ++F+GF+YGGLS++PE ++ +CSMGSTIAGEIGVFG++PSVLMD+LAGKRAEVGTK+GAY
Sbjct  541   IVFSGFAYGGLSQVPEKDFLTCSMGSTIAGEIGVFGHKPSVLMDILAGKRAEVGTKIGAY  600

Query  1870  MRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANR  2049
             MRSFSGDCSP+DLE ALQL+YQLF T+V PG+++V +VMQM +E I AQERDP+TA+ NR
Sbjct  601   MRSFSGDCSPTDLEIALQLIYQLFVTSVHPGDDEVKLVMQMTKEGIEAQERDPFTAYVNR  660

Query  2050  VRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLIL  2229
             VRE+NYGNSY+F+PI ++DL+KV+P +AC +F++CFKDPS FT+ IVG I P    PLIL
Sbjct  661   VREINYGNSYYFKPITVKDLRKVDPLRACAFFDSCFKDPSAFTIAIVGKIIPEKVVPLIL  720

Query  2230  QYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSED  2409
             QYLGGIP PSEP++ +NRD+L+GLPF FP+ IIRE V   M+EAQ SVQ+ FPVELK+ +
Sbjct  721   QYLGGIPSPSEPVMKYNRDELQGLPFTFPAGIIREEVRRSMIEAQGSVQITFPVELKASN  780

Query  2410  MMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSC  2589
             +ME+VHF  F+SKLLETK++QVLRFK+GQIY A VS FLGG+KPSR  ++ GDI I+FSC
Sbjct  781   VMEEVHFTSFISKLLETKMMQVLRFKHGQIYTASVSAFLGGSKPSRSSDVCGDIAISFSC  840

Query  2590  DPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
             DPD +  LV+ +L+E+ RLQ +GP+ ++V TVLEIEQRAHENG QEN YWLDR+ R+YQS
Sbjct  841   DPDSAWKLVEFSLEEVARLQLEGPTKQEVLTVLEIEQRAHENGQQENVYWLDRLSRAYQS  900

Query  2770  RIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKR  2949
             R+Y GD+  SF+ QD+ R  VR  L  +  Q AL RILP PC +++T V L+P+ SRMK 
Sbjct  901   RLYVGDLNTSFQGQDQWRDSVRSSLDEVAMQRALCRILPVPCAQRHTAVALVPRPSRMKA  960

Query  2950  LKSLVCS  2970
             +  L+ S
Sbjct  961   IAGLLNS  967



>ref|XP_008797887.1| PREDICTED: uncharacterized protein LOC103712947 isoform X4 [Phoenix 
dactylifera]
Length=830

 Score =  1311 bits (3394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/830 (77%), Positives = 732/830 (88%), Gaps = 1/830 (0%)
 Frame = +1

Query  589   MQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQ  768
             MQDAHWVLM EGSKYAERLPIGLEKVIRTV+P+ V++FY+KWYHL+NMAV+AVGDF DTQ
Sbjct  1     MQDAHWVLMFEGSKYAERLPIGLEKVIRTVTPETVRRFYRKWYHLQNMAVVAVGDFSDTQ  60

Query  769   SVVELIKAHFGYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
             SVVELI++HFG K S    PP+   + VPSHEEPRFSCFVESEAAGSAVMISCK+PVDE+
Sbjct  61    SVVELIRSHFGQKVSLSGLPPVIPDFPVPSHEEPRFSCFVESEAAGSAVMISCKIPVDEM  120

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             +TVKDYRD LAE+MF  ALNQRFFKISR+KDPPY++CS+AAD LVRPVKAYIMTSSC+EK
Sbjct  121   RTVKDYRDSLAEAMFHCALNQRFFKISRRKDPPYFACSSAADALVRPVKAYIMTSSCREK  180

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESML EVARVRLHGFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQHF
Sbjct  181   GTIEALESMLMEVARVRLHGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQHF  240

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
              R EPV+GIEYEAQLQKTLLPHIS +EVSK++  F T+ SCVIK +EPRA AT++DL++ 
Sbjct  241   FRKEPVVGIEYEAQLQKTLLPHISPAEVSKFAVNFCTTCSCVIKIVEPRACATIEDLKAS  300

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             VLK+N  E++  I PWD+E++PEEIV  KP+PG I+Q  ++ ++G  E  LSNGMR+CYK
Sbjct  301   VLKVNALEEENKISPWDDEHVPEEIVIDKPNPGSIVQHSDFPSIGVTELLLSNGMRICYK  360

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
             CT+FLDDQV+FTGF+YGGLSEL E EY SCSMGSTI+GEIGV+GY+PSVLMDMLAGKRAE
Sbjct  361   CTDFLDDQVIFTGFAYGGLSELSEDEYISCSMGSTISGEIGVYGYKPSVLMDMLAGKRAE  420

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             VGTK+GAYMR+FSGDCSP+DLETALQLVY LFTTNVEP +E+V IVMQMAEEAI AQERD
Sbjct  421   VGTKVGAYMRTFSGDCSPTDLETALQLVYLLFTTNVEPRDEEVKIVMQMAEEAIRAQERD  480

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             PYT FANRVRE+NYGNSYFFRPIRI DL+KV+P +AC+YFN+CFKDPSTFTVVIVGN DP
Sbjct  481   PYTVFANRVREVNYGNSYFFRPIRISDLRKVDPIRACKYFNDCFKDPSTFTVVIVGNFDP  540

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
             + + PLILQYLGGIPRP+E +L FNRDDLKGLPFKFP++I+REVV SPMVEAQCSVQL F
Sbjct  541   SVSLPLILQYLGGIPRPAELVLQFNRDDLKGLPFKFPATIVREVVRSPMVEAQCSVQLAF  600

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
             PV LK+  MME++H+VGFLSKLLETKI+QVLRFK+GQIY+  VSVFLGGNKPSR G++RG
Sbjct  601   PVVLKNMSMMEEIHYVGFLSKLLETKIMQVLRFKHGQIYSVNVSVFLGGNKPSRSGDVRG  660

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
             D  +NFSCDPDI+S LVD+AL+EI+ LQ  GPSDEDVST+LEIEQRAHENGLQEN YWLD
Sbjct  661   DTSVNFSCDPDIASKLVDIALEEIMYLQNHGPSDEDVSTILEIEQRAHENGLQENYYWLD  720

Query  2746  RILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILM  2925
             RILRSYQSR Y GDV  SF++QDE R+KVRK LTP T Q+ALQRILPFPCK QYT VILM
Sbjct  721   RILRSYQSRAYFGDVSASFEIQDEGRTKVRKALTPSTIQLALQRILPFPCKMQYTAVILM  780

Query  2926  PQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSSLKS  3075
             PQ SR+K LKSL+      +  DAKILAG AG  VL ++LWRYSRS+L S
Sbjct  781   PQLSRLKLLKSLLQFRSNGFSRDAKILAGAAGAVVLAVSLWRYSRSTLNS  830



>ref|XP_009120183.1| PREDICTED: uncharacterized protein LOC103845102 isoform X2 [Brassica 
rapa]
Length=839

 Score =  1300 bits (3364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/838 (74%), Positives = 726/838 (87%), Gaps = 1/838 (0%)
 Frame = +1

Query  550   MEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRN  729
             MEEYRG+RNA GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VK+FY+KWYHL N
Sbjct  1     MEEYRGNRNATGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKKFYQKWYHLCN  60

Query  730   MAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSA  909
             MAV+AVGDFPDT++VV+LIK HF  K S  +PP IP++ VPSHE+ RFSCFVESEAAGSA
Sbjct  61    MAVVAVGDFPDTKTVVDLIKTHFEDKRSSSNPPEIPFFPVPSHEDTRFSCFVESEAAGSA  120

Query  910   VMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPV  1089
             VMIS KMPV +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+
Sbjct  121   VMISYKMPVSDLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPL  180

Query  1090  KAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQ  1269
             KAYIM+SSCKEKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+Q
Sbjct  181   KAYIMSSSCKEKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQIQ  240

Query  1270  STSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEP  1449
             STSLRDEY+QHFL  EPVIGIEYEAQLQK+LLP ISAS+VS+YSE+  TS  CVIKT+EP
Sbjct  241   STSLRDEYIQHFLHKEPVIGIEYEAQLQKSLLPQISASDVSRYSEKLRTSCGCVIKTMEP  300

Query  1450  RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFE  1629
             R+ ATVDD+R+VV K+N+ E++  I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E
Sbjct  301   RSNATVDDMRNVVSKVNSLEEEMKIAPWDEEKIPEEVVNEKPTPGDVTHQLEYPEVGVTE  360

Query  1630  FDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPS  1809
               LSNGM+VCYK T+FLDDQVLFTGF+YGGLSELPES+Y SCSMGSTIAGEIG+FGY+PS
Sbjct  361   LTLSNGMQVCYKSTDFLDDQVLFTGFAYGGLSELPESDYISCSMGSTIAGEIGMFGYKPS  420

Query  1810  VLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQ  1989
             +LMDMLAGKR EV  +LG YMR+FS DCSP+DLETALQLVYQLFTTNV P EE+V IVMQ
Sbjct  421   MLMDMLAGKRVEVSARLGPYMRTFSCDCSPTDLETALQLVYQLFTTNVMPQEEEVGIVMQ  480

Query  1990  MAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPS  2169
             MAEEA+ A+ERDPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPS
Sbjct  481   MAEEAVRARERDPYTVFANRVKELNYGNSYFFRPIRINELRKVDPVKACEYFNSCFRDPS  540

Query  2170  TFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSP  2349
             TFTVVIVGN+DP+ A PLILQYLGGIP+P +PIL+FNRDDLKGLPF FP+ I RE V SP
Sbjct  541   TFTVVIVGNLDPSIALPLILQYLGGIPKPPQPILNFNRDDLKGLPFTFPTKITREFVRSP  600

Query  2350  MVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLG  2529
             MVEAQCSVQLCFPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLG
Sbjct  601   MVEAQCSVQLCFPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLG  660

Query  2530  GNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAH  2709
             GNKPSR  ++RGDI +NFSCDP+ISS LVDLAL+EI+RLQE+GPS ED+S +LEIEQRAH
Sbjct  661   GNKPSRTADLRGDISVNFSCDPEISSKLVDLALEEIVRLQEEGPSQEDISAILEIEQRAH  720

Query  2710  ENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPF  2889
             ENGLQEN YWLDRILR YQSR+Y+GD+G S ++ +E R ++R+ L P TAQ ALQRILP 
Sbjct  721   ENGLQENYYWLDRILRGYQSRVYAGDLGASCQILEEGRLRMRESLAPQTAQAALQRILPH  780

Query  2890  PCKKQYTVVILMPQASRMKRLKSLVCSAPK-RYCTDAKIlagtagvavllltlWRYSR  3060
             PCKKQYT VILMPQ SR   L S+  S+P+ R+  D KILAG AG+AVL+ ++WRYSR
Sbjct  781   PCKKQYTAVILMPQRSRFGFLSSIFASSPETRFIRDTKILAGIAGLAVLVFSIWRYSR  838



>ref|XP_006401292.1| hypothetical protein EUTSA_v10012682mg [Eutrema salsugineum]
 gb|ESQ42745.1| hypothetical protein EUTSA_v10012682mg [Eutrema salsugineum]
Length=839

 Score =  1278 bits (3308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/889 (71%), Positives = 725/889 (82%), Gaps = 53/889 (6%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA 
Sbjct  1     MTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNAT  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFPD
Sbjct  61    GRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFPD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             T++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMPV +
Sbjct  121   TKTVVDLIKTHFEDKRSSSNPPEIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPVSD  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQR FKISRKKDPP+++CS AAD L               
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRLFKISRKKDPPFFACSVAADVL---------------  225

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
                          VARVRLHGFSEREISVVRAL+MSEIESA+LERDQ QSTSLRDEY+QH
Sbjct  226   -------------VARVRLHGFSEREISVVRALMMSEIESAFLERDQTQSTSLRDEYIQH  272

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL NEPVIGIEYEAQLQKTLLP ISAS+VSKYSE+  TS  CVIKT+EPR+ ATVDD+R+
Sbjct  273   FLHNEPVIGIEYEAQLQKTLLPQISASDVSKYSEKLRTSCGCVIKTMEPRSAATVDDMRN  332

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N+ E+++ I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E  LSNGM+VCY
Sbjct  333   VVSKVNSLEEEKKIAPWDEEKIPEEVVNEKPTPGDVTHQLEYPEVGVTELTLSNGMQVCY  392

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             K T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PSVLMDMLA    
Sbjct  393   KSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSVLMDMLA----  448

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
                                 DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+ER
Sbjct  449   --------------------DLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARER  488

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+D
Sbjct  489   DPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNLD  548

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLI QYLGGIP+P +P+L+FNRDDL+GLPF FP+ I RE V SPMVEAQCSVQLC
Sbjct  549   PTIALPLIRQYLGGIPKPPQPVLNFNRDDLRGLPFTFPTKITREFVRSPMVEAQCSVQLC  608

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIR  2562
             FPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQIY+A VSVFLGGNKPSR  ++R
Sbjct  609   FPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQIYSAEVSVFLGGNKPSRTADLR  668

Query  2563  GDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             GDI +NFSCDP+ISS LVDLAL+EI+RLQE GPS ED+S +LEIEQRAHENGLQEN YWL
Sbjct  669   GDISVNFSCDPEISSKLVDLALEEIVRLQEQGPSQEDISAILEIEQRAHENGLQENYYWL  728

Query  2743  DRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             DRILR YQSR+Y+GD+G S ++ +E R ++R+ L P TAQ ALQRILP PCKKQYT VIL
Sbjct  729   DRILRGYQSRVYAGDLGASCQILEEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVIL  788

Query  2923  MPQASRMKRLKSLVCSAPKRYCT-DAKIlagtagvavllltlWRYSRSS  3066
             MPQ SR   L S+  S P+  C  D KILAG AG+AVL+ ++WRYSR S
Sbjct  789   MPQRSRFGFLSSIFVSRPETRCIRDTKILAGIAGLAVLVFSIWRYSRKS  837



>ref|XP_002987175.1| hypothetical protein SELMODRAFT_182881 [Selaginella moellendorffii]
 gb|EFJ11751.1| hypothetical protein SELMODRAFT_182881 [Selaginella moellendorffii]
Length=959

 Score =  1274 bits (3298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/965 (63%), Positives = 760/965 (79%), Gaps = 31/965 (3%)
 Frame = +1

Query  79    LPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAG  258
             +P    F+SLK + +  E+ L  TP GV YG LDNG+ YYVR N+KP+ RAALAL VR G
Sbjct  1     MPSDLSFKSLKPLELREEDFLPSTPVGVVYGTLDNGMCYYVRQNAKPRARAALALGVRIG  60

Query  259   SVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF  438
             SV+EEEEERGVAHI+EHLAFSAT KYTNHDIVKFLESIGAEFGACQNA+TSADET+YEL 
Sbjct  61    SVMEEEEERGVAHILEHLAFSATTKYTNHDIVKFLESIGAEFGACQNAMTSADETIYELL  120

Query  439   VPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMM  618
             VP+DKPELLSQAIS+LAEFS+ +RAS+ DLEKERGAVMEEYRG RNA GRMQ+AHW+L+M
Sbjct  121   VPVDKPELLSQAISVLAEFSAGIRASQEDLEKERGAVMEEYRGDRNALGRMQEAHWLLLM  180

Query  619   EGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHF  798
             +GSKYA+RLPIGLE +IR VS + V+ FY+KWYH ++MA +AVGDF DT+SVVELIK HF
Sbjct  181   QGSKYADRLPIGLENIIRNVSAETVRNFYRKWYHPKHMAFVAVGDFEDTESVVELIKLHF  240

Query  799   GYK---TSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRD  969
               K           +P Y VPSHEEPRFSCF E+EA GSAV++S K+P  ++ TV DYR 
Sbjct  241   QEKDPVVEKRAYNELPLYHVPSHEEPRFSCFAETEAGGSAVVVSWKIPSRQIVTVADYRY  300

Query  970   LLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALES  1149
              +AE MF  ALNQRFFK+SR+++PP++SC++  D L                        
Sbjct  301   TVAEGMFHSALNQRFFKLSRQQEPPFFSCASVDDNL------------------------  336

Query  1150  MLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIG  1329
                 VAR+RLHGFSERE+++VRA L +++ESAYLERDQMQSTS R+EY++HFL NEPV+G
Sbjct  337   ----VARIRLHGFSERELAMVRAFLTADMESAYLERDQMQSTSYREEYMEHFLHNEPVVG  392

Query  1330  IEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFE  1509
             IEYEA+LQK +LP I+A+EV+  +       SC+IKTIEPR + TV DL++V+ K+   E
Sbjct  393   IEYEARLQKAVLPGITATEVADIANLLKARLSCIIKTIEPRVSVTVKDLKNVIAKVQALE  452

Query  1510  QKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQ  1689
              + SIPPW+EE++PEE+V  KP PG I++   Y+  GA E  LSNG+RVCYK T+FLDDQ
Sbjct  453   DEGSIPPWNEEDVPEEVVENKPEPGVILETTVYEEFGATELVLSNGLRVCYKPTDFLDDQ  512

Query  1690  VLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAY  1869
             ++F+GF+YGGLS++PE ++ +CSMGSTIAGEIGVFG++PSVLMD+LAGKRAEVGTK+GAY
Sbjct  513   IVFSGFAYGGLSQVPEKDFLTCSMGSTIAGEIGVFGHKPSVLMDILAGKRAEVGTKIGAY  572

Query  1870  MRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANR  2049
             MRSFSGDCSP+DLE ALQL+YQLF T+V PG ++V +VMQM +E I AQERDP+TA+ NR
Sbjct  573   MRSFSGDCSPTDLEIALQLIYQLFVTSVHPGNDEVKLVMQMTKEGIEAQERDPFTAYVNR  632

Query  2050  VRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLIL  2229
             VRE+NYGNSY+F+PI ++DL+KV+P +AC +F++CFKDPS FT+ IVG I P    PLIL
Sbjct  633   VREINYGNSYYFKPITVKDLRKVDPLRACAFFDSCFKDPSAFTIAIVGKIIPEKVVPLIL  692

Query  2230  QYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSED  2409
             QYLGGIP PSEP++ +NRDDL+GLPF FP+ IIRE V   MVEAQ SVQ+ FPVELK+ +
Sbjct  693   QYLGGIPSPSEPVMKYNRDDLQGLPFTFPAGIIREEVRRSMVEAQGSVQITFPVELKASN  752

Query  2410  MMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSC  2589
             MME+VHF  F+SKLLETK++QVLRFK+GQIY A VS FLGG+KPSR  ++ GDI I+FSC
Sbjct  753   MMEEVHFTSFISKLLETKMMQVLRFKHGQIYTASVSAFLGGSKPSRSSDVCGDIAISFSC  812

Query  2590  DPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
             DPD +  LV+ +L+E+ RLQ +GP+ ++V TVLEIEQRAHENG QEN YWLDR+ R+YQS
Sbjct  813   DPDSAWKLVEFSLEEVARLQLEGPTKQEVLTVLEIEQRAHENGQQENIYWLDRLSRAYQS  872

Query  2770  RIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKR  2949
             R+Y GD+  SF+ QD+ R  VR  L  +  Q AL RILP PC +++T V L+P+ SRMK 
Sbjct  873   RLYVGDLNTSFQAQDQWRDSVRSSLDEVAMQKALCRILPVPCAQRHTAVALVPRPSRMKA  932

Query  2950  LKSLV  2964
             +  L+
Sbjct  933   IAGLL  937



>ref|XP_001774258.1| predicted protein [Physcomitrella patens]
 gb|EDQ60894.1| predicted protein [Physcomitrella patens]
Length=969

 Score =  1246 bits (3224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/955 (63%), Positives = 746/955 (78%), Gaps = 31/955 (3%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEE  276
             F++L+ + VN ++ L   P GVDYG L+NGL YYVR N+KPK RAALAL VR GSVLEEE
Sbjct  11    FKALRRLVVNPDDPLPAGPVGVDYGVLENGLCYYVRKNAKPKERAALALGVRIGSVLEEE  70

Query  277   EERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKP  456
             EERGVAHIVEHLAFSAT K+TNHDI++FLESIGAEFGACQNA TS DET+YEL VPIDKP
Sbjct  71    EERGVAHIVEHLAFSATRKHTNHDIIRFLESIGAEFGACQNASTSPDETIYELMVPIDKP  130

Query  457   ELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYA  636
             E+LSQA++ILAEFS+E+R S+ DLEKERGAV+EE RG RNA GR Q+AHW+L+M+GS+YA
Sbjct  131   EILSQALNILAEFSTEIRISDEDLEKERGAVLEELRGGRNAMGRTQEAHWLLLMKGSQYA  190

Query  637   ERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSp  816
              R PIGLEKVI+ V+   VK FY +WY   NMA++AVGDF  T++VVELIK HFG +   
Sbjct  191   NRQPIGLEKVIKNVTASRVKDFYHRWYRPENMAIVAVGDFHTTENVVELIKQHFGERKPH  250

Query  817   pdpp---pipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESM  987
                     IP + VPSHEEPRF CF E EA GSAVMISCK+P  +  T+KDYR ++AE M
Sbjct  251   AVDNNFPTIPAFSVPSHEEPRFLCFAEKEAGGSAVMISCKVPAKQDTTIKDYRFMIAELM  310

Query  988   FFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVA  1167
             F  ALNQRFFKISR+K+PP++ C ++++ LVRPVKAYIMT++C+E+GT++ALE MLTEVA
Sbjct  311   FHSALNQRFFKISRQKNPPFFYCISSSENLVRPVKAYIMTANCQERGTLQALEQMLTEVA  370

Query  1168  RVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQ  1347
             RVR +GFSEREI++VRA LM++IESAYLERDQMQST+LR+EYLQHFLR EPV+GIEYEAQ
Sbjct  371   RVRRYGFSEREIALVRAPLMADIESAYLERDQMQSTNLREEYLQHFLRGEPVLGIEYEAQ  430

Query  1348  LQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIP  1527
             LQKTL+P ISA+EV+K +E +    +CVIKT+EPRA +T  DL++++ K+   E    I 
Sbjct  431   LQKTLIPDISAAEVAKIAEYYHAKCNCVIKTLEPRARSTERDLKAILAKVQALEGG-DIA  489

Query  1528  PWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGF  1707
             PWDEE+ P+ IV   P PG ++Q  E+ ++GA E  LSNGMRVCYK T FL+DQVL +G+
Sbjct  490   PWDEEHTPDSIVDKLPIPGEVVQSKEFPDIGATELILSNGMRVCYKFTEFLEDQVLISGY  549

Query  1708  SYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSG  1887
             +YGGLSE+ +S++ SC +GSTIAGEIGVFG++PSVL D+LAGKRAEV TK+GAYMR+FSG
Sbjct  550   AYGGLSEVDKSDFLSCYLGSTIAGEIGVFGHKPSVLQDILAGKRAEVSTKIGAYMRNFSG  609

Query  1888  DCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY  2067
             DCSP+DL  ALQLVYQLF   VEP +E+V +VMQM  E I AQERDP+TA++NRVRELNY
Sbjct  610   DCSPTDLNAALQLVYQLFVAEVEPADEEVQLVMQMTLEGIKAQERDPFTAYSNRVRELNY  669

Query  2068  GNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGI  2247
             GNSY+F+PI  +DL KV+  +AC+YFN+CFKDPS FTV IVGNID   A PLILQYLGGI
Sbjct  670   GNSYYFQPITAKDLNKVDAKRACQYFNSCFKDPSGFTVAIVGNIDIEKALPLILQYLGGI  729

Query  2248  PRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVH  2427
             P+P  P++ + RD+L  LPF FP+ ++RE V   MV+AQCSVQL FPV+LK  D+ME+VH
Sbjct  730   PKPEIPVMIYTRDELSALPFTFPAQVVREEVRKNMVQAQCSVQLTFPVQLKGLDVMEEVH  789

Query  2428  FVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISS  2607
             +  F+ KLLETKI+QVLRFK+G +Y+  VS FLGG+KPSR GN+RG++ ++FSCDPD++ 
Sbjct  790   YTCFICKLLETKIMQVLRFKHGHVYSVSVSAFLGGSKPSRFGNVRGEVAVSFSCDPDVAW  849

Query  2608  TLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGD  2787
               VD+ALDE+ RLQE+GP+ EDVST+LE+EQR +E G Q    W                
Sbjct  850   KSVDIALDEVKRLQEEGPTAEDVSTILELEQRTYEIGQQAQEQW----------------  893

Query  2788  VGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRL  2952
                        R+ VR   T +T + AL RILP PCK+ YT V L+P+ASR ++L
Sbjct  894   -----------RNAVRSKATAVTMKDALCRILPVPCKEHYTAVALIPRASRWQQL  937



>ref|XP_010688399.1| PREDICTED: uncharacterized protein LOC104902351 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010688401.1| PREDICTED: uncharacterized protein LOC104902351 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score =  1238 bits (3203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/973 (61%), Positives = 763/973 (78%), Gaps = 2/973 (0%)
 Frame = +1

Query  37    EARMDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSK  216
             E  MD LP +++  L +KHRF+SLK VN+++ + L +TP+G D+GRL+NGLTYYVR N K
Sbjct  18    EKTMDALP-KATLELAQKHRFKSLKRVNLDLGKNLDETPFGADFGRLENGLTYYVRCNPK  76

Query  217   PKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQ  396
             P+MRAALALAV+ GS+ E   ERG+AHIVEHLAFSAT+KYTNHDIVKFLESIGAEFGAC 
Sbjct  77    PQMRAALALAVKVGSIFEASHERGIAHIVEHLAFSATKKYTNHDIVKFLESIGAEFGACG  136

Query  397   NAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRN  576
             NA TS DETVYELFVPIDKP LLS+AISIL+EFS E+R S  DL+KERGAV+EEYR  R+
Sbjct  137   NAYTSFDETVYELFVPIDKPGLLSEAISILSEFSYEIRISPEDLDKERGAVLEEYRRGRD  196

Query  577   ANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDF  756
             ANGR+ +A +  +M+GS YA+RLPIGLE VIR+   ++ KQFYKKWY L+NMAVIAVGDF
Sbjct  197   ANGRLSEATFASVMDGSNYAKRLPIGLELVIRSAPAEVAKQFYKKWYCLQNMAVIAVGDF  256

Query  757   PDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPV  936
             PDT+SVVELI  HFG   SP  P    + +VP H +PRFSC VE EA+GS+V I+ KM  
Sbjct  257   PDTKSVVELIIQHFGQIISPSPPVTPEH-VVPFHHKPRFSCLVEPEASGSSVEINWKMHN  315

Query  937   DELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSC  1116
             DE KT+ DY+D L   +F  ALN+RF KISR+KD P++ CS A   LVRPVKA  ++SSC
Sbjct  316   DEPKTIGDYKDWLIGVVFRSALNRRFTKISRRKDAPFFGCSIAELELVRPVKAVQISSSC  375

Query  1117  KEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYL  1296
             K+K  +EALESML+E+AR RLH FSEREIS+  A ++SE+ESAYLER++MQS++ R +YL
Sbjct  376   KDKSILEALESMLSELARARLHEFSEREISIACANILSEMESAYLEREKMQSSTWRYQYL  435

Query  1297  QHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDL  1476
             QHFLRNE V+G+E+EA+L KT+LP +SASEVS+YSE+   S S V+   EPRAT T  DL
Sbjct  436   QHFLRNEAVLGLEFEAKLYKTILPQLSASEVSRYSEKLKMSESSVVIITEPRATVTEKDL  495

Query  1477  RSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRV  1656
             +++V   ++ E+++ I  W ++ IPEE+V VKP+PG ++++ +YQ++G  E  LSNGM+V
Sbjct  496   QNLVSVTDSLEEEEKISAWKDDFIPEEVVQVKPNPGEVVRKSDYQDIGVTEIALSNGMKV  555

Query  1657  CYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGK  1836
             CYKCT+F +DQV+F G+SYGG SEL ESEY SC + S+IAGEIG FGY+P+VL DMLAGK
Sbjct  556   CYKCTDFQNDQVIFRGYSYGGYSELSESEYLSCMLSSSIAGEIGQFGYKPTVLEDMLAGK  615

Query  1837  RAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQ  2016
             RA V T+LGAY R+F GDCSPSDLETALQLVYQLF T V+P EED   V+Q+ EE I A 
Sbjct  616   RAGVYTQLGAYTRNFIGDCSPSDLETALQLVYQLFVTCVKPEEEDTRRVIQIVEEMIRAD  675

Query  2017  ERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGN  2196
             ERDPY  F NRV  + YGNSYF++P ++ DL KV+P KACEYF+  FKDPSTFTV IVGN
Sbjct  676   ERDPYNVFTNRVTRIKYGNSYFYKPAQLNDLPKVDPEKACEYFDRSFKDPSTFTVAIVGN  735

Query  2197  IDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQ  2376
             +DP    PLIL+YLGGIP+ S P LHFN +DL GLP   P +I+RE+V SPMVEAQCSV 
Sbjct  736   LDPTIIHPLILEYLGGIPKSSVPDLHFNLEDLSGLPSNPPVNIVREIVRSPMVEAQCSVH  795

Query  2377  LCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGN  2556
             +   ++L SE MME++ F  FLS+LL+TK+ Q LRFK+G+IY   V    G +KPS+  +
Sbjct  796   ISMNIKLCSETMMEELWFTKFLSQLLQTKLTQALRFKHGEIYTVSVDSNFGYSKPSKTAD  855

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
             + G+I I+FSCDP++++TLVD++LDE LRLQE GPS+EDVS VLEIEQR +EN LQEN +
Sbjct  856   LEGEITIDFSCDPNVAATLVDVSLDETLRLQEHGPSEEDVSAVLEIEQRDYENELQENTH  915

Query  2737  WLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVV  2916
             WL +IL+SY+SR+YSG++G +F+  ++ARS+ R+ L+PLT + ALQ+ILP+PCK+ Y  V
Sbjct  916   WLFQILQSYRSRLYSGNLGSTFQELEKARSRARQTLSPLTVKWALQKILPYPCKQHYISV  975

Query  2917  ILMPQASRMKRLK  2955
              L+P+ +R + LK
Sbjct  976   TLIPETNRFRLLK  988



>tpg|DAA59001.1| TPA: hypothetical protein ZEAMMB73_046584 [Zea mays]
Length=783

 Score =  1206 bits (3120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/783 (75%), Positives = 678/783 (87%), Gaps = 1/783 (0%)
 Frame = +1

Query  730   MAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGS  906
             MAV AVGDFPDTQ+VVELI  HFG+K   P PPP+   + VPSHEEPRFSCFVESEAAGS
Sbjct  1     MAVFAVGDFPDTQAVVELINEHFGHKAPAPHPPPVIPEFSVPSHEEPRFSCFVESEAAGS  60

Query  907   AVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRP  1086
             AV+ISCKMP   +KTVKDY+D LAESMF  ALNQR FKISR+KDPPY+SCS+AAD LV P
Sbjct  61    AVVISCKMPAGGIKTVKDYKDSLAESMFHCALNQRLFKISRRKDPPYFSCSSAADALVCP  120

Query  1087  VKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQM  1266
             VKAYIMTSSC+E+GTVEALESML EVARVRLHGFS+REIS+VRAL+MSE+ESAYLERDQM
Sbjct  121   VKAYIMTSSCRERGTVEALESMLLEVARVRLHGFSDREISIVRALMMSEMESAYLERDQM  180

Query  1267  QSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIE  1446
             QSTSLRDE+LQHFLR EPV+GIEYEAQLQKTLLPHIS++EV+K++E F T+SSCVIK +E
Sbjct  181   QSTSLRDEFLQHFLREEPVVGIEYEAQLQKTLLPHISSAEVAKFAENFSTASSCVIKIVE  240

Query  1447  PRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAF  1626
             PRA A+++DL++VVLK+N+ E+ +SI PWDEE IPEEIV+  P PG I+ + E+  +GA 
Sbjct  241   PRAHASLEDLKAVVLKVNSMEEDKSIFPWDEEQIPEEIVAQAPEPGTIIAKVEHPGIGAT  300

Query  1627  EFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRP  1806
             E  LSNGMR+CYK T+FLDDQV+FTGF+YGGLSEL E+EY SCSMGSTIAGEIG FGYRP
Sbjct  301   EMILSNGMRICYKYTDFLDDQVVFTGFAYGGLSELSEAEYTSCSMGSTIAGEIGTFGYRP  360

Query  1807  SVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVM  1986
             SVLMDMLAGKRAEVGTK+GAYMR+FSGDCSPSDLETALQLVYQLFTTNVEP EE+V IVM
Sbjct  361   SVLMDMLAGKRAEVGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTTNVEPREEEVKIVM  420

Query  1987  QMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDP  2166
             QMAEEAI+AQERDPYTAFANRVRE+NYGNSYFF+PIRI DL+KV+P +ACEYFNNCFKDP
Sbjct  421   QMAEEAIYAQERDPYTAFANRVREINYGNSYFFKPIRISDLKKVDPIRACEYFNNCFKDP  480

Query  2167  STFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHS  2346
             S FTVVIVG IDPA + PL+LQYLGGIPR  +     +RDDL+GLPFKFP++IIREVV S
Sbjct  481   SAFTVVIVGKIDPAISLPLVLQYLGGIPRVQDATQPLSRDDLRGLPFKFPATIIREVVRS  540

Query  2347  PMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFL  2526
             PMVEAQC VQL FPV LK+  M ED+H+VGFLSKLLETKI+QVLRFKYGQIY+  V+VFL
Sbjct  541   PMVEAQCFVQLAFPVVLKNTMMTEDIHYVGFLSKLLETKIMQVLRFKYGQIYSVNVAVFL  600

Query  2527  GGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRA  2706
             GGNKPSR G++RGDI +NFSCDPDISS LVD  L+EI  LQ +GPS+EDV ++LEIEQRA
Sbjct  601   GGNKPSRTGDVRGDISVNFSCDPDISSKLVDFVLEEISCLQTEGPSEEDVLSILEIEQRA  660

Query  2707  HENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILP  2886
             HENGLQEN +WLDRILRSYQSR++SGD+G +F  Q+E R KVR  LTP + Q ALQR++P
Sbjct  661   HENGLQENYFWLDRILRSYQSRLFSGDIGSTFAFQEEGRIKVRDALTPQSMQSALQRVIP  720

Query  2887  FPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRSS  3066
             FPC+KQYTVVILMP++S    +KS++  +      DAKILAG AG  VL ++LWRYSRSS
Sbjct  721   FPCRKQYTVVILMPKSSCWASVKSMLSWSSNGVSRDAKILAGMAGALVLAVSLWRYSRSS  780

Query  3067  LKS  3075
             LKS
Sbjct  781   LKS  783



>ref|XP_009764558.1| PREDICTED: uncharacterized protein LOC104216239 isoform X3 [Nicotiana 
sylvestris]
Length=604

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/604 (85%), Positives = 563/604 (93%), Gaps = 0/604 (0%)
 Frame = +1

Query  1264  MQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTI  1443
             MQSTSLRDEYLQHFLRNEPV+GIEYEAQLQKTLLPHISASEVSKY E+F TSSSCVIKTI
Sbjct  1     MQSTSLRDEYLQHFLRNEPVVGIEYEAQLQKTLLPHISASEVSKYCEKFQTSSSCVIKTI  60

Query  1444  EPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGA  1623
             EPRATA VDDL++VV++IN+ E+++S+PPWD+ENIPEEIV  KP+PG I+QQ EY  +GA
Sbjct  61    EPRATAAVDDLKAVVVRINSLEREKSLPPWDDENIPEEIVCAKPNPGHIVQQLEYSTIGA  120

Query  1624  FEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYR  1803
              E  LSNGMRVCYK T+FLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG+FGYR
Sbjct  121   TELILSNGMRVCYKSTDFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGIFGYR  180

Query  1804  PSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIV  1983
             P++LMDMLAGKRAEVGTKLGAYMR+FSGDCSP+DLETALQLVYQLFTT VEPGEEDV IV
Sbjct  181   PTILMDMLAGKRAEVGTKLGAYMRTFSGDCSPTDLETALQLVYQLFTTTVEPGEEDVKIV  240

Query  1984  MQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKD  2163
             MQMAEEAI AQERDPYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKD
Sbjct  241   MQMAEEAIRAQERDPYTAFANRVRELNYGNSYFFRPIKFGDLRKVNPYKACEYFNSCFKD  300

Query  2164  PSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVH  2343
             PSTFTVVIVGNIDP+ A PL+LQYLGGIPRP EP+LHF+RDDLKGLPF+FP++I REVV 
Sbjct  301   PSTFTVVIVGNIDPSIACPLMLQYLGGIPRPPEPVLHFSRDDLKGLPFQFPTTITREVVR  360

Query  2344  SPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVF  2523
             SPMVEAQCSVQLCFPVELK+E MMEDVHFVGFLSKLLETKIVQVLRFKYGQIY+AGVSVF
Sbjct  361   SPMVEAQCSVQLCFPVELKNEKMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYSAGVSVF  420

Query  2524  LGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQR  2703
             LGGNKPSR+GNIRGDI INFSCDPDISSTLVDLALDEIL LQE+GPS++DV  VLEIEQR
Sbjct  421   LGGNKPSRLGNIRGDISINFSCDPDISSTLVDLALDEILHLQEEGPSNDDVMAVLEIEQR  480

Query  2704  AHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRIL  2883
             AHENGLQEN YWLDRILRSYQSRIYSGDVG+SF+VQD ARSKVR +LTPLTAQ+ALQRI+
Sbjct  481   AHENGLQENYYWLDRILRSYQSRIYSGDVGNSFEVQDAARSKVRSILTPLTAQLALQRIM  540

Query  2884  PFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRS  3063
             PFPCKKQYTVVILMPQASR+K+LKSL+ S  K Y  DAKILAG AGV VL L+LW+YSRS
Sbjct  541   PFPCKKQYTVVILMPQASRIKKLKSLMQSVSKSYSRDAKILAGIAGVTVLSLSLWKYSRS  600

Query  3064  SLKS  3075
             +LKS
Sbjct  601   TLKS  604



>ref|XP_009595117.1| PREDICTED: uncharacterized protein LOC104091476 isoform X3 [Nicotiana 
tomentosiformis]
Length=604

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/604 (85%), Positives = 563/604 (93%), Gaps = 0/604 (0%)
 Frame = +1

Query  1264  MQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTI  1443
             MQSTSLRDEYLQHFLRNEPV+GIEYEAQLQKTLLPHISASEVSKYSE+F TSSSCVIKTI
Sbjct  1     MQSTSLRDEYLQHFLRNEPVVGIEYEAQLQKTLLPHISASEVSKYSEKFQTSSSCVIKTI  60

Query  1444  EPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGA  1623
             EPRATA VDDL++VV++IN+ E+++S+PPWD+E+IPEEIV  K +PG I+QQ EY  +GA
Sbjct  61    EPRATAAVDDLKAVVVRINSLEREKSLPPWDDESIPEEIVCAKSNPGHIVQQLEYSTIGA  120

Query  1624  FEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYR  1803
              E  LSNGMRVCYK T+FLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG+FGYR
Sbjct  121   TELILSNGMRVCYKYTDFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGIFGYR  180

Query  1804  PSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIV  1983
             P++LMDMLAGKRAEVGTKLGAYMR+FSGDCSP+DLETALQLVYQLFTT VEPGEEDV IV
Sbjct  181   PTILMDMLAGKRAEVGTKLGAYMRTFSGDCSPTDLETALQLVYQLFTTTVEPGEEDVKIV  240

Query  1984  MQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKD  2163
             MQMAEEAI AQERDPYTAFANRVRELNYGNSYFFRPI+  DL+KVNPYKACEYFN+CFKD
Sbjct  241   MQMAEEAIRAQERDPYTAFANRVRELNYGNSYFFRPIKFGDLRKVNPYKACEYFNSCFKD  300

Query  2164  PSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVH  2343
             PSTFTVVIVGNIDP+ A PL+LQYLGGIPRP EP+LHF+RDDLKGLPF+FP++I REVV 
Sbjct  301   PSTFTVVIVGNIDPSIACPLMLQYLGGIPRPPEPVLHFSRDDLKGLPFQFPTTITREVVR  360

Query  2344  SPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVF  2523
             SPMVEAQCSVQLCFPVELK+E MMEDVHFVGFLSKLLETKIVQVLRFKYGQIY+AGVSVF
Sbjct  361   SPMVEAQCSVQLCFPVELKNEKMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYSAGVSVF  420

Query  2524  LGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQR  2703
             LGGNKPSR+GNIRGDI INFSCDPDISSTLVDLALDEIL LQE+GPS++DV  VLEIEQR
Sbjct  421   LGGNKPSRLGNIRGDISINFSCDPDISSTLVDLALDEILHLQEEGPSNDDVMAVLEIEQR  480

Query  2704  AHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRIL  2883
             AHENGLQEN YWLDRILRSYQSRIYSGDVG+SF+VQD ARSKVR +LTPLTAQ+ALQRIL
Sbjct  481   AHENGLQENYYWLDRILRSYQSRIYSGDVGNSFEVQDAARSKVRSILTPLTAQLALQRIL  540

Query  2884  PFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlWRYSRS  3063
             PFPCKKQYTVVILMPQASR+K+LKSL+ S  K Y  DAKILAG AGV VL L+LW+YSRS
Sbjct  541   PFPCKKQYTVVILMPQASRIKKLKSLMQSVSKSYSRDAKILAGIAGVTVLSLSLWKYSRS  600

Query  3064  SLKS  3075
             +LKS
Sbjct  601   TLKS  604



>ref|XP_006401291.1| hypothetical protein EUTSA_v10012682mg [Eutrema salsugineum]
 gb|ESQ42744.1| hypothetical protein EUTSA_v10012682mg [Eutrema salsugineum]
Length=656

 Score =  1035 bits (2676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/708 (71%), Positives = 576/708 (81%), Gaps = 52/708 (7%)
 Frame = +1

Query  403   VTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNAN  582
             +T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA 
Sbjct  1     MTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNAT  60

Query  583   GRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPD  762
             GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFPD
Sbjct  61    GRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFPD  120

Query  763   TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDE  942
             T++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMPV +
Sbjct  121   TKTVVDLIKTHFEDKRSSSNPPEIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPVSD  180

Query  943   LKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKE  1122
             LKTVKDYRD+LAESMF HALNQR FKISRKKDPP+++CS AAD L               
Sbjct  181   LKTVKDYRDMLAESMFLHALNQRLFKISRKKDPPFFACSVAADVL---------------  225

Query  1123  KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQH  1302
                          VARVRLHGFSEREISVVRAL+MSEIESA+LERDQ QSTSLRDEY+QH
Sbjct  226   -------------VARVRLHGFSEREISVVRALMMSEIESAFLERDQTQSTSLRDEYIQH  272

Query  1303  FLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRS  1482
             FL NEPVIGIEYEAQLQKTLLP ISAS+VSKYSE+  TS  CVIKT+EPR+ ATVDD+R+
Sbjct  273   FLHNEPVIGIEYEAQLQKTLLPQISASDVSKYSEKLRTSCGCVIKTMEPRSAATVDDMRN  332

Query  1483  VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCY  1662
             VV K+N+ E+++ I PWDEE IPEE+V+ KP+PG +  Q EY  VG  E  LSNGM+VCY
Sbjct  333   VVSKVNSLEEEKKIAPWDEEKIPEEVVNEKPTPGDVTHQLEYPEVGVTELTLSNGMQVCY  392

Query  1663  KCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRA  1842
             K T+FLDDQVLFTGFSYGGLSELPES+Y SCSMGSTIAGEIG+FGY+PSVLMDMLA    
Sbjct  393   KSTDFLDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSVLMDMLA----  448

Query  1843  EVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER  2022
                                 DLETALQLVYQLFTTNV P EE+V IVMQMAEEA+ A+ER
Sbjct  449   --------------------DLETALQLVYQLFTTNVMPQEEEVGIVMQMAEEAVRARER  488

Query  2023  DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNID  2202
             DPYT FANRV+ELNYGNSYFFRPIRI +L+KV+P KACEYFN+CF+DPSTFTVVIVGN+D
Sbjct  489   DPYTVFANRVKELNYGNSYFFRPIRISELRKVDPLKACEYFNSCFRDPSTFTVVIVGNLD  548

Query  2203  PATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC  2382
             P  A PLI QYLGGIP+P +P+L+FNRDDL+GLPF FP+ I RE V SPMVEAQCSVQLC
Sbjct  549   PTIALPLIRQYLGGIPKPPQPVLNFNRDDLRGLPFTFPTKITREFVRSPMVEAQCSVQLC  608

Query  2383  FPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFL  2526
             FPV+L +  M+E++H +GFL KLLETKI+Q LRF +GQ+Y+     FL
Sbjct  609   FPVQLTNGTMIEEIHCIGFLGKLLETKIIQFLRFTHGQVYSTIRVSFL  656



>ref|XP_003630660.1| Chloroplast processing enzyme-like protein [Medicago truncatula]
Length=624

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/633 (76%), Positives = 544/633 (86%), Gaps = 23/633 (4%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKM  225
             M+LLP+E++  + +K  FRSLKLV+ +M + LS  P GVD+G LDNGL YYVR NSKP+M
Sbjct  1     MELLPSEAAAPISRKQGFRSLKLVSTDMNQLLSDQPVGVDFGTLDNGLRYYVRCNSKPRM  60

Query  226   RAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAV  405
             RAALALAVR GSVLEEE+ERGVAHIVEHLAFSAT++Y NHDIVKFLESIGAEFGACQNAV
Sbjct  61    RAALALAVRVGSVLEEEDERGVAHIVEHLAFSATKRYNNHDIVKFLESIGAEFGACQNAV  120

Query  406   TSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANG  585
             TS+D+TVYEL VP+DKPELLSQAISILAEFSSE+R S+ DLEKERGAVMEEYRGSRNA G
Sbjct  121   TSSDDTVYELLVPVDKPELLSQAISILAEFSSEIRVSKDDLEKERGAVMEEYRGSRNATG  180

Query  586   RMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDT  765
             R+QDAHW L+MEGSKYAERLPIGLEKVIRTVSP+ V+ FYKKWYHL NMAVIAVG     
Sbjct  181   RLQDAHWTLLMEGSKYAERLPIGLEKVIRTVSPETVRHFYKKWYHLCNMAVIAVG-----  235

Query  766   QSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDEL  945
              SVVELIK HFG K   PDPPPIP + VPSH++PRFSCFVESEAAG             L
Sbjct  236   -SVVELIKVHFGQKIPAPDPPPIPTFQVPSHDDPRFSCFVESEAAGQM----------SL  284

Query  946   KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEK  1125
             KTVKDYRDLLAESMF +ALNQRFFKISR+KDPPY+SCSA+AD LVRPVK  I+TSSC+ K
Sbjct  285   KTVKDYRDLLAESMFLYALNQRFFKISRRKDPPYFSCSASADVLVRPVKTNIITSSCRGK  344

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
             GT+EALESMLTEVARVRLHGFSERE+S+VRALLMSEIESAYLERDQ+QSTSLRDEYLQHF
Sbjct  345   GTLEALESMLTEVARVRLHGFSEREVSIVRALLMSEIESAYLERDQVQSTSLRDEYLQHF  404

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSV  1485
             L NEPV+GIEYEAQLQKTLLPHISA EVSKYSE+  TS SCVIKT+EPRA A  DDL++V
Sbjct  405   LHNEPVVGIEYEAQLQKTLLPHISALEVSKYSEKLRTSCSCVIKTMEPRAFAVFDDLKNV  464

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             V K+N  E++  I  WD+++IPEEIV+ KP+ G ++++ EY N+GA E  LSNGMR+CYK
Sbjct  465   VKKVNLLEEEGGISLWDDDHIPEEIVTTKPNMGHVVKELEYSNIGATELILSNGMRICYK  524

Query  1666  CTNFLDD-------QVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDM  1824
              T+FLDD       QV+FTG+SYGGLSELPESEYFSCSMG TIAGEIGVFGYRPSVLMDM
Sbjct  525   RTDFLDDQMCHNSQQVIFTGYSYGGLSELPESEYFSCSMGPTIAGEIGVFGYRPSVLMDM  584

Query  1825  LAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQ  1923
             LAGKRAEVGTK+GAYMR+F GDCSPSDLET LQ
Sbjct  585   LAGKRAEVGTKIGAYMRTFYGDCSPSDLETGLQ  617



>ref|XP_010688402.1| PREDICTED: uncharacterized protein LOC104902351 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=812

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/780 (60%), Positives = 603/780 (77%), Gaps = 1/780 (0%)
 Frame = +1

Query  616   MEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAH  795
             M+GS YA+RLPIGLE VIR+   ++ KQFYKKWY L+NMAVIAVGDFPDT+SVVELI  H
Sbjct  1     MDGSNYAKRLPIGLELVIRSAPAEVAKQFYKKWYCLQNMAVIAVGDFPDTKSVVELIIQH  60

Query  796   FGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLL  975
             FG   SP  P    + +VP H +PRFSC VE EA+GS+V I+ KM  DE KT+ DY+D L
Sbjct  61    FGQIISPSPPVTPEH-VVPFHHKPRFSCLVEPEASGSSVEINWKMHNDEPKTIGDYKDWL  119

Query  976   AESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESML  1155
                +F  ALN+RF KISR+KD P++ CS A   LVRPVKA  ++SSCK+K  +EALESML
Sbjct  120   IGVVFRSALNRRFTKISRRKDAPFFGCSIAELELVRPVKAVQISSSCKDKSILEALESML  179

Query  1156  TEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIE  1335
             +E+AR RLH FSEREIS+  A ++SE+ESAYLER++MQS++ R +YLQHFLRNE V+G+E
Sbjct  180   SELARARLHEFSEREISIACANILSEMESAYLEREKMQSSTWRYQYLQHFLRNEAVLGLE  239

Query  1336  YEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQK  1515
             +EA+L KT+LP +SASEVS+YSE+   S S V+   EPRAT T  DL+++V   ++ E++
Sbjct  240   FEAKLYKTILPQLSASEVSRYSEKLKMSESSVVIITEPRATVTEKDLQNLVSVTDSLEEE  299

Query  1516  QSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVL  1695
             + I  W ++ IPEE+V VKP+PG ++++ +YQ++G  E  LSNGM+VCYKCT+F +DQV+
Sbjct  300   EKISAWKDDFIPEEVVQVKPNPGEVVRKSDYQDIGVTEIALSNGMKVCYKCTDFQNDQVI  359

Query  1696  FTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMR  1875
             F G+SYGG SEL ESEY SC + S+IAGEIG FGY+P+VL DMLAGKRA V T+LGAY R
Sbjct  360   FRGYSYGGYSELSESEYLSCMLSSSIAGEIGQFGYKPTVLEDMLAGKRAGVYTQLGAYTR  419

Query  1876  SFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVR  2055
             +F GDCSPSDLETALQLVYQLF T V+P EED   V+Q+ EE I A ERDPY  F NRV 
Sbjct  420   NFIGDCSPSDLETALQLVYQLFVTCVKPEEEDTRRVIQIVEEMIRADERDPYNVFTNRVT  479

Query  2056  ELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQY  2235
              + YGNSYF++P ++ DL KV+P KACEYF+  FKDPSTFTV IVGN+DP    PLIL+Y
Sbjct  480   RIKYGNSYFYKPAQLNDLPKVDPEKACEYFDRSFKDPSTFTVAIVGNLDPTIIHPLILEY  539

Query  2236  LGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMM  2415
             LGGIP+ S P LHFN +DL GLP   P +I+RE+V SPMVEAQCSV +   ++L SE MM
Sbjct  540   LGGIPKSSVPDLHFNLEDLSGLPSNPPVNIVREIVRSPMVEAQCSVHISMNIKLCSETMM  599

Query  2416  EDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDP  2595
             E++ F  FLS+LL+TK+ Q LRFK+G+IY   V    G +KPS+  ++ G+I I+FSCDP
Sbjct  600   EELWFTKFLSQLLQTKLTQALRFKHGEIYTVSVDSNFGYSKPSKTADLEGEITIDFSCDP  659

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRI  2775
             ++++TLVD++LDE LRLQE GPS+EDVS VLEIEQR +EN LQEN +WL +IL+SY+SR+
Sbjct  660   NVAATLVDVSLDETLRLQEHGPSEEDVSAVLEIEQRDYENELQENTHWLFQILQSYRSRL  719

Query  2776  YSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLK  2955
             YSG++G +F+  ++ARS+ R+ L+PLT + ALQ+ILP+PCK+ Y  V L+P+ +R + LK
Sbjct  720   YSGNLGSTFQELEKARSRARQTLSPLTVKWALQKILPYPCKQHYISVTLIPETNRFRLLK  779



>gb|KHG10444.1| putative zinc protease pqqL [Gossypium arboreum]
Length=658

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/670 (65%), Positives = 524/670 (78%), Gaps = 45/670 (7%)
 Frame = +1

Query  952   VKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGT  1131
             +KDYR++L +SMF  ALN+R F+ISR+KDPPY+SCS A+  LVR +KAYIM+SSCKEKGT
Sbjct  1     MKDYREMLVKSMFRIALNRRLFRISRRKDPPYFSCSVASYVLVRDLKAYIMSSSCKEKGT  60

Query  1132  VEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLR  1311
             +EALESML EVARVRLHGFSEREISVVR LLMS IESAYLERDQ++STSLR EY QHF  
Sbjct  61    LEALESMLIEVARVRLHGFSEREISVVRDLLMSSIESAYLERDQIESTSLRYEYSQHFTH  120

Query  1312  NEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVL  1491
             N+P+IGIEYEAQLQK++LP I ASEVSK++E+  TS SCVI+ +EP+A A+VDD++++V+
Sbjct  121   NKPIIGIEYEAQLQKSILPDILASEVSKFAEKLWTSCSCVIQIVEPQAFASVDDMKNIVM  180

Query  1492  KINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCT  1671
             KIN  E ++SI PWD+E IPEEIV                                    
Sbjct  181   KINKLENERSISPWDDEQIPEEIV------------------------------------  204

Query  1672  NFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVG  1851
                    LFTGFSYGGLSELPE++YFS SMGSTIA EIG++G+RPSVLMDMLAGKR +V 
Sbjct  205   -------LFTGFSYGGLSELPENKYFSSSMGSTIAEEIGMYGHRPSVLMDMLAGKRVDVD  257

Query  1852  TKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPY  2031
              ++ +Y RSF GDCSP  LETA QLVYQLFTT V P +E +  VMQ+ EE I A+ERDPY
Sbjct  258   VEVRSYKRSFYGDCSPFYLETAFQLVYQLFTTEVTPDDEVIKRVMQVKEETILARERDPY  317

Query  2032  TAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPAT  2211
             T+F+NR RE+NYGNSYFFRP  I DLQKV+P KAC+YFN CFKDPSTFTVVIVG IDP  
Sbjct  318   TSFSNRAREINYGNSYFFRPFGISDLQKVDPLKACKYFNTCFKDPSTFTVVIVGKIDPTV  377

Query  2212  AFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPV  2391
             A PLIL+YLGGI +P EPI HFN D +K LPFKFP S+ REVV SPM+EAQC V++CFP+
Sbjct  378   AVPLILKYLGGIGKPPEPIFHFNCDRIKSLPFKFPKSMTREVVCSPMIEAQCMVRICFPI  437

Query  2392  ELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDI  2571
             ELK   M E++H+ GFL+KLLETK++Q+LRFK+GQIY+A VS F+ G+ P   G+I GDI
Sbjct  438   ELKHGTMEEEIHYTGFLAKLLETKLLQLLRFKHGQIYSASVSEFIHGDLPCLTGDIGGDI  497

Query  2572  GINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
              I+FSCDP IS  LVD+AL+EILRLQE+GPSD+DV T+LEIEQRAHENGLQEN YWL+ I
Sbjct  498   QIDFSCDPKISLKLVDIALNEILRLQEEGPSDQDVETILEIEQRAHENGLQENYYWLNLI  557

Query  2752  LRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             + SYQSRIYS D+G SFK+ DE RSKVR  LTPLT Q+AL+RI+  PC   +TVVILMPQ
Sbjct  558   IGSYQSRIYSSDIGTSFKILDETRSKVRNSLTPLTMQLALRRIM--PCNNPHTVVILMPQ  615

Query  2932  ASRMKRLKSL  2961
              S +KR+KS 
Sbjct  616   TSWLKRIKSF  625



>gb|EMT28860.1| Putative zinc protease pqqL [Aegilops tauschii]
Length=577

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/533 (77%), Positives = 469/533 (88%), Gaps = 1/533 (0%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEE  276
             FRSLKLVNV+MEEAL   P GV YGRL NGLTYYVRSN KP+MRAAL+LAV+ GSV+EEE
Sbjct  7     FRSLKLVNVSMEEALPAEPVGVAYGRLANGLTYYVRSNPKPRMRAALSLAVKVGSVVEEE  66

Query  277   EERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKP  456
             +ERGVAHIVEHLAFSAT +YTNHDIV+FLESIGAEFGACQNA+TS+DET+YEL VP+DKP
Sbjct  67    DERGVAHIVEHLAFSATSRYTNHDIVRFLESIGAEFGACQNALTSSDETIYELLVPVDKP  126

Query  457   ELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYA  636
              LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYA
Sbjct  127   GLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNATGRMQDSHWTLLFEGSKYA  186

Query  637   ERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSp  816
             ERLPIG EKVIRTV+ + V+ FY KWY+L NMAV AVGDFPDTQ+VVELIK HFG K S 
Sbjct  187   ERLPIGTEKVIRTVTHETVRNFYHKWYNLSNMAVFAVGDFPDTQAVVELIKEHFGQKASI  246

Query  817   pdpppip-YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFF  993
               PPP+   + VPSH EPRFSCFVESEAAGSAV+ISCKMP  E+KTVKDYRD LAES+F 
Sbjct  247   SCPPPVIPEFPVPSHIEPRFSCFVESEAAGSAVVISCKMPAGEIKTVKDYRDSLAESIFH  306

Query  994   HALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARV  1173
              ALNQR FK+SR++DPPY+SCS+AAD LVRPVKAYIMTSSC+EKGTVEALESML EVAR 
Sbjct  307   CALNQRLFKLSRRRDPPYFSCSSAADALVRPVKAYIMTSSCREKGTVEALESMLVEVARA  366

Query  1174  RLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQ  1353
             RL+GFSEREIS+VRAL+MSEIESAYLERDQMQSTSLRDEYLQHFLR EPV+GI+YEA+LQ
Sbjct  367   RLYGFSEREISIVRALMMSEIESAYLERDQMQSTSLRDEYLQHFLREEPVVGIDYEARLQ  426

Query  1354  KTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPW  1533
             KTLLP+IS++EV K++E F T+SSCVIK +EPRA A+++DL++VVLK+NT E+K+SIPPW
Sbjct  427   KTLLPYISSAEVVKFAENFSTTSSCVIKIVEPRAHASLEDLKAVVLKVNTLEEKRSIPPW  486

Query  1534  DEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQV  1692
             +EE IPEEIVS  P PG I+ + E+  +GA E  LSNGMRVCYKCT+FLDDQ+
Sbjct  487   EEEQIPEEIVSQSPVPGIIVDKVEHPGIGATEMILSNGMRVCYKCTDFLDDQM  539



>gb|EEE54808.1| hypothetical protein OsJ_02226 [Oryza sativa Japonica Group]
Length=1084

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/609 (69%), Positives = 488/609 (80%), Gaps = 28/609 (5%)
 Frame = +1

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSC  1428
             LE+D      ++ + L HFL  +PV+GIEYEAQLQKTLLPHIS++EV K++  F T SSC
Sbjct  504   LEQDNAIPPWMKSKSL-HFLHEDPVVGIEYEAQLQKTLLPHISSAEVVKFAANFSTISSC  562

Query  1429  VIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEY  1608
             VIK +EP A A+++DL++VVLK+NT EQ  +IPPWDEE IPEEIVS  P PG I+ + E+
Sbjct  563   VIKVVEPHAHASLEDLKAVVLKVNTLEQDNAIPPWDEEQIPEEIVSQSPEPGSILDKVEH  622

Query  1609  QNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG  1788
               +GA E  LSNGMR+CYKCT+FLDDQV+FTGF+YGGLSEL E EY SCSMGSTIAGEIG
Sbjct  623   PGIGATEMILSNGMRICYKCTDFLDDQVVFTGFAYGGLSELSEDEYTSCSMGSTIAGEIG  682

Query  1789  VFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEE  1968
             +FGYRPSVLMDMLAGKRAEVGTK+GAYMRSFSGDCSPSDLETALQLVYQLFTT VEP EE
Sbjct  683   IFGYRPSVLMDMLAGKRAEVGTKVGAYMRSFSGDCSPSDLETALQLVYQLFTTKVEPREE  742

Query  1969  DVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFN  2148
             +V IVMQMAEEAI+AQERDPYTAFANR RE+NYGNSYFF+PIRI DL+KV+P +ACEYFN
Sbjct  743   EVKIVMQMAEEAIYAQERDPYTAFANRAREINYGNSYFFKPIRISDLKKVDPIRACEYFN  802

Query  2149  NCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSII  2328
             NCFKDPS FTVVIVGNIDP+ + PLILQYLGGIP     +L   RDDLKGLPFKFP +II
Sbjct  803   NCFKDPSAFTVVIVGNIDPSISVPLILQYLGGIPNVGNAVLPLTRDDLKGLPFKFPETII  862

Query  2329  REVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNA  2508
             REVV SPMVEAQC VQL FPV LKS  M ED+H+VGFLSKLLETKI+QVLRFKYGQ+Y+ 
Sbjct  863   REVVRSPMVEAQCFVQLGFPVVLKSTTMTEDIHYVGFLSKLLETKIMQVLRFKYGQVYSV  922

Query  2509  GVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVL  2688
              V VFLGGNKPSR G+IRGDI +NFSCDPD+SS LVD  L+EI  LQ +GPS+EDV T+L
Sbjct  923   NVGVFLGGNKPSRSGDIRGDISVNFSCDPDMSSKLVDFVLEEISFLQNEGPSEEDVLTIL  982

Query  2689  EIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMA  2868
             EIEQRAHENGLQ                           +QDE R KVR+ LTP + QMA
Sbjct  983   EIEQRAHENGLQ---------------------------IQDEGRLKVREALTPQSMQMA  1015

Query  2869  LQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAKIlagtagvavllltlW  3048
             LQR++PFPC+KQ+TVVILMP++S     K+L+  +P  +  DAKILAG AG  VL ++LW
Sbjct  1016  LQRVVPFPCRKQFTVVILMPKSSCWNSFKALLTWSPGGFSRDAKILAGMAGAIVLAVSLW  1075

Query  3049  RYSRSSLKS  3075
             RYSRS+L+S
Sbjct  1076  RYSRSTLRS  1084


 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/480 (76%), Positives = 417/480 (87%), Gaps = 1/480 (0%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEE  276
             FRSLK+V+V+M+E L   P GV YGRL NGL YYVRSN KP+MRAAL+LAV+ GSV+EEE
Sbjct  34    FRSLKMVSVSMDEPLPAEPVGVAYGRLANGLAYYVRSNPKPRMRAALSLAVKVGSVVEEE  93

Query  277   EERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKP  456
             +ERGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA+TS+DET+YEL VP+DKP
Sbjct  94    DERGVAHIVEHLAFSATSRYTNHDIVKFLESIGAEFGACQNALTSSDETIYELLVPVDKP  153

Query  457   ELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYA  636
              LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYA
Sbjct  154   GLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNATGRMQDSHWALLFEGSKYA  213

Query  637   ERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSp  816
             ERLPIG EKVIRTV  + V+ FY KWYHL NMAV AVGDFPDTQ+VVE+IK HFG K  P
Sbjct  214   ERLPIGTEKVIRTVPHETVRHFYHKWYHLSNMAVFAVGDFPDTQAVVEMIKEHFGQKAPP  273

Query  817   pdpppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFF  993
               PPP+   + VPSH EPRFSCFVESEAAGSAV++SCKMP D +KTV DYRD LAESMF 
Sbjct  274   SCPPPVIPDFPVPSHVEPRFSCFVESEAAGSAVVVSCKMPADRIKTVTDYRDSLAESMFH  333

Query  994   HALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARV  1173
              ALNQR FKISR+ DPPY+SCS+AAD LVRPVKAYIMTSSC+E+GTVEALESML EVARV
Sbjct  334   CALNQRLFKISRRNDPPYFSCSSAADALVRPVKAYIMTSSCRERGTVEALESMLLEVARV  393

Query  1174  RLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQ  1353
             RLHGFSEREIS+ RAL+MS+IESAYLERDQMQST+LRDE+LQHFL  +PV+GIEYEAQLQ
Sbjct  394   RLHGFSEREISIARALMMSDIESAYLERDQMQSTTLRDEFLQHFLHEDPVVGIEYEAQLQ  453

Query  1354  KTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPW  1533
             KTLLPHIS++EV K++  F T SSCVIK +EP A A+++DL++VVLK+NT EQ  +IPPW
Sbjct  454   KTLLPHISSAEVVKFAANFSTISSCVIKVVEPHAHASLEDLKAVVLKVNTLEQDNAIPPW  513



>ref|XP_010485190.1| PREDICTED: uncharacterized protein LOC104763532, partial [Camelina 
sativa]
Length=534

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/534 (75%), Positives = 464/534 (87%), Gaps = 2/534 (0%)
 Frame = +1

Query  46    MDLLPAESSQMLPKKHRFRSLKLVNVNMEEALSQTP--YGVDYGRLDNGLTYYVRSNSKP  219
             MDL+  ESS+ + +KH FRSLKL++V+ME+ L   P  +G DYGRLDNGL YYVR NSKP
Sbjct  1     MDLIAGESSKKVLRKHGFRSLKLMSVDMEQELGNEPEPFGADYGRLDNGLVYYVRRNSKP  60

Query  220   KMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQN  399
             +MRAALALAV+ GSVLEEE++RGVAHIVEHLAFSAT +YTNHDIVKFLES+GAEFG CQN
Sbjct  61    RMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIVKFLESVGAEFGPCQN  120

Query  400   AVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNA  579
             A+T+ADET+YELFVP+DKPELLSQAISILAEFSSE+R S+ DL+KERGAVMEEYRG+RNA
Sbjct  121   AMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLDKERGAVMEEYRGNRNA  180

Query  580   NGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFP  759
              GRMQD+HW LMMEGSKYAERLPIGLEKVIR+V    VKQFY+KWYHL NMAV+AVGDFP
Sbjct  181   TGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQKWYHLCNMAVVAVGDFP  240

Query  760   DTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVD  939
             DT++VV+LIK HF  K S  +PP IP + VPSHEE RFSCFVESEAAGSAVMIS KMP+ 
Sbjct  241   DTKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFVESEAAGSAVMISYKMPIS  300

Query  940   ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK  1119
             +LKTVKDYRD+LAESMF HALNQR FKISR+KDPP+++CS AAD LV P+KAYIM+SSCK
Sbjct  301   DLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSVAADVLVSPLKAYIMSSSCK  360

Query  1120  EKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQ  1299
             EKGT+ +LESML EVARVRLHGFSEREISVVRAL+MSEIESAYLERDQ+QSTSLRDEY+Q
Sbjct  361   EKGTLASLESMLLEVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQ  420

Query  1300  HFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR  1479
             HFL  EPVIGIEYEAQLQKTLLP ISAS+V++YSE+  TS  CVIKT+EPR+ AT+DDLR
Sbjct  421   HFLHKEPVIGIEYEAQLQKTLLPQISASDVARYSEKLRTSCGCVIKTMEPRSAATIDDLR  480

Query  1480  SVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLS  1641
             +VV K+N+ E+++ I PWDEE IPEE+V  KP+PG +  Q EY  VG  E  LS
Sbjct  481   NVVSKVNSLEEEKMIAPWDEEKIPEEVVDEKPTPGEVTHQLEYPEVGVTELTLS  534



>gb|EMS58066.1| putative zinc protease pqqL [Triticum urartu]
Length=1114

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/535 (76%), Positives = 468/535 (87%), Gaps = 1/535 (0%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEE  276
             FRSLKLVNV+MEEAL   P GV YGRL NGLTYYVRSN KP+MRAAL+LAV+ GSV+EEE
Sbjct  28    FRSLKLVNVSMEEALPAEPVGVAYGRLANGLTYYVRSNPKPRMRAALSLAVKVGSVVEEE  87

Query  277   EERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKP  456
             ++RGVAHIVEHLAFSAT +YTNHDIV+FLESIGAEFGACQNA+TS+DET+YEL VP+DKP
Sbjct  88    DQRGVAHIVEHLAFSATSRYTNHDIVRFLESIGAEFGACQNALTSSDETIYELLVPVDKP  147

Query  457   ELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYA  636
              LLSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ EGSKYA
Sbjct  148   GLLSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNATGRMQDSHWTLLFEGSKYA  207

Query  637   ERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSp  816
             ERLPIG EKVIRTV+ + V+ FY KWY+L NMAV AVGDFPDTQ+VVELIK HFG K S 
Sbjct  208   ERLPIGTEKVIRTVTHETVRNFYHKWYNLSNMAVFAVGDFPDTQAVVELIKEHFGQKASI  267

Query  817   pdpppip-YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFF  993
               PPP+   + VPSH EPRFSCFVESEAAGSAV+ISCKMP  E+KTVKDYRD LAES+F 
Sbjct  268   SCPPPVIPEFPVPSHIEPRFSCFVESEAAGSAVVISCKMPAGEIKTVKDYRDSLAESIFH  327

Query  994   HALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARV  1173
              ALNQR FK+SR++DPPY+SCS+AAD LVRPVKAYIMTSSC+EKGTVEALESML EVAR 
Sbjct  328   CALNQRLFKLSRRRDPPYFSCSSAADALVRPVKAYIMTSSCREKGTVEALESMLVEVARA  387

Query  1174  RLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQ  1353
             RL+GFSEREIS+V AL+MSEIESAYLERDQMQSTSLRDEYLQHFL  EPV+GIEYEA+LQ
Sbjct  388   RLYGFSEREISIVSALMMSEIESAYLERDQMQSTSLRDEYLQHFLCEEPVVGIEYEARLQ  447

Query  1354  KTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPW  1533
             KTLLP+IS++EV K++E F T+SSCVIK +EPRA A+++DL++VVLK+NT E+K+SIPPW
Sbjct  448   KTLLPYISSAEVVKFAENFSTTSSCVIKIVEPRAHASLEDLKAVVLKVNTLEEKRSIPPW  507

Query  1534  DEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLF  1698
             +EE IPEEIVS  P PG I+ + E+  +GA E  LSNGMRVCYKCT+FLDDQ +F
Sbjct  508   EEEQIPEEIVSRSPVPGIIVDKVEHPGIGATEMILSNGMRVCYKCTDFLDDQNIF  562



>ref|NP_001136725.1| uncharacterized protein LOC100216862 [Zea mays]
 gb|ACF82472.1| unknown [Zea mays]
Length=544

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/497 (77%), Positives = 439/497 (88%), Gaps = 1/497 (0%)
 Frame = +1

Query  103   SLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEE  282
             SLKLV+V M+E L   P G  YGRL NGLTYYVRSN KP+MRAAL+LAV+ GSV+EEE+E
Sbjct  33    SLKLVSVAMDETLPVDPVGATYGRLANGLTYYVRSNPKPRMRAALSLAVKVGSVVEEEDE  92

Query  283   RGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPEL  462
             RGVAHIVEHLAFSAT +YTNHDIVKFLESIGAEFGACQNA+TS+DET+YEL VP+DKP L
Sbjct  93    RGVAHIVEHLAFSATARYTNHDIVKFLESIGAEFGACQNALTSSDETIYELLVPVDKPGL  152

Query  463   LSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAER  642
             LSQAIS+LAEFSSEVR S  DLEKERGAV+EEYRG RNA GRMQD+HW L+ +GSKYAER
Sbjct  153   LSQAISVLAEFSSEVRVSAEDLEKERGAVLEEYRGGRNAAGRMQDSHWALLFDGSKYAER  212

Query  643   LPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppd  822
             LPIG EKVIRTV+ + VK+FY+KWYHL NMAV AVGDFPDTQ+VVELI  HFG+K   P 
Sbjct  213   LPIGTEKVIRTVTHETVKRFYQKWYHLSNMAVFAVGDFPDTQAVVELINEHFGHKAPAPH  272

Query  823   pppipY-YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHA  999
             PPP+   + VPSHEEPRFSCFVESEAAGSAV+ISCKMP   +KTVKDY+D LAESMF  A
Sbjct  273   PPPVIPEFSVPSHEEPRFSCFVESEAAGSAVVISCKMPAGGIKTVKDYKDSLAESMFHCA  332

Query  1000  LNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRL  1179
             LNQR FKISR+KDPPY+SCS+AAD LV PVKAYIMTSSC+E+GTVEALESML EVARVRL
Sbjct  333   LNQRLFKISRRKDPPYFSCSSAADALVCPVKAYIMTSSCRERGTVEALESMLLEVARVRL  392

Query  1180  HGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKT  1359
             HGFS+REIS+VRAL+MSE+ESAYLERDQMQSTSLRDE+LQHFLR EPV+GIEYEAQLQKT
Sbjct  393   HGFSDREISIVRALMMSEMESAYLERDQMQSTSLRDEFLQHFLREEPVVGIEYEAQLQKT  452

Query  1360  LLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDE  1539
             LLPHIS++EV+K++E F T+SSCVIK +EPRA A+++DL++VVLK+N+ E+ +SI PWDE
Sbjct  453   LLPHISSAEVAKFAENFSTASSCVIKIVEPRAHASLEDLKAVVLKVNSMEEDKSIFPWDE  512

Query  1540  ENIPEEIVSVKPSPGWI  1590
             E IPEEIV+  P PG++
Sbjct  513   EQIPEEIVAQAPEPGYL  529



>ref|XP_005649759.1| chloroplast processing enzyme-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25215.1| chloroplast processing enzyme-like protein [Coccomyxa subellipsoidea 
C-169]
Length=949

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/972 (42%), Positives = 590/972 (61%), Gaps = 48/972 (5%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVD---YGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVL  267
             FR L  + +  +E  +  P G D   YG+L NGL YYV + +KPK RAALAL VR GSV+
Sbjct  5     FRRLPDIELTSDEWSAPPPLGPDGVRYGQLRNGLRYYVCATTKPKQRAALALVVRIGSVV  64

Query  268   EEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPI  447
             EE+ ERG+AHIVEHLAF+AT+ + +HDIVKFLESIGA+FGACQNA T+ DETVYEL VP 
Sbjct  65    EEDHERGLAHIVEHLAFNATDAFQSHDIVKFLESIGAKFGACQNAYTTVDETVYELTVPS  124

Query  448   DKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGS  627
             D P+LL QA S+LA+F++ VR S  DL+KERG V+EE+R  +++ GR Q+ HW L++ GS
Sbjct  125   DDPKLLGQAFSVLAQFAAAVRCSPEDLQKERGPVLEEWRMGKDSMGRAQEVHWELILRGS  184

Query  628   KYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHF---  798
             KYAERLPIGL+ +I+ V   +V+ FY++WY   + AV+  GDF D  +VV ++       
Sbjct  185   KYAERLPIGLKDIIQGVPADVVRSFYERWYRPEHQAVVVTGDF-DPDAVVAMLTEKLEGC  243

Query  799   GYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLA  978
               + + P P    Y LVP H +PRF  F++ EA  S V +S K     + T   Y   L 
Sbjct  244   QSRETTPAPAIPRYPLVP-HNQPRFKVFIDKEAQQSLVHVSFKTETAPVTTPAQYLSSLR  302

Query  979   ESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLT  1158
             E +F  A+N RFF+I R+++PP+Y+     + +   +++ ++T+S +EK T  ALE++L+
Sbjct  303   EDLFHTAMNSRFFRIGRRQNPPFYNAQIGTEQITATIRSIVLTASTQEKNTSRALEAILS  362

Query  1159  EVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEY  1338
             E+A VR+HG S+REI       MS+ ES ++ER Q+ +  LR EY++HFL  E V+  + 
Sbjct  363   ELASVRIHGLSKREIRSAIDFHMSDAESLFIERHQVYAEELRGEYVRHFLNGEFVVDRKR  422

Query  1339  EAQLQKTLLPHISASEVSKYSE---RFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFE  1509
             EA L K++L  IS  +   + E   +  ++S+ V+KT   R   T +DL  VV +++  E
Sbjct  423   EAHLCKSMLNKISREDGHAFQELAHKCCSTSNMVVKTTSHRRVVTEEDLADVVARVDRAE  482

Query  1510  QKQSIPPWDE-ENIPEEIV--SVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFL  1680
                 I   D   + P  ++    +P  G I+ + ++  +GA E  LSNGM+VCYKCT+ L
Sbjct  483   ANGEIKAPDMLADAPTSVIPPGKEPQAGEIVHRRQFPKLGAIELVLSNGMKVCYKCTDLL  542

Query  1681  DDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKL  1860
             DDQ+L TG + GGL+E+ + EY + S G+T+A E+G+FG +P V MD+L GKR  +  + 
Sbjct  543   DDQILCTGLAPGGLTEVGQDEYRTASFGATLAQEMGLFGIKPEVTMDLLTGKRCGINVQE  602

Query  1861  GAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAF  2040
             GAY RS  G+ +P DLET LQL+Y LFTT V P   +++  MQ   E   AQ R+P   F
Sbjct  603   GAYWRSIGGEQAPVDLETGLQLIYALFTTAVTPVPAELDTCMQYLREVTLAQLRNPMRRF  662

Query  2041  ANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFP  2220
             A+RVR+L + + YF+RP  +RDL +V+P+ AC +FN  F +P+ F++   G++       
Sbjct  663   ADRVRQLIFQDCYFYRPFSLRDLARVDPHAACAHFNRSFCNPAEFSICFTGSLKADEFEE  722

Query  2221  LILQYLGGIPRPSEPILHFNR--DDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVE  2394
             L+ +YL  IP P++      +  D LK L F+FP  ++RE V   MVE      + FP  
Sbjct  723   LVKKYLAAIP-PADSTCPAPKSPDKLKPLEFQFPDGVLREDVRVSMVENMSQALIAFPAR  781

Query  2395  L--KSEDMM---EDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKP-SRVGN  2556
             L   + D +    +  ++  + KLLETK++Q LRF++G++Y   V+    G  P S  G 
Sbjct  782   LAIATTDGLPCGNEAVWLFLVCKLLETKLMQKLRFEFGEVYTVAVAPSFSGEAPCSSKGY  841

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
               GD+ I FSCDPD +  L+++AL E+ RLQE+GPS+EDV TVL ++QR+ E   QEN +
Sbjct  842   SDGDVAITFSCDPDNAQRLIEMALSEMHRLQEEGPSEEDVKTVLVLDQRSWETEQQENSF  901

Query  2737  WLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVV  2916
             W + +                          V+    P + Q AL R+ P PC  +Y  +
Sbjct  902   WHNNL-------------------------AVQAAADPASVQAALCRLFPMPCHSRYVAL  936

Query  2917  ILMPQASRMKRL  2952
              L+PQ   + R+
Sbjct  937   TLLPQKPLLSRM  948



>ref|XP_002502523.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63781.1| predicted protein [Micromonas sp. RCC299]
Length=1075

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/964 (41%), Positives = 566/964 (59%), Gaps = 46/964 (5%)
 Frame = +1

Query  166   YGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNH  345
             +G L NG+ YYV+   KPK RAALALAV  GS+ E EEERGVAH+VEHLAF ATE   N 
Sbjct  87    HGTLPNGMRYYVQKTHKPKDRAALALAVDVGSIAETEEERGVAHLVEHLAFRATESNDNF  146

Query  346   DIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHD  525
              IVKFLESIGAEFGACQNA TS DETVYEL VPIDKP +L Q++ + AEF++++R S+ D
Sbjct  147   AIVKFLESIGAEFGACQNAYTSMDETVYELLVPIDKPNVLEQSLDVFAEFATKIRISDGD  206

Query  526   LEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFY  705
             +  ERGAVMEE R  R+A GR  +A+W ++M+GS YAERLPIGLEKV+R   P++ ++FY
Sbjct  207   VNDERGAVMEELRMGRDARGRASEAYWKMLMQGSLYAERLPIGLEKVVREGDPEVFRRFY  266

Query  706   KKWYHLRNMAVIAVGDFPDTQSVVELIKAHFG----YKTSppdpppipYYLVPSHEEPRF  873
             KKWY    MAV+A GDF +  +V +LIK  F      +  P + P +   L+  H EPR 
Sbjct  267   KKWYRPERMAVVAAGDFENLGAVEKLIKQAFAKCAPAEGQPKENPKVERPLIAPHVEPRI  326

Query  874   SCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYS  1053
             +C V+ EA  ++V ++ K    E  T   +     E  F  AL+ R +KI RK DPP++S
Sbjct  327   TCMVDREATKTSVTVTFKYEASECATPSGFFTKTVEDSFKLALDNRLYKIMRKADPPFFS  386

Query  1054  CSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
              + + +   R    + +   C+E    + LE+ L E+ R RLHGFSE+E+ +  A  +++
Sbjct  387   AACSIEEATRTTTIFSLQIVCEEGKAKQGLEAGLRELTRARLHGFSEQELRIAGAKQLAD  446

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
              E  ++ERDQ   TSLRDE + HFLR E V+G E EA++ +  +  +  S++ ++++R  
Sbjct  447   AEQLFVERDQTYCTSLRDELVGHFLRGEFVVGAEEEARITRACVERVKTSDLKEFAKRLN  506

Query  1414  TSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIV--SVKPSPGW  1587
              ++SCVI+ +E RA  T  D+   +  I   E   +I   +  N+PE ++     P PG 
Sbjct  507   FNNSCVIRAMEGRALTTEKDIAGAIDTIQREEHAGAITENEMFNVPERLIEEDTLPPPGK  566

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I  + ++  +G     LSNGM+V  K T+FLDDQVL   F+ GGLSE+ + +Y      +
Sbjct  567   IEGERKFPKLGFKIVQLSNGMQVAMKQTDFLDDQVLVRCFARGGLSEVDQKDYLDALYAN  626

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
             TIA E+G +G +P +L D+LAGKR +V  K G Y R   G+ SP+D+E+ LQL++ LFT+
Sbjct  627   TIASELGSYGVKPEILADILAGKRCDVAAKTGTYYRKVDGEASPTDIESTLQLIHMLFTS  686

Query  1948  NVEPG--EEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVN  2121
             +V+     E++  V++M EEAI  + RDP + +   +R L YG S+  +P+R++D++K+ 
Sbjct  687   DVKSMLVPEELEAVLRMQEEAIRNRSRDPVSIYNQTIRHLVYGKSFQSQPLRVKDVRKMK  746

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGI---PRPSEPILHFNRDDL  2292
             P KACE+FN  F DPS FT+V+VG  D     P+I +YLG I   P P   +L      +
Sbjct  747   PAKACEHFNASFGDPSEFTMVLVGAFDERRVRPMIEKYLGSIQPSPNPKGRVLQ-----V  801

Query  2293  KGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVG------------  2436
                PFKFP  ++   +   MVE      + FPV + + D     H  G            
Sbjct  802   TPAPFKFPRGVVNRDLRVAMVEPMAQASITFPVNIPNPDYN---HKTGQATPSLEGSVAL  858

Query  2437  --------FLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGN-IRGDIGINFSC  2589
                     F S ++E +++ +LRFK+G+IY    S       P   G   RGDI INFSC
Sbjct  859   TREKLTCVFASSIIERRLLALLRFKFGEIYTCAASTSFAYQDPQARGPYFRGDIMINFSC  918

Query  2590  DPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
             DP     L  LA++++  +Q +GP+ E+V+T +E+E RA E  +QEN YW +     + S
Sbjct  919   DPIAGHRLAQLAMEDVGAMQREGPTAEEVTTAVELETRALEVRVQENSYWREYFEALHNS  978

Query  2770  R---IYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASR  2940
             R   +  GD+   ++V +  R ++   LTP   +  L R +     K   VV+L PQ   
Sbjct  979   RLSPLMEGDLDQLYQVSERTRKELMDGLTPEMVRAHLLRCVNL---KNRVVVVLRPQRPL  1035

Query  2941  MKRL  2952
              +RL
Sbjct  1036  WQRL  1039



>ref|XP_003056917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58562.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1059

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/936 (41%), Positives = 550/936 (59%), Gaps = 33/936 (4%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G L NG+ +YV    KPK RA+LALAV  GS+ EEE+E+GVAH+VEHLAF ATE   N  
Sbjct  75    GTLANGMKFYVMRTFKPKDRASLALAVDVGSIAEEEDEQGVAHLVEHLAFRATESNENFH  134

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             IVKFLESIGAEFGACQNA TS DETVYEL VPIDKP +L +A+SI++E+ ++VR S+ D+
Sbjct  135   IVKFLESIGAEFGACQNAYTSMDETVYELTVPIDKPGILDEALSIMSEWVNKVRISDDDV  194

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
               ERGAV+EE R  R+A GR  +A+W L+M GSKYAERLPIGL+ VI+   P++ ++FY+
Sbjct  195   RDERGAVLEEMRMGRDARGRSAEAYWKLLMSGSKYAERLPIGLQSVIKDGDPEVFRRFYR  254

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYL----VPSHEEPRFS  876
             KWY    MAV+ VGDFPD   V E I   F   +  P  P     +    +  H  PR +
Sbjct  255   KWYRPERMAVVVVGDFPDLDGVAESIAKTFETCSPAPGQPVENPVVHRPTIAPHAAPRVT  314

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
             C V+ E   + V ++ K     + T     +   E  F  A++ R +KI RK DPP++S 
Sbjct  315   CDVDKEHTKTMVTVTYKYASGGISTPGGLFEKTVEEAFKLAIDNRLYKIMRKADPPFFSA  374

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             + + +   R    + +   C E      L + L E+ R RLHG SE+E+ +  A  ++E 
Sbjct  375   ACSVEDATRTTTMFSVQIVCDEGKVTRGLAAGLREMTRARLHGISEQELKIAAAKQLAEA  434

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E  Y+ERDQ   TSLRDE + HFLR E V+G E EA+L K     +  +    + ++F  
Sbjct  435   EQLYVERDQTYCTSLRDELVGHFLRGELVVGAEEEARLSKACTEKMRTTHADAFGKKFSV  494

Query  1417  SSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVS--VKPSPGWI  1590
              +SC I+ +E R + TV+++ +VV +I   E    I       +P  ++     P PG +
Sbjct  495   DASCTIRVMEGRRSTTVEEIEAVVREIQREEDAGEITENAMFQVPSVVLKDEALPPPGRV  554

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
              ++  + +VG     LSNGM+V  K T+FLDDQVL   F+ GGLSE+PESEY      +T
Sbjct  555   TEERSFPSVGFEVLTLSNGMKVGMKTTDFLDDQVLVRCFAKGGLSEVPESEYLDALYANT  614

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             IA E+G+FG +P +L D+LAGKR +V +K G Y R   GD SP+D+E+ LQL++ LFT+N
Sbjct  615   IATELGIFGLKPEILSDVLAGKRCDVSSKTGTYYRRVDGDTSPTDIESGLQLIHALFTSN  674

Query  1951  VEPG--EEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNP  2124
             V      E++  V++M E+AI  + R+P T F   +R L YG SY  RP++  D++K+ P
Sbjct  675   VRDMLVPEELEAVLRMQEQAIRNRSRNPNTLFHETIRYLAYGRSYMTRPLKPSDVRKMRP  734

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              +ACE+FN  + DPS F V +VG  D     P++ +YLG IP PS+   H ++  L    
Sbjct  735   LRACEHFNASYSDPSEFAVALVGAFDADRVRPMLEKYLGSIPVPSDSKPHDSK-PLTPAT  793

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSED-----------------MMEDVHFV  2433
             FKFPS ++ + +  PMVE      + FP+ + + D                 +    H  
Sbjct  794   FKFPSGVVNKTIRVPMVEPMAMASIIFPINIPNPDHDAVTGEVVATVEGSAKIRRMKHIS  853

Query  2434  GFLSKLLETKIVQVLRFKYGQIY--NAGVSVFLGGNKPSRVGN-IRGDIGINFSCDPDIS  2604
                S ++E +++ +LRFK+G+IY  +AG S F   ++ + VG+ IRGD+ I+FSCDPD  
Sbjct  854   VTASGIIERRLLALLRFKFGEIYTCSAGAS-FSYQDQSAMVGDVIRGDVMISFSCDPDAG  912

Query  2605  STLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR---I  2775
               L  LAL+ ++ L E+GP+ EDV T +E+E+R  E   +EN YW +       SR   +
Sbjct  913   QRLAALALENVVDLIENGPTLEDVKTAVEVERRTLEVSAKENSYWREYFQALTNSRLAPV  972

Query  2776  YSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRIL  2883
               GD+   F++ +  R ++   +TP   +  L+  L
Sbjct  973   VDGDLDAIFELSERTREELLDGITPAIVREHLRECL  1008



>ref|XP_002952218.1| hypothetical protein VOLCADRAFT_105434 [Volvox carteri f. nagariensis]
 gb|EFJ46689.1| hypothetical protein VOLCADRAFT_105434 [Volvox carteri f. nagariensis]
Length=1102

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/1018 (39%), Positives = 580/1018 (57%), Gaps = 92/1018 (9%)
 Frame = +1

Query  97    FRSLKLVNVN---MEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVL  267
             +  L+ V+V+     E L   P G+ YG L NG+ YYVR  +KPK R ALALAVR GSV+
Sbjct  5     YDQLEAVDVSGDKFHEPLPLGPDGLRYGNLPNGMKYYVRQCAKPKGRCALALAVRVGSVV  64

Query  268   EEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPI  447
             EEE+ERGVAHIVEHLAF+ATE Y+NHDIV+ LE IGAEFGACQNA TSADETVY L VP 
Sbjct  65    EEEDERGVAHIVEHLAFNATESYSNHDIVRLLERIGAEFGACQNAYTSADETVYTLTVPT  124

Query  448   -DKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEG  624
              DK  LL + + ++AE + ++R    DL KERGAV+EE+R SR+A GR+Q+AHW L+ +G
Sbjct  125   GDKEGLLDETLGVMAEMAFKIRCDPGDLAKERGAVLEEWRMSRDAGGRLQEAHWQLIFQG  184

Query  625   SKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFG-  801
             SKYA+RLPIG E VIR  S   V+ FY++WY   NMA++AVGDF +   VV+LI+ H G 
Sbjct  185   SKYADRLPIGTEAVIRRGSAATVRAFYERWYRPENMALVAVGDFAEPDVVVDLIRRHLGS  244

Query  802   --YKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLL  975
                ++S    PP  +  VP H EPRF   ++ E     V +S K P   + T  D+ + L
Sbjct  245   GASRSSETPIPPPRFEYVP-HAEPRFKVLIDRETQHPVVYVSYKHPRIRISTPGDFLEHL  303

Query  976   AESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESML  1155
               S+F  A+N R +KISR++ PP+ S S + + L     + +++++  +   + ALES+L
Sbjct  304   TLSIFEVAINNRLYKISRQRQPPFASASVSEEPLCATTGSCVLSATAMDGEALTALESLL  363

Query  1156  TEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGI-  1332
             TEVARVRLHG    E +   + + SEIE+  LE DQ   T +RDEY++HFL NE V G+ 
Sbjct  364   TEVARVRLHGIGPAEFARAISEMTSEIENTALEADQGYCTEIRDEYVRHFLYNEFVTGMG  423

Query  1333  ----------------------------------------------EYEAQLQKTLLPHI  1374
                                                           EYE++L KTL+P +
Sbjct  424   AKIRPPRQLCLLKAAIGTLAMDERYGLDPVYTWQDVVRNGCTMLCQEYESRLGKTLIPLV  483

Query  1375  SASEVSKYSERFGTSSSCVIKT----IEPRATATVDDLRSVVLKINTFEQKQSIPPWDEE  1542
             +   V + ++++    SCV+K     ++   + T D LR V+ ++   E   +I PW+E 
Sbjct  484   TREAVEQCAKKYRPCDSCVVKASVRVVDHSRSCTEDQLRKVLERVAADEASGAIGPWEEP  543

Query  1543  NIPEEIVSVKPSP----GWIMQQFEY-QNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGF  1707
               PE +++  P+P      ++Q+  +   +   E  L NGMRV +K T F+ D++  TGF
Sbjct  544   PAPESLMTELPTPLPLESAVVQERHFPAPLDVTELTLCNGMRVAFKSTTFMRDEIHLTGF  603

Query  1708  SYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSG  1887
             + GGLSE P   +++ S+  T+AG +GVFG+RP VL D+LAG+R E+ T  G Y    S 
Sbjct  604   AVGGLSETPLELFYTSSLSGTLAGHLGVFGFRPDVLGDILAGRRVELETTEGEYDEYDST  663

Query  1888  DC--SPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL  2061
              C  +PS    A   V  L          +V   +++  +AI AQ R+P  ++  RVR +
Sbjct  664   ACGSAPSSTSVANSSVPCL----------EVETAVKLVRQAIEAQLRNPLHSYHQRVRYI  713

Query  2062  NYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLG  2241
             NYG  Y+F+ + + ++ KV+P  A  + N  +++P+ FT+V+ GN+D      L+ +YL 
Sbjct  714   NYGGCYYFKQLTLEEVDKVDPALALAHHNLSWRNPAEFTLVLTGNVDRGQLEQLLCRYLA  773

Query  2242  GIPRPSEPILHFNRDDLKGLPFKFPSSIIREVV--HS---PMVEAQCSVQLCFPVELKSE  2406
              +P+ + P     + D+K LP++FP + + E V  HS    MV      Q+ FPV L   
Sbjct  774   TLPKTALPPPKLPK-DVKPLPYRFPETPVVEDVKLHSFVVAMVSPVAQSQITFPVSLSRP  832

Query  2407  DMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFS  2586
                E+V ++    + LET+++Q +RF         VS F G   PS  G+  GD+ I FS
Sbjct  833   RAREEVVWLALACRALETRLIQRMRF-------VSVSSFFGCVAPSLDGDPEGDVAIMFS  885

Query  2587  CDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQ  2766
             CDP     LV +AL+E+  +Q  G + E+V T++ +E+  +E  L EN YW + I+  +Q
Sbjct  886   CDPANKDRLVGMALEEVAAIQASGMTTEEVETLINLERLQYEESLAENSYWHEVIVSGFQ  945

Query  2767  SRIY---SGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             S+ Y    GD+G  +    EAR KV    TP T Q A +R+ P P   +YT + ++P+
Sbjct  946   SKSYQLLGGDLGAVYGKNTEAREKVWGSCTPETLQEAFRRLFPSPPTGRYTAISMLPR  1003



>tpg|DAA59000.1| TPA: hypothetical protein ZEAMMB73_046584 [Zea mays]
Length=939

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/471 (69%), Positives = 373/471 (79%), Gaps = 37/471 (8%)
 Frame = +1

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I+ + E+  +GA E  LSNGMR+CYK T+FLDDQV+FTGF+YGGLSEL E+EY SCSMGS
Sbjct  431   IIAKVEHPGIGATEMILSNGMRICYKYTDFLDDQVVFTGFAYGGLSELSEAEYTSCSMGS  490

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
             TIAGEIG FGYRPSVLMDMLAGKRAEVGTK+GAYMR+FSGDCSPSDLETALQLVYQLFTT
Sbjct  491   TIAGEIGTFGYRPSVLMDMLAGKRAEVGTKVGAYMRTFSGDCSPSDLETALQLVYQLFTT  550

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPY  2127
             NVEP EE+V IVMQMAEEAI+AQERDPYTAFANRVRE+NYGNSYFF+PIRI DL+KV+P 
Sbjct  551   NVEPREEEVKIVMQMAEEAIYAQERDPYTAFANRVREINYGNSYFFKPIRISDLKKVDPI  610

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             +ACEYFNNCFKDPS FTVVIVG IDPA + PL+LQYLGGIPR  +     +RDDL+GLPF
Sbjct  611   RACEYFNNCFKDPSAFTVVIVGKIDPAISLPLVLQYLGGIPRVQDATQPLSRDDLRGLPF  670

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
             KFP++IIREVV SPMVEAQC VQL FPV LK+  M ED+H+VGFLSKLLETKI+QVLRFK
Sbjct  671   KFPATIIREVVRSPMVEAQCFVQLAFPVVLKNTMMTEDIHYVGFLSKLLETKIMQVLRFK  730

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
             YGQIY+  V+VFLGGNKPSR G++RGDI +NFSCDPDISS L                  
Sbjct  731   YGQIYSVNVAVFLGGNKPSRTGDVRGDISVNFSCDPDISSKL------------------  772

Query  2668  EDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLT  2847
                                EN +WLDRILRSYQSR++SGD+G +F  Q+E R KVR  LT
Sbjct  773   -------------------ENYFWLDRILRSYQSRLFSGDIGSTFAFQEEGRIKVRDALT  813

Query  2848  PLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAK  3000
             P + Q ALQR++PFPC+KQYTVVILMP++S    +KS++  +      DAK
Sbjct  814   PQSMQSALQRVIPFPCRKQYTVVILMPKSSCWASVKSMLSWSSNGVSRDAK  864


 Score =   445 bits (1144),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 218/288 (76%), Positives = 255/288 (89%), Gaps = 1/288 (0%)
 Frame = +1

Query  730   MAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY-YLVPSHEEPRFSCFVESEAAGS  906
             MAV AVGDFPDTQ+VVELI  HFG+K   P PPP+   + VPSHEEPRFSCFVESEAAGS
Sbjct  1     MAVFAVGDFPDTQAVVELINEHFGHKAPAPHPPPVIPEFSVPSHEEPRFSCFVESEAAGS  60

Query  907   AVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRP  1086
             AV+ISCKMP   +KTVKDY+D LAESMF  ALNQR FKISR+KDPPY+SCS+AAD LV P
Sbjct  61    AVVISCKMPAGGIKTVKDYKDSLAESMFHCALNQRLFKISRRKDPPYFSCSSAADALVCP  120

Query  1087  VKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQM  1266
             VKAYIMTSSC+E+GTVEALESML EVARVRLHGFS+REIS+VRAL+MSE+ESAYLERDQM
Sbjct  121   VKAYIMTSSCRERGTVEALESMLLEVARVRLHGFSDREISIVRALMMSEMESAYLERDQM  180

Query  1267  QSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIE  1446
             QSTSLRDE+LQHFLR EPV+GIEYEAQLQKTLLPHIS++EV+K++E F T+SSCVIK +E
Sbjct  181   QSTSLRDEFLQHFLREEPVVGIEYEAQLQKTLLPHISSAEVAKFAENFSTASSCVIKIVE  240

Query  1447  PRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
             PRA A+++DL++VVLK+N+ E+ +SI PWDEE IPEEIV+  P PG++
Sbjct  241   PRAHASLEDLKAVVLKVNSMEEDKSIFPWDEEQIPEEIVAQAPEPGYL  288



>ref|XP_005826780.1| hypothetical protein GUITHDRAFT_143191 [Guillardia theta CCMP2712]
 gb|EKX39800.1| hypothetical protein GUITHDRAFT_143191 [Guillardia theta CCMP2712]
Length=1024

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/964 (38%), Positives = 557/964 (58%), Gaps = 49/964 (5%)
 Frame = +1

Query  166   YGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNH  345
             +GRL NGLTYYVR+N KP+ RA L L V+ GSV EE+ E+GVAH+VEHLAF  T  +   
Sbjct  20    HGRLGNGLTYYVRNNGKPEARAELRLIVKVGSVNEEDHEQGVAHMVEHLAFRGTAMFNTF  79

Query  346   DIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHD  525
              +V+FLE+IGA+FGACQNA T+ DETVY L VPID   LL +++ +L E++  +R ++ D
Sbjct  80    QVVRFLEAIGAKFGACQNAYTAFDETVYFLRVPIDTDNLLERSLIVLREWAFHIRCTDDD  139

Query  526   LEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFY  705
             + KERG VMEE+R  R A+GR  + ++  +M+GS YA RLPIG   VI+   P +V+ FY
Sbjct  140   VNKERGIVMEEWRQGRTAHGRTDENYFQTLMDGSTYARRLPIGKIDVIKHCKPSVVRDFY  199

Query  706   KKWYHLRNMAVIAVGDFPD----TQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             KKWYH + MAV+AVGDF +     + VV +I+      T   +         P   EP+ 
Sbjct  200   KKWYHPQRMAVVAVGDFDNYSGGVEEVVRMIQEILDV-TPASEWREPLAVSFPHQVEPKL  258

Query  874   SCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYS  1053
             S F + EA  ++V++ CK P   + T +DYR  + E +F  AL+ R +K+    DPP+YS
Sbjct  259   SIFKDQEATNASVIVDCKRPRQPVNTHRDYRRTILEYLFHEALSNRLYKLGVSLDPPFYS  318

Query  1054  CSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
                        ++   +  S +E   + AL ++L EV RV+  GFS  E+S  +A LMS+
Sbjct  319   AVTTISLPTSIMETCSIAISMQEGLELRALRAVLVEVERVKRRGFSVSELSRAKANLMSD  378

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
             +E+  LE+DQ  S     EY++HF R EP +G+E+E  L K +LP I+  EV+  +  F 
Sbjct  379   LEADQLEKDQHDSDFFCSEYVEHFCRGEPAMGVEHEVLLCKAVLPGITCEEVAAVARDFD  438

Query  1414  TSSSCVIKTIEPRAT----------------ATVDDLRSVVLKINTFEQKQSIPP----W  1533
              +  CV+K   P ++                 +VD +R V      FE+   + P    W
Sbjct  439   WTGDCVVKITRPESSWLKRILSHRSHGSLPLLSVDSMRKV------FEEVARVSPDLTDW  492

Query  1534  DEEN--IPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGF  1707
             ++       +++   PSPG I+ + EY+ +   E  LSNGMRVCYK TNFLDD+V F GF
Sbjct  493   EQSEALALSDVLKPPPSPGTIVSRSEYREMKMTELQLSNGMRVCYKKTNFLDDEVQFKGF  552

Query  1708  SYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSG  1887
             + GGLSEL + +  S  M ++IA EIG FG RP  L+DMLAG R  V T++  Y R+F G
Sbjct  553   AMGGLSELSKKQLLSGRMSTSIASEIGAFGVRPGELVDMLAGMRVTVNTEISTYSRAFGG  612

Query  1888  DCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY  2067
             +CSP++LE ALQ+++ LFT+ ++P ++ V ++++M  E I  Q R P   F+ +V  LN 
Sbjct  613   ECSPTNLEAALQMIHLLFTSQLQPSQDQVAVLLRMTREQIENQGRSPQALFSQKVMSLNT  672

Query  2068  GNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGI  2247
              ++ FF P++  D+ +++ + +  +F  CF DPS F   + GNI+      L+  YL  I
Sbjct  673   SHNDFFVPLKPSDVDEIDVFLSSSFFRRCFSDPSNFVFALSGNIEEEKLLALVEGYLASI  732

Query  2248  PRPSE---------PILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFP--VE  2394
             PR S+         P +  +RD L+ + F+FP+  + E +   MV+  C  Q+ FP  +E
Sbjct  733   PRLSQEEDLGFSRVPRMPNDRDLLRPVSFEFPAGKVEEHMRMRMVDPLCYCQVTFPMFIE  792

Query  2395  LKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIG  2574
                 ++ E +     + +LLET+++  LRF+ G +YN   S     + PS    + G  G
Sbjct  793   CSGAELRETMLLAQAM-QLLETRLIDRLRFQRGVVYNVLASADFSSSHPSHSQPLHGLAG  851

Query  2575  INFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRIL  2754
             I+++C P   STL  + L E+ +L+ +GP+ E+V+T LEI +R  E   + N +W++R++
Sbjct  852   ISWTCQPHHISTLAGVILRELEQLKAEGPTGEEVATRLEITRREFETSSKHNSWWVERMV  911

Query  2755  RSYQSRIYSGDVGDSFKVQDEARSKVRKLLTP-LTAQMALQRILPFPCKKQYTVVILMPQ  2931
               Y S+ Y G++G   +  ++ R +V   L+P L  Q+  +R   FP  ++ T V L P 
Sbjct  912   SGYGSKSYKGNLGLCLQELEDVRQEVLSSLSPELLRQVFCRR---FPDLERRTFVSLRPS  968

Query  2932  ASRM  2943
              S M
Sbjct  969   WSTM  972



>emb|CEF98053.1| Metalloenzyme, LuxS/M16 peptidase-like [Ostreococcus tauri]
Length=1057

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/964 (38%), Positives = 536/964 (56%), Gaps = 41/964 (4%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G L NG+ YYV  + KPK  AALAL V  GS+ E +EERGVAHIVEHLAF  T+ Y +  
Sbjct  62    GTLPNGMRYYVAESRKPKEHAALALCVDVGSIAERDEERGVAHIVEHLAFRGTQAYPHFA  121

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             IV FLESIGAEFGAC NA TS DETVYEL +PI K E+L+ ++ IL+EF+  VR ++ D+
Sbjct  122   IVNFLESIGAEFGACSNAYTSMDETVYELVLPIQKAEVLATSMHILSEFARGVRITDEDV  181

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             E ERG+VMEE+R  R+A GR  +A+W  +MEGS YAER PIGLE VIR V P++++ FY 
Sbjct  182   ETERGSVMEEWRSGRDARGRAAEAYWKTLMEGSLYAERSPIGLEDVIRHVEPRVLRDFYN  241

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYL------VPSHEEPR  870
             KWY     AV+ VGDF D   VV LI++ F         P     L         H  PR
Sbjct  242   KWYRPDRQAVVVVGDFVDLDDVVSLIESTFQDLRPHESQPEETPTLERPDTTTMQHATPR  301

Query  871   FSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYY  1050
                 V+ E   +A+ ++ K     + T + Y     E +F  AL+ R ++I R+  PP++
Sbjct  302   VVTHVDRELRQTALTVTFKFHSIAIDTPRGYYLKTVEDIFKTALDNRLYRIMRRAKPPFF  361

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
             +     +   R      + + C E    EAL ++L E+AR+RLHG SE+E+ + ++ +++
Sbjct  362   NAGGIIEDATRTTTLLSVQAQCAEGRADEALIAVLRELARIRLHGISEQELKIAKSRMLA  421

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
             + E  Y ER+Q    S+RDE + +FLR + VIG E EA L K  +  +S  +V  ++ + 
Sbjct  422   DTEQLYAEREQTYCESVRDELIMNFLRGDLVIGAEDEASLAKACIDRVSHEDVIAFATQL  481

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKP-SPGW  1587
                +SCVI+  E R T     LR+ +  +   E K  I P +   IPE ++ +     G 
Sbjct  482   HVRNSCVIRVQEGRRTTGEAALRAAIEHVQKEEAKGMIEPSEVFYIPESLMDLTSLVSGT  541

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I+   +   +   E  L+NGMRV  + T+FLDDQVLF G + GGLSE+   EY      +
Sbjct  542   IVNGRDLPALETREVILNNGMRVALRVTDFLDDQVLFRGVARGGLSEVRNDEYIDAMCSN  601

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
              IAGE+G++G+RP V  D++AG R +V   +G Y R+  G+ SP D+E ALQ ++ LFT 
Sbjct  602   MIAGELGMYGHRPDVFDDIVAGLRCDVHASVGMYRRNIEGEASPVDIENALQCIHLLFTH  661

Query  1948  NV----EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQK  2115
             NV    +PG   +  +M M EE I  Q RDP + ++N VR L YG+SY  + I ++ L +
Sbjct  662   NVGTTNDPGV--LETLMLMQEEKIRNQSRDPESKYSNVVRSLVYGDSYQSQTITVKSLHE  719

Query  2116  VNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP-RPSEPILHF-----  2277
             ++  KAC +F+ CF+DPS FT+V VG ID  T  PL+ +YLG IP +  E  LH      
Sbjct  720   MDSTKACAFFDECFRDPSEFTIVFVGAIDSTTFVPLVEKYLGSIPSKKPEKFLHIFEGIR  779

Query  2278  -NRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVG------  2436
                  +   P KFP+ +I+  V + M +      + FPV  ++ D       +G      
Sbjct  780   HRERRVTPFPLKFPNHVIKRTVRAHMTDPMSKASITFPVRFRNPDFGGPPTLLGGRELTV  839

Query  2437  ------FLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI-RGDIGINFSCDP  2595
                     + ++E +++ VLRF+YG+IY    +       P   G +  GDI ++FSC P
Sbjct  840   AKFKTVMTASIIERRLLAVLRFEYGEIYTCHANASFAYQDPDVAGEMYSGDIMVSFSCAP  899

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR-  2772
             +    L   A + + +L+  GP++++V  V E E R  E   QEN +W + I   Y+SR 
Sbjct  900   ERGVHLAKHAREVVNKLRTHGPNEDEVQAVRECETRDFEVNRQENAFWREYITELYKSRL  959

Query  2773  ----IYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASR  2940
                 I  GD+   +++ +E R  V K L+P   +  L+ +L       +  VIL PQ S 
Sbjct  960   MGAGILDGDIEALYRMTEEVRDDVIKSLSPDVVREHLRAVLSM---DNHVTVILKPQRST  1016

Query  2941  MKRL  2952
              +R+
Sbjct  1017  FRRI  1020



>ref|XP_001417805.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96098.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=992

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/963 (38%), Positives = 536/963 (56%), Gaps = 48/963 (5%)
 Frame = +1

Query  187   LTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLE  366
             + YYV  + KP+  AALALAV AGSV E E ERG AH+VEHLAF  TE Y +  IV FLE
Sbjct  1     MAYYVAESQKPREHAALALAVDAGSVFEGEGERGAAHVVEHLAFRCTESYEHFAIVNFLE  60

Query  367   SIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGA  546
             SIGAEFGAC NA TS DETVYEL +P  K E+L+ ++ IL+EF+S VR S  D+  ERG+
Sbjct  61    SIGAEFGACSNAYTSMDETVYELTIPTQKAEVLATSMHILSEFASAVRISNEDVACERGS  120

Query  547   VMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLR  726
             VMEE+R  R+A GR  +A+W  +MEGS YAER PIGLE  I+   PQ+++ FY KWY   
Sbjct  121   VMEEWRLGRDARGRAAEAYWKTLMEGSLYAERSPIGLEDFIQNADPQVLRDFYAKWYRPE  180

Query  727   NMAVIAVGDFPDTQSVVELIKAHF-GYKTSppdpppipYYLVPS-----HEEPRFSCFVE  888
              MAVIAVGDF D   VV LI++ F   K     P   P    P      H EPR    V+
Sbjct  181   RMAVIAVGDFQDLDDVVSLIESTFQDLKPKEGQPAENPVMERPKNSAMEHSEPRVVTHVD  240

Query  889   SEAAGSAVMISCK---MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
              E   +AV ++ K   +PVD   T + Y     E ++  AL+ R +++ R+  PP++S  
Sbjct  241   RELKQTAVTVTFKYASIPVD---TPRGYYLKTVEDIYKTALDNRLYRMMRQPKPPFFSAG  297

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
                +   R      + ++C E      LE++L E+AR+RLHG SE+E+ + ++ ++++ E
Sbjct  298   GIIEDATRTTTLLSVQATCAESRASTGLEALLRELARIRLHGISEQELKIAKSRMLADTE  357

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
               Y ER+Q    S+RDE + HFLR + VIG E EA L K  +  +S  +V  ++ +    
Sbjct  358   QLYAEREQTYCESVRDELVCHFLRGDLVIGAEDEAALAKACIERVSQEDVLAFARQLNVR  417

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKP-SPGWIMQ  1596
             +SCVI+  E R   + DDLR  +  +   E + +I   +  +IPE ++     + G I+ 
Sbjct  418   NSCVIRVQEGRKRTSEDDLREAIENVRLREIEGAIDQSEVFDIPEVLMDATSLTSGTIVG  477

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
               E   +   E  L+NGMR+  + T+FLDDQVL  G + GGLSE+ + +Y      + +A
Sbjct  478   SRELPALEVNEITLNNGMRIAIRVTDFLDDQVLIRGVARGGLSEVAQIDYIDAMCSNMVA  537

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
              E+G++G+RP V   ++AG R++V   +  Y R+  G+ SP D+E+ALQ ++ LFT +V 
Sbjct  538   SELGIYGHRPDVYDGIIAGLRSDVHANVTMYRRNIEGETSPVDIESALQCIHLLFTHDVS  597

Query  1957  PGE--EDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYK  2130
                  E +  +MQM EE I  Q RDP + ++  VR L YG SY  + I ++ L++++  K
Sbjct  598   TTNDPEVLETLMQMQEEKIRNQSRDPESKYSEVVRSLVYGESYHSQRITVKSLREMDSKK  657

Query  2131  ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPI--------LHFNRD  2286
             AC +F+ CF DPS FT+V VG ID  T  PLI +YLG IP P+ P         +   + 
Sbjct  658   ACAFFDACFLDPSEFTMVFVGAIDSKTLVPLIEKYLGSIP-PASPTKVLKAFEGISQRKR  716

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFL--------  2442
              L     KFP+ +I   V + M E      + FPV +++ D          L        
Sbjct  717   SLTPFLLKFPTRVISRTVRAHMREGMSKASITFPVRIQNPDFHNSRGRSTLLGGKELTVA  776

Query  2443  -------SKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI-RGDIGINFSCDPD  2598
                    + ++E +++ +LRF+YG+IY        G   P   G +  GDI ++FSC P+
Sbjct  777   KFKTVMTAAIIERRLLALLRFEYGEIYTCHADASFGYQDPDVAGEMYSGDIMVSFSCAPE  836

Query  2599  ISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR--  2772
               + L   A + +  L+E GP++EDV  V E E R  E   QEN +W + I   Y+SR  
Sbjct  837   RGAHLAAHAREVVRHLREHGPTEEDVHAVRECEIRDFEVSRQENTFWREYITELYKSRMM  896

Query  2773  ---IYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRM  2943
                I +GD+   +++ +E R +V + L+P   +  LQ ++          V+L PQ S +
Sbjct  897   HKSILNGDIEALYRMTEEVREEVIESLSPAVIREHLQCVMSM---NNSVTVVLKPQRSLL  953

Query  2944  KRL  2952
             +R+
Sbjct  954   RRI  956



>ref|XP_003079435.1| putative zinc protease PQQL (ISS) [Ostreococcus tauri]
Length=1051

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/964 (38%), Positives = 529/964 (55%), Gaps = 47/964 (5%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G L NG+ YYV  + KPK  AALAL V  GS+ E +EERGVAHIVEHLAF  T+ Y +  
Sbjct  62    GTLPNGMRYYVAESRKPKEHAALALCVDVGSIAERDEERGVAHIVEHLAFRGTQAYPHFA  121

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             IV FLESIGAEFGAC NA TS DETVYEL +PI K E      +I    S+ VR ++ D+
Sbjct  122   IVNFLESIGAEFGACSNAYTSMDETVYELVLPIQKAE------AIFVVCSTGVRITDEDV  175

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             E ERG+VMEE+R  R+A GR  +A+W  +MEGS YAER PIGLE VIR V P++++ FY 
Sbjct  176   ETERGSVMEEWRSGRDARGRAAEAYWKTLMEGSLYAERSPIGLEDVIRHVEPRVLRDFYN  235

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYL------VPSHEEPR  870
             KWY     AV+ VGDF D   VV LI++ F         P     L         H  PR
Sbjct  236   KWYRPDRQAVVVVGDFVDLDDVVSLIESTFQDLRPHESQPEETPTLERPDTTTMQHATPR  295

Query  871   FSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYY  1050
                 V+ E   +A+ ++ K     + T + Y     E +F  AL+ R ++I R+  PP++
Sbjct  296   VVTHVDRELRQTALTVTFKFHSIAIDTPRGYYLKTVEDIFKTALDNRLYRIMRRAKPPFF  355

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
             +     +   R      + + C E    EAL ++L E+AR+RLHG SE+E+ + ++ +++
Sbjct  356   NAGGIIEDATRTTTLLSVQAQCAEGRADEALIAVLRELARIRLHGISEQELKIAKSRMLA  415

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
             + E  Y ER+Q    S+RDE + +FLR + VIG E EA L K  +  +S  +V  ++ + 
Sbjct  416   DTEQLYAEREQTYCESVRDELIMNFLRGDLVIGAEDEASLAKACIDRVSHEDVIAFATQL  475

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKP-SPGW  1587
                +SCVI+  E R T     LR+ +  +   E K  I P +   IPE ++ +     G 
Sbjct  476   HVRNSCVIRVQEGRRTTGEAALRAAIEHVQKEEAKGMIEPSEVFYIPESLMDLTSLVSGT  535

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I+   +   +   E  L+NGMRV  + T+FLDDQVLF G + GGLSE+   EY      +
Sbjct  536   IVNGRDLPALETREVILNNGMRVALRVTDFLDDQVLFRGVARGGLSEVRNDEYIDAMCSN  595

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
              IAGE+G++G+RP V  D++AG R +V   +G Y R+  G+ SP D+E ALQ ++ LFT 
Sbjct  596   MIAGELGMYGHRPDVFDDIVAGLRCDVHASVGMYRRNIEGEASPVDIENALQCIHLLFTH  655

Query  1948  NV----EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQK  2115
             NV    +PG   +  +M M EE I  Q RDP + ++N VR L YG+SY  + I ++ L +
Sbjct  656   NVGTTNDPGV--LETLMLMQEEKIRNQSRDPESKYSNVVRSLVYGDSYQSQTITVKSLHE  713

Query  2116  VNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP-RPSEPILHF-----  2277
             ++  KAC +F+ CF+DPS FT+V VG ID  T  PL+ +YLG IP +  E  LH      
Sbjct  714   MDSTKACAFFDECFRDPSEFTIVFVGAIDSTTFVPLVEKYLGSIPSKKPEKFLHIFEGIR  773

Query  2278  -NRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVG------  2436
                  +   P KFP+ +I+  V + M +      + FPV  ++ D       +G      
Sbjct  774   HRERRVTPFPLKFPNHVIKRTVRAHMTDPMSKASITFPVRFRNPDFGGPPTLLGGRELTV  833

Query  2437  ------FLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNI-RGDIGINFSCDP  2595
                     + ++E +++ VLRF+YG+IY    +       P   G +  GDI ++FSC P
Sbjct  834   AKFKTVMTASIIERRLLAVLRFEYGEIYTCHANASFAYQDPDVAGEMYSGDIMVSFSCAP  893

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR-  2772
             +    L   A + + +L+  GP++++V  V E E R  E   QEN +W + I   Y+SR 
Sbjct  894   ERGVHLAKHAREVVNKLRTHGPNEDEVQAVRECETRDFEVNRQENAFWREYITELYKSRL  953

Query  2773  ----IYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASR  2940
                 I  GD+   +++ +E R  V K L+P   +  L+ +L       +  VIL PQ S 
Sbjct  954   MGAGILDGDIEALYRMTEEVRDDVIKSLSPDVVREHLRAVLSM---DNHVTVILKPQRST  1010

Query  2941  MKRL  2952
              +R+
Sbjct  1011  FRRI  1014



>gb|EMS58065.1| hypothetical protein TRIUR3_26510 [Triticum urartu]
Length=402

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/439 (69%), Positives = 344/439 (78%), Gaps = 37/439 (8%)
 Frame = +1

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             MGSTIAGEIG+FGYRPSVLMDMLAGKRAEVGTK+GAYMRSFSGDCSPSDLET LQLVYQL
Sbjct  1     MGSTIAGEIGIFGYRPSVLMDMLAGKRAEVGTKVGAYMRSFSGDCSPSDLETGLQLVYQL  60

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKV  2118
             FTT VEP EE+V IVMQMAEEAI+AQERDPYTAFANR RE+NYGNSYFF+PIRI DL+KV
Sbjct  61    FTTKVEPREEEVKIVMQMAEEAIYAQERDPYTAFANRSREINYGNSYFFKPIRISDLKKV  120

Query  2119  NPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKG  2298
             NP +ACEYFN+CFKDPS FTVV+VGNIDP  + PLIL+YLGGIP+  + +   +R+DLKG
Sbjct  121   NPIRACEYFNSCFKDPSAFTVVVVGNIDPDISIPLILEYLGGIPKVQDTVQPLSREDLKG  180

Query  2299  LPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVL  2478
             LPFKFP +IIREVV SPMVEAQC VQL FPV LKS  M ED+H+VGFLSKLLETKI+QVL
Sbjct  181   LPFKFPETIIREVVRSPMVEAQCFVQLGFPVVLKSTMMTEDIHYVGFLSKLLETKIMQVL  240

Query  2479  RFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDG  2658
             RFKYGQ+Y+  V VFLGGNKPSR G++RGDI +NFSCDPD+SS L               
Sbjct  241   RFKYGQVYSVNVGVFLGGNKPSRSGDVRGDISVNFSCDPDMSSRL---------------  285

Query  2659  PSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRK  2838
                                   EN YWLDRILRSYQSRIYSGDVG +F VQDE R KVR+
Sbjct  286   ----------------------ENYYWLDRILRSYQSRIYSGDVGSTFMVQDEGRVKVRE  323

Query  2839  LLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYCTDAKIlagta  3018
              LTP   QMAL+R++ FPCKKQYTVVILMP++SR   L S+V  +   +  DAKILAG A
Sbjct  324   ALTPQAMQMALRRVISFPCKKQYTVVILMPKSSRWNSLISVVSWSSGGFSRDAKILAGMA  383

Query  3019  gvavllltlWRYSRSSLKS  3075
             G  VL  +LWRYSR +L+S
Sbjct  384   GALVLAASLWRYSRGALRS  402



>ref|XP_007513960.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15397.1| predicted protein [Bathycoccus prasinos]
Length=1191

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/975 (37%), Positives = 535/975 (55%), Gaps = 52/975 (5%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
             GV+ GRL NGL Y+V    KP+ RAALALAV  GSV E EEERGVAHIVEHLAF AT  Y
Sbjct  178   GVEEGRLPNGLRYFVGQCKKPEKRAALALAVDVGSVFENEEERGVAHIVEHLAFRATTSY  237

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
                 IV FLES+GA FGACQNA TS+DETV+EL VPID   +L +++ I +EF+  VR S
Sbjct  238   ETFQIVNFLESVGAAFGACQNAYTSSDETVFELTVPIDDMNVLEESLKIFSEFARGVRIS  297

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
             + D++ ERGAV+EE+R  R+A GR   A+W  + EGS YA+R PIG E+VIR    +I +
Sbjct  298   DEDVDNERGAVLEEWRSGRDARGRAAQAYWEALCEGSLYADRSPIGTEEVIRKAPGEIFR  357

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPS---HEEP  867
              FY KWY   NMAVI  GDF D   V E I   F         P  P ++ P+   H +P
Sbjct  358   NFYHKWYRPENMAVIVTGDFEDVGVVKEKIIRLFSPLAPAEHVPAPPKFIRPTFPEHAKP  417

Query  868   RFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY  1047
             R  C V+ E + + V  +  +    + T +D+     +  +   L+ R +K+ R+  P +
Sbjct  418   RVCCHVDRELSNTVVNATFHVEQKPIATPEDFFKQTVQECYQLCLDNRLYKLMRRPKPNF  477

Query  1048  YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLM  1227
             +S   A++ L R      +  +C+     +ALES+LTEV+R RL GFS +E+ + +   +
Sbjct  478   FSAGIASEHLSRTSALLSVQMTCEASKVKDALESVLTEVSRARLFGFSAQELRIAKLNQI  537

Query  1228  SEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER  1407
             +++E  Y+ERDQ   T  RDE +QHFLR + VIG   EA L    +  ++  +V +Y++ 
Sbjct  538   ADMEQLYVERDQTYCTDARDELVQHFLRGDMVIGAGLEASLAIACIEKVTLEDVFQYAQE  597

Query  1408  FGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEEN-----IPEEIVS--  1566
                S SC+I+  E R     DDLR  V ++   E++  I    EEN     +PE +++  
Sbjct  598   VSVSKSCMIRLQEGRKKTNEDDLREAVNRVAEKERRGEI----EENSETFVVPERLMADP  653

Query  1567  --VKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPES  1740
               +K     I     +      E  L NG+++  K TNFLDDQVL    + GGLSE+P+ 
Sbjct  654   QPLKEGESAIASTRTHSISDVTEVVLKNGIKIALKSTNFLDDQVLMRVVARGGLSEVPKE  713

Query  1741  EYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETAL  1920
             +Y       T+A E+GVFGYRP V  D +AGKR +V   +G Y RS  G+ SP  ++  L
Sbjct  714   KYKDAIFAGTVARELGVFGYRPEVFSDAMAGKRVDVVPNIGTYKRSIVGETSPDHIDVLL  773

Query  1921  QLVYQLFTTNVEP--GEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI  2094
             Q  + +F+ NVE    E+D+ ++ ++  E +   +RDP   FA   R L YGNSY   PI
Sbjct  774   QCTHLIFSNNVENQCNEDDLEVLREIQRELVKNAKRDPMKVFAEIKRALTYGNSYLSEPI  833

Query  2095  RIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILH  2274
              ++ L K++  KAC YFN CF DPS FT+V+VG  D     PL+ +Y+G IPRP +    
Sbjct  834   TLKTLAKMDAEKACRYFNECFVDPSHFTMVLVGAFDIEKILPLLEKYIGSIPRPIDSKEK  893

Query  2275  FNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPV-------ELKSEDMMEDVHFV  2433
              +R  +   PF+FP   + + V   M+E Q    L FPV       +LK   + +   F 
Sbjct  894   LSR--VTPAPFEFPKKTVSKRVRLKMIENQGVASLTFPVMIENPDAKLKQAAIAKGEDFN  951

Query  2434  G-------------FLS----KLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVG--N  2556
             G             FL+     ++E +++  LRF+ G+IY+   +       P+     +
Sbjct  952   GPTLAGSQVIVRSKFLTVISAAIIERRLLARLRFERGEIYSCAANTSFAYQDPNAANGES  1011

Query  2557  IRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCY  2736
              RGDI + F+CDP     L  +AL+EI +L  +GP++ED  T  E+E R+ +   +EN +
Sbjct  1012  YRGDIMVVFACDPKSGEKLSKVALEEIEQLISEGPTEEDCQTAKEVELRSIQEHKEENSF  1071

Query  2737  WLDRILRSYQSR---IYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQY  2907
             W+  +   + S+   + +GD+   +   ++ R  V + L+P   +  L + L     ++ 
Sbjct  1072  WVSYVDAMFTSQLLPVLNGDIDKMYVNTEQIRGDVLETLSPTIIREHLAKTLAV---ERR  1128

Query  2908  TVVILMPQASRMKRL  2952
               V+L+PQ     RL
Sbjct  1129  VNVVLIPQRPLFLRL  1143



>ref|XP_003630661.1| Zinc protease PQQL-like protein [Medicago truncatula]
Length=425

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/386 (75%), Positives = 332/386 (86%), Gaps = 6/386 (2%)
 Frame = +1

Query  1924  LVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIR  2103
             LVYQLFTTN+ P EE+V IVMQMAEEA+ AQ+RDPYTAF NRV+ELNYGNSYFFRPI+  
Sbjct  26    LVYQLFTTNLTPDEENVKIVMQMAEEAVCAQDRDPYTAFTNRVKELNYGNSYFFRPIKKC  85

Query  2104  DLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYL------GGIPRPSEP  2265
             DLQKV+P +ACEYF+ CF+DPS FTVVIVGNIDP  A PLILQYL      GGIP+P EP
Sbjct  86    DLQKVDPLEACEYFSKCFRDPSAFTVVIVGNIDPTIALPLILQYLVSIHPLGGIPKPPEP  145

Query  2266  ILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLS  2445
             I+HFNRDDLKGLPF FP++I REVV SPMVEAQC VQ+CFPVELK+  M+E++HFVGFLS
Sbjct  146   IMHFNRDDLKGLPFTFPTAIHREVVRSPMVEAQCLVQICFPVELKNGTMVEEIHFVGFLS  205

Query  2446  KLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLA  2625
             KLLETKI+QVLRFK+GQIY+ GVSVFLGGNKPSR G +RGDI INFSCDP+ISS LVD+A
Sbjct  206   KLLETKIMQVLRFKHGQIYSVGVSVFLGGNKPSRTGIVRGDISINFSCDPEISSKLVDIA  265

Query  2626  LDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFK  2805
             LDE+LRLQ++GP+++DVSTVLEIEQRAHENGLQEN YWLDRIL SYQSR+YSGDVG SF+
Sbjct  266   LDEMLRLQDEGPTEQDVSTVLEIEQRAHENGLQENYYWLDRILHSYQSRVYSGDVGTSFE  325

Query  2806  VQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRY  2985
             +Q E RSKVR  LTP TAQ+ALQRILP+PCKKQYT VILMP++S  K LKS+  S     
Sbjct  326   IQGEGRSKVRSSLTPSTAQLALQRILPYPCKKQYTAVILMPKSSPFKFLKSVFQSTRING  385

Query  2986  CTDAKIlagtagvavllltlWRYSRS  3063
               +AKILAG AG+AVL L+LWR+SRS
Sbjct  386   GREAKILAGIAGLAVLALSLWRHSRS  411



>ref|XP_002448515.1| hypothetical protein SORBIDRAFT_06g028295 [Sorghum bicolor]
 gb|EES12843.1| hypothetical protein SORBIDRAFT_06g028295 [Sorghum bicolor]
Length=460

 Score =   550 bits (1416),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 285/531 (54%), Positives = 346/531 (65%), Gaps = 92/531 (17%)
 Frame = +1

Query  97    FRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEE  276
             FRSLK V+V+M++ L   P G  YGRL NGLTYYVR N  P+MRA L+LAV+ GSV+EEE
Sbjct  22    FRSLKRVSVSMDDTLPVDPVGAIYGRLANGLTYYVRFNPNPRMRAVLSLAVKVGSVVEEE  81

Query  277   EERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKP  456
             +ERG+AHI+EHLAF AT +YTNHD+VKFLESIGA+ GACQNA+T+ DET+YE  VP+DKP
Sbjct  82    DERGMAHIIEHLAFRATARYTNHDVVKFLESIGAKLGACQNALTTTDETIYEFSVPLDKP  141

Query  457   ELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYA  636
              LLSQAIS+LAEFS+EVR S  DLEKERGAV+EEYRG  NA G MQD+HWV + EGSKYA
Sbjct  142   SLLSQAISVLAEFSTEVRMSAEDLEKERGAVLEEYRGGCNAAGLMQDSHWVQLFEGSKYA  201

Query  637   ERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSp  816
             +RLPIG EKV++ V+ + VK+FY+KWYHL NMA+ AVGDFPDTQSVV             
Sbjct  202   DRLPIGTEKVMQNVAHETVKRFYQKWYHLSNMAIFAVGDFPDTQSVV-------------  248

Query  817   pdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFH  996
                                              ISCKMP   +KTVKDY+D LAESMF  
Sbjct  249   ---------------------------------ISCKMPSGGIKTVKDYKDSLAESMFHC  275

Query  997   ALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVR  1176
             ALNQRFF IS  KD PY SCS+A   LV PVKAY MTSSC E+GTVEALESML       
Sbjct  276   ALNQRFFTISHTKDAPYVSCSSAIMPLVCPVKAYTMTSSCHERGTVEALESML-------  328

Query  1177  LHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQK  1356
                                                    L+HFLR E VIG EY AQL K
Sbjct  329   ---------------------------------------LEHFLREEAVIGTEYNAQLLK  349

Query  1357  TLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWD  1536
             TLL HIS+ EV+K++E+F T+ SCVIK +EP+  A+++DL+ +VLK+NT E+++SIPPW+
Sbjct  350   TLLAHISSVEVAKFAEKFSTARSCVIKIVEPQVHASLEDLKELVLKVNTLEEEKSIPPWN  409

Query  1537  EENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQ  1689
             EE   E  +   P PG I  + E+  + + E   S+    C K T+FLDDQ
Sbjct  410   EELTREGTIGQSPEPGIITDKVEHPGICSTEVIHSDDTLSCCKYTDFLDDQ  460



>ref|XP_009620904.1| PREDICTED: uncharacterized protein LOC104112632 isoform X1 [Nicotiana 
tomentosiformis]
Length=968

 Score =   472 bits (1214),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 308/951 (32%), Positives = 504/951 (53%), Gaps = 38/951 (4%)
 Frame = +1

Query  121   VNMEEALSQTPYGVDYGRLDNGLTYYVR--SNSKPKMRAALALAVRAGSVLEEEEERGVA  294
             +++++     P+  DY  LD+G+TYYV+  +N+  K    L L V+AG+V EEE E GVA
Sbjct  37    LDLQQVFPTQPFETDYEVLDSGVTYYVKRSANTNDKGLIHLTLIVKAGAVCEEENELGVA  96

Query  295   HIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQA  474
             HI+EHL       Y++ D + +L++   + GA Q A+T +D T+Y   V       L +A
Sbjct  97    HIIEHLVLEGY-GYSDPDALDYLQAFKHQCGAHQQALTLSDYTIYNFVVT--NTVNLKKA  153

Query  475   ISILAEFSSEVRASEHDLEKERGAVMEE-YRGSRNANGRMQDAHWVLMMEGSKYAERLPI  651
             I+++A  S E+  +  +LEKE+  V +E +  S+    + Q      + +G+KY E  P+
Sbjct  154   IALMAAISQELDFTSDELEKEKRIVSQELWNDSQIIEKKHQLTFSTHLFQGTKYGE--PV  211

Query  652   GLE-KVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpp  828
             G   K I+ VS  IVK FY KWY   NMAVI VGD  +TQ++++LIK +F  +       
Sbjct  212   GATIKSIKDVSVDIVKGFYTKWYVPSNMAVIVVGDITETQNIIDLIKTYFERQPRGMPQH  271

Query  829   pipYYLVPSHEEPRFSCFVESEAAG---SAVMISCKMPVDELKTVKDY----RDLLAESM  987
                 + +P H EPR    V+S       S V ++     +  K V D     + +L + +
Sbjct  272   LE--FPLPKHTEPRLIAHVDSALVKWRMSVVYVTFMFEKEGWKCVNDVFINIQRMLLQKV  329

Query  988   FFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVA  1167
                 L +RF  +S+ K   Y    +  D  +  +  Y+++  C+   T + LE+ L E+A
Sbjct  330   ILGRLKKRFSSMSKPKQLQY----SRDDSHMYTI--YVVSVECEGYETNKVLETFLVEIA  383

Query  1168  RVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQ  1347
             R+R+HG  E E+S  +   +   +  YL      S  LR  Y  HF+ NE     + EAQ
Sbjct  384   RMRVHGIKENELSEGKDFCLCIPKGRYLNHHDRSSEQLRRTYTSHFVYNEADFSPKLEAQ  443

Query  1348  LQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIP  1527
             +   L   I+   +  + E    +S+  +   + +   T ++++  + KI  FE++ S P
Sbjct  444   VMIALTKRINMELIKNFCEMQFAASNLSVIIFQSKTFVTQEEMKRSLQKITDFEKEGSFP  503

Query  1528  PWDEE---NIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLF  1698
              W +E    +   I  ++   G I+++ E+ ++GA E  LSNGM+V Y+CT   DD+V+ 
Sbjct  504   SWSDEEMEGLTNLIQEMEIESGKIVERLEHFDIGAVELILSNGMQVTYQCTKN-DDKVVL  562

Query  1699  TGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRS  1878
              GFSYGGLSE+ E++  SCS  S I   I ++  +    + M+  K      ++  Y R+
Sbjct  563   RGFSYGGLSEVTETDILSCSYSSVIGQIIWLYSSKN---LPMIRDK-VNFAIEVDEYKRA  618

Query  1879  FSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE  2058
             F G+   SD+E ALQ++Y LFT+++EP EE+   +++  +  +    + P     + V+E
Sbjct  619   FCGNFDSSDIELALQILYLLFTSDLEPEEEEFQALIEDLKIRLSPAHQQPADVLIDTVKE  678

Query  2059  LNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYL  2238
             +N G S +++     D+  ++  KA +YF NCF+ PS+F V++VGN+D A+   L+ +YL
Sbjct  679   INSGKSCYYKAPVAEDMSNIDATKAWQYFQNCFRGPSSFRVILVGNLDTASVNSLLSRYL  738

Query  2239  GGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC--FPVELKSEDM  2412
             GGIPRP  PI+ F R  L   PF FP ++I+E V S  V +   +  C  FP+   ++ +
Sbjct  739   GGIPRPHRPIMKFQRGKLTTAPFHFPPTVIKEEV-SLAVGSGNGMYTCISFPLRFNNQTL  797

Query  2413  MEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSC-  2589
              ED+  +  L  LL+ K+ QVLR + G  YN  V  F      S  G+  G I  N    
Sbjct  798   EEDLLLLIILRNLLKVKVTQVLRHEKGIAYNVDVDTFNPNGDWSCSGSKPGTINFNLLIK  857

Query  2590  DPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
             D D +   VD  + EI +L+E GPS   V  VL+      E   + N   ++++L++Y S
Sbjct  858   DNDAAQMAVDAVVHEIEQLKEVGPSQNLVQHVLDRRPSLEEE--ERNTSLMNQMLQAYGS  915

Query  2770  RIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
              +Y+G++  S+K+  +   +   L     A+  L+R+LP+PC++Q+T+V L
Sbjct  916   NLYAGNIDQSYKILRDMNRRAWDLFNADVAKSTLKRMLPYPCQEQHTIVNL  966



>ref|WP_022817736.1| peptidase M16 [Candidatus Latescibacter anaerobius]
Length=946

 Score =   466 bits (1200),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 285/868 (33%), Positives = 457/868 (53%), Gaps = 22/868 (3%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
             G+  G+LDNGL YYVR N KP+ RA L L V AG+VLEE+ ++G+AH  EH+AF+ T+ +
Sbjct  47    GIVIGKLDNGLIYYVRENQKPEKRAELRLVVNAGAVLEEDGQQGLAHFAEHMAFNGTKNF  106

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
                ++V +LESIG  FG   NA TS DETVY L VP D   ++ +A  IL +++  V   
Sbjct  107   NKQELVDYLESIGMRFGPDLNAYTSFDETVYMLQVPTDSVHIVEKAFQILEDWAHNVSYE  166

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG ++EE+R  R A+ RM+D    ++++ S+YAERLPIG ++++ T     ++
Sbjct  167   AEEIDKERGVIIEEWRMGRGASARMRDKQLPILLKDSRYAERLPIGKKEILETFGYDTLR  226

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              FY +WY    MAVIAVGDF + + +  LIK HF    S  +      + VP H+E  F+
Sbjct  227   DFYTEWYRPDLMAVIAVGDF-EGKWIENLIKQHFSRLPSVENARDRKVFPVPDHDETLFA  285

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + EA GS+V +  K+ V+  KTV DYR  L ES++    N+R  ++++K DPP+   
Sbjct  286   IATDPEATGSSVSVYYKLDVEPQKTVNDYRKTLIESLYNSMFNRRLDELTKKSDPPFLYS  345

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              ++    +   + Y++++  K+ G    LE++LTE  R+++ GF++ E+   +   +  I
Sbjct  346   YSSKGRFILSKEFYVLSAGVKDNGLERGLEAVLTEAERIKIFGFTQTELDRQKKETLRYI  405

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E +Y ERD+ +S +   EY+++FL +EP+ GIEYE +L K  +P I   E++  +  + T
Sbjct  406   ERSYNERDKTESRNYASEYIRNFLMDEPIPGIEYEYELYKKYIPGIHLEEINGLAGEWIT  465

Query  1417  SSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
               + VI    P +   TV D R  +L +     K+ + P+ +    + ++S   +P  I+
Sbjct  466   DGNRVIMVDAPEKEDMTVPD-RKDLLAVFDRVSKEDLEPYIDTFTDKPLISDSLNPVPII  524

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
              + E + +G  E+ LSNG+RV  K T+F +D++LFT FS GG S     ++   S  S++
Sbjct  525   GKKEIEAIGVTEWTLSNGVRVILKPTDFKNDEILFTSFSPGGYSLAGNEDFIPASTASSV  584

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
               E G+  +    L  +L GK   V   +       SG  SP DLET  QL+Y  FT+  
Sbjct  585   IVEGGIGDFDQIELNKLLTGKVLRVSPWIDELQEGISGSASPEDLETMFQLIYLYFTSPR  644

Query  1954  EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKA  2133
             +      ++  +M +  I  +   P TAF + +           RP  +  L +++   +
Sbjct  645   KDSTAFQSLKTRM-KGFIENRSASPETAFEDTISVTMAQYHPRVRPWTMELLDEMDLETS  703

Query  2134  CEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDD-LKGLPFK  2310
              + + N F D S FT   VGN +P     L   YLG +P         NR++  K     
Sbjct  704   YDMYRNRFADSSDFTFFFVGNFEPDRLESLAQVYLGNLP-------SLNRNETWKDTGIS  756

Query  2311  FPSSIIREVVHSPMVE-AQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
              P  II++ V+  + E +Q  +    P     ++  +    VG    +L  K+ +VLR  
Sbjct  757   PPDGIIKKAVYKGLEEKSQVRILFTGPFIWNRQNRYDLQSMVG----ILRIKLREVLRED  812

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
              G  Y  GV            G     I I F C+P     LV     ++  L+++G S+
Sbjct  813   MGGTYGVGVRASTSHFPDEEYG-----ITIGFGCNPQRVEELVTTVFGQLEDLKKNGASE  867

Query  2668  EDVSTVLEIEQRAHENGLQENCYWLDRI  2751
               ++ V E+++R HE  L+EN YWL  +
Sbjct  868   TYLTKVKEMQRREHETNLKENSYWLSNL  895



>ref|WP_020532664.1| hypothetical protein [Flexithrix dorotheae]
Length=949

 Score =   455 bits (1170),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 280/873 (32%), Positives = 462/873 (53%), Gaps = 25/873 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG+TYY+R N+KP+ +  L L + AGS++E E++RG+AH +EH+ F+ TE + 
Sbjct  46    VKIGKLKNGITYYLRKNAKPEEKIELRLVLNAGSLMENEDQRGLAHFMEHMCFNGTENFQ  105

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V++L+S+G +FGA  NA TS DETVY L +P DK E++     IL +++  V    
Sbjct  106   KNELVEYLQSVGVKFGAHLNAYTSFDETVYILPIPSDKEEVVENGFQILEDWAHNVTLEP  165

Query  520   HDLEKERGAVMEEYR-GSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
              +++KERG V+EE+R      + RMQ+ ++ ++ + S+YAERLPIG  +V+    P+ +K
Sbjct  166   EEIDKERGVVIEEWRLRDLGPDARMQEKYFPILFKDSRYAERLPIGKVEVLENFKPETIK  225

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              FY  WY    M+V+ VGD  D + +   +K HFG      +P     Y VP H+E   +
Sbjct  226   DFYNDWYRPDLMSVVVVGDM-DLKDMEARVKKHFGKIKPVSNPKERKVYDVPDHKETLVA  284

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + EA+ + V +  K   +  KT+ DY+  + +S++   L+ R  ++++  +PP+   
Sbjct  285   IVTDKEASNTQVQVIYKHDTEAQKTLADYKTGIVQSLYNGMLSMRLRELTQSANPPFIFG  344

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              +    L+R   AY   +   E G  + L+++L E  RV LHGF+E E+S  +  +M+  
Sbjct  345   GSGYGGLIRTKDAYYAYAGTAEDGVEKGLQTLLEENKRVMLHGFTEGELSRYKMQMMASY  404

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E AY ERD+ +S +   EY ++FL NEP+ GI +E    K +LP I+  EV+  ++++ T
Sbjct  405   EKAYNERDKTESGAYVGEYQRNFLENEPIPGIAFEFGFVKAILPSITLDEVNALAKKWIT  464

Query  1417  SSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
               + V+    P            VL I     +++I P+ +      ++   P+PG +  
Sbjct  465   EENRVVVITAPEKEGVEIPSEERVLAILNEVDEKNIEPYVDNLASAALMENIPTPGKVTA  524

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
               E  + G  E  LSNG +V  K T+F +D++LF GFS+GG S  P+  Y S S  S + 
Sbjct  525   SVEKPH-GVTELTLSNGAKVVLKPTDFKNDEILFDGFSFGGSSIYPDEVYQSASNASVLV  583

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
              + G+  +  + +  +L GK A V   +       SG CSP DLET  QL +  FT    
Sbjct  584   SQGGIGEHSITDVQKLLTGKIAGVNPYIRQLTEGLSGRCSPKDLETMFQLAHLYFTA---  640

Query  1957  PGEEDVNIVMQMAEEAIHAQE--RDPYTAFANRVRELNYGNSYFFRPI-RIRDLQKVNPY  2127
             P ++       M     + Q    DP   ++N V ++   N      I  + +L  ++  
Sbjct  641   PRKDPEAFQGYMTRLKAYMQNLLSDPNYYYSNEVSKILSQNHPRGGGIPTMEELDAISLD  700

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDD-LKGLP  2304
             KA E +   FKD S FT  +VGN D  T  PL+  YLG +P          RD+  K + 
Sbjct  701   KAFEVYQERFKDASDFTFFLVGNFDVETIKPLLETYLGSLP-------DIERDETWKDVG  753

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              ++P  +++E V     +A+  V L F  +L  E   ++ + +  ++++L+ K+ + LR 
Sbjct  754   MRYPEGVVKEEVKKG-ADAKSQVTLAFTGDL--EYSRKEAYKIRSITEILQIKLTEKLRE  810

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             + G +Y +  +   G  +   V N    I INF+C P+    L+D    EI +LQE+GP 
Sbjct  811   EMGGVYGSRAN---GSAQQLPVENY--SININFTCSPENVQALIDATFGEIKKLQEEGPL  865

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             ++D+  + E ++   + GL+EN  WL  +   Y
Sbjct  866   EKDLVKIKETQKLEMKEGLKENGTWLSLLRNHY  898



>ref|WP_015334283.1| peptidase M16 domain protein [Fibrella aestuarina]
 ref|YP_007323777.1| peptidase M16 domain protein [Fibrella aestuarina BUZ 2]
 emb|CCH03184.1| peptidase M16 domain protein [Fibrella aestuarina BUZ 2]
Length=948

 Score =   450 bits (1157),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 286/882 (32%), Positives = 452/882 (51%), Gaps = 31/882 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+R N++P  RA L L VRAGSVLE + ++G+AH +EH+AF+ T+ + 
Sbjct  50    VKVGKLPNGLTYYIRKNAEPANRAELRLVVRAGSVLENDAQQGLAHFMEHMAFNGTKNFP  109

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+S G  FGA  NA TS DETVYEL VP D   +  Q++ IL +++  V    
Sbjct  110   KNELVNFLQSSGIRFGADLNAYTSFDETVYELPVPTDSANVFEQSMQILEDWAHNVTLDP  169

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++EKERG V+EE+R  R A  RM+D ++  ++  S+YA RLPIG + +IR   P +++ 
Sbjct  170   AEVEKERGVVLEEWRLGRGAQQRMRDKYFPFILNNSRYANRLPIGKDSIIRNFKPAVLRD  229

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+AVGDF D   V  +I+  FG       P P P + +P H++ +   
Sbjct  230   FYKTWYRPDLMAVVAVGDF-DVNQVEAMIRQKFGRIPKATTPLPRPTFTIPPHKDTKVVI  288

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               ++E   + V I  K P  + KT+ D R  +   +F   L  R  +++++ DPP+    
Sbjct  289   VTDNEQPNTIVQIIYKRPQLKEKTLGDLRSDIVRDLFNGMLGNRIQELTQQADPPFLYGY  348

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             +     +  + A+   +  KE     A+ ++L E ARV+  GF+  E++  +  L+  IE
Sbjct  349   SNYGSFLGNLDAFTAFAVAKEGNIERAIRALLDENARVKQFGFTPTELARAKTDLLRGIE  408

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              AYLERD+ +S +   EY+ +F   EPV+ I Y     K  L  I  +EV+   ++F  +
Sbjct  409   QAYLERDKTRSANYVGEYVGNFTDQEPVVNIGYYFDFVKQHLDGIKLTEVNGLVDQFIRN  468

Query  1420  SSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
              +  +  + P +  A +  +  V+  ++     Q +  +++  + + +++  P PG I+ 
Sbjct  469   ENRAVVLMAPEKDKAKLPSVEQVIGYVDA--AGQGLTAYNDNVLDKPLLAKAPVPGKIIS  526

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             + +   +G  E  LSNG+RV  K TNF +DQ+LF+G S GG S    +++ S    ST+ 
Sbjct  527   EQKLDKIGVTELRLSNGVRVVLKPTNFKNDQILFSGNSLGGTSRYELADFQSARFASTLV  586

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                G   Y    L   LAGK   V   +G      SG  +P DLETALQL+Y  FT   +
Sbjct  587   SLGGTGEYSQVQLGKFLAGKALNVSPYIGELNEGVSGGTAPKDLETALQLLYSYFT---Q  643

Query  1957  PGEEDVNIVM-----QMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVN  2121
             P  +D ++V      Q +  A       P   F + V      N+   +P+   DL +++
Sbjct  644   P-RKDADVVAGFLSNQKSALANQLATPTPQKVFQDTVSVTLGNNNPRRQPLTPADLDRIS  702

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               +A + +N+ F D S FT   VGN DP    PL+  YLGG+P         + +  + L
Sbjct  703   LDRALQIYNDRFADASNFTFTFVGNFDPIKVRPLLETYLGGLPSTQ------SNETFRDL  756

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
               + P   + + V    V+ + SVQL +      +   E+   V  L+++LE K+++ LR
Sbjct  757   GIRAPEGQLSKTVRR-GVDPKASVQLVYTGNF--DWTPENAVQVDALAEVLEIKLIEKLR  813

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              +   +Y    S   G     R    R    INF C P+    LV     E+ +L+  G 
Sbjct  814   EEESGVYGVSASGVYG-----RYPVPRYTFRINFGCAPENVEKLVASVNREVAKLKATGA  868

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGD  2787
               +D++      QR  E  L++N +WL  +   Y    Y+GD
Sbjct  869   DAKDIAKFKAETQREQEVQLRDNNFWLSYLANQY----YNGD  906



>ref|XP_009620905.1| PREDICTED: uncharacterized protein LOC104112632 isoform X2 [Nicotiana 
tomentosiformis]
Length=947

 Score =   448 bits (1152),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 297/950 (31%), Positives = 491/950 (52%), Gaps = 57/950 (6%)
 Frame = +1

Query  121   VNMEEALSQTPYGVDYGRLDNGLTYYVR--SNSKPKMRAALALAVRAGSVLEEEEERGVA  294
             +++++     P+  DY  LD+G+TYYV+  +N+  K    L L V+AG+V EEE E GVA
Sbjct  37    LDLQQVFPTQPFETDYEVLDSGVTYYVKRSANTNDKGLIHLTLIVKAGAVCEEENELGVA  96

Query  295   HIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQA  474
             HI+EHL       Y++ D + +L++   + GA Q A+T +D T+Y   V       L +A
Sbjct  97    HIIEHLVLEGY-GYSDPDALDYLQAFKHQCGAHQQALTLSDYTIYNFVVT--NTVNLKKA  153

Query  475   ISILAEFSSEVRASEHDLEKERGAVMEE-YRGSRNANGRMQDAHWVLMMEGSKYAERLPI  651
             I+++A  S E+  +  +LEKE+  V +E +  S+    + Q      + +G+K       
Sbjct  154   IALMAAISQELDFTSDELEKEKRIVSQELWNDSQIIEKKHQLTFSTHLFQGTK-------  206

Query  652   GLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdppp  831
                             FY KWY   NMAVI VGD  +TQ++++LIK +F  +        
Sbjct  207   ---------------GFYTKWYVPSNMAVIVVGDITETQNIIDLIKTYFERQPRGMPQHL  251

Query  832   ipYYLVPSHEEPRFSCFVESEAAG---SAVMISCKMPVDELKTVKDY----RDLLAESMF  990
                + +P H EPR    V+S       S V ++     +  K V D     + +L + + 
Sbjct  252   E--FPLPKHTEPRLIAHVDSALVKWRMSVVYVTFMFEKEGWKCVNDVFINIQRMLLQKVI  309

Query  991   FHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVAR  1170
                L +RF  +S+ K   Y    +  D  +  +  Y+++  C+   T + LE+ L E+AR
Sbjct  310   LGRLKKRFSSMSKPKQLQY----SRDDSHMYTI--YVVSVECEGYETNKVLETFLVEIAR  363

Query  1171  VRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQL  1350
             +R+HG  E E+S  +   +   +  YL      S  LR  Y  HF+ NE     + EAQ+
Sbjct  364   MRVHGIKENELSEGKDFCLCIPKGRYLNHHDRSSEQLRRTYTSHFVYNEADFSPKLEAQV  423

Query  1351  QKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPP  1530
                L   I+   +  + E    +S+  +   + +   T ++++  + KI  FE++ S P 
Sbjct  424   MIALTKRINMELIKNFCEMQFAASNLSVIIFQSKTFVTQEEMKRSLQKITDFEKEGSFPS  483

Query  1531  WDEE---NIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFT  1701
             W +E    +   I  ++   G I+++ E+ ++GA E  LSNGM+V Y+CT   DD+V+  
Sbjct  484   WSDEEMEGLTNLIQEMEIESGKIVERLEHFDIGAVELILSNGMQVTYQCTKN-DDKVVLR  542

Query  1702  GFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSF  1881
             GFSYGGLSE+ E++  SCS  S I   I ++  +    + M+  K      ++  Y R+F
Sbjct  543   GFSYGGLSEVTETDILSCSYSSVIGQIIWLYSSKN---LPMIRDK-VNFAIEVDEYKRAF  598

Query  1882  SGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL  2061
              G+   SD+E ALQ++Y LFT+++EP EE+   +++  +  +    + P     + V+E+
Sbjct  599   CGNFDSSDIELALQILYLLFTSDLEPEEEEFQALIEDLKIRLSPAHQQPADVLIDTVKEI  658

Query  2062  NYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLG  2241
             N G S +++     D+  ++  KA +YF NCF+ PS+F V++VGN+D A+   L+ +YLG
Sbjct  659   NSGKSCYYKAPVAEDMSNIDATKAWQYFQNCFRGPSSFRVILVGNLDTASVNSLLSRYLG  718

Query  2242  GIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLC--FPVELKSEDMM  2415
             GIPRP  PI+ F R  L   PF FP ++I+E V S  V +   +  C  FP+   ++ + 
Sbjct  719   GIPRPHRPIMKFQRGKLTTAPFHFPPTVIKEEV-SLAVGSGNGMYTCISFPLRFNNQTLE  777

Query  2416  EDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSC-D  2592
             ED+  +  L  LL+ K+ QVLR + G  YN  V  F      S  G+  G I  N    D
Sbjct  778   EDLLLLIILRNLLKVKVTQVLRHEKGIAYNVDVDTFNPNGDWSCSGSKPGTINFNLLIKD  837

Query  2593  PDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR  2772
              D +   VD  + EI +L+E GPS   V  VL+      E   + N   ++++L++Y S 
Sbjct  838   NDAAQMAVDAVVHEIEQLKEVGPSQNLVQHVLDRRPSLEEE--ERNTSLMNQMLQAYGSN  895

Query  2773  IYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVIL  2922
             +Y+G++  S+K+  +   +   L     A+  L+R+LP+PC++Q+T+V L
Sbjct  896   LYAGNIDQSYKILRDMNRRAWDLFNADVAKSTLKRMLPYPCQEQHTIVNL  945



>ref|WP_010853439.1| putative zinc protease [Cyclobacteriaceae bacterium AK24]
 gb|EON78098.1| putative zinc protease [Cyclobacteriaceae bacterium AK24]
Length=946

 Score =   447 bits (1150),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 276/864 (32%), Positives = 448/864 (52%), Gaps = 29/864 (3%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G L+NGLTY+++ N KP+ +  L L V AGSVLE+E + G+AH VEH+AF+ TE +  ++
Sbjct  46    GVLENGLTYFIQQNPKPESKLELRLVVNAGSVLEDESQLGLAHFVEHMAFNGTEHFEKNE  105

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             ++ +L+SIG  FGA  NA TS DETVY L +P D PE L    ++L +++  +     D+
Sbjct  106   LISYLQSIGVSFGADLNAYTSFDETVYILPIPTDDPEKLHNGFTVLKDWAGGLLLEAEDI  165

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             + ER  ++EE+R  +  + R++D +  L++ GS+YAERLPIG   +IR    + +++FY+
Sbjct  166   DAERSIIVEEWRTGQGVDQRLRDQYLPLLLFGSRYAERLPIGDMDIIRNAPYEDLRRFYR  225

Query  709   KWYHLRNMAVIAVGDF-PDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFV  885
              WY   NMAV+A GD  PDT  +VELI  +FG   +P D P    + VP HEE   +   
Sbjct  226   DWYRPDNMAVVAAGDVAPDT--LVELITRYFGSLKNPSDAPDRVSFEVPEHEETLITVLT  283

Query  886   ESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAA  1065
             + EA G  + +  K       TV DYR+ +   M    L QR  +I ++   P+    A 
Sbjct  284   DEEAPGIQLQLFYKHKPKPTVTVADYRNRIIRIMLGGMLTQRLDEIRQRPQAPFVYAGAR  343

Query  1066  ADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESA  1245
                 VR +  +  + +     T+  +ES LTE  RV  +GF++ E+  V+  L++  +  
Sbjct  344   FGSFVRDLDFFTTSGAVTTGNTLRGVESFLTENERVLRYGFTDSELDRVKRSLLNSADRG  403

Query  1246  YLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSS  1425
             + E D+M+S +L   Y+ HFL      G E    L + L+P IS  +V+  ++      +
Sbjct  404   FQEMDKMESRNLVGRYVSHFLTGSFAEGEEIRYHLYQALVPAISLEDVNAMAQTLIREEN  463

Query  1426  CVIKTIEPRATATVDDLRSVVLKINTFEQKQSIP--PWDEENIPEEIVSVKPSPGWIMQQ  1599
              V+    P A  +  DL S       FE+ +++P  P+DEE  PE ++S  PSPG +++ 
Sbjct  464   RVLIVTAPEADRS--DLPSEEELRLLFEKVKALPLEPYDEEVFPEVLMSTLPSPGRVVEM  521

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
                  V      LSNGMRV +K T++ +D+++FTG   GG S  P+ ++++ S  S +  
Sbjct  522   TVNDEVQVTTVTLSNGMRVSFKPTDYKNDEIIFTGMGRGGASLYPDEDHYAASYASVMVN  581

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
              +G+  + P+ L  +L GK   V   L  Y  + SG  SP DLE ALQLV+ L+ T    
Sbjct  582   VMGIGDFSPTALRKVLTGKNVSVTPNLSTYGETISGGTSPRDLELALQLVH-LYFTAPRL  640

Query  1960  GEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYFFRPIRIRD---LQKVNPY  2127
               E  ++ ++     +   + +P   F  RV E+ N GN    R + I D   L  ++  
Sbjct  641   DRELFDVYIENQRNQLETAQSNPDFQFNKRVSEIVNQGN---LRAMGIYDPEQLDLIDLE  697

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             +  E +   F + + F  +  GN+D     PLI  YLG +P          RD+ + L  
Sbjct  698   RGLEIYRERFANAANFEFLFTGNLDLEQVIPLIELYLGSLPGDGT-----RRDEYRDLGI  752

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
             + P  I   +      ++Q  +    P        ++    V +L ++L  ++++ LR +
Sbjct  753   RIPRGIQERIEVGRDDKSQVIMYFSGPAAYD----LDKNQQVSYLGEILTIRLIETLREE  808

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
              G +Y  G    L     SRV +      I+F C PD    L+D+  +EI ++QE+GP +
Sbjct  809   IGGVYGVGARGAL-----SRVPDESFSFSISFPCSPDNVDMLIDVVWEEIKKIQENGPEE  863

Query  2668  EDVSTVLEIEQRAHENGLQENCYW  2739
             +D+  V E ++ + +  ++ N +W
Sbjct  864   KDLLKVRESKRISLDENMKRNGFW  887



>ref|WP_014456599.1| putative Zn-dependent peptidase [Spirochaeta africana]
 ref|YP_005476324.1| putative Zn-dependent peptidase [Spirochaeta africana DSM 8902]
 gb|AFG38617.1| putative Zn-dependent peptidase [Spirochaeta africana DSM 8902]
Length=958

 Score =   447 bits (1150),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 294/902 (33%), Positives = 455/902 (50%), Gaps = 34/902 (4%)
 Frame = +1

Query  58    PAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAAL  237
             PAE +++ P +   R          E L   P  +  GRLDNGLTYY+R N +P+ R  L
Sbjct  32    PAEPTEVFPTETESRG---------ETLPTDPQ-LTIGRLDNGLTYYIRRNPEPENRVFL  81

Query  238   ALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSAD  417
              L V AGS+LE E E G+AH VEH AF  T+ +T+  IV +LES+G  FG   NA T  D
Sbjct  82    RLVVNAGSILETESELGLAHFVEHAAFLGTKDFTHDQIVAYLESLGMRFGPDVNAYTGFD  141

Query  418   ETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQD  597
             ETVY L +P D PE + + + IL +++  V      +E ERG ++EE+R  R A  R++D
Sbjct  142   ETVYMLQIPADDPEKIERGVHILQQWAHAVSFDPQRVETERGVILEEWRVGRGAEQRLRD  201

Query  598   AHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVV  777
               + ++   S+YAERLPIG  +V    SP+ ++ FY++WY    M+VIAVGDF D   + 
Sbjct  202   LQFPILFRDSRYAERLPIGEPEVFMQASPEDLRAFYERWYRPDLMSVIAVGDF-DPARME  260

Query  778   ELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVK  957
             EL++++F       +P   P Y +  H+E  F+ F + EA  S V +  K P  +L+T  
Sbjct  261   ELLQSYFADIPPHEEPQERPLYPISQHDETLFAPFSDPEAGHSRVTVYTKHPPRQLQTEN  320

Query  958   DYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVE  1137
             DY + L   +F   +N+RF  ISR  D P+ +  AA   LVR     ++ +  +E    E
Sbjct  321   DYLETLRHRLFAVIMNERFADISRSADAPFLAAGAAQGNLVRTASGTMLQAVTEEDRIAE  380

Query  1138  ALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNE  1317
               E++L E  R R HGFSE E+   R  L+  +++AY ER+   S     EY +HFL NE
Sbjct  381   GFEAILVEAVRARSHGFSESELERARQRLLRSMQTAYNERNTTPSGQYAAEYTRHFLENE  440

Query  1318  PVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLR----SV  1485
              V GI YE +L + LLP I+  E++  ++ + +  + V+      + A  ++L+    S+
Sbjct  441   AVPGIAYEWELTRRLLPAITVEEINTVADSYLSPENRVVTV----SAAETENLQMPDESL  496

Query  1486  VLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYK  1665
             +  I      + IPP +     ++++S  P+PG I  Q  +Q+V   E+ L NG+ V  +
Sbjct  497   LSAILGDVLDRDIPPLESAEYLDQLISDLPTPGTIRSQEHHQDVEVTEWTLDNGVTVLLR  556

Query  1666  CTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAE  1845
              T+F  D+V    F  GGLS   + +Y +  + + +A + GV     + L  +L+G+R  
Sbjct  557   PTDFRSDEVRLHAFQRGGLSLAEDQDYHAALLAAPLAEQSGVAHLNRTQLDQLLSGQRVS  616

Query  1846  VGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERD  2025
             +   +  Y   F+G  S +D+ET LQLV+  +  +     +  N +M+    ++  +   
Sbjct  617   LSPFIHDYSHGFTGSSSSADIETLLQLVHA-YAVSPRFDRDSYNFLMRQLRASLDRRRDQ  675

Query  2026  PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDP  2205
             P   FA+R++EL         P++  DL K +   A   +   F D S  TV++VGN+D 
Sbjct  676   PDAVFADRLQELTAAGDIRRLPLQTDDLVKADYDSAVSQYLKRFSDLSGLTVILVGNLDL  735

Query  2206  ATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF  2385
                 PLI QYL  +P   E      R          P   I++ +     E      L F
Sbjct  736   EELEPLITQYLATLPVGGELQEAVPRSG------SLPRGRIQDQLRFGQ-EDSSRAALVF  788

Query  2386  PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG  2565
               E  +   ++        +  +  +  +V+R   G  Y   VS    G++    G  R 
Sbjct  789   TGEFSAAPEIDYARAALADALRIHLR--EVIREGEGGTYGVQVS---SGSEKFPFGRYRY  843

Query  2566  DIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLD  2745
              IG  F+ DP     L     DEI  ++EDGP+ + V  V E  +R HE+ L+ N +WL 
Sbjct  844   TIG--FNTDPQRVEHLTQRVHDEIQLIREDGPATDIVQRVQETHRRDHESNLRSNGWWLS  901

Query  2746  RI  2751
             R+
Sbjct  902   RL  903



>ref|WP_038032229.1| hypothetical protein [Thermonema rossianum]
Length=935

 Score =   442 bits (1137),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 285/876 (33%), Positives = 451/876 (51%), Gaps = 31/876 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY+R N KP+ R  L L V AGSVLE+E++ G+AH VEH+AF+ T+K+ 
Sbjct  35    VKTGVLPNGLTYYIRHNQKPEKRVELRLVVNAGSVLEDEKQLGLAHFVEHMAFNGTKKFP  94

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++IV +L+SIG +FG   NA TS DETVY L VP DKPEL+ + + IL E++S V    
Sbjct  95    KNEIVSYLQSIGVQFGGDLNAYTSFDETVYMLPVPTDKPELVDKGLEILREWASNVTFEP  154

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++EKERG V+EE+R  R A  RM D  + ++++GS+YA+RLPIG E+ ++T   + + +
Sbjct  155   EEVEKERGVVLEEWRLGRGAEQRMMDKQFPVILKGSRYAKRLPIGTEQSLKTFKYKDLVR  214

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+ VGD  D   + + IKA FG   +P   P   +Y VP H+E   + 
Sbjct  215   FYKDWYRPDLMAVVVVGDI-DPAQIEQKIKALFGDLKAPKKAPKREFYPVPDHKEMLVTV  273

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EAA  +V +  K     +KT +DY + L   M    L++R  ++    +PP+    
Sbjct  274   ASDKEAAFPSVQLLFKKAPVSIKTEQDYLERLKMEMVEGMLSERLEELRLSAEPPFSYAW  333

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A     VR   A+ + +        +AL+++LTE  R  L+GF E+E  + +   ++E+E
Sbjct  334   ANYGNFVRTKDAFSLDAITDGSKLQDALQTLLTEARRAALYGFVEQEFELYKKKYLAELE  393

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
               Y +R + +S  L   Y+ H+L   P  GIEY+    K  L  I+  +++   ++  T 
Sbjct  394   LQYNDRQKTESKRLVWAYVNHYLEGAPAPGIEYKYAFAKEHLDKITLEDLNALIKQMITG  453

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIV-SVKPSPGWIMQ  1596
              + V+    P            V ++    QKQ + P++ + +   ++  ++  PG +  
Sbjct  454   ENMVVVVQGPEKEGVKMPTEEEVRRMVQETQKQEVKPYEAKALAASLMQGIELKPGKVTA  513

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             +   +++G  E+ LSNG RV  K TNF DD+VL + FSYGG     E    S    + + 
Sbjct  514   EHTIESLGVIEWTLSNGARVLLKPTNFKDDEVLISAFSYGGSWLADEKNLPSAEFIAGVV  573

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
              E GV+ +  + L  MLAGK  EV   +G  +  F G  +P DL+TAL+L++  F   V 
Sbjct  574   AESGVYQFSATELSKMLAGKNVEVSPTIGNLLEGFRGKTTPKDLQTALELLHLYF---VA  630

Query  1957  PGE--EDVNIVMQMAEEAIHAQERDPYTAFANRVREL-----NYGNSYFFRPIRIRDLQK  2115
             P    E     +Q ++  +     +P   F ++   L      YG+++      + D  K
Sbjct  631   PRHDPEAFRSALQRSKGFMTNLMANPMYYFYDQYARLLSNYHPYGDAW------LPDYDK  684

Query  2116  VNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLK  2295
             ++  K   ++   F D S FT + VGNIDP T  P++ +Y+  +P  +      +R    
Sbjct  685   IDYDKGFAFYKERFADASDFTFLFVGNIDPETFKPMVERYIASLPSLNRKEKWIDRG---  741

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
                 + P   +  + +    + +  VQ+ F  EL + D  E    +  L  LL  K+V+ 
Sbjct  742   ---VRPPKGKVDTIFYKG-SDPKSMVQMVFAGELPAYDEKE-AFLLQMLGDLLNIKLVET  796

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             +R +   +Y  G   ++   K    G      GI+F C P+    L  LAL E+ ++QE 
Sbjct  797   IREEASGVYTVGAYGYM--TKSPSAGY---RFGISFPCAPERVEELTALALAEVKKVQEG  851

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
               ++ED+  + E  +R  E  LQ N YWL+ +   Y
Sbjct  852   KIAEEDLQKIKEQYRRKKEVELQTNNYWLNALQSRY  887



>ref|WP_037572693.1| hypothetical protein, partial [Spirochaeta cellobiosiphila]
Length=890

 Score =   438 bits (1127),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 276/866 (32%), Positives = 445/866 (51%), Gaps = 32/866 (4%)
 Frame = +1

Query  175   LDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIV  354
             LDNGLTY+VR N KP  R AL L V AGS++EEE+++G+AH++EH+AF+ TE +   ++V
Sbjct  1     LDNGLTYFVRENKKPDNRIALRLVVNAGSLMEEEDQQGLAHLIEHMAFNGTEHFAKQELV  60

Query  355   KFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEK  534
              + E +G +FG   NA TS DETVY L +P D PE+L +A+ +L ++++ +     +++K
Sbjct  61    DYFEMVGMDFGPEINAYTSFDETVYMLRIPADDPEILDKALLVLHDWATSISFDPEEVDK  120

Query  535   ERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKW  714
             ERG V EE+R  R A GR+QD  + ++ +GS+YA+RLPIG   V+     Q +K FY KW
Sbjct  121   ERGVVTEEWRLGRGAQGRIQDQQFPVLFDGSRYADRLPIGHMDVVANAPVQRLKDFYHKW  180

Query  715   YHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESE  894
             Y    M++I VGD  D  +V++ IK  F Y +      P   Y VP +++   +   + E
Sbjct  181   YRPELMSIIVVGDV-DQDTVIKKIKEQFDYPSQGGPERPS--YPVPDNKDININITTDPE  237

Query  895   AAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADC  1074
              + + V +  K    +  T  DYR+ + +++ F  LN+R  +I ++++PP+   S  +  
Sbjct  238   TSYNQVEVYYKQDPKDFFTRGDYRETIKQALQFRMLNKRLAEILQEENPPFLDVSTGSQR  297

Query  1075  LVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLE  1254
              VR      + +     G   +L ++L E  RV+ +GF++ E+   +  L+S +   YLE
Sbjct  298   FVRNKDLGYLIAIAPSGGIDTSLRALLEESERVKRYGFTQAELDREKNNLLSSMRQYYLE  357

Query  1255  RDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--GTSSSC  1428
             ++ + S+SL DE  +H+L  EP+ GIE E QL K  LP IS  E++++   +        
Sbjct  358   KENIPSSSLADELKRHYLFGEPIPGIEVEYQLYKDFLPGISLKEMNQFVSNWLDDVGPVV  417

Query  1429  VIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEY  1608
             +I   E     T  D+  +  ++ + + K      D+  + E I    P+PG I+ + +Y
Sbjct  418   LISAPEGEMIPTESDVEGIFNQVKSEDLKPYALMADDRELMENI----PTPGAILDEQKY  473

Query  1609  QNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG  1788
                G   + LSNG +V  K T+F+D+QVLF   S GG S + + +Y S      IA + G
Sbjct  474   PATGITRWTLSNGAQVIVKPTDFMDNQVLFYAVSPGGSSLVKDRDYLSSQFAMAIASQSG  533

Query  1789  VFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEE  1968
             + G+    L ++LAGK  +V + +  Y    SG  SP D  T  QLV   FT  +   ++
Sbjct  534   LNGFNSIELQNLLAGKSVKVNSWIHDYYEGVSGQYSPEDGTTFFQLVNLSFTKQMYT-KQ  592

Query  1969  DVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFN  2148
               N +M      +  +E DP T F++R+R L  G  + +RP+    L +V   +A +   
Sbjct  593   AFNSLMNRYSSFLENKENDPQTIFSDRLRVLTSGGHFRYRPLTSSLLSEVKLEQAQKIGE  652

Query  2149  NCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSII  2328
               F + + FT   VGNID       +  Y+  +P  ++      R+        FP  I 
Sbjct  653   ERFANAADFTFFFVGNIDMKELKEEVSTYIASLPATTK------RESFVDQNVNFPKGIT  706

Query  2329  REVVHSPMVEAQCSVQLCFPVELK----SEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQ  2496
              E +H  + E Q  V L F  +       +D+ E    V  L+  L  KI + +   YG 
Sbjct  707   EETIHKGL-EPQSRVHLTFSGDFTPGKWQKDLFEAARHV--LALRLHEKIREDMSGTYG-  762

Query  2497  IYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDV  2676
             +  +G +        + V N    + I+F C+P     L     DEI +L      ++++
Sbjct  763   VRVSGAA--------TDVPNDHFSLNIDFGCEPGREEELTAAVFDEIKKLASGVVQEKNI  814

Query  2677  STVLEIEQRAHENGLQENCYWLDRIL  2754
               V E   R  E GL+EN YWL +++
Sbjct  815   VKVKEGLIRDQEKGLKENSYWLSQMI  840



>ref|WP_012682228.1| putative metallopeptidase [Gemmatimonas aurantiaca]
 ref|YP_002760251.1| putative metallopeptidase [Gemmatimonas aurantiaca T-27]
 dbj|BAH37781.1| putative metallopeptidase [Gemmatimonas aurantiaca T-27]
Length=950

 Score =   438 bits (1127),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 282/891 (32%), Positives = 452/891 (51%), Gaps = 27/891 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NG+ YYVR N+KP+ RA L L V AGS+LE+E++RG+AH VEH+AF+ T  + 
Sbjct  51    VRVGTLPNGIKYYVRRNAKPEQRAELRLVVNAGSILEDEDQRGLAHFVEHMAFNGTTNFA  110

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +DIVK+LESIG  FGA  NA T  DET+Y L VP D   +L ++   L + +S ++   
Sbjct  111   KNDIVKYLESIGVRFGADLNAYTGFDETIYILPVPTDSAGILERSFRFLGDVASGIKFDS  170

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++  ERG V+ E+R       R++D  + ++  GS+YAERLPIG  ++I   +P  +K+
Sbjct  171   AEVVAERGVVLAEWRDGLGVGERLRDKQFPVIFRGSRYAERLPIGKPEIIEGATPAPLKR  230

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             F++ WY    MAV+AVGD  D   +  LI+  F      P P P     VP+H+    + 
Sbjct  231   FWRDWYRPDLMAVVAVGDV-DPARLERLIRTTFASIPRRPSPRPRTIATVPAHDSTLVTI  289

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E   S V +  K P    +TV D R  L + ++   +NQRF +++ K D P+    
Sbjct  290   ATDKELTSSNVGVLWKRPGKATRTVGDLRVGLLDELYDGMINQRFRELALKADAPFVGAG  349

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A++   VR      + ++ +E   +E+L+++LTE  RV+ HGF   E+   R  ++   E
Sbjct  350   ASSGAFVRGSAYSSLDANAREGQVIESLQAILTEAERVQRHGFLAAELDRARTNMLRGYE  409

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              AY ERD+  S +  DEY+ H+L  + + GI +E    + LLP+++  EV+  +++   +
Sbjct  410   RAYAERDKSPSGAFVDEYVNHYLVGDGIPGIAFEYAAVQKLLPNVTLDEVNALAQQRSGA  469

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
             ++ V+    P          + V ++        I PW E    E++V   P+ G ++ +
Sbjct  470   ANRVVTVTVPDKDGLAVPTEAEVRRVFGTLVAADIKPWVETVSDEDLVPTPPAAGKVVSE  529

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
                 ++   ++ LSNG+RV  K T+F  DQ++ + +S GG S + + + F  S+  T+  
Sbjct  530   RTVASLDVTDWTLSNGVRVLVKPTDFNADQIVMSAWSPGGASLVADKDVFKTSLTPTVIE  589

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
               GV  +    L   L GK A V T +G    S +G  SP DLET LQL + L  T    
Sbjct  590   RGGVGAFSLIDLTKKLTGKVASVNTGIGDLSESLNGRASPRDLETLLQLTW-LRMTAPRV  648

Query  1960  GEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACE  2139
                    ++   E A+  ++ +P   F++ V+    G     RP+ I  L ++N  +   
Sbjct  649   DSAAFQALLPPIETALRNKDANPGAVFSDTVQVTLAGGHPRVRPLTIDMLSELNLGEMFN  708

Query  2140  YFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP---RPSEPILHFNRDDLKGLPFK  2310
              + + F D S FT + VGN+DPAT  PL+ Q+LG +P   R  EP     RD     P +
Sbjct  709   IYRDRFGDASEFTFLFVGNVDPATLKPLVEQWLGALPASGRKEEP-----RDV---GPKQ  760

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
             F   I + V      ++Q +V L            E+ + +  + ++LE +++  LR   
Sbjct  761   FTGVIDKTVRKGIAPQSQTAVLLAGSAPWSR----EEAYLLSSVGEVLEMRLLDRLREAL  816

Query  2491  GQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDE  2670
             G  Y+  VS        SR       I I++   PD +  +      E+  L+   P+  
Sbjct  817   GGTYSVSVSTAF-----SRRLRQEWQIAISYGSAPDNAEQMFKAVEQELDSLRRTPPTAA  871

Query  2671  DVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEAR  2823
             +V  V E ++R  E   ++N YWL+ I    + R+ +GD  D   ++DEAR
Sbjct  872   EVERVREQQRRELEVAKKQNGYWLNTI----RGRVENGDPLDG-PIEDEAR  917



>ref|WP_012500445.1| peptidase M16 domain-containing protein [Chloroherpeton thalassium]
 ref|YP_001996808.1| peptidase M16 domain-containing protein [Chloroherpeton thalassium 
ATCC 35110]
 gb|ACF14361.1| peptidase M16 domain protein [Chloroherpeton thalassium ATCC 
35110]
Length=941

 Score =   437 bits (1123),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 277/870 (32%), Positives = 453/870 (52%), Gaps = 30/870 (3%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+L+NGLTY +R N++P+ RA L L V AGSVLE E+E+G+AH VEH++F+ T  Y
Sbjct  37    NVTIGKLENGLTYIIRKNTRPENRADLRLVVNAGSVLENEQEQGLAHFVEHMSFNGTTHY  96

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
                ++V FLES+G  FGA  NA T  DETVY L +P D   LL+  + IL E++ EV   
Sbjct  97    EKQELVNFLESVGVRFGADLNAYTGFDETVYMLQIPTDSAGLLTTGLDILKEWAHEVSFD  156

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               ++EKERG ++EE+R  R A+ R++D  + ++   S+YA+RLPIG + ++ T     ++
Sbjct  157   GEEIEKERGVIIEEWRSGRGADTRIRDKQFPVIFHNSQYAKRLPIGQKAILDTFQHATLR  216

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              FYKKWY    MAVIAVGDF + + V   I+  F    +  +    P Y VP H+E   +
Sbjct  217   NFYKKWYRSDMMAVIAVGDF-EPKKVESEIREIFSKIPARANVIRRPSYPVPDHKETLIA  275

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + EA+ S V I  K  ++E KT++DYR  + +S+  + LNQR  +++++  PPY   
Sbjct  276   IATDPEASSSQVAIYHKKAIEEEKTLRDYRKTIVQSLAENMLNQRLDELAKRPTPPYIFG  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
                   LVR    + +++S  + G    L+S+L E  R+R  GFS  E+   +  L+  I
Sbjct  336   YGYYGSLVRTKDVFALSASVGDTGIAFGLQSLLLEAKRIREFGFSASELLREKKSLLKNI  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E+ Y ERD+ +S     EY +HFL NEP+ G+E E +  K  +P IS  EV++  + +  
Sbjct  396   ETLYKERDKSESEGFVREYTRHFLTNEPIPGLENEYEYYKQFVPEISLDEVNRLIKEWLK  455

Query  1417  SSSCVIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
               + VI    P   +    T  D+R+++ K  T +    +    EE +  E  +  P  G
Sbjct  456   PENRVILVSAPEKESVEIPTEADIRALLRKAETMKVDAYVDNASEEPLLSE--ADLPEAG  513

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMG  1764
              ++ + + + +G  E+ LSNG+RV  K T+F +D++L + +S GG S +P+S Y +    
Sbjct  514   KVVSEAKNETLGTVEWILSNGVRVVLKPTDFKNDEILMSAYSKGGTSLVPDSSYIAAVTA  573

Query  1765  STIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFT  1944
             S+I    G+  +    L   L+GKR  +   +        G  +P DLET  +L Y  FT
Sbjct  574   SSIVRLSGLGQFDAVQLEKKLSGKRVSINPYISELEEGIGGFSTPDDLETLFKLCYLNFT  633

Query  1945  ---TNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDL-Q  2112
                T+       +     + E     + R P TAF + + ++     +F + +    + +
Sbjct  634   APRTDTSAFRSYITRFRGLLEN----RSRQPETAFFDTL-QVTLAQHHFRQRVWTSQMFR  688

Query  2113  KVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDL  2292
             + +  K+ + +   F++   FT   VGN  P +  PL+L+YLG +P   E      ++  
Sbjct  689   EFSLEKSIQIYKERFRNAGDFTFFFVGNFSPDSLKPLVLKYLGALPASDE------KETW  742

Query  2293  KGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQ  2472
             +    + P   + ++V    +E +  V + F  + +     E+ + +  L+  LE ++ +
Sbjct  743   RDNGIRLPKKSLHKIVQKG-IEKKSRVAMIFTGDFQWS--RENRYNIRSLADALEIRLRE  799

Query  2473  VLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQE  2652
             VLR + G  Y   VS       P           I+F C+P+  + L+  A  EI ++Q 
Sbjct  800   VLREEKGGTYWIRVSA-----SPEHFPKDAFTFEISFGCNPERVAELLASAKAEIKKVQA  854

Query  2653  DGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             +G     V  V E ++R++E  L+EN +WL
Sbjct  855   EGLDSIYVGKVKESQRRSYETSLKENSFWL  884



>gb|ADI23662.1| predicted Zn-dependent peptidases [uncultured Gemmatimonadales 
bacterium HF4000_15H13]
Length=941

 Score =   436 bits (1122),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 304/955 (32%), Positives = 479/955 (50%), Gaps = 64/955 (7%)
 Frame = +1

Query  118   NVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAH  297
              + +E  L   P  V  G LDNG+ Y +R NS+P+ RA L L V  GSVLE++ + G+AH
Sbjct  28    QIPLESPLPVDP-NVTIGELDNGVKYIIRQNSRPENRAELRLVVDVGSVLEDDSQLGLAH  86

Query  298   IVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQA  474
              VEH+AF+ TE +   ++V +LESIG EFG   NA TS DETVY L  VP D+PE L+ A
Sbjct  87    FVEHMAFNGTEHFEKQELVDYLESIGMEFGPSINAYTSFDETVYMLSQVPTDEPETLATA  146

Query  475   ISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIG  654
               IL ++S  +     +++KERG V+EE+R  R A  R+QD  + +M  GS+YAERLPIG
Sbjct  147   FQILEDWSHLLSFEPEEIDKERGVVIEEWRSRRGAAARIQDLQFPIMFTGSRYAERLPIG  206

Query  655   LEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppi  834
               + +++   +++ +FY  WY    M+VIAVGDF D   + +LI+ HF    +P  P   
Sbjct  207   TVENLQSFPHEVLTRFYDTWYRPDLMSVIAVGDF-DPAQIEQLIQTHFDRLPTPATPLER  265

Query  835   pYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRF  1014
             PY+ VP H E  ++   + EA+GS+V +       E+ TV  YR+ L E++    +N R 
Sbjct  266   PYFDVPDHAETYYAIAADPEASGSSVGVLSMRDPPEITTVGGYRESLVEALVSGMMNNRL  325

Query  1015  FKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSE  1194
              +++++ DPP+ +  + A   VR   A+ + +   E G    LE++  E  R   HGF+E
Sbjct  326   QELTQQADPPFVAAFSGAGGFVRTKSAFQLLAVVPEDGHERGLEALFIEAERAARHGFTE  385

Query  1195  REISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHI  1374
              E+   +  L+  +E  Y +R+  QS     EY+ +FL+ + + GIE+E    + L+  I
Sbjct  386   GELGREKLDLVRGLEQTYNDRENQQSRRFASEYINYFLQGDAIPGIEFEYMAAQALMATI  445

Query  1375  SASEVSKYSERFGTSSSCVI--KTIEPRA--TATVDDLRSVVLKINTFEQKQSIPPWDEE  1542
                 V++ +      S+ V+    IE     T T      V+  + + +    I P+ + 
Sbjct  446   DLDLVNQAARANLDQSNRVVLADAIEKPGLDTPTRAGFERVLDDVTSAD----IEPYVDT  501

Query  1543  NIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGL  1722
              + E +V  +P+PG ++ +     +    + LSNG+ V  K T+F +D++     S GG 
Sbjct  502   TLDEPLVPEQPTPGAVIAESMIDELNMTVWTLSNGVTVWLKPTDFKEDEIAMRATSPGGW  561

Query  1723  SELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPS  1902
             S     ++ S +M + +  + GV  +    L   LAGK   V   +G      SG  SP 
Sbjct  562   SNSSLEDHQSAAMAAGLVQQGGVGAFSTIDLQKALAGKAVRVSPSIGENTERMSGSASPQ  621

Query  1903  DLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQER--------DPYTAFANRVRE  2058
             DLET LQLV+  FT    P E++       A +A  AQ R         P  AFA+    
Sbjct  622   DLETMLQLVWLYFTA---PREDET------AYQAFQAQFRAMLENRGASPMAAFADTFSV  672

Query  2059  LNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYL  2238
                      RPI +  L +++   A +++ + F D S FT V VG ID     PL  QYL
Sbjct  673   TMAQGHPRSRPISVAVLDEIDLGTAVDFYEDRFADASDFTFVFVGAIDLDVMRPLAEQYL  732

Query  2239  GGIP---RPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF--PVELKS  2403
             G +P   R   P+      DL   P   P   I + V +  VE Q   ++ F  P +  +
Sbjct  733   GSLPTVERNDGPV------DLDIDP---PDGHIEKTVRA-GVEPQSQTRIAFTGPFDYTA  782

Query  2404  EDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINF  2583
             ++ ++    +  +++ L+ ++++ +R   G  Y+ GV+         R+   R  + I F
Sbjct  783   QNRVD----IRVMAEALQLRLMERMREDLGGTYSVGVNASY-----ERIPEGRYTVSIQF  833

Query  2584  SCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
               DP+ +  L  +  +EI  LQ DGPS EDV  V+E E+ + E  LQ N YW  +++ S 
Sbjct  834   GSDPERAEELRGVVFEEIRGLQADGPSQEDVEKVVEAEKLSLETNLQLNPYWAVQLMYSR  893

Query  2764  QSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMP  2928
             ++     D    F +       V + L    AQ+ L        ++Q  +V+L+P
Sbjct  894   EA-----DQDPRFLLDGTRYDNVSRELIQQGAQLYLN-------EEQVVIVVLLP  936



>ref|WP_002700665.1| peptidase M16 [Microscilla marina]
 gb|EAY26633.1| putative zinc protease [Microscilla marina ATCC 23134]
Length=941

 Score =   436 bits (1122),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 269/879 (31%), Positives = 441/879 (50%), Gaps = 36/879 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGL YY+R N+KP+ R  L LAV AGS+ E + ++G+AH VEH+AF+ T+ + 
Sbjct  39    VRTGKLKNGLKYYIRKNAKPEKRVELRLAVNAGSMQENDNQQGLAHFVEHMAFNGTKNFK  98

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+S G +FGA  NA TS DETVY L +P DK E++ +   IL +++  V    
Sbjct  99    KNELVSYLQSAGVKFGAHLNAYTSFDETVYMLRLPTDKQEVMDKGFQILEDWAHNVSFDN  158

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG V+EE+R  R A  RM+D ++ +++  S+YA+RLPIG +K++       +KQ
Sbjct  159   KEIDKERGVVIEEWRLGRGAGQRMRDQYFPVLLNDSRYAKRLPIGKKKILENFKYNTLKQ  218

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+ VGD  D  ++ + IK HF       +      Y VP H++   S 
Sbjct  219   FYKDWYRPDLMAVVVVGDI-DLDAMEKKIKQHFSRLKPVKNVREKKLYPVPPHQKTFVSI  277

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EA  S V I  K P+ ++K + DYR  +        LNQR  +++ K DPP+ +  
Sbjct  278   NTDKEAPFSQVQIIYKKPLKKVKNLTDYRQQIINRFHSGMLNQRLRELTEKADPPFINAG  337

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
                   +R + AY  +        +  L   LTE  RVR HGF++ E    +  +++  +
Sbjct  338   FYYGSFIRSIDAYSGSVLANGDDILGGLRVALTESKRVRKHGFTKGEFERYKKTILNSYK  397

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              AY ER +  S S   EY+ HFL+ EP  G+++E +  K +LP I+ +EV+  S+++ T 
Sbjct  398   RAYNERKKTDSKSFAREYVAHFLQKEPTPGVKFEYEFVKKVLPTITLAEVNALSKKWITK  457

Query  1420  SSCVIKTIEPRATATVDDLRS---VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
              + VI    P     +    +    VLK   F    ++ P+ ++ +  +++   P+ G +
Sbjct  458   DNRVIIINAPEKKGVIVPTEAQVRTVLKEVAFN---AVKPYKDKAVGTKLMDKMPTAGKV  514

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
                  Y   G  E  LSNG+ V  K T+F DDQVLF G+S GG S      + S    S 
Sbjct  515   TNTKTYPKSGTTELTLSNGIVVTLKPTDFKDDQVLFNGYSLGGYSLAAAKNHVSAIYASQ  574

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFT--  1944
             I    GV  ++ + L  M+AGK   V   +       SG  +P DLETALQ+ +  FT  
Sbjct  575   IIVASGVSKFKAADLRKMMAGKSVSVKPYIREVTHGVSGATTPQDLETALQMTHLYFTQP  634

Query  1945  ----TNVEPGEEDVNIVMQ--MAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRD  2106
                 T  +  +     +MQ  MA    + Q++        +++  N+  +  F P +  +
Sbjct  635   RKDETAFKSMKNQYKSMMQNLMANPNFYFQDQ------LTKIKNQNHPRAAGFFPTK-EE  687

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD  2286
             L+K++  +   ++   F +   F  V VGN       PL+ +Y+G +P   +      + 
Sbjct  688   LEKIDLDQTMAFYKRIFSNGQNFKFVFVGNFKVDKIKPLLEKYIGSLPTTQQ------KA  741

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
               K L  + P   + + ++    + +  V L F    K     +D   +  L++ L  K+
Sbjct  742   TFKDLGIRPPKGKVTKKLYKGK-DPKSQVHLSFMGAAKYS--TKDASLIKALAEALSIKL  798

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRL  2646
             ++ LR + G +Y AG   ++              I ++F C P+    LV   + EI ++
Sbjct  799   IEKLREEKGGVYGAGAYSYMQKKPYDNYA-----IVVSFPCAPNNVDDLVTATMGEIKKI  853

Query  2647  QEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             Q+ G S +D+  V   + R+ E  ++ N YWL+ +  +Y
Sbjct  854   QKSGISSKDLKKVQAQQIRSMETNMKNNRYWLNTLRSAY  892



>ref|WP_009186036.1| peptidase M16 [Cecembia lonarensis]
 gb|EKB48380.1| hypothetical protein B879_03016 [Cecembia lonarensis LW9]
Length=936

 Score =   434 bits (1117),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 269/869 (31%), Positives = 458/869 (53%), Gaps = 33/869 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY++ N KP+ +  L LAV AGSVLE ++++G+AH  EH+AF+ T  + 
Sbjct  37    VRMGVLSNGLTYYIQQNPKPENKVELRLAVNAGSVLETDKQQGLAHFTEHMAFNGTRNFE  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG  FGA  NA TS DETVY L +P D  E L     +L++++  +   E
Sbjct  97    KNELVSYLQSIGVAFGADLNAYTSFDETVYILPIPSDDEEKLRSGFLVLSDWAGGILMRE  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++ ER  ++EE+R  +  + R++D +  +M+  S+YA RLPIG  +++     + ++Q
Sbjct  157   EDIDAERSIIVEEWRTGQGYSQRLRDQYLPIMLYNSQYANRLPIGQMEIVENFEYETIRQ  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY   NMAVIAVGD  D  +++ LI+  FG   +P   P   ++ VP HEE   S 
Sbjct  217   FYRDWYRPDNMAVIAVGD-ADPGALLSLIEEFFGDMDNPKRAPKRKHFEVPEHEETFVSI  275

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EA G  + +  K       T  DYR+LL  +++   L QR  +I ++ D P+    
Sbjct  276   LTDHEAPGIQIQLFYKHKALPTNTKADYRNLLLRNLYGGMLTQRLDEIRQQPDAPFIFAG  335

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEA-LESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
                   VR +  Y   S     G +EA +++++ E  RV   GF++ E+  V+  +++  
Sbjct  336   TGYGNFVRDLD-YFSASGVVAPGKIEAGIQALILENERVSQFGFTQAELDRVKRAVINNA  394

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E AY E D+ +S+SL   Y+ HFL+     G  ++ +  + ++P I+  E++  ++    
Sbjct  395   ERAYKEMDKSESSSLVGRYVNHFLKGRFAEGEAWKYEFYQEIIPEITLEEMNALAKALVR  454

Query  1417  SSSCVIKTIEPRATATVDDLRS--VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
               + VI    P      D+L S   VL +     +  + P++E  + E+++ V P PG I
Sbjct  455   EDNRVIIITAPDTEK--DNLPSEEQVLALFDLVDQMELAPYEERLLGEQLLEVLPQPGSI  512

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
             + +   + V  FE  LSNG++V  K T+F +D+++F+    GG+S   + +++S S    
Sbjct  513   LSKEHVEAVDVFELVLSNGVKVFVKPTDFKNDEIVFSARGEGGVSVFGDEDHYSASYAGV  572

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             +   +G+  + PS L  +LAGK   V   +G Y ++ SG  SP DLE ALQL+Y  FT+ 
Sbjct  573   LVNVMGIGDFTPSDLRKILAGKSVSVTPNVGTYSQTISGSTSPRDLEMALQLIYLYFTS-  631

Query  1951  VEPGEED--VNIVMQMAEEAIHAQERDPYTAFANRVREL----NYGNSYFFRPIRIRDLQ  2112
               P E+    ++ +   +  + + + +P   F+ ++  +    N   S  + P    +L 
Sbjct  632   --PREDSQLFDVFINNQKTQLASAQSNPDYQFSKQLNRIIADGNLRASSIYDP---EELD  686

Query  2113  KVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDL  2292
             +V+  +A E + + F + + F     GNI+  T  PL+ QY+  +P   +     N D  
Sbjct  687   QVDMPRAMEIYADRFSNAANFEFFFTGNINMDTFIPLLEQYIASLPADPD-----NLDSF  741

Query  2293  KGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQ  2472
             + L  + P      +      + +  V + F  EL+ +   E    + +L ++L  K+++
Sbjct  742   RDLGIRAPRGRTENIKVG--TDEKSQVIMLFTGELEYD--REKATDITYLGEILNIKLIE  797

Query  2473  VLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQE  2652
              LR + G +Y  G S  +G      VGN      I F C PD+  TL++ A +E+ ++QE
Sbjct  798   TLREEIGGVYGVGASGSMGIQP---VGNF--SFSIVFPCSPDMVDTLIEAAWEEVRKIQE  852

Query  2653  DGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
             +GPS+ED++ V E  + A +  L+ N +W
Sbjct  853   NGPSEEDLNKVKEKRRIALDENLRRNNFW  881



>ref|WP_005671270.1| hypothetical protein [Massilia timonae]
 gb|EKU79685.1| hypothetical protein HMPREF9710_05058 [Massilia timonae CCUG 
45783]
Length=975

 Score =   432 bits (1112),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 298/943 (32%), Positives = 474/943 (50%), Gaps = 46/943 (5%)
 Frame = +1

Query  142   SQTPYG--VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLA  315
             S  P G  V  G+LDNGLTYY++ N++P+ +  L L V+AGS+LE+E++RG+AH VEH+A
Sbjct  48    SPIPVGPQVKVGKLDNGLTYYIQRNARPERKLELRLVVKAGSILEDEDQRGLAHFVEHMA  107

Query  316   FSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEF  495
             F+ T  +  H++V +L+SIG  FGA  NA TS DETVY L +P DKPE +S+A  +L ++
Sbjct  108   FNGTTNFRKHELVSYLQSIGVGFGADLNAYTSFDETVYILPIPTDKPEHVSKAFQVLEDW  167

Query  496   SSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRT  675
             +  VR     +EKERG V+EE R  + A+ RM    +  +  GSKYAERLPIG E V+R 
Sbjct  168   AHGVRFDADAIEKERGIVLEELRLGKGASDRMGKQIYPRLFNGSKYAERLPIGREDVLRN  227

Query  676   VSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPS  855
               P  + +FY+ WY    MAV+ VGD  D     +L+K HF +  +P +P P  Y  +P+
Sbjct  228   FKPDALTRFYRDWYRPDLMAVVVVGDV-DPARAEKLVKQHFAHLKNPANPRPRDYAAIPA  286

Query  856   HEEPRFSCFVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRK  1032
               +       + EA G+AV+I   + PV EL T+  YRD L +S+F   LNQR  ++++ 
Sbjct  287   RADTEALVVTDPEANGNAVLIRYPVQPVRELGTIGAYRDELVQSLFGTMLNQRLAELAQL  346

Query  1033  KDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVV  1212
              D PY   S++   L     +Y  +++   +G + A+ +++ E  R R HGF E+E+   
Sbjct  347   PDAPYLGASSSLGKLTPRYHSYNSSAAIGPRGALPAITALVQENERARQHGFGEQELERA  406

Query  1213  RALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVS  1392
             +  LM   E A+ ER +  S +   EY+++FL++E + GI+ E +  + L+P IS +E++
Sbjct  407   KKNLMRTYEQAWNERAKSDSATYAAEYIRNFLQDEAIPGIDTEWRYVQQLVPGISLAEMN  466

Query  1393  KYSERF--GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQS-IPPWDEENIPEEIV  1563
              Y+ R     S   V+ T   +     D      L     E  ++ +   DE+ +   ++
Sbjct  467   DYARRTIPADSGKLVLYTGVSKGDNQPDAPTGAQLLAAVSEAARTPVERHDEKLLATRLM  526

Query  1564  SVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESE  1743
                  PG I  +   + +G     LSNG++V  K T+F +DQV+ +    GG S  P+ +
Sbjct  527   ERPAQPGKITAEEHDKALGLTRLTLSNGVKVILKPTDFRNDQVMLSAARPGGQSLFPDGD  586

Query  1744  YFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQ  1923
               +    + I   +GV  + P  +  +LAGK A V   LG+Y    +G    +D+ET LQ
Sbjct  587   ILNARFSNAIVASMGVKDFTPLDMRKILAGKAAGVTVGLGSYTDVIAGASGATDIETMLQ  646

Query  1924  LVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS-YFFRPIRI  2100
             L++  F   V   E   +  +    E    Q   P   F + +    Y N     R +  
Sbjct  647   LLWLKF-AGVRRDEGLFHAYIDKQAEIARNQSGLPGRYFNDALVAALYNNHPRAPRTLDA  705

Query  2101  RDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFN  2280
              +  K++  ++ + F   F      T ++VG+ D     PL+  YLG +P P  P+ +  
Sbjct  706   EEYAKIDLDRSIDIFRQRFSSAKDLTFILVGSFDERQIRPLLATYLGTLPTPDIPVAY--  763

Query  2281  RDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFP--VELKSEDMMEDVHFVGFLSKLL  2454
             RD    +  +  + I++  V S   E + S+ L F    E    + +        LS L+
Sbjct  764   RD----VGLRPATGIVKREVRS-GSEPKSSIALNFTGQAEFSEAEQLR-------LSALI  811

Query  2455  ET---KIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLA  2625
             E    +I++VLR K   IY  G S  L     S++      +GI+    P+    ++   
Sbjct  812   EVTNLRIIEVLREKMAMIYGGGASGTL-----SKIPYGNYSVGISLPTGPENVDKVIAAT  866

Query  2626  LDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSG-DVGDSF  2802
               EI RLQ+DGP   ++  V     + H   L+EN YW+  +    QS +  G D     
Sbjct  867   FAEIARLQQDGPDAAELDKVKTGWIQNHRRSLRENGYWVANL----QSALTEGTDPASIL  922

Query  2803  KVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
              V+ + ++     LT    +MA +R       + Y  V+L P+
Sbjct  923   SVEKQVQA-----LTANDIKMAARRYF---DTRNYVQVVLNPE  957



>ref|WP_008104727.1| peptidase, M16 (pitrilysin) family [Verrucomicrobiae bacterium 
DG1235]
 gb|EDY85046.1| peptidase, M16 (pitrilysin) family [Verrucomicrobiae bacterium 
DG1235]
Length=947

 Score =   431 bits (1108),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 283/873 (32%), Positives = 448/873 (51%), Gaps = 23/873 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G LDNGL YY+R N++P+ R +L L V AGS+ EE+ +RG+AH +EH+AF+ T+ + 
Sbjct  45    VRVGELDNGLRYYIRENARPENRVSLRLVVNAGSLQEEDNQRGIAHFLEHMAFNGTKNFQ  104

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
               ++V FLESIG  FG   NA TS D+T+Y+L VP + PE++ +A  IL +++S +    
Sbjct  105   KLELVNFLESIGMRFGQHLNASTSFDQTIYQLEVPWEDPEVVDKAFLILEDWASNISLDP  164

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++E ERG V+EE+R  + A  R++D  + L+   S+YA+RLPIG   V++    +    
Sbjct  165   FEIEAERGVVVEEWRSGQGAAQRIRDQQYPLVYYNSRYAKRLPIGSMFVVQNAPAERFVD  224

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYKKWY    MAVIAVGDF D   V   I + F    +P   P      VP H++  FS 
Sbjct  225   FYKKWYRPNLMAVIAVGDF-DADEVERQIISRFSRLENPEGAPERVNSEVPDHDQTLFSI  283

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E  G +  I  K+  D  +T  DYR  L E ++F  LNQR  + +   +PPY + S
Sbjct  284   VSDPEVTGMSTSIYLKVDPDGDETGADYRRHLIERIYFTLLNQRLSERTLDAEPPYINAS  343

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
              ++  L R  +AY M+    +    E +E ++ EVAR    GFS+ E+  V+A ++  ++
Sbjct  344   VSSTGLGREKRAYAMSVGLIQGKVQEGIEYLVAEVARASEDGFSQSELDRVKADMIRGMD  403

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              A+ ER+  QS     EY + F  +EP+ GIE E  +    L  +   EV++  + F   
Sbjct  404   RAFEERENTQSGVFASEYTRAFTIDEPIPGIELERDMTHAFLADLDIEEVNRVGDVFKNE  463

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
              + VI    P A       +  +L      +   +  + ++     +++V P  G I+++
Sbjct  464   KNRVILFTAPEADGYELPSQDELLAALESGKAMGLGAYIDDVSDAPLLAVVPEAGEIVEE  523

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
               +++V   E+ LSNG RV  K T+F +DQ+L + +S GG S + + E+      + + G
Sbjct  524   SYHESVDVHEWTLSNGARVVVKSTDFKNDQILMSAYSEGGSSLVADDEFIPALTTTMLLG  583

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
             E G+  +    L   LAGK   V   +G    +  G  SP D+E   +L++   T   +P
Sbjct  584   EAGIGPFNTIQLEKKLAGKTIRVSPAIGGNAETIGGSASPQDIEDFFKLLHLQIT---QP  640

Query  1960  GEEDV----NIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPY  2127
              E+D+    + V     E +  + + P   F + + E  YG+    +P+ +  L+++   
Sbjct  641   NEKDLEKAFHSVKNRLSEVVANRGKSPNAVFQDAIEEAYYGDHPRHQPLDLGRLEEMEAR  700

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP-RPSEPILHFNRDDLKGLP  2304
              + E F + F++   F  V VG I+  +    +  YL  +P R  E      R+  + L 
Sbjct  701   LSLEIFKDRFQNAGDFVFVFVGAIELDSFRDYVKTYLATLPSRGGE------REKARDLG  754

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              K P S    V     +E + SV++ F  +  +E   E+ + + F   LL  ++ +VLR 
Sbjct  755   DK-PKSGRLSVDLKKGLEEKTSVRVFFNGD--AEWSPENRYALAFARALLNIRMREVLRE  811

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             + G +Y  GVSVF       R+ +     G  FSCDP  +  LV L L EIL LQE G  
Sbjct  812   ENGGVY--GVSVF---GSLGRLPSPTYSTGFGFSCDPGNAEMLVRLGLVEILSLQEQGVR  866

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
              E+   V E+  R HE GL+EN +WL  ++  Y
Sbjct  867   PENAQKVRELHIREHERGLKENGFWLSNLVGVY  899



>ref|WP_022837550.1| MULTISPECIES: peptidase M16 [Marinimicrobia]
Length=945

 Score =   431 bits (1108),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 279/871 (32%), Positives = 460/871 (53%), Gaps = 29/871 (3%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+LDNGLTYY++ NSKP+ R  L L V AGSVLE+++++G+AH +EH+AF+ T  +   +
Sbjct  51    GKLDNGLTYYIKYNSKPEKRLELRLVVNAGSVLEDDDQQGLAHFLEHMAFNGTRHFAKQE  110

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             ++ +++SIG  FGA  NA TS DETVY L +  D   LL +   IL++++ ++     ++
Sbjct  111   LINYIQSIGMRFGADLNAYTSFDETVYMLQISTDNDSLLEKGFMILSDWAHQIALESEEI  170

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG + EE+R SR A  R++D    L+  GS+YA+RLPIG   VI T   + ++QFY+
Sbjct  171   DKERGVIREEWRLSRGAAARLEDRQLPLIYFGSQYAQRLPIGQMAVIDTFRHERLRQFYQ  230

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY    MAV+ VGD  + + V +L+  + G     P  P    Y +P H+E  FS   +
Sbjct  231   DWYRPDLMAVVVVGD-AEPRRVQQLVSRYLGALPVKPALPVRITYAIPDHQETLFSIETD  289

Query  889   SEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAA  1068
              E   +++ +  K      KTV DYR+ L E+++   LN R  +++R+ DPPY    +  
Sbjct  290   PELTTTSIDVLYKFDAKTAKTVGDYREHLVETLYNTMLNNRLGELAREADPPYLRAYSKR  349

Query  1069  DCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAY  1248
               L R  + Y++ +   E     ALE++LTEV RVRL+GF+  E+   +  L+  +E AY
Sbjct  350   GRLSRLKEYYLIGAVTHENQAERALETLLTEVQRVRLYGFTSTELQRAKDNLLQAMEIAY  409

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSC  1428
              ER + +S +  +EY+++FL  EP+ GI+ E  L + LLP IS SEV+  S+R+    + 
Sbjct  410   RERGKTESANYANEYIRNFLLEEPIPGIQQEYALCQQLLPTISLSEVNYVSQRWMLDHNR  469

Query  1429  VIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEY  1608
             V+    P+   T     + +L +      + I  + ++   + +V      G I+ +  Y
Sbjct  470   VVLYAAPQKKTTRVPTPAGLLAVMQRVLDKEILAYVDKVPNQPLVKKISRKGQIIIRRRY  529

Query  1609  QNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIG  1788
               +G  E+ L+NG++V  K T F +D++L   FS GG S + +S +      + +    G
Sbjct  530   PELGVSEYVLNNGVKVVLKPTEFKNDEILMAAFSPGGHSLVTDSLFIPAVTATPLIAASG  589

Query  1789  VFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEE  1968
             V  +    L   LAGK  +V   +     S SG  +P DLET LQL+Y  FTT   P ++
Sbjct  590   VGEFGVVELEKKLAGKAVKVRCAINDITESLSGAATPRDLETMLQLIYLYFTT---PRKD  646

Query  1969  DVNIV--MQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEY  2142
              +  V  ++    A+  +  DP+  F++ +R     N +  RP+ ++ +  +N  K+ + 
Sbjct  647   SIAFVSYVKKLRSALENRAADPFAVFSDSLRATVTQNHFRARPLNLKMIPALNLEKSFQV  706

Query  2143  FNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD----DLKGLPFK  2310
             F   F D S FT   VGN+D   A  LI +YLG +P       +  R     D+   P  
Sbjct  707   FKERFADASDFTFFFVGNLDTLRAPQLIARYLGALP-------NLKRQERWVDVGIYP--  757

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
              P  +I + +    +E Q  V+L F  +   E   ++ + +  L++LL  ++ + +R + 
Sbjct  758   -PQGVINKAIQKG-IEPQSYVELRFTGDF--EWSRQNRYALAALAELLRLRLREQVREEK  813

Query  2491  GQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDE  2670
             G  Y   VS         +  +    + I++ C P+    L+ L + E+ +L  +  +++
Sbjct  814   GGTYGVRVS-----QSNQQYPHPEYSLNISWGCAPERVEELIRLVMTEVEKLHTELATED  868

Query  2671  DVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             ++  + E   R +E  L+EN YWLD IL  Y
Sbjct  869   EIRKIKETHLRTYETNLKENRYWLD-ILNFY  898



>ref|WP_009285031.1| peptidase M16 [Fibrisoma limi]
 emb|CCH56466.1| peptidase M16 domain protein [Fibrisoma limi BUZ 3]
Length=974

 Score =   431 bits (1109),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 289/933 (31%), Positives = 478/933 (51%), Gaps = 44/933 (5%)
 Frame = +1

Query  58    PAESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAAL  237
             PA  S   P K  F        ++ + +   P  V  G+L NGLTYY+R N++PK RA L
Sbjct  37    PASQSVSAPAKAGF--------DLSKPIPTDP-AVKVGKLPNGLTYYIRKNAEPKNRAEL  87

Query  238   ALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSAD  417
              L +RAGSVLE +E++G+AH +EH+ F+ T+ +  +++V  L+S G  FGA  NA T  D
Sbjct  88    RLVIRAGSVLETDEQQGLAHFMEHMEFNGTKNFPKNELVNVLQSAGIRFGADLNAYTGFD  147

Query  418   ETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQD  597
             ETVY+L VP D   +  QA  IL +++        +++KERG V+EE+R  R A  RM+D
Sbjct  148   ETVYQLPVPTDSANVFRQAFQILEDWAHNATLDPKEIDKERGVVLEEWRLGRGAGQRMRD  207

Query  598   AHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVV  777
              ++ L++  S+YA RLPIG E VI+   P++++QFYK WY    MAVIAVGDF +   V 
Sbjct  208   KYFPLILNNSRYANRLPIGKEDVIKNFKPEVLEQFYKDWYRPDLMAVIAVGDF-NVNEVE  266

Query  778   ELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVK  957
              +I+  F    + P+P P   Y +P+H++ +     + E   + V +  K P  + +T+ 
Sbjct  267   GIIREKFSRIPAVPNPKPRTEYDIPAHKDTKVVIVTDPEQPNTVVQVIYKRPEIKERTLN  326

Query  958   DYRDLLAESMFFHALNQRFFKISRKKDPPY-YSCSAAADCLVRPVKAYIMTSSCKEKGTV  1134
             D R+ +   +F   L  R  +++++ DPP+ +  S  +D L   + A+   +  KE    
Sbjct  327   DLRESIKRGLFNTMLGNRIQELTQQADPPFLFGYSNYSDFLGN-LDAFTSVAVAKEGNVE  385

Query  1135  EALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRN  1314
              A+ ++L E ARV+  GF+E E++  +    + +E AY ERD+ +S++  +EY+++F   
Sbjct  386   RAIRAVLDENARVKQFGFTETELARAKQEFFTGVEQAYKERDKTRSSNFVNEYVRNFTDK  445

Query  1315  EPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLK  1494
             EP   IE+     K     I  +EV+   ++F  + +  +  + P      D L SV   
Sbjct  446   EPYTSIEFYYDFLKKEQATIKLAEVNALVDQFIRNENRAVVVMAPDKDK--DKLPSVEQI  503

Query  1495  INTFEQK-QSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCT  1671
             I+  +   + +  + +E + + +++ +P P  ++ +   +++GA E+ L NG++V  K T
Sbjct  504   ISYIDNAGKGLTAYKDETLNKPLLAKEPVPSPVVSEKPLKDIGATEWTLKNGVKVVVKPT  563

Query  1672  NFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVG  1851
             NF +DQ+LF+G SYGG S     ++ S    ST+A   G   Y    L   LAGK     
Sbjct  564   NFKNDQILFSGTSYGGTSLYALKDFMSARFASTLATLGGTGEYNQIQLGKFLAGKSVSAF  623

Query  1852  TKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIV---MQMAEEAIHAQER  2022
               +G      SG  +P DLETA+QL+Y   T   +P  +D ++V   +   + A+  Q  
Sbjct  624   PYIGELNEGVSGSAAPRDLETAMQLLYSYLT---QP-RKDADVVKGFLSNQKSALQNQIN  679

Query  2023  DPYTA--FANRVRELNYGNSYFFR-PIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVG  2193
              P  A  F + V  +  GN    R P++  DL K++  +A   +   F +   FT   VG
Sbjct  680   TPTPARVFQDTV-SVTLGNYNPRRMPLKPEDLDKIDLDRALTIYKERFANAGDFTFFFVG  738

Query  2194  NIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSV  2373
             N D  T  PL+ +YLGG+P   +P      +  K L  + P+  I + V+   V+ + +V
Sbjct  739   NFDEKTLKPLVEKYLGGLPTNGKP------EKFKDLGIRIPAGQISKTVYR-GVDPKATV  791

Query  2374  QLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVG  2553
             QL +  +       ++   +  L+++LE K+++ LR +   +Y  G S        S+  
Sbjct  792   QLVYSGDFTW--TTDNTTQLDALAEVLEIKLIEKLREEESGVYGVGASAIY-----SKYP  844

Query  2554  NIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENC  2733
               R    I F C P+    L+    + I  L++ G +  D++      +R  E  L++N 
Sbjct  845   VPRYTFRIGFGCAPENVEKLIAKTQELINDLKQKGAAQGDINKFKAETRRETELQLKDNQ  904

Query  2734  YWLDRILRSYQSRIYSGDVGDSFKVQDEARSKV  2832
             +WL  +   Y    Y+ D  +    +DE   KV
Sbjct  905   FWLSYLANQY----YNDDDLNEVLQEDEHLKKV  933



>ref|WP_019988600.1| hypothetical protein [Rudanella lutea]
Length=955

 Score =   429 bits (1103),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 273/878 (31%), Positives = 457/878 (52%), Gaps = 31/878 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTY++R NS+PK RA L L +RAGSVLE  +++G+AH +EH+AF+ T  + 
Sbjct  51    VKVGKLPNGLTYFIRKNSEPKNRAELRLVIRAGSVLENPDQQGLAHFMEHMAFNGTRNFP  110

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+S G  FGA  NA TS DETVY+L VP D  +L  ++  IL +++       
Sbjct  111   KNELVNFLQSSGVRFGADLNAYTSFDETVYQLPVPTDSVQLFERSFQILEDWAHNALLDS  170

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++EKERG ++EE R  R A  RM+D ++ L++  S+YA RLPIG + +I +  P +++ 
Sbjct  171   VEIEKERGVILEEARLGRGAQQRMRDKYFPLILNNSRYASRLPIGKDNIISSFRPSLLRD  230

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGY--KTSppdpppipYYLVPSHEEPRF  873
             FY+ WY    MAVIAVGDF D + V  +I+  FG   K +        Y + P H++ + 
Sbjct  231   FYRDWYRPDLMAVIAVGDF-DEKQVEAMIREKFGRIPKPAANAKARPEYGIEP-HKDTKV  288

Query  874   SCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYS  1053
                 + E   + V +  K P  + +T+ D RD L  S+F   L  R  ++++K +PP+  
Sbjct  289   VVVTDPEQPNTIVQVIYKRPEIKERTIGDLRDGLQRSLFNAMLGNRIQELTQKANPPFVF  348

Query  1054  CSAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               +     +  + A+   +  K+ G+VE A+ ++L E  R R  GF+  E++  +  L +
Sbjct  349   GFSNYGGFLGNLDAFSSIAVPKDAGSVEVAIRAVLDENGRARRFGFTPTELARAKQELRT  408

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E AY ERD+ +S+SL  +Y+Q++L   P  GI++  Q     L  I  SEV+K +  F
Sbjct  409   GVEQAYRERDKTRSSSLVGQYVQYYLEGSPATGIDFYYQFVNKYLDGIQLSEVNKLAGTF  468

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQK-QSIPPWDEENIPEEIVSVKPSPGW  1587
               + +  +  + P      D L SV   I   +   + +  + ++ + + +++  P+   
Sbjct  469   IGNENRAVVIMAPEKDK--DKLPSVEQVIRVIDNAGKDLTAYVDQTVNKPLLATSPTAKP  526

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             ++ + +   +G  E+ L NG RV  K T+F +DQ+LF   SYGG S     +Y +    S
Sbjct  527   VVGEKQVAPIGVTEWTLGNGARVVLKPTDFKNDQILFASVSYGGTSLYDLKDYMNARFAS  586

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
             T+ G+ G   +    L   LAGK   V   +       SG  +P DLET+LQL+Y  FT 
Sbjct  587   TLIGQGGTGPFNQIQLGKYLAGKSLSVNPYISEINEGVSGSTTPKDLETSLQLLYSYFT-  645

Query  1948  NVEPGEEDVNIVMQ-MAEEAIHAQER----DPYTAFANRVRELNYGNSYFFRPIRIRDLQ  2112
               +P  +D ++V   ++ +    Q +     P   F + +      N+   +P+   DL 
Sbjct  646   --QP-RKDSDVVQGFLSNQRSLLQNQITTPTPQKVFQDTISVTLGQNNPRRQPLAPTDLD  702

Query  2113  KVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP-RPSEPILHFNRDD  2289
             +++  +A + +   F + + FT   VGNIDPA   PL+ +Y+GG+P   + P     R++
Sbjct  703   QISLDRAEQIYRERFANAADFTFFFVGNIDPARLKPLVEKYIGGLPGNATTP-----REN  757

Query  2290  LKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIV  2469
              + L  + P+  + + V+  + E + +VQL F  +L      E    +  L+++LE K+ 
Sbjct  758   FRDLGIRIPAGKLNKTVYKGL-EPRATVQLVFSGDLSWSP--ETTTQIDALAEVLEIKLT  814

Query  2470  QVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQ  2649
             + LR + G +Y  GVS        S++   R    + F C P+    L+   LD I  ++
Sbjct  815   EKLREEEGGVYTPGVS-----GSYSKLPAQRYTFRVGFGCAPENVEKLIGKTLDVINEVK  869

Query  2650  EDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             + G   +D+       +R  E  L++N +WL  +   Y
Sbjct  870   QKGADPKDIDKFKAESRRETEIQLKDNNFWLGYLTNQY  907



>ref|WP_036216474.1| peptidase M16 [Massilia sp. LC238]
 gb|KFC63267.1| Zinc protease PqqL [Massilia sp. LC238]
Length=971

 Score =   429 bits (1102),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 282/895 (32%), Positives = 459/895 (51%), Gaps = 30/895 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGL+YY++ N++P+ +  L L V+AGS+LE+E++RG+AH VEH+AF+ +  + 
Sbjct  55    VKVGKLANGLSYYIQRNARPERKLELRLVVKAGSILEDEDQRGMAHFVEHMAFNGSTNFH  114

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              H++V +L+SIG  +GA  NA TS DETVY L +P DKPE +++A  +L +++  +R   
Sbjct  115   KHELVSYLQSIGVGYGADLNAYTSFDETVYILPIPTDKPEHVAKAFQVLEDWAHGLRFDP  174

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +EKERG V+EE R  + A  RM       +  GSKYAERLPIG E+V+R+  P  + +
Sbjct  175   DAIEKERGIVLEELRLGKGALDRMSKQIMPAIFNGSKYAERLPIGTEEVLRSFKPDALTR  234

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+AVGD  D     +L+K HF +  +P    P  Y  +P+ +  +   
Sbjct  235   FYRDWYRPDLMAVVAVGDI-DPLQAEQLVKKHFAHLKNPVPARPRAYAEIPARQATQALV  293

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               ++EA G+AV+I   + PV E  T++ YRD L +S+F   LNQR  ++S+  +PP+   
Sbjct  294   ITDNEATGNAVLIRYPVQPVVEAGTIRAYRDDLVQSLFSAMLNQRLQELSQLPEPPFMGA  353

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             S++   L    ++Y  +++   +G   AL +++ E  R R +GF   E+  V+  LM   
Sbjct  354   SSSLGKLTPRYRSYNASAALGPRGAETALTALVEENERARRYGFGAAELERVKKSLMRNY  413

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E A+ ER +  S +   EY+++FL+ E + GI+ E +  K LLP I+  EV+ Y+ R   
Sbjct  414   EQAWNERAKSDSGTYAAEYIRNFLQQEAIPGIDAEYRYVKELLPGITLDEVNAYARRTIP  473

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
               S   V+ T   R         + +L      ++  + P DE+ +   ++   P PG I
Sbjct  474   ADSGKLVLYTGVTRPDTPKG---AQLLAAVAGAERAELLPHDEKAVAARLMERPPKPGSI  530

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
             + +   + +G     LSNG++V  K T+F +DQVL +   +GG S   + +  +    + 
Sbjct  531   VAESHDKALGLTRLTLSNGVKVILKPTDFRNDQVLMSAARFGGQSLFGDQDILNARFANA  590

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             I   +GV  + P  +  +LAGK A+V   L  Y     G    +D+ET LQL +  F   
Sbjct  591   IVASMGVKDFTPLDMRKILAGKAAQVNVGLANYTDVVVGASGATDIETMLQLTWLKF-QG  649

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYG-NSYFFRPIRIRDLQKVNPY  2127
             V   E+     +    E    Q   P   F + V    Y  +    R ++  + ++++  
Sbjct  650   VRRDEDLFRSYVGKQVEQARNQTAQPGARFGDAVMAALYNMHPRAPRTLKAEEYEQIDLD  709

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             ++ + F   F      T ++VG+ D A   PL+  YLG +P P   + +  RD    +  
Sbjct  710   RSIDIFRQRFSSARDLTFILVGSFDVAALKPLLATYLGSLPTPELTVAY--RD----VGL  763

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCFPVELK-SEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
             +  + +++  V S   E + +V L F  + + SED  E +     L ++L  +I+ VLR 
Sbjct  764   RPATGVVKREVRSGS-EPKSTVSLTFTGKAEFSED--EQLRLAALL-EVLNLRIIDVLRE  819

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             K   IY  G S  L     S++      IG+     P+    ++     EI RLQ +GP 
Sbjct  820   KMALIYGGGASGVL-----SKIPYGNYSIGVTLPTGPENVDKVIATTFAEIARLQAEGPE  874

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSG-DVGDSFKVQDEARS  2826
               D+  V     + H   L+EN YWL  +    QS +  G D G   +V+ + ++
Sbjct  875   MGDLDKVKRNWIQNHRGSLRENGYWLSHL----QSALSEGTDPGAILEVEKQVQA  925



>ref|WP_026773810.1| hypothetical protein [Sediminibacterium sp. OR43]
Length=935

 Score =   427 bits (1099),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 277/873 (32%), Positives = 451/873 (52%), Gaps = 40/873 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+R N +PK RA L L V AGS LE +++ G+AH VEH+ F+ T+ + 
Sbjct  35    VKIGKLSNGLTYYIRKNQEPKNRAELRLVVNAGSTLESDKQVGLAHFVEHMCFNGTKHFK  94

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
               ++V FLE  G  FGA  NA TS DETVYEL VP D P +  QA+ IL +++  V    
Sbjct  95    KQELVNFLEKSGVNFGADLNAYTSFDETVYELQVPTDSPVVYRQALQILEDWAHLVSFEH  154

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG ++EE+R  R A+ R++D ++ +M++GS+YA+RLPIG ++ I T     +  
Sbjct  155   TEIDKERGVIVEEWRLGRGADARLRDKYFPVMLKGSQYAKRLPIGTKENIDTAHYNTLTS  214

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     AVI VGD  D     ++IK HF       +P P   + +PSH E R S 
Sbjct  215   FYKDWYRPDLQAVIVVGDV-DVAETEQMIKEHFAKIPKAVNPKPRKKFSIPSHTETRVSI  273

Query  880   FVESEAAGSAVMISCKMP-VDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + E   + V I    P +   KT  +YR  +   +F   ++ R  +I++K D P+   
Sbjct  274   LTDPEQPYNVVQIYYTQPEIPAAKTESEYRASIVRGLFNQMMSSRLDEIAQKPDAPFLFG  333

Query  1057  SAAADCLVRPVKAYIMTSSCKE-KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
             S++    +    A+ + +  K  K    ++E+++TE  RVR +GF + E+       MS 
Sbjct  334   SSSYGSFIGDKDAFSLLAVAKTGKDIAASMETLVTENERVRQYGFVQSELDRAVKSSMSY  393

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF-  1410
             IE+ Y ER++ +S  L  E ++++L+ E + GIEYE  L +  LP I+  EV+    R+ 
Sbjct  394   IENLYKERNKTKSAELLQELVRNYLKQESIPGIEYEYGLYQKFLPTITLQEVNSLISRWI  453

Query  1411  -GTSSSCVIKTIEPR------ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSV  1569
               T  S ++   E        +TA +D L   +  +  +E K +  P         ++ V
Sbjct  454   KKTDRSIIVTAPEKEKNNLISSTAALDILNKPLGSLKKYEDKMATGP---------LLPV  504

Query  1570  KPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYF  1749
              P PG I  + +Y+++G  E+ LSNG  V  K T F +D + F+  S+GG S   +++Y 
Sbjct  505   APIPGKITAEKQYESIGTTEWTLSNGAHVVLKPTTFKNDDIQFSAISWGGTSLYSDADYM  564

Query  1750  SCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLV  1929
             + +  S IA   G+       L   +AGK   V   +  YM+  +G  +  DLETA+QL+
Sbjct  565   NATNASLIALTGGMGNLDIQSLQKEMAGKNCSVAPSMSNYMQGMNGSSTTKDLETAMQLL  624

Query  1930  YQLFTTNVEPGEED--VNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFR-PIRI  2100
             Y  F   V P ++     +V Q  +  +  ++++P + F + V  +  GN +  R P+ +
Sbjct  625   YGYF---VAPRKDSSMFKVVQQQMQVQLANKDKNPASVFGDTVGYV-MGNYHPRRKPVTL  680

Query  2101  RDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFN  2280
               ++++   +A   +   F +   F    VGN    +  PL+ +Y+  +P   +      
Sbjct  681   EAVKQLELDRAFNIYKERFSNGGQFLFTFVGNFTLDSIRPLVEKYIASLPSTGK------  734

Query  2281  RDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLET  2460
             +D  K +  ++P  +I +VV     E++ SV+L F     + + ++++  +G L K L  
Sbjct  735   QDTWKDVGLRYPQGVINKVVKKGK-ESKASVRLYFTGNSAAFNDLDELQ-IGQLCKALGI  792

Query  2461  KIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEIL  2640
             ++ +VLR   G +Y   VS   GG     V N    IGI F C P+    L+ L +DEI 
Sbjct  793   RLREVLREDAGGVYGVSVS---GGLSREPVNNY--SIGIQFGCAPENVDKLIGLTMDEIN  847

Query  2641  RLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
               + +G +  ++  V+  + R  E   +EN YW
Sbjct  848   HTKSNGVAPVNIEKVIAEQTRGLETEFKENSYW  880



>ref|WP_036984505.1| hypothetical protein [Prolixibacter bellariivorans]
Length=948

 Score =   427 bits (1099),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 295/967 (31%), Positives = 490/967 (51%), Gaps = 46/967 (5%)
 Frame = +1

Query  73    QMLPKKHRFRSLKLVNVN-----MEEALSQTPYG--VDYGRLDNGLTYYVRSNSKPKMRA  231
             ++L KK  F  L +  V      M +  S+ P+    D G L NGLTYYVR+N  PK RA
Sbjct  8     ELLMKKLLFGLLTIFMVTGAYAQMPDLNSKIPFDPQTDKGVLKNGLTYYVRANHTPKNRA  67

Query  232   ALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTS  411
              L L V AGS+LE+ +++G+AH  EH++F+ T+ +  +++V + ESIG EFG   NA T 
Sbjct  68    ELMLVVSAGSILEDNDQQGLAHFCEHMSFNGTKNFPKNELVNYFESIGMEFGPEINAYTG  127

Query  412   ADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRM  591
              D+TVY L VP+D  + + + + +L +++ +V  S  ++ KERG + EE+RG + A  RM
Sbjct  128   FDQTVYMLKVPLDSTKFMDKGLQVLYDWACQVTDSNDEINKERGVIHEEWRGGQGAQQRM  187

Query  592   QDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQS  771
                   +  + S YA+RLPIG   V+ +  P  +++F   WY     A+I VGDF D + 
Sbjct  188   MKQWLPVFFKDSHYADRLPIGKMSVVDSCPPSALRRFRNDWYRPDLQAIIVVGDF-DQKK  246

Query  772   VVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKT  951
             +V+ +K  F            P Y VPS +        + EA  S+  +  K P++   T
Sbjct  247   MVQEVKEKFSNIPVHKPERKKPSYDVPSQKGTLIKVVTDPEARYSSATLYIKHPMELDTT  306

Query  952   VKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGT  1131
             V  YR+++  S++   +N R  +I++K++PP+    ++   LV PV  Y           
Sbjct  307   VGGYREMMMHSLYNSMINARLSEITQKENPPFVFARSSYGGLVGPVDVYSSMVVTHPGKI  366

Query  1132  VEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFL-  1308
              E L++ L E  RV+ +GF++ E+   +A +MS +E+AY +RD+ QS S+ +EY ++FL 
Sbjct  367   PEGLKAALIENQRVKDYGFTDSELKRAKASMMSSMETAYNDRDKRQSISIANEYSRNFLM  426

Query  1309  RNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATA----TVDDL  1476
             R EPV G++ E Q  K L+P I  ++V+  ++++ T  + V+    P        T DD+
Sbjct  427   RKEPVPGLDKEYQYYKELMPTIKLADVNALAKKWLTEDNRVVIITAPDVKGVPVPTNDDI  486

Query  1477  RSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRV  1656
             + ++ +++T      I P+ ++     ++  +P+PG I+ + +   V A E+ LSNG +V
Sbjct  487   KKLLAEVDT----AKIKPYKDQVSDAPLMPKQPTPGKIVSEKKIPEVNAVEWTLSNGAKV  542

Query  1657  CYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGK  1836
               K T+F DD++LF+ +  GG S  P S+  S    +TI    G+  +    L   LAGK
Sbjct  543   ILKKTDFKDDEILFSAYGPGGYSVYPSSDDVSTDFAATILQMSGLSDFTAPELDKKLAGK  602

Query  1837  RAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQ  2016
              A V   +    + F G  S  D+ET +QLV  L+ T+    +   N  M   E  +  +
Sbjct  603   VASVEPFIRQITQGFQGSSSKKDVETLMQLV-NLYFTHPRLDQSAFNSFMTRMESQLDNR  661

Query  2017  ERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGN  2196
             +  P  AF++  R +    S + RP+    L++ N  +      + F +   F  + VGN
Sbjct  662   KASPEAAFSDTFRVVTSNYSPWVRPLTKETLKEANFDRIKAIDKDRFSNAGDFKFIFVGN  721

Query  2197  IDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQ  2376
             +D     PL+  YL  +P   +   H+   DL   P K   +++++V      ++   +Q
Sbjct  722   VDFDKMKPLVKTYLASLPTTGK-TEHWK--DLGIRPPK--GAVVKKVYKGTEPKSIQYIQ  776

Query  2377  LCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPS--RV  2550
                P+   ++D++E    +  LSK+L T++++ +R           SV+  G +PS  ++
Sbjct  777   FHGPLNYDTKDIVE----LDALSKILTTRLLESIR-------EDKSSVYYIGAQPSFNKL  825

Query  2551  GNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQEN  2730
                   + I +  DP    TL     DEI  L ++GP+ E+V   +E   R  E  L+EN
Sbjct  826   PEPEYTMTIYYGTDPKKIDTLKAAVFDEIKDLIKNGPTQEEVHKAMEKMLRERETNLREN  885

Query  2731  CYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYT  2910
              YWL   L+SY    Y    GD F   ++  ++V   L P   Q A + +        Y 
Sbjct  886   SYWL-TALKSY----YLNHDGD-FSTFNQFNTEVNA-LNPEELQKAAKWVWDL---NNYV  935

Query  2911  VVILMPQ  2931
              V L+P+
Sbjct  936   SVALLPE  942



>ref|WP_027866174.1| peptidase M16 [Massilia alkalitolerans]
Length=972

 Score =   428 bits (1100),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 285/929 (31%), Positives = 471/929 (51%), Gaps = 36/929 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGL+YY++ N++P+ +  L L V+AGS+LE+E +RG+AH VEH+AF+ +  + 
Sbjct  56    VKVGKLANGLSYYIQRNARPERKLELRLVVKAGSILEDEAQRGMAHFVEHMAFNGSTNFH  115

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              H++V +L+SIG  +GA  NA TS DETVY L +P DKPE +++A  +L +++  +R   
Sbjct  116   KHELVSYLQSIGVGYGADLNAYTSFDETVYILPIPTDKPEHVAKAFQVLEDWAHGLRFDP  175

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +EKERG V+EE R  + A+ RM       +  GSKYAERLPIG E+V+R+  P ++ +
Sbjct  176   DAIEKERGIVLEELRLGKGASDRMSKQIMPAIFNGSKYAERLPIGTEEVLRSFKPDVLTR  235

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+AVGD  D     +L+K HF +  +P    P  Y  +P+ +  +   
Sbjct  236   FYRDWYRPDLMAVVAVGDI-DPLQAEQLVKKHFAHLKNPVPARPRAYAEIPARQATQALV  294

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA G+AV+I   + PV E  T++ YRD L +S+F   LNQR  ++S+  +PP+   
Sbjct  295   VTDDEATGNAVLIRYPVQPVVEAGTIRAYRDDLVQSLFSAMLNQRLQELSQLPEPPFMGA  354

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             S++   L    ++Y  +++   +G   AL +++ E  R R +GF   E+  V+  LM   
Sbjct  355   SSSLGKLTPRYRSYNASAALGPRGAETALTALVEENERARRYGFGAAELERVKKSLMRNY  414

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E A+ ER +  S +   EY+++FL+ E + GI+ E +  + LLP I+  EV+ Y+ R   
Sbjct  415   EQAWNERAKSDSGTYAAEYIRNFLQQEAIPGIDAEYRYVRELLPGITLDEVNAYARRTIP  474

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
               S   V+ T   R         + +L      ++  + P DE+ +   ++   P PG I
Sbjct  475   ADSGKLVLYTGVTRPDTPKG---AQLLAAVAGAERAELLPHDEKAVAARLMERPPKPGSI  531

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
             + +   + +G     LSNG++V  K T+F +DQVL +   +GG S   + +  +    + 
Sbjct  532   VAESHDKALGLTRLTLSNGVKVILKPTDFRNDQVLMSAARFGGQSLFGDQDILNARFANA  591

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             I   +GV  + P  +  +LAGK A+V   L  Y     G    SD+ET LQL +  F   
Sbjct  592   IVASMGVKDFTPLDMRKILAGKAAQVNVGLANYTDVVVGASGASDIETMLQLTWLKF-QG  650

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYG-NSYFFRPIRIRDLQKVNPY  2127
             V   E+     +    E    Q   P   F + V    Y  +    R ++  + ++++  
Sbjct  651   VRRDEDLFRSYVGKQVEQARNQTAQPGARFGDAVMAALYNMHPRAPRTLKAEEYEQIDLD  710

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             ++ + F   F      + ++VG+ D A   PL+  YLG +P P   + +  RD    +  
Sbjct  711   RSIDIFRQRFSSARDLSFILVGSFDVAALKPLLATYLGSLPTPELTVAY--RD----VGL  764

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
             +  + +++  V S   E + +V L F  + +  +  E +     L ++L  +I+ VLR K
Sbjct  765   RPATGVVKREVRSGS-EPKSTVSLTFTGKAEFSE-AEQLRLAALL-EVLNLRIIDVLREK  821

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
                IY  G S  L     S++      IG+     P+    ++     EI RLQ +GP  
Sbjct  822   MALIYGGGASGVL-----SKIPYGNYSIGVTLPTGPENVDKVIAATFAEIARLQAEGPDT  876

Query  2668  EDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSG-DVGDSFKVQDEARSKVRKLL  2844
              D+  V     + H   L+EN YWL  +    QS +  G D G   +V+ + ++     +
Sbjct  877   ADLDKVKRNWIQNHRGSLRENGYWLSHL----QSALSEGTDPGAILEVEKQVQA-----I  927

Query  2845  TPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             T    + A +R      ++ Y  V+L P+
Sbjct  928   TGEEIRAAARRYF---NQQNYVQVVLNPE  953



>ref|WP_018479433.1| peptidase M16 [Pontibacter roseus]
Length=948

 Score =   427 bits (1098),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 270/873 (31%), Positives = 460/873 (53%), Gaps = 21/873 (2%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+L NGLTYY++ NS P+ RA L LAV AGS+LE++ ++G+AH  EH+AF+ T+ +
Sbjct  45    NVRTGKLANGLTYYIQKNSTPEKRAELRLAVNAGSILEDDSQQGLAHFTEHMAFNGTKNF  104

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               ++++ +L+S+G +FGA  NA T  DETVY L VP DK E++ +++ IL +++  V   
Sbjct  105   KKNELINYLQSVGVKFGAHLNAYTGFDETVYILPVPTDKEEIVDKSLLILEDWAFNVAFE  164

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG ++EE R  + A  RM   ++ ++ + SKYA+RLPIG ++V++    + ++
Sbjct  165   GEEIDKERGVIVEEKRSRQEAGMRMAYQYFPVLFKDSKYAQRLPIGTDEVLKNFKHEEIR  224

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
             +FYK WY   +M  + V    D  ++ + IKA+FG   +  +P     + VP+H+E   S
Sbjct  225   RFYKDWYR-PDMMAVVVVGDIDVDAMEKKIKANFGKYKAAANPKERKTFDVPNHKETLVS  283

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + EA    V +  K    +LKT+ D R  LA  M+   LNQR  ++ ++ D P+   
Sbjct  284   IVRDKEATMPGVQLHYKKDALQLKTLGDMRSKLARDMYNGMLNQRLSELQQQADAPFLFA  343

Query  1057  SAAADCL--VRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
             + A   L  +    AY    +  E G V  L+++  E  RV+ HGF++ E+S  +  +++
Sbjct  344   TTAYTSLQGLSSKDAYSSYVTTNEGGVVRGLKTVAEENERVKRHGFTQSELSRYKTQVLA  403

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               E AY ER +  S    ++Y+ +FL   P  GIE++ +  K  L  I+ +EV++ + ++
Sbjct  404   AYEKAYNERSKTNSGVYVNQYVANFLDESPATGIEFQFEFLKKHLDGITLAEVNQLAGQW  463

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
              T  + V+    P   +      + +L I        + P++++     ++   P  G I
Sbjct  464   ITDDNRVVVITAPDKESLKLPTEAEILSILKEASLADLQPYEDKVTASTLMDAAPKAGTI  523

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
              ++ + + +G  E  LSNG+RV  K T+F DD++L T +S+GG S   +S++ + S  S 
Sbjct  524   TKENKIEKLGVTELTLSNGVRVVLKPTDFKDDEILMTAYSHGGHSLYSDSDFHTASFTSE  583

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             I    GV       L  +LAGK A V   + +     SG+ +P DLET LQLV+  FT  
Sbjct  584   IMSRSGVKDMSAVDLRKVLAGKNANVNASISSLREGVSGNTTPKDLETMLQLVHLKFTA-  642

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI-RIRDLQKVNPY  2127
                 E+D    +   +  +      P   FA++V  +   N      I  + DL +V+  
Sbjct  643   PRKSEQDFQAFLNQYKGILPNLLASPQNYFADQVARIQSQNHLRGGSIPTVEDLNQVSLD  702

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             +A   + + F D S FT V VGN D     P++  YLG +P  +       ++  K +  
Sbjct  703   RAYAIYKDRFADASDFTFVFVGNFDVEQMKPMLQTYLGSLPATNR------KETFKDVGV  756

Query  2308  KFPSSII-REVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
             + P  ++ +E+V     + + +V + F  E K     E+ + +  LS++++ ++ + LR 
Sbjct  757   RAPKGVVTKELVKGS--DQKSNVVISFRDEAKYSK--ENSYHLAALSEVMKIRLTEKLRE  812

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             + G +Y  G SV  G N   R  N      I+F+C P+    LV+   +EI +LQ+ G  
Sbjct  813   EIGGVY--GTSVSAGAN---RFPNQSYAFNISFTCAPENVDKLVNATFEEIKKLQKSGAL  867

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             + D++ V E ++RA E  ++EN  WL  +  +Y
Sbjct  868   EADLNKVKEADRRAIETNMRENRAWLSSLENAY  900



>ref|WP_026770341.1| hypothetical protein [Sediminibacterium sp. OR53]
Length=935

 Score =   426 bits (1096),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 277/873 (32%), Positives = 450/873 (52%), Gaps = 40/873 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+R N +PK RA L L V AGS LE +++ G+AH VEH+ F+ T+ + 
Sbjct  35    VKIGKLSNGLTYYIRKNQEPKNRAELRLVVNAGSTLESDKQVGLAHFVEHMCFNGTKHFK  94

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
               ++V FLE  G  FGA  NA TS DETVYEL VP D P +  QA+ IL +++  V    
Sbjct  95    KQELVDFLEKSGVNFGADLNAYTSFDETVYELQVPTDSPVVYRQALQILEDWAHLVSFEH  154

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG ++EE+R  R A+ R++D ++ +M++GS+YA+RLPIG ++ I T     +  
Sbjct  155   TEIDKERGVIVEEWRLGRGADARLRDKYFPVMLKGSQYAKRLPIGTKENIDTAHYNTLTS  214

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     AVI VGD  D      +IK HF       +P P   + +PSH E R S 
Sbjct  215   FYKDWYRPDLQAVIVVGDV-DVAETERMIKEHFAKIPRAVNPKPRKKFSIPSHTETRVSI  273

Query  880   FVESEAAGSAVMISCKMP-VDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + E   + V I    P +   KT  +YR  +   +F   ++ R  +I++K D P+   
Sbjct  274   LTDPEQPYNVVQIYYTQPEIPAAKTESEYRASIVRGLFNQMMSSRLDEIAQKPDAPFLFG  333

Query  1057  SAAADCLVRPVKAYIMTSSCKE-KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
             S++    +    A+ + +  K  K    ++E+++TE  RVR +GF + E+       MS 
Sbjct  334   SSSYGSFIGDKDAFSLLAVAKTGKDIAASMETLVTENERVRQYGFVQSELDRAVKSSMSY  393

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF-  1410
             IE+ Y ER++ +S  L  E ++++L+ E + GIEYE  L +  LP I+  EV+    R+ 
Sbjct  394   IENLYKERNKTKSAELLQELVRNYLKQESIPGIEYEYGLYQKFLPTITLQEVNSLISRWI  453

Query  1411  -GTSSSCVIKTIEPR------ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSV  1569
               T  S ++   E        +TA +D L   +  +  +E K +  P         ++ V
Sbjct  454   KKTDRSIIVTAPEKEKNNLISSTAALDILNKPLGSLKKYEDKMATGP---------LLPV  504

Query  1570  KPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYF  1749
              P PG I  + +Y+++G  E+ LSNG  V  K T F +D + F+  S+GG S   +++Y 
Sbjct  505   APVPGKITAEKQYESIGTTEWTLSNGAHVVLKPTTFKNDDIQFSAISWGGTSLYSDADYM  564

Query  1750  SCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLV  1929
             + +  S IA   G+       L   +AGK   V   +  YM+  +G  +  DLETA+QL+
Sbjct  565   NATNASLIALTGGMGNLDIQSLQKEMAGKNCTVAPSMSNYMQGMNGSSTTKDLETAMQLL  624

Query  1930  YQLFTTNVEPGEED--VNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFR-PIRI  2100
             Y  F   V P ++     +V Q  +  +  ++++P + F + V  +  GN +  R P+ +
Sbjct  625   YGYF---VAPRKDSSMFKVVQQQMQVQLANKDKNPASVFGDTVGYV-MGNYHPRRKPVTL  680

Query  2101  RDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFN  2280
               ++++   +A   +   F +   F    VGN    +  PL+ +Y+  +P   +      
Sbjct  681   EAVKQLELDRAFNIYKERFSNGGQFLFTFVGNFTLDSIRPLVEKYIASLPSTGK------  734

Query  2281  RDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLET  2460
             +D  K +  ++P  +I +VV     E++ SV+L F     + + ++++  +G L K L  
Sbjct  735   QDTWKDVGLRYPQGVINKVVKKGK-ESKASVRLYFTGNSAAFNDLDELQ-IGQLCKALGI  792

Query  2461  KIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEIL  2640
             ++ +VLR   G +Y   VS   GG     V N    IGI F C P+    L+ L +DEI 
Sbjct  793   RLREVLREDAGGVYGVSVS---GGLSREPVNNY--SIGIQFGCAPENVDKLIGLTMDEIN  847

Query  2641  RLQEDGPSDEDVSTVLEIEQRAHENGLQENCYW  2739
               + +G +  ++  V+  + R  E   +EN YW
Sbjct  848   HTKSNGVAPVNIEKVIAEQTRGLETEFKENSYW  880



>ref|WP_013446016.1| peptidase M16 [Paludibacter propionicigenes]
 ref|YP_004043632.1| peptidase m16 domain-containing protein [Paludibacter propionicigenes 
WB4]
 gb|ADQ80647.1| peptidase M16 domain protein [Paludibacter propionicigenes WB4]
Length=935

 Score =   425 bits (1093),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 272/895 (30%), Positives = 475/895 (53%), Gaps = 46/895 (5%)
 Frame = +1

Query  139   LSQTPY------GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             L+Q+P        V  G L NG TYY+R N++P+ R  L LA + GS+LE+++++G+AH 
Sbjct  24    LAQSPALLPLDSAVTVGHLPNGFTYYIRKNAEPQNRVVLYLANKVGSILEDDDQQGLAHF  83

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAIS  480
             VEH++F+ T+ +  +++V +L+  G  FG   NA TS DETVY+L +P D PELL     
Sbjct  84    VEHMSFNGTKHFPKNELVSYLQKAGVRFGGDLNAYTSFDETVYQLPLPTDNPELLKNGFQ  143

Query  481   ILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLE  660
             I+ +++ E      ++EKERG ++EE R  ++A  RMQ+ ++  +M  SKY++R+PIG E
Sbjct  144   IMRDWAHEALFDSLEIEKERGVILEEKRLGKSAQERMQNKYFPFIMNQSKYSKRIPIGTE  203

Query  661   KVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY  840
             ++++   P  +++FY  WY     A+I VG+  D +   + I   F    +P  P     
Sbjct  204   EILKNFKPATIRRFYNDWYRPDLQALIVVGNI-DVKETEKTIIELFSDLKAPAHPRARTE  262

Query  841   YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFK  1020
             Y +P  ++ +F    + E   +A+ +  K   ++LKT  DY   +  +++   +  R+ +
Sbjct  263   YTIPLSQKNQFLTVTDKEFPVTAIQVMSKFTGNQLKTTVDYHQTILRALYNQIIGARYNE  322

Query  1021  ISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCK---EKGTVE-ALESMLTEVARVRLHGF  1188
             +S++ +PP+      A+  +    A ++T+S     ++G +E   ++  TE+ R + +GF
Sbjct  323   LSQQPNPPFLQ----AENYINNFMANLLTTSTTIVGKQGELEKGFKAAWTEIERAKKYGF  378

Query  1189  SEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLP  1368
             +E E++  + +L+S +ESAY ERD+  S S  +EYL  FL+ E   G+ YE    K  L 
Sbjct  379   TETELARAKDVLLSGMESAYNERDKTASVSYANEYLNLFLKGEASPGVGYEYNYYKNDLS  438

Query  1369  HISASEVSKYSERFGTSSS---CVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDE  1539
              I+ SE+++  + + T  +    V+ + + +A    D+    V K  T  Q  +I  + +
Sbjct  439   KITLSEINELIKEYLTDKNRDILVLSSEQEKANLPTDE---TVYKWITDVQNSNISAYVD  495

Query  1540  ENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGG  1719
                 + ++S K + G I+ + + + +G     LSNG++V  K TN+ +D++ F  +S GG
Sbjct  496   NVSEKPLLSQKIAGGKIISEKKDEKIGITTLSLSNGVKVVLKPTNYKNDEIHFYAYSPGG  555

Query  1720  LSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSP  1899
              S   +SEY S    S++A   GV  Y  + L   L+GK+  V   +GA    F+G  SP
Sbjct  556   YSLCKDSEYESAIHASSLASYGGVADYSLNQLEKYLSGKKVSVSPFIGARYEGFTGFSSP  615

Query  1900  SDLETALQLVYQLFT-----TNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELN  2064
              +LETALQLVY  FT     T V  G      ++Q+  E++  +  DP T F++ +  + 
Sbjct  616   KELETALQLVYLYFTQPRKDTAVYKG------MIQLERESLINRNSDPSTVFSDTISAVL  669

Query  2065  YGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGG  2244
                ++ + P     L K+N  +A E + + F D S F  ++VGN D  T  PL+ QYLG 
Sbjct  670   GCYNFRYTPPSNEKLDKINLDRAFEIYKDRFADASDFNFILVGNFDVTTIKPLLEQYLGA  729

Query  2245  IPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDV  2424
             +P           +  + L    PS  I + V     E + +VQL F  + +  ++ E+ 
Sbjct  730   LPTIKRV------EKARDLKIVIPSGKIEKKVFKGE-EQKSTVQLVFSGDYQY-NITEND  781

Query  2425  HFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDIS  2604
             + +  LS++L+ +++  LR     +Y  GV+         +    R    + F C P+  
Sbjct  782   NLLA-LSEVLDIRLINRLREDESGVYGVGVNASY-----EKYPRNRYTFTVAFGCAPENV  835

Query  2605  STLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
               L++  LDEI +++E+G + E+++ V+  E+RA E   +EN +W++ +   YQ+
Sbjct  836   DKLINSTLDEIRKIRENGATQEEINKVIAEERRAIEVQSKENGFWINYLSDKYQN  890



>ref|WP_020652642.1| hypothetical protein [Massilia niastensis]
Length=949

 Score =   425 bits (1092),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 275/871 (32%), Positives = 449/871 (52%), Gaps = 35/871 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N++P+ +  L L V+AGS+LE+E++RG+AH VEH+AF+ +  + 
Sbjct  37    VKVGKLANGLTYYIQRNARPERKLELRLVVKAGSILEDEDQRGLAHFVEHMAFNGSTHFR  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              H++V +L+SIG  FGA  NA TS DETVY L +P DKPE +++A  +L +++  V+ + 
Sbjct  97    KHELVSYLQSIGVGFGADLNAYTSFDETVYILPIPTDKPEHVTKAFQVLEDWAHGVQFAP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               ++KERG V+EE R  + A  RM    +  +  GSKYAERLPIG E+V+R+  P  +++
Sbjct  157   DAIDKERGIVLEELRLGKGAADRMGKQIYPRLFNGSKYAERLPIGREEVLRSFRPDTLRR  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+ VGD  D     +LI  HF    +P  P P  Y  +P  ++     
Sbjct  217   FYRDWYRPDLMAVVVVGDI-DPARAEKLITTHFTRLKNPARPRPREYAAIPPRQDTEALV  275

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA G++V+I   + PV E  T+  YRD L +++F   LNQR  ++ +  + P+   
Sbjct  276   VTDPEANGNSVLIRYPVQPVREPGTIGAYRDELVQALFGAMLNQRLAELVQLPEAPFLGA  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             S++   L     +Y  +++   +G   A+ +++ E  R R HGF   E+   +  +M   
Sbjct  336   SSSLGKLTPRYHSYNASAALGPRGAAPAIAALVQENERARRHGFGAAELERAKKNMMRNY  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E A+ ER +  S +   EY+++FL+ E + GI+ E +  + L+P I+  E++ Y+ R   
Sbjct  396   EQAWNERAKSDSATYAAEYIRNFLQQEAIPGIDTEYRYVQELVPGITLDEMNAYARRTIP  455

Query  1411  GTSSSCVIKT-IEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
               S   V+ T ++     T   L + V +     ++  + P DE+ +   ++   P+PG 
Sbjct  456   ADSGKLVLYTGVDKPEPPTGAQLLAAVAE----AERAQVAPHDEKAVAALLMEKPPAPGA  511

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I+ Q E + +G     LSNG++V  K T+F +DQV+ +   +GG S   + +  +    +
Sbjct  512   IVSQREDKALGLTHLLLSNGVKVILKPTDFRNDQVMLSAARFGGQSLYGDGDILNARFAN  571

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
              I   +GV  + P  +  +LAGK A V   LG+Y    +G    SD+ET LQL++  F +
Sbjct  572   AIVASMGVPNFSPLDMRKILAGKAAGVTVGLGSYTDVVAGASGASDVETMLQLLWLKF-S  630

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANR-VRELNYGNSYFFRPIRIRDLQKVNP  2124
              V   E+     +    E    Q   P   F +  V  L   +    R ++  +  K++ 
Sbjct  631   GVRRDEDLFRSYVGKQAEIARNQSAQPGRRFGDALVSALFNDHPRAPRSLQADEYAKIDL  690

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              ++ + F   F      T ++VG+ DPA   PL+  YLG +P P  P+ +  RD    + 
Sbjct  691   DRSIDIFRQRFSSARDLTFIVVGSFDPAAIKPLLATYLGSLPTPELPVAY--RD----VG  744

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLET---KIV  2469
              +  + +++  V S   E + +V L F  P E    + +        LS L+E    +I+
Sbjct  745   LRPVTGVVKREVRS-GTEPKSTVSLNFTGPAEFSEAEQLR-------LSALIEVANLRII  796

Query  2470  QVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQ  2649
              VLR +   IY  G S  L     S++      I IN    P+    ++     EI RLQ
Sbjct  797   DVLREQMAMIYGGGASGAL-----SKIPYGNYSISINLPTGPEHVDKVLAATFAEIRRLQ  851

Query  2650  EDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             E GP   D++ V     + H   L+EN YW+
Sbjct  852   EKGPDAADLAKVKSNWIQNHRRSLRENGYWV  882



>ref|WP_036245117.1| peptidase M16 [Massilia sp. BSC265]
 gb|KFI08614.1| peptidase M16 [Massilia sp. BSC265]
Length=978

 Score =   424 bits (1091),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 280/896 (31%), Positives = 464/896 (52%), Gaps = 32/896 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N++P+ +  L L V+AGS+LE+E++RG+AH VEH+AF+ +  + 
Sbjct  62    VKVGKLANGLTYYIQRNARPERKLELRLVVKAGSILEDEDQRGLAHFVEHMAFNGSTNFR  121

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              H++V +L+SIG  +GA  NA TS DETVY L +P DKPE +S+A  +L +++  ++   
Sbjct  122   KHELVSYLQSIGVGYGADLNAYTSFDETVYILPIPTDKPEHVSRAFQVLEDWAHGLQFDP  181

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +EKERG V+EE R  + A+ RM       +  GSKYAERLPIG E+V+R   P+ + +
Sbjct  182   EAVEKERGIVLEELRLGKGASDRMGKQIMPAIFNGSKYAERLPIGTEEVLRNFKPEALAR  241

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+ VGD  D     +L+KAHF +  +P    P  Y  +P+ +  +   
Sbjct  242   FYRDWYRPDLMAVVVVGDI-DPLRAEKLVKAHFAHLKNPVPARPRAYAEIPARQATQALV  300

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA G+AV+I   + PV E  T++ YRD L +S+F   LNQR  ++S+  +PP+   
Sbjct  301   VTDKEATGNAVLIRYPVQPVIEAGTIRAYRDDLVQSLFSAMLNQRLQELSQLPEPPFMGA  360

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             S++   L    ++Y  +++   +G   AL +++ E  R R +GF   E+  V+  LM + 
Sbjct  361   SSSLGKLTPRYRSYNASAALGPRGAEAALTALVEENERARRYGFGAAELERVKKSLMRQY  420

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E A+ ER +  S++   EY+++FL+ E + GI+ E +  + L+P I+  EV+ Y+ R   
Sbjct  421   EQAWNERAKSDSSTYAAEYIRNFLQQEAIPGIDTEYRYVRELVPGITLDEVNAYARRTIP  480

Query  1411  GTSSSCVIKTIEPRATATVDDLRS--VVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
               S   V+ T       T DD      +L      ++  + P DE+ +   ++   PSPG
Sbjct  481   ADSGKLVLYT-----GVTRDDTPQGPQLLAAVAGAERAELRPHDEKAVAARLMDRPPSPG  535

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMG  1764
              I+ +     +G     LSNG++V  K T+F +DQV+ +   +GG S   + +  +    
Sbjct  536   RIVAESIDAALGLTRLTLSNGVKVILKPTDFRNDQVMMSAARFGGQSLYGDQDILNARFA  595

Query  1765  STIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFT  1944
             + I   +GV  + P  +  +LAGK A+V   L  Y     G    +D+ET LQL +  F 
Sbjct  596   NAIVASMGVRDFTPLDMRKILAGKAAQVDVGLANYTDVVVGASGATDIETMLQLTWLKFH  655

Query  1945  TNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYG-NSYFFRPIRIRDLQKVN  2121
                       + V + AE+A + Q   P   F + V    Y  +    R ++  + ++++
Sbjct  656   GVRRDEALFRSYVGKQAEQARN-QTAQPGARFGDAVMAALYNKHPRAPRTLKAEEYEQID  714

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               ++ + F   F      T ++VG+ + A   PL+  YLG +P  SE  + + RD    +
Sbjct  715   LDRSIDIFRQRFSSAKDLTFILVGSFEVAALKPLLATYLGSLP-TSELTVAY-RD----V  768

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
               +  + +++  V S   E + ++ L F    +  D  E +     L +++  +++ VLR
Sbjct  769   GLRPATGVVKREVRS-GTEPKSTISLTFTGTAEFSD-AEQLRLAALL-EVVNLRLIGVLR  825

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              K   IY  G S  L     S++      IG+     P+    ++    DEI RLQ +GP
Sbjct  826   EKMALIYGGGASGVL-----SKIPYGNYSIGVTLPTGPEHVDKVIAATFDEIRRLQAEGP  880

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSG-DVGDSFKVQDEARS  2826
                D+  V     + H   L+EN YWL  +    Q+ +  G D G   +V+ + R+
Sbjct  881   EAADLDKVKSNWIQNHRRSLRENGYWLGYL----QTALSEGTDPGAILEVEKQVRA  932



>ref|WP_036237660.1| peptidase M16, partial [Massilia sp. JS1662]
Length=941

 Score =   422 bits (1085),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 286/937 (31%), Positives = 468/937 (50%), Gaps = 46/937 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+LDNGLTYY++ N  P+ +  L L V+AGS+LE+E+++G+AH  EH+AF+ +  + 
Sbjct  38    VKVGKLDNGLTYYIQRNRMPEHKLELRLVVKAGSILEDEDQQGLAHFTEHMAFNGSRHFK  97

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              H++V +L+SIG +FGA  NA TS DETVY L VP D+ E L +A  +L +++  +  ++
Sbjct  98    KHELVSYLQSIGVKFGADLNAYTSFDETVYILPVPSDRKEDLDKAFLVLEDWAHGLTLTD  157

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++KER  V+EE R  + A  RMQ      M  GS+YA+RLPIG E VIR   P+ +++
Sbjct  158   ADIDKERDIVLEEARLGKGAGDRMQKVLMPKMYNGSRYADRLPIGQEDVIRNFKPETLRR  217

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+AVGD  D     +LI+ HF    +P  P P  Y  +P+  +     
Sbjct  218   FYKDWYRPDLMAVVAVGDI-DPAQAEKLIRRHFAGLKNPAHPRPREYARIPARTDNEALV  276

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA  ++++I   + P  E  T++ YR+ L E++F   LNQR  ++S    PP+   
Sbjct  277   VTDKEAGPASILIRYPLQPFHERATLRGYREQLIEALFAGMLNQRLQELSALPSPPFIGA  336

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             S+A   L    ++Y   ++    G   A+++++ E  R R  GF+  E+  ++  +M   
Sbjct  337   SSALSRLTPRYRSYNAMAALGMNGATVAIDALVQENERARRFGFTAAELERMKKTMMRTY  396

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E A+ ERD+  S     E +++FL  E + GI+ E +  K L P I+ +E++ Y+ +   
Sbjct  397   ERAWNERDKTDSAVHAAELMRNFLEGESIPGIDAEYRYVKELAPGITLAEINAYAAKTIP  456

Query  1411  GTSSSCVIKTIEPRATA-----TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKP  1575
               S   VI T   +        T + L + V    T  +K+ +   DE+ +   ++   P
Sbjct  457   ADSGKLVIYTGSTKTEGDAPIPTGEQLLAAV----TNAEKRDVKAHDEKAVAAHLMDQPP  512

Query  1576  SPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSC  1755
             +PG I+ +    ++G     LSNG++V  K T F +DQVL +   +GG S   + + F+ 
Sbjct  513   APGKIVDESRDVSLGLTRLTLSNGVKVILKPTTFRNDQVLMSAARFGGQSLFDDKDMFNA  572

Query  1756  SMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQ  1935
                 TI   +G+  + P  +  +LAGK A V   LG      +G    +D+ET LQ+V+ 
Sbjct  573   RYADTIVAAMGLKDFSPLDMRKILAGKAASVSAGLGNNTDVVAGTAGATDVETMLQMVWL  632

Query  1936  LFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS-YFFRPIRIRDLQ  2112
              F   V   E+     +    E    +   P   F + V    Y N+    R +R  D+ 
Sbjct  633   KF-AGVRRDEDLYKSFIGKQMELARNRLSQPGALFGDTVLATLYDNNPRAPRALRPEDIN  691

Query  2113  KVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDL  2292
             K++  +A   +   F      T + VG+ D A   PL+  YLG +P P  P  +      
Sbjct  692   KIDLDRAIAIYRQRFSSAKGLTFIFVGSFDVAAIKPLVATYLGSLPTPDIPTAY------  745

Query  2293  KGLPFKFPSSIIREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLETKI  2466
             + L  +  + +++  + S   E + +V L F  P E+     +E++     L++++  +I
Sbjct  746   RDLGIRPVTGVVKREIKSGS-EDRSNVSLTFTGPGEVTE---LEELRLSA-LTEVMNIRI  800

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRL  2646
             + +LR K G IY  G+   +     +R+      IG+     PD    ++     EI R+
Sbjct  801   IDILREKLGLIYGGGMEASM-----TRIPYSHYTIGVQLPTGPDNVDKVLAATFAEIDRM  855

Query  2647  QEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSG-DVGDSFKVQDEAR  2823
             +++GP+ ED+  V     + +   LQEN YW    L + Q+ +  G D G       E +
Sbjct  856   RKEGPTQEDLDKVKTNWLQTYRKSLQENTYW----LAALQTSLTEGTDPGTILTFDKEVQ  911

Query  2824  SKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQA  2934
             +     LT    + A QR L       Y  V+L P+A
Sbjct  912   N-----LTVDDVRRAAQRYL---NTDNYVQVVLNPEA  940



>ref|WP_014021800.1| peptidase M16 [Cyclobacterium marinum]
 ref|YP_004775746.1| peptidase M16 domain-containing protein [Cyclobacterium marinum 
DSM 745]
 gb|AEL27515.1| peptidase M16 domain protein [Cyclobacterium marinum DSM 745]
Length=954

 Score =   422 bits (1084),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 270/921 (29%), Positives = 478/921 (52%), Gaps = 26/921 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L+NGLTYY++ N KP+ +  L LA++AG++ E++ + G+AH VEH+AF+ +E + 
Sbjct  53    VKIGQLENGLTYYIQHNPKPENKLELRLALKAGAMQEDDNQLGLAHFVEHMAFNGSEHFE  112

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++++ +L+SIG  FG+  NA TS DETVY L +P D+ E L+    ++ +++  +  + 
Sbjct  113   KNELISYLQSIGVAFGSDLNAYTSFDETVYMLPIPTDEEEKLTNGFQVMRDWAGGLLLNT  172

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++ ERG V+EE+R  +    R++DA+  +++  S+YA+R+PIG  ++IR  +  +V++
Sbjct  173   EDIDAERGIVVEEWRTGQGVGQRLRDAYLPVLLHESRYAQRMPIGKMEIIRNAADSLVRK  232

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MA++AVGD P T+ V  LIK +F     P + P   YY VPSH++     
Sbjct  233   FYKDWYRPDLMAIVAVGDVP-TEKVEGLIKTYFSNLKKPENAPAREYYEVPSHKDNFVKI  291

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EA G  V +  K          DY+  +  +MF   + QR  +I +++D P+    
Sbjct  292   ITDEEAPGIQVQLYYKHKAKPSINYSDYKGRILRTMFGGMITQRLDEIRQQEDAPFIFAG  351

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A    LV+P+  + ++         + L S LTE  RV  HGF++ E+  V+  L++  E
Sbjct  352   ARYGNLVKPLDFFTISGVVGPGKLKDGLLSFLTENQRVVDHGFTQSELDRVKRSLLNSAE  411

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              ++ E D+++S +L   Y+ HFL      G E   +  + ++P I+  EV++ ++    +
Sbjct  412   KSFKEMDKVESRNLVGRYVSHFLNQSFADGPENRYRFYQEIIPQITLEEVNELADELIRN  471

Query  1420  SSCVIKTIEP----RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
              + V+    P     +     DL +V+    + + K    P++E+ + EE++  KP PG 
Sbjct  472   DNIVLIVSAPEKDKESLPKESDLLAVLENATSIQTK----PYEEDLLREELMLSKPQPGE  527

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             ++ +   + V      L NGM+V +K T++ +++++FT  S GG S  P  +++S +   
Sbjct  528   VVGRAYNEGVDVTTVTLDNGMKVYFKPTDYKNNEIIFTASSNGGTSLYPLEDHYSANYSG  587

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
             T    +G+  + PS L  +LAG+  +V   +  Y    SG  +P DLE  LQL++ L+ T
Sbjct  588   TAINVMGIGDFTPSQLKKVLAGRNVQVTPNISTYSERISGATTPGDLEMTLQLIH-LYFT  646

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE-LNYGNSYFFRPIRIRDLQKVNP  2124
             +        N+ +   +  + +   +P   F  RV E ++ GN           L  ++ 
Sbjct  647   SPRMDRSLWNVFIANQKNQLESAGVNPDFQFNKRVNEIISNGNPRGRGIYTAEQLDSISL  706

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              K+ E + + F + + F V+  GNI+     PLI QYLG +  P +P    N  DL GL 
Sbjct  707   DKSLEIYKDRFANAADFNVLFTGNINMEEVLPLITQYLGSL--PGDPSKKENFLDL-GLT  763

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
                P    +E +   M + +  V L F  E  S D+ +    + +L ++L  K+++ LR 
Sbjct  764   ---PPHDRKETIKVGM-DDKSQVILYFSGE-TSYDLAKSQQ-LSYLGEILTIKLIETLRE  817

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             + G +Y  G    L     SRV   R +  ++F C P+    L     ++I ++QE+GP+
Sbjct  818   EIGGVYGVGARGSL-----SRVPKERFNFSVSFPCGPESVEKLTAAVWEQIRKIQEEGPN  872

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDV-GDSFKVQDEARSKVRKL  2841
             + D++ V E ++   E  ++ N YW  +++ +  S +    V G   +V     S+++K+
Sbjct  873   EADLAKVRETKRLDLEENMKRNGYWHGQLVAAITSGLPLDTVLGAEGRVLGVTASEIKKV  932

Query  2842  LTPLTAQMALQRILPFPCKKQ  2904
                   +  L  I+ +P   Q
Sbjct  933   ANEFIQKPHLLEIIRYPANFQ  953



>ref|WP_026850055.1| hypothetical protein [Gemmatimonas sp. AP64]
Length=951

 Score =   421 bits (1082),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 277/889 (31%), Positives = 446/889 (50%), Gaps = 36/889 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NG+ YY+R N+KP+ RA L L + AGS+LE++++RG+AH VEH+AF+ T+ + 
Sbjct  52    VTVGTLPNGIRYYIRQNAKPEKRAELRLVINAGSILEDDDQRGLAHFVEHMAFNGTKSFA  111

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +DIVK+LESIG  FGA  NA TS DETVY L VP D   +L ++   L + +S V    
Sbjct  112   KNDIVKYLESIGVRFGADLNAYTSFDETVYILPVPTDSAGILPKSFRFLGDVASGVLFDS  171

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++  ERG V+ E+R    A  R++D  + ++  GS+YAERLPIG  +++   +P  VK+
Sbjct  172   AEVVAERGVVLSEWRNGLGAGERLRDKQFPVIFRGSRYAERLPIGKPEILEKANPGPVKR  231

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             F++ WY    MAVIAVGD  +   +  LI++ F        P P     VP+H+    + 
Sbjct  232   FWRDWYRPDLMAVIAVGD-ANPAELERLIRSTFSGIPKRTAPRPRTLASVPTHDSTLVTI  290

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E   S+V +  K P    +TV D R+ L   ++   +NQRF ++S K + P+    
Sbjct  291   ATDKELTTSSVGVLWKRPGKSTRTVGDMREDLINRLYNGMINQRFQELSLKPETPFTGAG  350

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A++   VR  +   + +  KE   +E+L+++LTE  RV+ HGF   E+   R   +   E
Sbjct  351   ASSGGFVRGSELNALDAGAKEGKIIESLQALLTEAERVQRHGFLASELERARTNTLRSYE  410

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNE--PVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
              ++ ERD+  S +  DEY+ ++L  E  P I  EY A +QK LLP I+ +EV+  +   G
Sbjct  411   RSFAERDKTPSGAFVDEYIANYLSGEGAPSIAFEY-AAVQK-LLPTITLAEVNAVANARG  468

Query  1414  TSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
              +++ V+    P          S V  +       +I PW E      +V   PS G ++
Sbjct  469   GAANRVVTVTVPEKDGLRVPTESEVRAVFGTVVASNITPWVETVAEGALVPTTPSAGKVV  528

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
             ++         ++ LSNG+RV  K T+F  DQ+L + FS GG S + + + F  S+  +I
Sbjct  529   KEARIAAQNITDWTLSNGVRVLIKPTDFNADQILMSSFSPGGASLVADKDAFKTSLAPSI  588

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
                 GV  +    L   L GK A     +       SG  SP DLET +QL+Y  FT   
Sbjct  589   IAAGGVGSFSTIDLRKKLTGKVASATPSISDLSEGMSGAASPKDLETLMQLIYLRFTAP-  647

Query  1954  EPGEEDVNIV---MQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNP  2124
                  D  +    +Q  E+ +  ++ +P   F++ +++   G     RP+ +  L++++ 
Sbjct  648   ---RADSTVFKAQLQQFEQFLKNKDANPMAVFSDTIQQTLAGGHPRARPLSMEMLKELDI  704

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP---RPSEPILHFNRDDLK  2295
              +    + + F D   FT   VGN+D AT  PL+ Q+LG +P   R   P     RD   
Sbjct  705   NELLTIYKDRFSDAGDFTFFFVGNVDLATFKPLVEQWLGALPTAGRKETP-----RDV--  757

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
               P +F   I + V      ++Q  V +        ED     + +  L +LL+ +++  
Sbjct  758   -GPTQFAGVIDKAVKKGIAPQSQSIVLMAGSAPWNREDS----YVLSSLGELLQMRLLDR  812

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR   G  Y+  V+        SR       + I +   PD + T+     DE+ +L+  
Sbjct  813   LRESLGGTYSVSVTSAF-----SRRLRQEWQVAIQYGSAPDKADTMFAAVRDEMQKLRTT  867

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSF  2802
              P+  ++  V E ++R  E   ++N YWL+    + ++R+ +GD  D+ 
Sbjct  868   PPTAAELERVKEQQRREFEVSQKQNGYWLN----TMRTRVENGDPLDTM  912



>ref|WP_012929860.1| peptidase M16 [Spirosoma linguale]
 ref|YP_003390163.1| peptidase M16 domain-containing protein [Spirosoma linguale DSM 
74]
 gb|ADB41364.1| peptidase M16 domain protein [Spirosoma linguale DSM 74]
Length=955

 Score =   421 bits (1083),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 271/924 (29%), Positives = 470/924 (51%), Gaps = 33/924 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+R N++PK RA L L +RAGSVLE + ++G+AH +EH+ F+ T+ + 
Sbjct  56    VKVGKLANGLTYYIRKNAEPKNRAELRLVIRAGSVLENDNQQGLAHFMEHMEFNGTKNFP  115

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+S G  FGA  NA T  DETVY+L VP D   + + A  IL +++       
Sbjct  116   KNELVNFLQSAGVRFGADLNAYTGFDETVYQLPVPTDSVNVFTNAFQILEDWAHNATIDP  175

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG ++EE R  R A  RM+D ++ +++  S+YA+RLPIG E+V+ T  P++++Q
Sbjct  176   TEVDKERGVILEERRLGRGAGQRMRDQYFPILLNNSQYAKRLPIGTEQVLTTFKPEVLRQ  235

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAVIAVGDF D + V  +I+  FG   +   P P   Y +P+H++ +   
Sbjct  236   FYKDWYRPDLMAVIAVGDF-DMKQVEGIIREKFGRIPAVKSPKPRTEYDIPAHKDTKVVI  294

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E   + V +  K P  + KT+ D R+ +   +F   L  R  +++++ +PP+    
Sbjct  295   VTDPEQPNTVVQVIYKRPEIKEKTLGDLRESIKRGLFNTMLGNRIQELTQQANPPFLGGY  354

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             +     +  + A+   +  KE     A+ ++L E ARV+  GF+  E++  +   M+ +E
Sbjct  355   SNYSDFLGNLDAFTSIAVAKEGNVERAIRAVLDENARVKQFGFTPTELARAKQEFMTNVE  414

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              AY ERD+ +S +  +EY+Q+F   EP   IE+     K     I  +EV+   ++F  +
Sbjct  415   QAYSERDKTRSVNYVNEYVQNFTDKEPYTSIEFYYNFLKKEQDGIKLAEVNALVDQFIHN  474

Query  1420  SSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
              +  +  + P +  A +  +  ++  ++     + +  ++++ +   +++ +P+   ++ 
Sbjct  475   DNRAVIVMAPEKDKAKLPTVEQIIGYVDN--AGKGLTAYEDKTLDSPLLATQPTASPVVN  532

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             + + +++G  E+ L NG+RV  K TNF +DQ+LF+  S GG S     ++ S    ST+A
Sbjct  533   EKQIKDIGVTEWTLKNGVRVVLKPTNFKNDQILFSASSQGGTSLYDLKDFQSARFSSTLA  592

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                G   Y    L   L+GK+  V   +G      +G  +P DLETALQL+Y  FT   +
Sbjct  593   AMGGTGAYNQIQLGKFLSGKQVSVFPYVGELNEGVNGSAAPKDLETALQLLYSYFT---Q  649

Query  1957  PGEEDVNIVMQMAEEAIHAQER----DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNP  2124
             P ++   +   ++ +    Q R     P   F + V      N+   +P++  DL  ++ 
Sbjct  650   PRKDPDVVKGFLSNQRSALQNRINTPTPQGVFQDTVTVTLGNNNPRRQPLKPEDLDNIDL  709

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              +A + +   F +   FT   VGN       PL+ +YLGG+P   +       +    L 
Sbjct  710   DRALKIYQERFANAGDFTFYFVGNFKEDQLKPLVEKYLGGLPSTGK------SEKFNDLG  763

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              + P   I + V+  + + + +VQL +  ++      E    +  L+++LE K+++ LR 
Sbjct  764   IRAPKGQISKTVYRGL-DPKAAVQLVYTGDINWSP--ETSTQLDALAEVLEIKLIEKLRE  820

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             +   +Y    S        ++    R    INF C P+    L+    + I  L+E G  
Sbjct  821   EESGVYGVSASAAY-----AKYPVPRYTFRINFGCAPENVEKLIAKTQELINNLKEKGAL  875

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLL  2844
               D++      +R  E  L++N +WL  +    Q++ Y+GD  D    +DE  +KV    
Sbjct  876   ATDIAKFKAETRRETEVQLKDNQFWLGYL----QNQYYNGDAPDEVLHEDEQLAKVTVES  931

Query  2845  TPLTAQMALQ----RILPFPCKKQ  2904
             T   A   L     R++  P KKQ
Sbjct  932   TKAAANQYLSSNLIRLVLMPEKKQ  955



>ref|WP_006927433.1| peptidase M16 domain protein [Caldithrix abyssi]
 gb|EHO40448.1| peptidase M16 domain protein [Caldithrix abyssi DSM 13497]
Length=948

 Score =   421 bits (1081),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 278/929 (30%), Positives = 472/929 (51%), Gaps = 43/929 (5%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NGLTY ++ N+KP+ R  L L V+ GSV+EE+ E+G+AH  EH+AF+ T+ +   +
Sbjct  52    GQLPNGLTYLIKQNAKPEKRLFLRLVVKIGSVVEEDNEQGIAHFCEHMAFNGTKHFKKQE  111

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             ++ FLESIG  FGA  NA TS D+TVY L VP D   L+ QA  I+ +++  V     ++
Sbjct  112   LIDFLESIGMRFGADLNAYTSFDQTVYMLEVPTDSLPLIRQAFQIVEDWAHNVLYDPQEI  171

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             ++ERG V+EE+R  R A  R++D    ++ + S+YA+RLPIG ++++ T   ++   FYK
Sbjct  172   DRERGVVIEEWRRGRGAYQRVRDQFLPVLFKESRYAKRLPIGKKEILETFPHEVPLNFYK  231

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
             KWY    MAVI VGDF D Q++ +L   HF    +PP+ P   YY VP      FS   +
Sbjct  232   KWYRPELMAVIVVGDF-DPQTLKDLTLEHFSNLQNPPNAPERVYYPVPPQNRTIFSLAKD  290

Query  889   SEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAA  1068
              E   + + I  K   D  + V DYR  L ESM    L++R  + + + +PP+    ++ 
Sbjct  291   PELPVAQIEIDYKRDPDTARVVADYRKSLMESMISQMLSKRLQEYTSRPNPPFNYAYSSM  350

Query  1069  DCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAY  1248
               LV+  + + +  + + +  +   +++L E  R   HGF+  E+   +  ++S ++ A+
Sbjct  351   MRLVQTKEIFTIACAARSEDILSGYKTLLIESRRALEHGFTPSELERQKKSILSYLKKAF  410

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSC  1428
              ERD+  S  L +EY +H L  E V GIE E ++ K +LP IS +E+++ +     +   
Sbjct  411   NERDKQNSKKLIEEYTRHVLYMESVPGIEKEFEIVKQILPGISLAEINQLTGELLQNPDR  470

Query  1429  VIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
             VI  + P        T D L++++  ++T +    I P+ ++ I +++V  + +PG +++
Sbjct  471   VIAVMGPDKEGVYFPTEDTLKTILAAVDTMK----IAPYVDQKIAKQLVDKQITPGSVVK  526

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             +  + ++G  E+ LSNG R+  K T+F +D++L  GFS+GG S  P+S Y S    S IA
Sbjct  527   EINHSDIGVIEWRLSNGARILLKPTDFKNDEILMNGFSFGGYSLAPDSIYDSARFSSAIA  586

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                G+  +    L   LAGK   +   +      F+G  S  D E+ LQ+VY  F   V 
Sbjct  587   SASGLGKFNRIQLRKFLAGKVVRLNAGISKDTEEFNGSSSVKDFESLLQMVYLNF---VS  643

Query  1957  PGEEDVNIVMQMAEEA--IHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYK  2130
             P  +       +A +   +  +E DP   + + +          + P+  + L ++    
Sbjct  644   PRFDSTAFQSLIARQKSWLKNKELDPEAVYNDSLIVWLTQRHPRYLPVNEQTLSRIRLKP  703

Query  2131  ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFK  2310
             A +++   F +P  FT + VG+  P T  PL+  Y+GGIP       H  R+      + 
Sbjct  704   AADFYRQRFDNPGDFTFIFVGSFKPETIRPLLETYIGGIPG------HEEREKWGSQDYT  757

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              P  ++ + ++   V+ +    + F  P     E++ + +    F++ +LE K+ + +R 
Sbjct  758   PPDQVVEKRLYKG-VDPKSVNTIIFSGPFNWSFENVRKGL----FMADILEIKLRERIRE  812

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
                  Y+  V       K   +   R ++ I FSCDP     L      +I  L + GP 
Sbjct  813   AESGTYSISVR-----GKFYHIPRQRYELLIRFSCDPKRVEELTADVFQQIDSLLQFGPQ  867

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLL  2844
             ++D+  V E+  + +E GL++N +W  R+  S   +I    V    ++ D  RS      
Sbjct  868   EKDLQKVREMYLKDYEEGLKQNGFWRSRLHYSLFHQIPFDHV---LRMDDIYRS------  918

Query  2845  TPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
               +T Q   Q       KK+Y   +L+P+
Sbjct  919   --ITLQDVHQMAKELLNKKRYLRAVLLPE  945



>ref|WP_013446024.1| peptidase M16 [Paludibacter propionicigenes]
 ref|YP_004043640.1| peptidase m16 domain-containing protein [Paludibacter propionicigenes 
WB4]
 gb|ADQ80655.1| peptidase M16 domain protein [Paludibacter propionicigenes WB4]
Length=942

 Score =   420 bits (1080),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 264/874 (30%), Positives = 457/874 (52%), Gaps = 24/874 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG TYY+R N++PK R  L LA + GS+LE + ++G+AH +EH++F+ T+ + 
Sbjct  44    VKVGKLPNGFTYYIRRNTEPKNRVTLYLANKVGSILENDNQQGLAHFIEHMSFNGTKHFP  103

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+  G  FG   NA TS DETVY+L +P D PELL     I+ +++ +     
Sbjct  104   KNELVSYLQKAGVRFGGDLNAYTSFDETVYQLPLPTDNPELLKNGFQIMRDWAQDDLLDS  163

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++ KERG ++EE R  +NA+ R+Q  +  +++  S+Y+ RLPIG E+++    PQ +  
Sbjct  164   VEINKERGVILEEKRLGKNASQRLQYKYLPVILNKSRYSNRLPIGTEEILNNFRPQTLTD  223

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     A+I VGD  D  +  + I A F     P  P P   Y VP  ++ +F  
Sbjct  224   FYKTWYRPDLQALIVVGDV-DVAATEKTIIALFSDLKLPKAPKPRIKYTVPLLQKNQFLI  282

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               ++E   +A+ +  K     LKTV+DY   +  S+F   +++RF ++S++  PP+    
Sbjct  283   ATDNEYPTTAIQVFVKHQATALKTVEDYHQSILRSIFNFIVSERFDELSKQASPPFIEGG  342

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
              +    +  +     +   K        +++ TE+ R++  GF++ E++  +  LM  +E
Sbjct  343   GSIGSFLANIDVLSASVVAKPGELERGFKAVWTEMERLKKFGFTQSELNRAKEALMQSME  402

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
             S Y E+D+ QS S  +EYL  FL+ +   GIEYE +L +   P I+ +E++   +++   
Sbjct  403   SVYKEKDKTQSESYTNEYLNLFLKGDAAPGIEYEYKLYQNSFPKITLAELNGLIKKYLVD  462

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
              +  I  +     +T      VV +     QK +I  + ++++ + +++ +P  G I+ +
Sbjct  463   INRDIVVLGSTKDSTTLPTEKVVNQWMLDVQKSTINSYIDKSVDKPLMTQQPVAGKIVSE  522

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
              +   +G  E+ LSNG++V  K TNF +D++ F  FS GG S   +++Y S    S++ G
Sbjct  523   KKQDALGLIEYTLSNGVKVNLKPTNFKNDEISFHAFSSGGTSLYSDADYESAIRASSLVG  582

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
               G+  +    L   L GK+  V   +G      +G  +P D ETALQLVY  FT   +P
Sbjct  583   YSGLADFNLVQLGKYLTGKQVRVSPYIGERTEGLTGYSTPKDFETALQLVYLYFT---QP  639

Query  1960  GEEDVNI---VMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI-RIRDLQKVNPY  2127
               +DV +   V+      +  +  DP   FA+ V  +  GN    R    I  L K++  
Sbjct  640   -RKDVEVYKGVLSQERATLSTRGNDPAAVFADTVNTV-LGNYSLRRSAPSIARLDKIDLD  697

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             +A + + + F D S FT   VGN+D     PL+ +YLG +     P +H   +  + L  
Sbjct  698   RAFDIYKDRFADASDFTFTFVGNLDLEKVKPLLEKYLGSL-----PAIH-RTESARDLGI  751

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
               P+  I +VV+    + + +V+L F  E    +  ++ + +  L+++L  K+ + LR  
Sbjct  752   HIPAGKINKVVYKGQ-DPKSTVRLVFSGEYNYSN--DENNLLDALAEVLTIKLTERLRED  808

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
                +Y             ++  + R    + F C P+ +  L++ ALDEI +L+++GPS 
Sbjct  809   ESGVYGVEARASY-----AKYPHNRFSFSVMFGCGPENTEKLINSALDEINKLRQNGPSL  863

Query  2668  EDVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
              DV+ VL  E+R+ E  L+EN +WL+ +   +Q+
Sbjct  864   VDVNKVLAEERRSTEVQLKENNFWLNYLTNQFQN  897



>ref|WP_015814355.1| peptidase M16 [Dyadobacter fermentans]
 ref|YP_003089279.1| peptidase M16 domain-containing protein [Dyadobacter fermentans 
DSM 18053]
 gb|ACT96114.1| peptidase M16 domain protein [Dyadobacter fermentans DSM 18053]
Length=936

 Score =   420 bits (1079),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 287/932 (31%), Positives = 473/932 (51%), Gaps = 42/932 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG+TYY+R NS+PK RA L LAV+AGSVLE + ++G+AH +EH+ F+ T  + 
Sbjct  37    VKTGKLKNGITYYIRKNSEPKNRAELRLAVKAGSVLETDAQQGLAHFMEHMNFNGTTNFP  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+  G  FGA  NA T  DETVY L +P D   LL + I +L +++       
Sbjct  97    KNELVNFLQKTGVRFGADLNAYTGFDETVYMLPIPTDSAGLLEKGIQVLEDWAQGALLDP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++EKERG V+EE R  R A  RM+D    +++  S+YAERLPIG + ++++  P+ +K 
Sbjct  157   DEIEKERGVVLEESRMGRGAQQRMRDKFLKVILNNSRYAERLPIGKDSILKSFKPETIKA  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAVIAVGDF D   V  LI   F     P +P     Y +P     + + 
Sbjct  217   FYKDWYRPDLMAVIAVGDF-DVAKVESLINQKFSSIKPPVNPKKRIRYDIPLDGSTKVAI  275

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-YSC  1056
               + E   + V +  K P  + KT++D R+  A+ ++   + QR  ++++K +PP+ Y  
Sbjct  276   VTDPEYPQNLVQLIYKQPNSKEKTLQDVRNNFAQDLYNAMMGQRMQELTQKANPPFLYGA  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
             S   D L   + +Y   +  K+ G+++ AL ++L E  RV+  GF++ E+   +    + 
Sbjct  336   SQYGDFLGN-LDSYTSIALAKDAGSMKTALTTLLEENVRVQKFGFTQPELDRAKKDFYNA  394

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
             IE AY ERD+ +S +   EYL HFL ++P +G E   +  K  L  ++ +E++  ++++ 
Sbjct  395   IEEAYKERDKTKSANHVQEYLDHFLHDKPFMGAEAYFEFVKKHLDGVTLAEINGLAKKYI  454

Query  1414  TSSSCVIKTIEPR----ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSP  1581
             T  +  +  + P     A  T  ++R+++      E  + +  + ++ +   ++  +P+P
Sbjct  455   TDKNRAVVIMGPEKSKDALPTEAEIRTLL-----NEAGKDVTAYVDDVVDAPLLKTEPTP  509

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I  +     +G  E  LSNG++V  K T+F +D++L    + GG S  P+ E  +   
Sbjct  510   GKITGEKLLDKLGVTELTLSNGVKVLLKSTDFKNDEILIKATAKGGYSLFPD-ERETGIF  568

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
              S +    GV  Y  + L   LAGK A  G  L        G+ +P DLET LQL+Y  F
Sbjct  569   TSYLVQSGGVGPYNQTQLQKFLAGKTASAGPYLSELTEGVGGNTNPKDLETTLQLIYAYF  628

Query  1942  TTNVEPGEEDVNIVMQMAEEAIHAQER-DPYTAFANRVRELNYGNSYFFRPIRIRDLQKV  2118
             T   +  +    I+        + Q+   P   +++ +  +   N+   +P++   + KV
Sbjct  629   TEPRKDADVATGILANQKAYLENIQKTLTPEKVYSDSINAVLTSNNPKRQPLKPESVDKV  688

Query  2119  NPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKG  2298
             +  +A E + + F D S F   IVG   P T  PLI +YLG +P          RDD   
Sbjct  689   SLDRAFEIYKDRFADASDFVFTIVGAFKPETVKPLIEKYLGSLPSSE-------RDDTFS  741

Query  2299  LPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVL  2478
              P  FP     E V    +E +  V L    E       E+   +  L ++L+ K+++ L
Sbjct  742   HPNIFPPKGRIEKVIYKGLEPKSRVTLVSSGEYDYNP--ENNTQIEALQEILQIKLIEAL  799

Query  2479  RFKYGQIYNAGVSVFLGGNK-PSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             R +   +Y  GVSV  G +K P+  G+ R  IG  F C P+    LV  AL+E+ +++++
Sbjct  800   REEESGVY--GVSVSEGTDKFPT--GHYRFSIG--FGCAPENVDKLVKRALEEVNKIKQN  853

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVR  2835
             G   +D+   +   +R  E  L+ N +WLD +        + GD  +    QD    ++ 
Sbjct  854   GADPKDIDKFVAETRRKTEIALKTNGFWLDYL----DDNTFLGDDLNEIFEQD----RLL  905

Query  2836  KLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             K +T  + + A Q+         +  V+LMP+
Sbjct  906   KSITVASTKAAAQQYF---NDDNFIKVVLMPE  934



>ref|WP_026260373.1| hypothetical protein [Segetibacter koreensis]
Length=926

 Score =   419 bits (1076),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 281/927 (30%), Positives = 477/927 (51%), Gaps = 36/927 (4%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NGLTYY+R N +PK RA L L V+AGSVLE +++ G+AH  EH+AF+ T+ +   +
Sbjct  30    GKLPNGLTYYIRKNDEPKDRAELRLVVKAGSVLENDKQVGLAHFTEHMAFNGTKHFEKQE  89

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             +V FLE  G  FGA  NA TS DET+Y L +P D   +  +   IL +++  V     ++
Sbjct  90    LVNFLEKSGVNFGADLNASTSFDETIYMLQLPTDSVAVFKKGFQILEDWAHNVSFDTAEI  149

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG V+EE+R  + A  R++   + ++++GS+YA RLPIG +  + T     + QFYK
Sbjct  150   DKERGVVIEEWRSGQGAGERIRSKTFPVLLKGSRYAIRLPIGTKSNLDTFKYSTLTQFYK  209

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY      V  VGD  D   V +LIK HF     P +P P   Y VP+ +E +     +
Sbjct  210   DWYRPDLEGVFVVGDI-DVNQVEQLIKQHFASIPKPVNPKPRIKYGVPTQKETQTLIVTD  268

Query  889   SEAAGSAVMISCKMP-VDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAA  1065
              E   + V I  K P + E +T  +YR  +   +F   ++ R  +IS++ D P+   S +
Sbjct  269   PEQRYNVVSIYYKQPAIPEEQTDLEYRASMIRILFNAMMSSRLLEISQRPDAPFLGASTS  328

Query  1066  ADCLVRPVKAYIMTSSCKE-KGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIES  1242
                L+    A+ + +  K   G  +A E++L E ARV  +GF++ E+   +A  +S +E+
Sbjct  329   YGRLIGDKDAFTLAAYAKNGAGIAKATEALLAENARVLQNGFTQGELDRAKAAALSGMEN  388

Query  1243  AYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSS  1422
              Y ER++ +S+++ +E +++FL  EPV GIE E  + K  +P I+  EV+    ++   +
Sbjct  389   IYNERNKQESSTMVEELIRNFLTKEPVPGIEKEYAMYKQYMPGITLKEVNNLITQWIKPT  448

Query  1423  SCVIKTIEPRA-TATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
                I    P A  A +     +V  +N  +Q+  I  ++++ +  ++++ KP  G I+ +
Sbjct  449   DRTIIVTAPEAEKANLPTEAQMVALVN--KQQGKITAYEDKVMKGDLLAKKPIAGKIVDE  506

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
              +   +G  E  LSNG +V  K TNF ++QVL +  S GG S   +++Y S S  +T+  
Sbjct  507   RKIDEIGVTELTLSNGAKVVMKPTNFKNNQVLISAISKGGASLYNDTDYLSASNATTVTQ  566

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
               GV  +    L   LA K+  V   +G Y    SG C+P DL TA QL+Y  FT   EP
Sbjct  567   YGGVGNFDAMSLQKELAAKQVSVTPYIGQYSEGISGGCTPKDLATAFQLIYGYFT---EP  623

Query  1960  GEEDV--NIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKA  2133
              ++    +++ Q    ++  + +DP + F++ V  +    S   +P+ +  + ++   KA
Sbjct  624   RKDTTMFSVLKQQLIASLANKGKDPSSVFSDSVSYIMGNYSPRRKPLTLDRVDEIKLDKA  683

Query  2134  CEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKF  2313
                +   F + S F    VGN    +  P I  Y+  +P  ++      ++  K +  +F
Sbjct  684   FSIYQERFSNASDFIFTFVGNFTVDSLKPFIETYIASLPSTNQ------KESWKDVGIRF  737

Query  2314  PSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYG  2493
             P   I +V+     E++ +V++ F    +  D +ED     F +K+LE ++ ++LR   G
Sbjct  738   PRGNISKVIRKGS-ESKSTVRITFTGTTQYSD-LEDTQLDQF-AKVLEIRLREILREDNG  794

Query  2494  QIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDED  2673
              +Y+ GV     G   +R       + I+F C P+    L  L ++EI  ++ +G S  +
Sbjct  795   GVYSVGV-----GANITREPINSYSVTISFGCAPENVDKLTALVMEEIKNMKANGGSQTN  849

Query  2674  VSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPL  2853
             V  V+  + R  +  ++EN YWL  +    Q + Y  +   S  ++D     VRKL    
Sbjct  850   VDKVIAEDTRGMQTSVKENSYWLYNL----QDKYYFNEDPKSL-LEDPLL--VRKLTVER  902

Query  2854  TAQMALQRILPFPCKKQYTVVILMPQA  2934
             T ++A +    +   +    ++LMP+A
Sbjct  903   TKELANK----YLNNENMIKIVLMPEA  925



>ref|WP_026632348.1| peptidase M16 [Dyadobacter alkalitolerans]
Length=936

 Score =   417 bits (1071),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 280/936 (30%), Positives = 468/936 (50%), Gaps = 48/936 (5%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
             GV  G+L NGLTYY+R N++PK RA L LAV+AGSVLE + ++G+AH +EH+ F+ T  +
Sbjct  36    GVRTGKLKNGLTYYIRKNAEPKNRAELRLAVKAGSVLETDAQQGLAHFMEHMNFNGTTNF  95

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +++V FL+  G  FGA  NA T  DETVY L +P D   LL + + +L +++      
Sbjct  96    PKNELVNFLQKTGVRFGADLNAYTGFDETVYMLPIPTDSAGLLDKGLQVLEDWAHGALLD  155

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               ++EKERG V+EE R  R A  RM+D    +++  S+YAERLPIG + ++++  P+ + 
Sbjct  156   PAEIEKERGVVLEESRMGRGAQQRMRDKFLKVILNNSRYAERLPIGKDSILKSFKPETIT  215

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              FYK WY    MAVIAVGDF D   V   IK  FG  T+P +      Y +P     + +
Sbjct  216   AFYKDWYRPDLMAVIAVGDF-DVDKVEATIKQKFGSMTAPVNVKKRTKYTIPLDGSTQVA  274

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + E   + + +  K P  + KT+K+ RD  A+ ++   + QR  ++++K +PP+   
Sbjct  275   IVTDPEYPQNLIQLIYKQPNSKEKTLKNVRDNFAQGLYNSMMAQRMQELTQKANPPFLYG  334

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
              +     +  + +Y   +  K+  +++ AL ++L E ARV+  GF++ E+   +    + 
Sbjct  335   DSQYGDFLGDLDSYTSIALAKDAASMKIALTALLEENARVQKFGFTQPELDRAKKDFYNS  394

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
             IE  Y ERD+ +S +   EYL HFL  EP +  E   +  K  L  +S  E++  ++++ 
Sbjct  395   IEQYYKERDKTKSANHVQEYLDHFLHEEPYMSAEAYFEFVKKHLEGVSLMEINALAKKYI  454

Query  1414  TSSSCVIKTIEPRATATVDDL-RSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
             T  +  +  + P  +   D+L +   ++    E  + +  + ++ +   ++  +P PG +
Sbjct  455   TDKNRAVVVMGPEKSK--DELPKEAEIRTLLLEAGKDVTAYVDDVVDSPLLPAEPKPGKV  512

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
               + +   +G  E  LSNG+++  K T+F +D++L      GG S  PE E  +    S 
Sbjct  513   TSEKQLDKLGVTELALSNGVKILLKPTDFKNDEILIKATGKGGYSLFPE-ERETGIFASY  571

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             +    GV  Y  + L   LAGK A  G  L        G  +P DLET LQL+Y  FT  
Sbjct  572   LVQSGGVGPYNQTQLQKFLAGKTASAGPYLSELTEGMGGSTNPKDLETTLQLIYAYFTA-  630

Query  1951  VEPGEEDVNIVMQMAEEAIHAQER-----DPYTAFANRVRELNYGNSYFFRPIRIRDLQK  2115
                  +D +++  + E      E       P   +++ +  +        RP++   + K
Sbjct  631   ---PRKDADVITGILENQKAYLENMQKTLTPEKVYSDSLNGVLTSYDPKRRPLKPESIDK  687

Query  2116  VNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLK  2295
             VN  +A E + + F D S F    VG   P    PL+ +Y+GG+P         +RDD  
Sbjct  688   VNLDRAVEMYKDRFADASDFVFTFVGAFKPEEIKPLLEKYIGGLPST-------DRDDTF  740

Query  2296  GLPFKF-PSSIIREVVHSPMVEAQCSVQLCFPVELK--SEDMMEDVHFVGFLSKLLETKI  2466
               P  F P   I + ++  + E +  V L    E +   E+ M+    +  L ++L+ K+
Sbjct  741   KHPNIFPPKGTIDKTIYKGL-EPKSRVTLISSGEFEYSPENNMQ----IEALQEVLQIKL  795

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNK-PSRVGNIRGDIGINFSCDPDISSTLVDLALDEILR  2643
             ++ LR +   +Y  GVSV    +K PS  G+ R  IG  F C P+    LV  A +E+ +
Sbjct  796   IEALREEESGVY--GVSVSESTDKFPS--GHYRFSIG--FGCAPENVDKLVKRAREEVNK  849

Query  2644  LQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEAR  2823
             ++++G   +D+   +   QR  E  L+ N +WLD +        + GD  +    QD   
Sbjct  850   VKQNGADPKDIEKFVAETQRKTETALKTNNFWLDYL----DDNTFLGDDLNEIFTQD---  902

Query  2824  SKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
              K+ K +T  + + A ++         +  V+LMP+
Sbjct  903   -KLLKSITVASTKAAAEKYF---NDDNFIKVVLMPE  934



>ref|WP_009032964.1| peptidase M16 [Indibacter alkaliphilus]
 gb|EOZ92205.1| putative zinc protease pqqL [Indibacter alkaliphilus LW1]
Length=945

 Score =   414 bits (1063),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 273/906 (30%), Positives = 463/906 (51%), Gaps = 30/906 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L+NGL YYV+ N KP+ +  L L V AGSVLE E++RG+AH  EH+AF+ +E + 
Sbjct  36    VKIGTLENGLVYYVQQNPKPENKVELRLVVNAGSVLENEDQRGLAHFTEHMAFNGSENFE  95

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++++ +L+SIG  FGA  NA T  DETVY L +P D  E L     +L +++  +   E
Sbjct  96    KNELISYLQSIGVSFGADLNAYTGFDETVYILPIPSDDEEKLRSGFQVLRDWAGGLSLRE  155

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++ ER  ++EE+R  +  + R +D +   ++  S+YAERLPIG   VI+    + ++Q
Sbjct  156   EDIDAERSIILEEWRTGQGYSQRTRDQYLPKLLYQSQYAERLPIGDMDVIQNFEYETLRQ  215

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY   NMA+IAVGD  D   + +L+ A+F    +P + P    + VP HEE   S 
Sbjct  216   FYRDWYRPNNMAIIAVGD-ADPAELEKLVIAYFNDLKNPDNYPERRSFEVPDHEETFVSI  274

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EA G  + +  K P    +T  DY+  L  +M+   L QR  +I ++ + P+    
Sbjct  275   VTDEEAPGIQIQLFYKHPPLPFQTKADYKAYLIRTMYAGMLTQRLDEIRQQPNAPFIFAG  334

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
                   VR +  +  +     +   E + S++ E  RV  HGF++ E+  V+  L++   
Sbjct  335   TGYGNFVRSMDYFTASGVVSPEKVKEGIFSLIVENKRVATHGFTQPELDRVKRALLNSAG  394

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              ++ E D+ +S ++   Y+ HFL+     G +++ +  + + P IS S+++  ++   T 
Sbjct  395   RSFKEMDKTESRAIVGRYVNHFLKGNFAEGEQWKYEFYQEIFPEISLSDINALADELITE  454

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIP--PWDEENIPEEIVSVKPSPGWIM  1593
              + VI    P      D L S    +  FE+   +   P+DE+ + E ++S  PSP  I+
Sbjct  455   HNRVIIITAPEEEK--DKLPSEKEVLEFFEKASHVDLEPYDEKELGENLISNPPSPVSIL  512

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
              Q E ++VG +EFDL+NG +V  K T+F +D+++FT    GG+S  P+ +++S S    +
Sbjct  513   DQKEVESVGIYEFDLANGAKVFVKPTDFKNDEIVFTITGKGGVSIYPDEDHYSASYAGVM  572

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
                +GV  + PS L   LAGK   V   +G Y ++ SG  SP+  ETALQL++ L+ TN 
Sbjct  573   VNVMGVGDFSPSDLRKFLAGKTVSVTPNIGTYDQNISGSFSPNQAETALQLIH-LYFTNP  631

Query  1954  EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE-LNYGNSYFFRPIRIRDLQKVNPYK  2130
                +E  +I     +  + + + +P    + ++ + +  GN          +L  ++  +
Sbjct  632   REDKELFDIYFNNQKTQLASAQANPDYQLSKQLNKIIANGNKRALGIFDPEELDMISVDR  691

Query  2131  ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFK  2310
               E F   F + + F     GNI+  +  PL+  YL  +P   + +  F  +DL   P +
Sbjct  692   GMEIFREAFSNAADFEFYFSGNIELESFIPLMETYLATLPAEPDNLKTF--EDLGIRPPR  749

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELK-SEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
               + +I E+      + +  V L F  E   S D   D+ ++G   ++L  K+++ LR +
Sbjct  750   GRAEVI-EI----GTDEKSQVILFFSSETSYSRDRARDITYLG---EILTIKLIESLREE  801

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
              G +Y  G    +  NKP      +    ++F C PD    L+     EI ++Q+ GP +
Sbjct  802   IGGVYGVGARGSM-VNKPVD----QFTFSVSFPCSPDRVDELIAAVWKEIKKIQDHGPEE  856

Query  2668  EDVSTVLEIEQRAHENGLQENCYWLDRI--LRSY----QSRIYSGDVGDSFKVQDEARSK  2829
              D+  V E  + A E  L+ N YW+ ++  +R Y    +  + + D  D+  V D  +  
Sbjct  857   TDLQKVKEKRKIALEENLKRNNYWVAQMSAIREYGLDWEIVLRAKDRIDAISV-DNIKDA  915

Query  2830  VRKLLT  2847
              R+ LT
Sbjct  916   AREFLT  921



>ref|WP_020596692.1| peptidase M16 [Spirosoma panaciterrae]
Length=950

 Score =   414 bits (1064),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 269/925 (29%), Positives = 467/925 (50%), Gaps = 33/925 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+L NGLTYY+R N++PK RA L L +R GSVLE + ++G+AH +EH+ F+ T+ +
Sbjct  50    AVKVGKLPNGLTYYIRKNAEPKNRAELRLVIRVGSVLETDNQQGLAHFMEHMEFNGTKNF  109

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +++V +L+S G  FGA  NA T  DETVY+L VP D   + ++A  IL +++      
Sbjct  110   PKNELVNYLQSAGVRFGADLNAYTGFDETVYQLPVPTDSINVFNKAFQILEDWAHNATID  169

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG V+EE R  R A  RM+D ++  ++  S+Y++RLPIG E+V+ T   + ++
Sbjct  170   PAEVDKERGVVLEERRLGRGAGQRMRDKYFPALLNNSQYSKRLPIGTEQVLTTFKTETLR  229

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
             QFY  WY    MAV+AVGDF D + V  +I+  FG      +P P   Y +P+H++ +  
Sbjct  230   QFYHDWYRPDLMAVVAVGDF-DVKQVEGIIREKFGRIPVVKNPRPRTEYDIPAHKDTKVV  288

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + E   + + +  K P  + KT+ D R+ +   +F   L  R  +++++ +PP+   
Sbjct  289   IVTDPEQPNTVIQVIYKRPEIKEKTLNDLRESIKRGLFNTMLGNRIQELTQQANPPFLGG  348

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              +     +  + A+   +  K     +A+ ++L E ARV+  GF+  E+   +   M+ +
Sbjct  349   YSNYGDFLGNLDAFTSIAVAKGGNVEQAIRAVLNENARVKQFGFTATELERAKQEFMTSV  408

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E AY ER++ +S+S  ++Y+Q+F   EP   IE+     K   P I  +EV+   ++F  
Sbjct  409   EQAYSERNKTRSSSFVNDYVQNFTEKEPYTSIEFYYDFLKKEQPGIKLAEVNALVDQFIH  468

Query  1417  SSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
             + +  +  + P          + +L     +  + +  ++++ +   ++  +P+   ++ 
Sbjct  469   NDNRAVIVMAPEKDKDKLPTEAQILSY-IDDSGKGLTAYEDKTVDSPLLVTQPTASPVVS  527

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             + +  ++G  E+ L NG++V  K T+F +DQ+LF+  S+GG S     ++ S    ST+ 
Sbjct  528   EKKISDIGVTEWTLKNGVKVVLKPTDFKNDQILFSANSFGGTSLYDLKDFQSARFSSTLT  587

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                G   Y    L   LAGK+  V   +G      +G  +P DLETALQL+Y  FT   +
Sbjct  588   AMGGTGAYNQIQLGKFLAGKQVSVFPYVGELSEGVNGSAAPKDLETALQLLYSYFT---Q  644

Query  1957  PGEEDVNIV---MQMAEEAIHAQ--ERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVN  2121
             P  +D ++V   +     A+  Q     P   F + V     GN+   +P++  DL K++
Sbjct  645   P-RKDPDVVKGFLSNQRSALQNQINTPTPQKVFQDTVSVTLGGNNPRRQPLKPDDLDKID  703

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               +A + +   F +   F    VGN       PLI +YLGG+P   +P      +    L
Sbjct  704   LDRALQIYQERFANGGDFRFFFVGNFKEEQIKPLIEKYLGGLPGSDKP------EKFNDL  757

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
               + PS  I + V+  + + + SVQL +  +L      E    +  L+++LE K+++ LR
Sbjct  758   GIRIPSGQISKTVYKGL-DPKASVQLVYSGDLSWSP--EVTTQLDALAEVLEIKLIEKLR  814

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              +   +Y  G S        ++    R    INF C P+    L+    ++I  L+++G 
Sbjct  815   EEESGVYGVGASAAY-----AKYPVPRYTFRINFGCGPENVEKLIAKTQEQINELKKNGA  869

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKL  2841
                D++      +R  E  L++N +WL  +    Q++ Y+GD  D    ++E   KV   
Sbjct  870   LPADIAKFKAETRRETEVQLKDNQFWLGYL----QNQYYNGDAPDEVLHENEQLEKVTVE  925

Query  2842  LTPLTAQMALQ----RILPFPCKKQ  2904
              T   A   L     R++  P KKQ
Sbjct  926   STKAAANKYLGENFIRLVLMPEKKQ  950



>ref|WP_037349103.1| peptidase M16 [Sediminibacter sp. Hel_I_10]
Length=941

 Score =   412 bits (1060),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 278/884 (31%), Positives = 457/884 (52%), Gaps = 47/884 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+++N KP+ +  L L V AGS+LEE+++RG+AH +EH+ F+ T+ + 
Sbjct  41    VKMGKLANGLTYYIKNNGKPEDKVELRLVVNAGSILEEDDQRGLAHFMEHMNFNGTKNFE  100

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P D PE L +   I+ +++     + 
Sbjct  101   KNELVDYLQSIGVKFGAHLNAYTSFDETVYILPIPSDDPEKLEKGFQIIEDWAHNALLTG  160

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               ++ ERG V+EEYR  + A+ RM   +   ++ GSKYA+RLPIG + V+       +K+
Sbjct  161   EQIDDERGVVLEEYRLGQGADERMMQNYLPKLLYGSKYADRLPIGTKDVLENFEYDSLKR  220

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY   ++  +      D  ++ + IK HFG    P DP P   + +P+H+E   + 
Sbjct  221   FYKDWYR-PDLMAVVAVGDVDVATLEQKIKDHFGGIEMPKDPKPRKTFDLPNHKETFIAI  279

Query  880   FVESEAAGSAVMISCKMPVDEL--KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ S V +  K   D     T+KDYR+ + E +F   +N R  ++    +PP+ Y
Sbjct  280   ESDKEASFSQVQVLFKDKEDAQPDHTLKDYRESMVEGLFSQMINNRLDELRNSPNPPFVY  339

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S       +  +AY   +   E G ++ALE++L E  RV+ HGF E E    +  +M+
Sbjct  340   GFSYHGGTYAKTKEAYRSFAMTSETGQLKALETLLEENQRVKQHGFFEGEFERAKKDIMA  399

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E +Y ++D+M+S  +  EY++H+L NEP+ GI +E    K  LP IS  EV+     +
Sbjct  400   RMEKSYKDKDKMESNRIVGEYVRHYLENEPMPGISWEYDFYKQQLPTISLKEVNALISDY  459

Query  1411  GTSSSCVIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                 + VI    P        T  +++S++  +N    K+++ P++++ + E +++  P+
Sbjct  460   IKEENRVIILTGPEKEGMTQVTEAEVKSLLDDVN----KRTLEPYEDKAVAESMITDMPT  515

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G +        +G     LSNG +V YK T+F +D++LF  FSYGG S   + E+ +  
Sbjct  516   AGTVTDYKVNDKLGTTTLTLSNGAKVTYKVTDFKNDEILFDAFSYGGSSLYTDEEHIATV  575

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
               +    E GV G+  + +  ML+GK   V  ++G Y    SG+ SP DLET  QLV+ L
Sbjct  576   NANGGLSEAGVNGFDINEMNKMLSGKIVNVRPRVGTYSEDISGNASPKDLETLFQLVH-L  634

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS----YFFRPIRIRD  2106
             + T++   EE     ++  +  +     +P T F+ ++ E  YG+S     F  P ++ +
Sbjct  635   YFTSLNKNEEAFGSYIEKQKSFLGNMMSNPQTYFSIKMGEFMYGDSPRYTGFPTPEKMDE  694

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD  2286
                   YK    +   F D   F    VGNI+      L  QYL  +P      ++   D
Sbjct  695   ADYDLAYKK---YQERFADAGDFHFYFVGNINEKELVELASQYLASLPGKGSNEMYEVSD  751

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF--PVELKS-EDMMEDVHFVGFLSKLLE  2457
                   F+ P +   E +     + + SV++ +  P E K+ ED   +      L ++L 
Sbjct  752   ------FR-PLTGQHEKIIEKGEDPKSSVRITYHGPTEYKAKEDFALET-----LGEILT  799

Query  2458  TKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGD---IGINFSCDPDISSTLVDLAL  2628
              K+V+ LR + G +Y  G      GN    + N+  D     I+F C P+    L   AL
Sbjct  800   IKLVEQLREEEGGVYGVGAR----GN----ISNMPYDWYSFNISFPCGPENVEKLKKAAL  851

Query  2629  DEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS  2760
              E+ +L  DGP+ +D+  V E     H+  ++EN +WL R L++
Sbjct  852   AEVQKLVTDGPTQKDLDKVKETYMLDHKEEMKENRFWL-RALKN  894



>ref|WP_007653940.1| peptidase M16 [Pontibacter sp. BAB1700]
 gb|EJF11011.1| peptidase m16 domain protein [Pontibacter sp. BAB1700]
Length=948

 Score =   412 bits (1060),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 260/873 (30%), Positives = 453/873 (52%), Gaps = 21/873 (2%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+L NGLTYY++ N  P+ RA L LAV AGS+LE++ ++G+AH  EH+AF+ T+ +
Sbjct  45    NVRTGKLANGLTYYIQKNGTPEKRAELRLAVNAGSILEDDSQQGLAHFTEHMAFNGTKNF  104

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               ++++ +L+S+G +FGA  NA T  DETVY L +P DKPE++ +++ IL +++  V   
Sbjct  105   KKNELINYLQSVGVKFGAHLNAYTGFDETVYILPIPTDKPEIIDKSLLILEDWAFNVTFE  164

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG ++EE R  + A  RM   ++ ++ + SKYA+RLPIG ++V++T   + ++
Sbjct  165   GEEIDKERGVIVEEKRSRQEAGMRMAYQYFPVLFKDSKYAQRLPIGTDEVLKTFKHEEIR  224

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
             +FYK WY    MAV+ V    D  ++ + IKA FG   +  +      + +PSH+E   +
Sbjct  225   RFYKDWYRPDLMAVVVV-GDIDVDAMEQKIKASFGKYKASANTKERKSFEIPSHKETLVA  283

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + EA    + +  K    +LKT+ D R+ LA  M+   LNQR  ++ ++ D P+   
Sbjct  284   IVRDKEATMPGLQLHYKKDAQKLKTLGDMRNKLARDMYNGMLNQRLSELQQQADAPFLFA  343

Query  1057  SAAADCL--VRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
             S +   L  +    AY    +  E G V  L ++  E  RV+ HGF++ E+   +  +++
Sbjct  344   STSYTSLQGLSAKDAYSSYLTTNETGVVRGLRTVAEENERVKRHGFTDSELIRYKTQMLA  403

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               E AY ER +  S    ++Y+ +FL N P  GIE++ +  K  L  I+ +EV++ + ++
Sbjct  404   SYERAYNERSKTNSGVYVNQYVANFLDNMPATGIEFQYEFIKKHLEGITLAEVNQLAAQW  463

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
              T  + V+    P          + VL I        + P++++     ++   P  G I
Sbjct  464   ITEDNRVVVITAPDKETVKLPTEAEVLAILKEASTADLQPYEDKMTATALMEETPKAGTI  523

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
              ++ + + +G  E  LSNG+RV  K T+F D+++L + +S+GG S   +++Y + +  S 
Sbjct  524   ARESKIEKLGVTELTLSNGVRVVLKPTDFKDNEILMSAYSHGGHSLYSDADYHTATFTSE  583

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             I    G+       L  ++AGK A V   +       SG  +P DLET LQL +  FT  
Sbjct  584   IVSRSGLKDMSAVDLRKVMAGKSANVSAFISELREGLSGMATPKDLETMLQLTHLKFTA-  642

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI-RIRDLQKVNPY  2127
                 E+D    +      +      P   F+++V  +   +      I  +  LQKVN  
Sbjct  643   PRKSEQDFQAFLTQYNGILPNLMASPQNYFSDQVARIMTQDHLRGGSIPTVEHLQKVNLD  702

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             +A E + + F D S FT V VGN D     P++  YLG +P  +       +++ K +  
Sbjct  703   RAYEIYQDRFGDASDFTFVFVGNFDVEQVKPMLQTYLGSLPSTNR------KENFKDVGK  756

Query  2308  KFPSSII-REVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
             + P  ++ +++V     + + +V + F  + K     E  + +  LS++++ ++ + LR 
Sbjct  757   RAPKGVVTKDLVKG--TDQKSNVMISFRDQTKYSK--EKSYHLAALSEVMKIRLTEKLRE  812

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             + G +Y   VS        SRV        I+F+C P+    LV    +EI +LQ+ G  
Sbjct  813   EIGGVYGTSVSA-----STSRVPYQNYAFNISFTCAPENVDKLVAATFEEIQKLQKSGAI  867

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             + D++ V E ++R+ E  ++EN  WL  +  +Y
Sbjct  868   EADLAKVKEADRRSIETSMRENRAWLSSLESAY  900



>ref|WP_014771850.1| peptidase M16 [Belliella baltica]
 ref|YP_006406607.1| putative Zn-dependent peptidase [Belliella baltica DSM 15883]
 gb|AFL83852.1| putative Zn-dependent peptidase [Belliella baltica DSM 15883]
Length=932

 Score =   409 bits (1051),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 263/874 (30%), Positives = 459/874 (53%), Gaps = 23/874 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYYV+ N KP+ +  L LAV AGS+LE++++ G+AH  EH+AF+ ++ + 
Sbjct  34    VRTGKLANGLTYYVQQNPKPEKKVELRLAVNAGSILEDDDQAGLAHFTEHMAFNGSKNFE  93

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG  FG+  NA T  DETVY L +P +  E+L +   +LA++++ V   +
Sbjct  94    KNELVSYLQSIGVSFGSDLNAYTGFDETVYILPIPSEDEEILRKGFLVLADWANGVLMED  153

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++ ERG ++EE+R  +  + R++D    +++  SKYA+RLPIG  +V+     + +++
Sbjct  154   EDIDGERGIIVEEWRTGQGYSQRIRDQFLPVLLHDSKYADRLPIGEMEVVENFEYETIRR  213

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAVIAVGD  D   +  +IK +FG   +P +  P   + VP H+E   + 
Sbjct  214   FYKDWYRPDLMAVIAVGD-EDPDKLEAMIKEYFGEMENPANAKPRESFPVPQHKETFVTI  272

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               ++EA G  + +  K P    +T +DY+  L  +++   LNQR  +I +K D P+    
Sbjct  273   ATDAEAPGIQLQLYYKHPALPSETKEDYKASLKRTLYSGMLNQRLDEIRQKPDAPFIYAG  332

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEA-LESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
                   VR +  Y   S+    G V+A L +++ E  RV  +GF+E E+  V+ ++++  
Sbjct  333   TGYGNFVREMD-YFSASAAVTPGKVDAGLTALILENERVAQYGFTEGELERVKKIILNSA  391

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E A  E D+ +S S+   Y+QH+L         ++ +  K +LP I+ +E++  ++    
Sbjct  392   ERASKEMDKAESGSIVGRYVQHYLSGSFAESQMWKYEFYKEILPQITVAEINALAKELVR  451

Query  1417  SSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
               + V+  I P +  A +     V+  IN  + K  I  ++E+ + EE++S  P+ G ++
Sbjct  452   DENRVVVIIAPEKEKANLPTEDGVLALINAVD-KMPITAYEEKLLAEELISDLPAAGKVL  510

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
              Q     VG  E  LSNG +V  K T+F +D++L +    GG S   E ++ + S    +
Sbjct  511   SQNTIDEVGVQELTLSNGAKVFVKVTDFKNDEILISASGKGGTSVYSEEDHLTASNAGVM  570

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
                +GV  + P+ L  +L+GK   +   +  Y +S SG  SP DLETA QL++ L+ T  
Sbjct  571   VNVMGVGEFSPTDLRKVLSGKTVSITPNISTYSQSISGIASPKDLETAFQLMH-LYFTKP  629

Query  1954  EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE-LNYGNSYFFRPIRIRDLQKVNPYK  2130
                 E   + +   +  + + + +P   F+ ++ + +  GN          D  KVN  +
Sbjct  630   RKDTELYQVYVSNQKSQLESAQANPDYQFSKQLNKIIANGNPRALGIFNPEDYDKVNVDR  689

Query  2131  ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFK  2310
               E F + F + + F     GNID  T  PL+ QY+G +P  +       +D+   L  +
Sbjct  690   GLEIFKDRFSNAANFEFFFTGNIDMDTFVPLLEQYIGSLPGDAS-----KKDNYVDLGIR  744

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
              P     ++      ++Q  +      E   +   +    +G+L ++L  K+++ LR + 
Sbjct  745   APRGQEEKIEVGTDEKSQVIMYFSGETEYDRKKAAD----IGYLGEILTIKLIENLREEI  800

Query  2491  GQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDE  2670
             G +Y  G    +G      VGN      I F C PD+   L + AL E+ ++QE+GP+++
Sbjct  801   GGVYGVGAGGSMG---IQPVGNF--SFSIQFPCSPDMVDRLSEAALAEVKKIQENGPTED  855

Query  2671  DVSTVLEIEQRAHENGLQENCYWLDRI--LRSYQ  2766
             D++ V E  + A+E  L+ N +W  ++  +R+Y+
Sbjct  856   DLNKVKEKRRIAYEENLKRNNFWNSQMSTVRNYE  889



>ref|WP_008509548.1| peptidase M16 [Mucilaginibacter paludis]
 gb|EHQ28671.1| peptidase M16 domain protein [Mucilaginibacter paludis DSM 18603]
Length=941

 Score =   409 bits (1051),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 266/936 (28%), Positives = 465/936 (50%), Gaps = 46/936 (5%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+L NG TYY+R N +PK R    LA + GS+LE ++++G+AH +EH++F+ T  +
Sbjct  32    AVRTGKLPNGFTYYIRHNEEPKNRVVFYLANKIGSILETDDQQGLAHFMEHMSFNGTTHF  91

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +++V +L+  G  FGA  NA TS DETVY+L +P DKPE+L   I I+ +++ E    
Sbjct  92    PKNELVDYLQKAGVRFGADINAYTSFDETVYQLPLPTDKPEVLQNGIQIMRDWAHEATLE  151

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG ++EE R  + A  RM+  +W  ++  S+YA R+PIG E+++++  P+ +K
Sbjct  152   PAEIDKERGVILEEKRLGKGAQERMRRQYWPALLNQSRYAVRIPIGTEEILKSFKPETIK  211

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              FY+ WY     A+I VGD  D   + + IK+ F   ++P        Y +P     +F 
Sbjct  212   SFYQDWYRPDLQALIVVGDI-DVNQMEQTIKSKFSDLSNPKAEKVRTKYTIPLTGLNQFQ  270

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + E   +   I  K     + T  DYR  +   +F   L +RF +++R+ DPP+   
Sbjct  271   AVTDPEMTSTVAQIIIKHKASTITTAADYRTAITNELFNQMLAERFSELARQADPPFLQG  330

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              AA D  +  +  +  + + K       L+++  E+ R +  GF+  E+   +    S++
Sbjct  331   GAAVDGFMGGLDDFSASVAVKPNTLERGLKNVWREIERAKRFGFTATELDRAKQNYQSQM  390

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             ESA  E+ +  S S   EYL +FL+ E   GI+ E Q+ K  LP IS ++++K  + +  
Sbjct  391   ESALKEKSKTGSESYVKEYLAYFLKGEAAPGIDVEYQIVKDALPKISLADIAKVMQTYIR  450

Query  1417  SSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
             + +  I  + P +  AT+ D  +++  + T E  + + P+ +E   + +++  PS G ++
Sbjct  451   ADNRDILIMAPEKDKATLPDEAAILGWLKTVE-AEDLAPYKDEVNNQALLAKAPSAGKVI  509

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
             +Q +  ++      LSNG++V  K T+F +D+++F+ F+ GG S   +++ F  +  + I
Sbjct  510   KQVKDDHLNITTLTLSNGVKVVLKPTDFKNDEIMFSSFAAGGTSLYSDAD-FQSAANAGI  568

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
                 G   Y  + L   L+GK+  V   +G   +  S   +  DLET LQL Y  F T  
Sbjct  569   IPSFGAGNYNTTELSKYLSGKQIGVQPYIGERSQGISARSTNKDLETCLQLAYA-FLTEP  627

Query  1954  EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRP-IRIRDLQKVNPYK  2130
                E     ++Q ++ A+  +  DP   F + V  +  GN    R    +  L++++  K
Sbjct  628   RKDESQFKSIIQRSKAALANRGNDPSNVFKDSVSAI-LGNYNVRRTGPTVAKLEQIDLDK  686

Query  2131  ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFK  2310
             A   +   F D S  T   VG+ D  T  PL+ +Y+  +     P  H N +  K L  +
Sbjct  687   AYRIYKERFADASGMTFTFVGSFDVETIKPLLEKYIALL-----PATHIN-EHAKDLGIR  740

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCF-------PVELKSEDMMEDVHFVGFLSKLLETKIV  2469
              P+  I + ++    E + +VQL F       P E K  D +++          LE +++
Sbjct  741   PPTGHIEKNIYK-GTEPKATVQLLFTGDFTYTPKERKQLDALKET---------LEIRLL  790

Query  2470  QVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQ  2649
             + LR     +Y    S F      +++ N R + GI F C P     LV  ALDE+ +L+
Sbjct  791   ERLREDESGVYTP--SAFAS---TAKLPNARYNFGIAFGCAPQNVDKLVASALDEVNKLK  845

Query  2650  EDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSK  2829
              DGP+  ++      + R  E  L+ N +W+  +    Q        G+     D   + 
Sbjct  846   TDGPAQVNIDKYKAEDARTRETNLKTNNWWMAYLNNQLQD-------GEPLNQLDNYSAN  898

Query  2830  VRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQAS  2937
             ++  + P + ++  Q+ L     K Y  ++L+PQ+S
Sbjct  899   IQS-IDPASLKLIAQKYL---SGKNYIRLVLLPQSS  930



>ref|WP_027885255.1| peptidase M16 [Mesonia mobilis]
Length=943

 Score =   409 bits (1051),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 263/889 (30%), Positives = 450/889 (51%), Gaps = 41/889 (5%)
 Frame = +1

Query  118   NVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAH  297
             N ++ E +   P  V  G L+NGLTYY+++N KP+ +  L L V AGS+LE+E++RG+AH
Sbjct  28    NQDLSEEIPFNP-EVKKGVLENGLTYYIKNNGKPEDKVELRLVVNAGSILEDEDQRGLAH  86

Query  298   IVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAI  477
              +EH+ F+ T+ +  +++V +L+SIG +FGA  NA TS DETVY L +P D PE L +  
Sbjct  87    FMEHMNFNGTKNFKKNELVDYLQSIGVKFGAHLNAYTSFDETVYILPIPSDDPEKLEKGF  146

Query  478   SILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGL  657
              I+ +++      + D+++ERG V+EEYR  + A  RM+  +   ++ GSKYA+RLPIG 
Sbjct  147   QIIEDWAHNALLEDKDIDEERGVVLEEYRLGQGAEQRMRQEYLPKILHGSKYADRLPIGT  206

Query  658   EKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppip  837
             ++ + T   + ++ FY  WY    M+V+AVGD  D + + + IK HF +  +P D     
Sbjct  207   KENLETFDYESIRSFYNDWYRPDLMSVMAVGDV-DVEVLEQKIKDHFAHIKNPKDERKRE  265

Query  838   YYLVPSHEEPRFSCFVESEA--AGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQR  1011
              + +P+HEE   +   + EA  A   V+   K  V+  +T++DYR+ + ES+F   +N R
Sbjct  266   SFELPNHEETLIAIESDEEATFANVQVLFKDKGNVEAEETLEDYRNSMVESLFAQMINNR  325

Query  1012  FFKISRKKDPPY-YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGF  1188
             F ++    +PP+ Y  S       R  +AY   + C     + AL ++L E  RV+ HGF
Sbjct  326   FDELRNSNNPPFVYGYSYHGGTWSRTKEAYQSFAMCDASKQLTALRALLEENERVKQHGF  385

Query  1189  SEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLP  1368
             ++ E+   +  +++ +E ++  + + +S+ +  EY+++FL NEP+ GI++E +  +  LP
Sbjct  386   TQSELERAKKDILARLEQSFKNKGKNESSRVVGEYIRNFLENEPMPGIDWEYKFHQEQLP  445

Query  1369  HISASEVSKYSERFGTSSSCVIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWD  1536
              I+  E++     +    + V+    P        T + +R++  +I    + + + P++
Sbjct  446   TINLKEINSLISGYIKDENRVVVLTGPEKDGVEQPTEEQVRALFKEI----ENKELEPYE  501

Query  1537  EENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYG  1716
             E  + E +++  P  G I +    + +G     LSNG  V YK T+F +D+VLF  FSYG
Sbjct  502   ETEVAESLMAKTPKKGSITKTETNKELGTTTLTLSNGATVTYKKTDFKNDEVLFEAFSYG  561

Query  1717  GLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCS  1896
             G S     +Y + +  +    E GV  +  + L  M++GK   V   +  Y   F G+ +
Sbjct  562   GTSLYSIEDYKATTFANGGLTEAGVNDFSKTDLSKMMSGKIVSVNPYISTYSEGFRGNAA  621

Query  1897  PSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS  2076
             P +LE   QL + L+ T +   EE  +  +   +  +      P   F   + E  YG+S
Sbjct  622   PKNLEELFQLTH-LYFTELNKDEEAFDSYVNKQKAFLGNLLASPQFYFQKELGEFIYGDS  680

Query  2077  YFFRPIRIRDLQKVNPYK-ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPR  2253
               +      +      Y  A + +   F D   F    VGNID A        YL  +P 
Sbjct  681   PRYTGFPTPEKMDAADYDLAYKKYQERFADAGDFHFYFVGNIDEAKLKDYAATYLASLPS  740

Query  2254  PSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFV  2433
                     N D+   +P   P S   E +     + + SV++ +    K     +D + +
Sbjct  741   K-------NSDESYEVPDFRPKSGSHEKIVEKGKDPKSSVRITYQGGAKYN--KKDAYAL  791

Query  2434  GFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG------DIGINFSCDP  2595
               L ++L  K+V+ LR + G +Y  G             GNI        +  I+F C P
Sbjct  792   KTLGEILTIKLVEKLREEEGGVYGVGAR-----------GNISKTPYGWYNFTISFPCGP  840

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             +    L + A+ E+ +L  +GP+++D+  V E +   H+  L+EN +WL
Sbjct  841   ENVDKLKNAAIKEVEKLVAEGPTEKDLQKVKETQLLEHKESLKENRFWL  889



>ref|WP_020889274.1| putative zinc protease pqqL [Cyclobacterium qasimii]
 gb|EPR65501.1| putative zinc protease pqqL [Cyclobacterium qasimii M12-11B]
Length=937

 Score =   408 bits (1049),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 256/862 (30%), Positives = 436/862 (51%), Gaps = 19/862 (2%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L+NGL YY++ N KP+ +  L LA++AG++ E + + G+AH +EH+AF+ +E + 
Sbjct  36    VRTGQLENGLEYYIQYNPKPENKLELRLAIKAGAMQENDNQLGLAHFLEHMAFNGSEHFE  95

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +D++ +L+SIG  FG+  NA TS DETVY L +P D+ E L+    ++ +++  +  + 
Sbjct  96    KNDLISYLQSIGVAFGSDLNAYTSFDETVYMLPIPTDEEEKLNNGFQVMRDWAGGLLLAS  155

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+E ERG V+EE+R  +  N R++DA+  +++  S+YA+R+PIG   +IR  +  +V+Q
Sbjct  156   DDIEAERGIVVEEWRTGQGVNQRLRDAYLPVLLHQSRYADRMPIGEMDIIRNAADSLVRQ  215

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+AVGD  D   V ELIK++F    +P +     YY VP+H+E     
Sbjct  216   FYQDWYRPDLMAVVAVGDV-DPDKVEELIKSYFSDLKNPLNARKREYYNVPTHKENFVKI  274

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EA G  V +  K       + KDY+  +  +MF   + QR  +I +K D P+    
Sbjct  275   ITDEEAPGIQVQLYYKQDARPSNSYKDYKGRILRTMFGGMITQRLDEIRQKPDAPFIFAG  334

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A    LVRP+  + ++         +   + LTE  RV  +GF++ E+  V+  L++  E
Sbjct  335   ARYGNLVRPLDFFTISGVVGPGKLKDGFLAFLTENQRVVDYGFTQSELDRVKRSLLNSSE  394

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              ++ E D+++S +L   Y+ HFL N    G E      + ++P I+  EV+  +      
Sbjct  395   KSFKEMDKVESRTLVGRYVSHFLNNSFADGPESRYDFYQDIIPKITLEEVNDIARELIRK  454

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
              + V+    P          + +L +          P+ E+ + EE++  KP  G ++  
Sbjct  455   ENIVLIVTAPEKDKETLTPEAELLALLENADAIETTPYKEDLVREELMLTKPKSGEVVNV  514

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
                + V      L NGM+V +K T+F +D+++F+  S GG S     +++S +   +   
Sbjct  515   SHDEEVDVTTVLLGNGMKVYFKPTDFKNDEIIFSASSEGGTSLYSLEDHYSANYAGSAIN  574

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT-NVE  1956
              +G+  + PS L  +LAGK  +V   +  Y  S SG  +P D E ALQL++  FT+  ++
Sbjct  575   IMGIGDFTPSQLKKVLAGKNVQVTPNISTYSESISGATTPGDFEMALQLIHLYFTSPRMD  634

Query  1957  PGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE-LNYGNSYFFRPIRIRDLQKVNPYKA  2133
                 +V +  Q  +  + +   +P   F  RV E ++ GN           L  ++  K+
Sbjct  635   KSLWEVFLANQ--KNQLESASVNPDFQFNKRVNEIISNGNPRGKGIYTAGQLDSIDLSKS  692

Query  2134  CEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKF  2313
              + +   F +   F V+  GNID     PL+ QYLG +P  S       ++D   L    
Sbjct  693   LKIYKERFANAGDFNVLFTGNIDREKMLPLVAQYLGSLPGDST-----GKEDFIDLGLTP  747

Query  2314  PSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYG  2493
             P    R+      V+ +  V L F  E   +  +E    + +L ++L  K+++ LR + G
Sbjct  748   PQD--RKENIKVGVDDKSQVILYFSGETAYD--LEKSQQLSYLGEILTIKLIETLREEIG  803

Query  2494  QIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDED  2673
              +Y  G    L     SRV   R +  I+F C P+    L     ++I ++QE+GP + D
Sbjct  804   GVYGVGARGSL-----SRVPEERFNFSISFPCGPESVDKLKAAVWEQIQKIQEEGPDEAD  858

Query  2674  VSTVLEIEQRAHENGLQENCYW  2739
             +  V E ++   E  L+ N +W
Sbjct  859   LEKVRETKRLDLEENLKRNGFW  880



>ref|WP_020606917.1| peptidase M16 [Spirosoma spitsbergense]
Length=957

 Score =   407 bits (1046),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 279/930 (30%), Positives = 472/930 (51%), Gaps = 37/930 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G L NGLTYY+R N++PK RA L L +RAGSVLE + ++G+AH +EH+ F+ T+ +
Sbjct  58    AVKVGVLSNGLTYYIRKNAEPKNRAELRLVIRAGSVLENDNQQGLAHFMEHMEFNGTKNF  117

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +++V FL+S G  FGA  NA T  DETVY+L VP D   +   A  IL +++      
Sbjct  118   PKNELVNFLQSAGVRFGADLNAYTGFDETVYQLPVPTDSANVFKGAFQILEDWAHNATLD  177

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG V+EE R  R A  RM+D ++  ++  S+YA+RLPIG E+V+ T  P  ++
Sbjct  178   PTEIDKERGVVLEERRLGRGAGQRMRDKYFPALLNDSQYAKRLPIGTEQVLTTFKPATLE  237

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
             QFYK WY    MAVIAVGDF D + V  +I+  FG   +   P P   Y +P H++ +  
Sbjct  238   QFYKDWYRPDLMAVIAVGDF-DIKEVEGIIQDKFGRIPATKSPKPRTEYEIPPHKDTKVV  296

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + E   + V +  K P  + KT+ D R+ +   +F   L  R  +++++ DPP+   
Sbjct  297   IVTDPEQPNTVVQVIYKRPEIKEKTLNDLRESIKRGLFNTMLGNRIQELTQQADPPFLGG  356

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              +     +  + A+   +  KE     A++++L E ARV+  GF+  E+S  R   M+ +
Sbjct  357   YSNYSDFLGNLDAFTSIAIAKEGNVERAIKAVLDENARVKQFGFTPTELSRARQEFMTSV  416

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E AY ER++ +S +  +EY+Q+F   EP   IE+     K  L  I   EV+   + F  
Sbjct  417   EQAYSERNKTRSVNFVNEYVQNFTDKEPYTSIEFYYSFLKKELDGIKLPEVNALVDLFIH  476

Query  1417  SSSCVIKTIEPRATATVDDLRSVVLK-INTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
             + +  +  + P          + +L  +N  +  + +  ++++ +   ++  +P+   ++
Sbjct  477   NDNRAVIVLAPEKDKDKLPTETQILSYVN--DAGKGLTAYEDKTLDSPLLVKEPTGSPVV  534

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
             ++ + +++G  E+ L NG+R+  K T+F +DQ+LF+  S+GG S     ++ S    ST+
Sbjct  535   EEKKIKDIGVTEWTLKNGVRIVVKPTDFKNDQILFSASSFGGSSLYDLKDFPSARFASTL  594

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
             A   G   Y    L   L+GK+  V   +G       G  +P DLETALQL+Y  FT   
Sbjct  595   AAMGGTGAYNQIQLGKFLSGKQVSVYPFVGELNEGIGGSAAPKDLETALQLIYSYFT---  651

Query  1954  EPGEEDVNIVMQMAEEAIHAQER----DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVN  2121
             +P ++   I   ++ +    Q R     P   F + V      N+   +P++  DL K++
Sbjct  652   QPRKDADVIKGFLSNQRSALQNRINTPTPQQVFQDTVTVTLGSNNPRRQPLKPADLDKID  711

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               +A + +   F +   FT   VGNID  T  PL+ +YLGG+P          ++  K L
Sbjct  712   LDRALQIYQERFANAGDFTFFFVGNIDEKTLKPLVEKYLGGLPATD------TKEKFKDL  765

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
               + P   + + V+  + + + SVQL +  ++      E    +  L+++LE K+++ LR
Sbjct  766   GIRAPKGEVSKTVYKGL-DPKASVQLIYSGDITWSP--ETTTQLDALAEVLEIKLIEKLR  822

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              +   +Y  GVS        ++    R    INF C P+    L+    + I  L++ G 
Sbjct  823   EEESGVY--GVS---ANGAYAKYPVPRYTFRINFGCAPENVDKLIAKTQELITDLKQKGA  877

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKL  2841
                D++      +R  E  L++N +WL  +    Q++ Y+GD  D    +D   +++ K+
Sbjct  878   LPADIAKFKAETRRETELQLKDNQFWLGYL----QNQYYNGDAPDEVLHED---AQLAKV  930

Query  2842  LTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
                 T + A Q   P      Y  ++LMP+
Sbjct  931   TVESTKEAANQYFGP-----NYIRLVLMPE  955



>ref|WP_013870505.1| peptidase M16 [Lacinutrix sp. 5H-3-7-4]
 ref|YP_004580154.1| peptidase M16 domain-containing protein [Lacinutrix sp. 5H-3-7-4]
 gb|AEH01726.1| peptidase M16 domain protein [Lacinutrix sp. 5H-3-7-4]
Length=949

 Score =   407 bits (1045),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 272/925 (29%), Positives = 470/925 (51%), Gaps = 63/925 (7%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY+++N KP+ +  L L + AGS+LE+E++ G+AH +EH+ F+ T+ + 
Sbjct  48    VKTGVLSNGLTYYIKNNGKPENKVELRLVINAGSILEDEDQLGLAHFMEHMNFNGTKNFK  107

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P + PE L +   IL +++     +E
Sbjct  108   KNELVDYLQSIGVKFGAHLNAYTSFDETVYILPIPSEDPEKLEKGFQILEDWAHNALLTE  167

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++ ERG V+EE R  + AN RM   +   +M GS+YA+RLPIG ++ I   + + +++
Sbjct  168   EEIDNERGVVLEELRLGKGANERMMQRYLPKLMYGSQYAKRLPIGTQESIENFTYESLRR  227

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    M+V+AVGD  D  ++ E IK HFG       P     + VP+H+E   + 
Sbjct  228   FYKDWYRPDLMSVMAVGDV-DVATLEEKIKTHFGRIAPAKSPRKRDVFYVPNHDETFVAI  286

Query  880   FVESEAAGSAVMI----SCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY  1047
               + EA+ S V +    S    V+E  TV+DYR  +A+S+F   +N R  ++   ++PP+
Sbjct  287   ESDKEASFSQVQVMFKDSNNAKVEE--TVEDYRKSMAKSLFSQMINTRLGELRNSENPPF  344

Query  1048  -YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALL  1224
              +  S       R   AY   +   E   ++AL+++L E  RV+ +GF + E    +  +
Sbjct  345   VFGSSFYGGTWARTKNAYQSFAMTSETDQLKALKALLEENERVKRYGFQQGEFERAKKRM  404

Query  1225  MSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSE  1404
             ++ +E ++ ++D+M+S  +  EY++HFL  E + GI +E  + K  LP+I+  EV+   +
Sbjct  405   LASMEKSFKDKDKMESNRIIGEYVRHFLEGEVMPGITWEYNMYKNELPNITLEEVNGLIK  464

Query  1405  RFGTSSSCVIKTIEPRATATVDDLRSVV-LKINTF---EQKQSIPPWDEENIPEEIVSVK  1572
              +    + VI    P      +DL  V   ++ T     +   I P+++E +   ++S  
Sbjct  465   NYLRDDNRVIVITGPEK----EDLEKVTEAQVKTLLNGLKDADIKPYEDEAVASSLISKL  520

Query  1573  PSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFS  1752
             P  G I    + + +G     LSNG  V YK T+F +D+++F  FS+GG S   +++Y +
Sbjct  521   PPKGSITNTVKDEKLGTTTLTLSNGATVTYKKTDFKNDEIMFEAFSFGGNSLYTDADYKA  580

Query  1753  CSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVY  1932
              +  +    E GV G+  + L  ML+GK   V   +G Y  +F G  +P DLE   QL +
Sbjct  581   TNFANGGLAEAGVNGFDKTQLSKMLSGKIVNVRPSIGTYSENFRGSSTPKDLEELFQLTH  640

Query  1933  QLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQ  2112
               FT  +   E+  N  +   +  I     +P T F+  + +  YG S      R     
Sbjct  641   LYFTA-LNKDEKAYNSYINKQKAFIGNMLSNPQTFFSIEMGKFMYGKS-----PRYMGFP  694

Query  2113  KVNPYKACEY------FNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILH  2274
                 + A +Y      +   F D   F    VGNID A       +YL  +P        
Sbjct  695   TPEAFDAADYDLAYKKYKERFADAGDFKFYFVGNIDEAKIKAFSEKYLASLPTN------  748

Query  2275  FNRDDLKGLPFKFPSSIIREVV--HSPMVEA----QCSVQLCF--PVELKSEDMMEDVHF  2430
              N ++      K+  +  R +   H+ +VE     + SV++ +  P    +    ++ H 
Sbjct  749   -NSNE------KYKVTDFRPLTGQHTKIVEKGTDEKSSVRITYHGPTTYNA----KEAHA  797

Query  2431  VGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISST  2610
             +  L ++L  K+V+ LR + G +Y AG    +     S++     +  I+F C P+    
Sbjct  798   LTSLGEILTIKLVEKLREEEGGVYGAGARGSI-----SKMPYGWFNFNISFPCGPENVEK  852

Query  2611  LVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS-YQSRIYSGD  2787
             L + AL E+ +L ++GP+++D++ V E +    +  L++N +W++ I  + YQ +    D
Sbjct  853   LKNAALAEVDKLIKNGPTEKDLAKVKEAQLLERKEQLKQNRFWINLIKNADYQDK----D  908

Query  2788  VGDSFKVQDEARSKVRKLLTPLTAQ  2862
                 F  +D+  +  ++ L  +  +
Sbjct  909   AKRIFTFEDDVNNLTKEFLQTIAKK  933



>emb|CEA16650.1| hypothetical protein ING2E5B_1913 [Porphyromonadaceae bacterium 
ING2-E5B]
Length=936

 Score =   407 bits (1045),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 285/957 (30%), Positives = 473/957 (49%), Gaps = 51/957 (5%)
 Frame = +1

Query  94    RFRSLKLVNVNMEEALSQTPY-----GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAG  258
             +F +L L+  +M     Q P       V  G+L+NGLTYYVR N +P+ RA   +A + G
Sbjct  3     KFLTLLLLVTSMVTLAQQNPTLPVDPNVRTGKLENGLTYYVRHNGQPENRADFYIAQKVG  62

Query  259   SVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF  438
             S+ EE+ + G+AH +EH+AF+ TE +    ++ +L+  G +FG   NA TS DETVY L 
Sbjct  63    SMQEEDNQAGLAHFLEHMAFNGTENFPGKSMLNYLQDNGIKFGTNINAYTSFDETVYFLT  122

Query  439   -VPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLM  615
              +P     L+  A+ +L ++++ +   E +LE ERG + EE+R    A  R+ D     M
Sbjct  123   DIPTTNRNLMDSALLVLHDWANAIALEEEELESERGVIREEWRTRGGAQQRLWDQLLPEM  182

Query  616   MEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAH  795
               GSKYA+R+PIG   VI    P+ ++ +Y KWY      +I VGDF D   + + I   
Sbjct  183   FPGSKYAKRMPIGSIDVINNFKPEEIRAYYHKWYRPDLQGIIVVGDF-DVDEMEKKIIDL  241

Query  796   FGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCK---MPVDELKTVK---  957
             F       +     YY VP ++EP F+   ++EA  +++M+  K   MP DELK  +   
Sbjct  242   FSPIKLDEEVAEREYYPVPDNKEPIFALATDNEARNTSIMMFYKHDPMP-DELKNTQAGY  300

Query  958   --DYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSA-AADCLVRPVK-AYIMTSSCKEK  1125
                Y    A SM    +NQRF +I +K D P+ S  A   D  V   K A+ + +   E 
Sbjct  301   LTQYIMNAAASM----MNQRFSEILQKPDAPFTSAYAYDGDFFVAKTKDAWTVVAGSSED  356

Query  1126  GTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHF  1305
                EAL +M+ E  R R HGF+  E  + R  ++  +E +Y  RD+ +++   +EY+  F
Sbjct  357   KIKEALAAMIRETERARQHGFTAAEYDIARTNILKSVEDSYNNRDKQRNSRYSEEYVMAF  416

Query  1306  LRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATV----DD  1473
             +  EP+ GIE+E Q  + + P+I    ++   ++  +  + V+    P+    V    ++
Sbjct  417   VDGEPIPGIEFEYQFLQAVAPNIPVEAINMTIKQLISDDNIVVAITGPKKEGLVYPTKEE  476

Query  1474  LRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMR  1653
             L SV+  +    + ++I  +  + I E +VS  P PG I+   + + +GA  + L NG++
Sbjct  477   LNSVLTSV----KAETIEAYVGDVIDEPLVSNIPEPGKIVSTEKDEELGATVWTLENGIK  532

Query  1654  VCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAG  1833
             V  K T+F +D++L TG S GG S   E +  +  + S ++   GV  +  + L  +LAG
Sbjct  533   VILKNTDFKNDEILLTGTSAGGYSHFAEKDPVNSKVLSAVSTLGGVGNFSATDLPKVLAG  592

Query  1834  KRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHA  2013
             K A     +    + F+G  S  D ET +QLVY L+ T+    ++     +Q  E  +  
Sbjct  593   KTASARPSVSLTTQDFNGSSSIKDFETMIQLVY-LYFTSPRKDQDAYQSYIQRMETQLRN  651

Query  2014  QERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVG  2193
             QE +P  AF++ +    YGN+   + I+  DLQK++  +  E +   F +P +FT  +VG
Sbjct  652   QEAEPMVAFSDSINAAIYGNNPLVQRIKTEDLQKLDYDRMMEMYKQLFSNPGSFTFTLVG  711

Query  2194  NIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSV  2373
             NI+     P+I +YL  +P  SE      + D   +P  F       +    M+  + SV
Sbjct  712   NINEDEVRPVIERYLASLPAKSE------KADFVKVPMNFVEGNSENIFRREMLNPKASV  765

Query  2374  QLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVG  2553
                    LK +  M++   +    ++L+    + +R + G  Y     V+ GG+  SR  
Sbjct  766   FNSITGNLKRD--MQNQILMSMFDQILDIVYTEKIREEEGGTY----GVYSGGSI-SRYP  818

Query  2554  NIRGDIGINFSCDPDISST--LVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQE  2727
               +  + I F  DPD      L  + LDE+  +  +GP + D S V E   +++   L+E
Sbjct  819   EGQSMLQITFDTDPDTDRMRHLNKIVLDELENIATNGPRESDFSKVKEYMNKSYNENLKE  878

Query  2728  NCYWLDRILRSYQSRIYSGDVGDSF--KVQDEARSKVRKLLTPLTAQMALQRILPFP  2892
             N YWL+ +   Y    Y  D+   +   +    R+ ++  +     Q  ++ I+  P
Sbjct  879   NRYWLNILDNKY---FYGEDMHTKYLDTLNSITRTDIQNFVANFLKQGNVKTIVMLP  932



>ref|WP_019596147.1| hypothetical protein [Rhodonellum psychrophilum]
 gb|ERM83612.1| hypothetical protein P872_03030 [Rhodonellum psychrophilum GCM71 
= DSM 17998]
Length=937

 Score =   405 bits (1042),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 275/926 (30%), Positives = 469/926 (51%), Gaps = 34/926 (4%)
 Frame = +1

Query  121   VNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             ++++E +   P  V  G+LDNGLTYY++ N +P+ +  L LA+ AGS+LEE++++G+AH 
Sbjct  24    ISLDEKVPLDPR-VKVGKLDNGLTYYIQYNPRPENKVELRLAINAGSILEEDDQQGLAHF  82

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAIS  480
             VEH+AF+ T  +  +++V +L+SIG  FGA  NA T  DETVY L +P +    L     
Sbjct  83    VEHMAFNGTRNFEKNELVNYLQSIGVSFGADLNAYTGFDETVYILPIPSENEATLRNGFK  142

Query  481   ILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLE  660
             +L++++  V   + D++ ERG ++EE+R     + RMQD +  +++  SKYAERLPIG  
Sbjct  143   VLSDWAGGVLMKDEDIDAERGIIVEEWRTGEGYSKRMQDQYLPVILHNSKYAERLPIGKM  202

Query  661   KVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY  840
             +++     + ++ FY+ WY   NMAVIAVGD  D + +  L+K HF    +P +      
Sbjct  203   EIVENFDYESLRNFYRDWYRPDNMAVIAVGDV-DPEKLEALVKEHFSDLKNPENAKERKS  261

Query  841   YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFK  1020
             + VP H+E   S   + EA G  +    K      +T +DYR+LL  +++   L QR  +
Sbjct  262   FEVPKHQETFVSVVTDQEAPGIQLQFFYKHKALPTETKEDYRNLLIRTLYGGMLTQRLDE  321

Query  1021  ISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSER  1197
             I +K   P+          VR +  Y   S+    G +E  L+S+L E  RV   GF+E 
Sbjct  322   IRQKPGAPFVFAGTGYGNFVRDLD-YFSASAVVASGKIETGLQSLLLENERVARFGFTEP  380

Query  1198  EISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHIS  1377
             E+  V+  +++  E ++ E D+ +S S+   Y+ HFL      G +++ +  + ++P I+
Sbjct  381   ELDRVKKSVLNSAERSFNEMDKAESRSIVGRYVNHFLGGRFADGEKWKHEFYQEIIPQIT  440

Query  1378  ASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEE  1557
              SEV+  + +   + + V+    P          + VL +       S+ P+ ++ + E 
Sbjct  441   LSEVNALAGQLVRNENRVVIITAPEGEKENIPSETAVLALMEEIADTSLEPYADKALAEN  500

Query  1558  IVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPE  1737
             ++   P P  +++     ++G       NG +V  K T+F +D+++F     GG+S  P+
Sbjct  501   LMEELPIPVSVLETETIASIGLTTLTFPNGAKVFVKPTDFKNDEIIFLAKGDGGVSLYPD  560

Query  1738  SEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETA  1917
              +++S S    +   +GV  + PS L  +LAGK   +   +  Y +  SG  SP DLET 
Sbjct  561   EDHYSASYAGVLVNIMGVGSFSPSDLRKVLAGKTVSLTPNVLTYSQEISGATSPKDLETT  620

Query  1918  LQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRV-RELNYGNSYFFRPI  2094
             LQL++ L+ T     +E   + M   +  + +   +P   F+  + R +  GN       
Sbjct  621   LQLLH-LYFTQPRKDQELFEVYMANQKAQLASALSNPDYQFSKALNRIIADGNLRAMGIY  679

Query  2095  RIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILH  2274
                DL  ++  +  E +   F +   F   I GN+D     PL+ QY+G +P   +    
Sbjct  680   DPEDLVNIDLDRGLEIYAERFANAGNFEFFITGNVDLEGITPLLEQYIGSLPGSPD----  735

Query  2275  FNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLL  2454
               ++  K L  + P    +E+V    V+ +  V L F  E+   D  +   F G+L ++L
Sbjct  736   -QKEAYKDLGIRAPRG-QKEIVEVG-VDQKSQVILYFSGEIPY-DRKKAADF-GYLGEIL  790

Query  2455  ETKIVQVLRFKYGQIYNAGVSVFLGGNKPSR-VGNIRGDIGINFSCDPDISSTLVDLALD  2631
               K+++ LR + G +Y  G +    G+  SR VGN      ++F C P+   +L++    
Sbjct  791   TIKLIESLREEIGGVYGVGAN----GSLSSRPVGNF--SFSVSFPCSPEKVESLIEATWI  844

Query  2632  EILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI--LRSYQSRIYSGDVGDSFK  2805
             EI ++QE+GPS ED++ V E  + A E  L+ N YW  ++  +R+Y         G S+ 
Sbjct  845   EIQKIQENGPSIEDLNKVKEKRRIALEENLKRNSYWNAQLSAIRTY---------GLSWD  895

Query  2806  VQDEARSKVRKLLTPLTAQMALQRIL  2883
             V  EA   +   +TP   Q A +  L
Sbjct  896   VILEAEKSIDS-VTPERIQSAAKEFL  920



>ref|WP_037321148.1| peptidase M16 [Salegentibacter sp. Hel_I_6]
Length=943

 Score =   405 bits (1041),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 262/870 (30%), Positives = 446/870 (51%), Gaps = 24/870 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+LDNGLTYY+R+N +P+ +  L L + AGS+LE E+++G+AH VEH+ F+ TE + 
Sbjct  33    VKMGKLDNGLTYYIRNNERPEDKLELRLVINAGSILENEDQQGLAHFVEHMNFNGTENFE  92

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P D  E L+    IL +++ +   ++
Sbjct  93    KNELVDYLQSIGVKFGADLNAYTSFDETVYILPIPSDDEETLNTGFQILEDWAHKATMTD  152

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+++ERG VMEEYR     + RM   +   +M  S YA+RLPIG ++VI+    + ++ 
Sbjct  153   EDIDEERGVVMEEYRLGLGPDKRMMQEYLPKVMYNSHYADRLPIGKKEVIQEADYETIRN  212

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+AVGD  D +++ + IK HF       +P     Y +P+HEE   S 
Sbjct  213   FYKDWYRPDLMAVVAVGDL-DVETIEKKIKEHFSNLKPVENPRERKTYDLPNHEETFVSI  271

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA  S V +  K     +++ T +DY D + +S+F   +N R  +++   +PP+ Y
Sbjct  272   ASDEEAPFSQVRVYYKDHEESEDVVTKQDYIDQMEKSLFSTMINNRLSELTNSSNPPFNY  331

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S       R   AY   +   E   +E+L+++L E  RV+ HGF+E E    ++  ++
Sbjct  332   GYSYYGGTFARNKNAYQSFAMTGEDQQLESLKALLEENERVKRHGFTESEFKRAKSEYLA  391

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E  Y +RD+ +S  L  +Y+ HFL N P+ G E+     +  L  I  +E++     F
Sbjct  392   RLEQQYKDRDKQESGRLVSQYVSHFLENSPIPGTEWRYNFAQENLEGIDLNEINGLISEF  451

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
                 + VI    P+           V+ +    +   I  ++EE + +E+++  P+ G +
Sbjct  452   LHEDNRVIVLTGPKKEGLEPVKEEEVMALLDEIKSSEIASYEEEALRDELITKMPNAGSV  511

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
             ++      VG     LSNG  V YK T+F +D++LF+  S GG S   + +Y + S+ ++
Sbjct  512   VETETNDEVGFTRLKLSNGAEVVYKKTDFKNDEILFSAKSMGGTSLYSDEDYLNTSLANS  571

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
                + G+     + L  M++GK  +V   + +Y   FSG  +P DLET  Q+V+ L+ T+
Sbjct  572   GLSQAGIADLSVNDLNKMMSGKIVQVRPDISSYTEGFSGSSTPKDLETLFQMVH-LYFTD  630

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYF--FRPIRIRDLQKVN  2121
             +   EE     +   +  +     +P   F N + +  N GNS +  F      D Q  +
Sbjct  631   LNKDEEAYTAFVNKQKAFLGNLMSNPNFYFQNELGKFRNEGNSRYVGFPTPEKYDSQDYD  690

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
                A + +   F +   FT   VGNID          Y+  +P   E      +++ K  
Sbjct  691   L--AYKKYQERFANAGDFTFYFVGNIDEDKVKQFASIYIASLPSSEE------KEEFKVP  742

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
              F+  +S  ++VV+    + +  V + +  E   +   E+   +  L ++L  K+V+ LR
Sbjct  743   EFRTATSGDKKVVYKG-TDPKSMVNILWNGETNYK--AEEDFTMKALGEILTIKLVEQLR  799

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              +   +Y  G    L     S++        I+F C P+   +L + AL E+ +++E+GP
Sbjct  800   EEEAGVYGVGARGNL-----SKIPYGSYSFNISFPCGPENVESLTEAALAEVEKIKENGP  854

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             +D+D+  + E      ++ LQEN +WL ++
Sbjct  855   TDKDLEKIKETFLVQRKDQLQENRFWLSQL  884



>ref|WP_034779297.1| peptidase M16 [Janthinobacterium lividum]
 gb|KHA80014.1| peptidase M16 [Janthinobacterium lividum]
Length=944

 Score =   404 bits (1038),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 269/930 (29%), Positives = 461/930 (50%), Gaps = 35/930 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N++P  +  L L V+AGS+LE+++++G+AH  EH+AF+ +  + 
Sbjct  37    VTVGKLPNGLTYYIKKNARPAQKVELRLVVKAGSILEDDDQQGLAHFTEHMAFNGSTHFK  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++++ +L+SIG +FGA  NA TS DETVY L +P +K E L +   +L +++  ++ + 
Sbjct  97    RNELISYLQSIGVKFGADLNAYTSFDETVYVLPIPTNKKENLEKGFLVLEDWAHGLKFNP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+  ERG V+EE R  + A+ RM    +  ++ GS+YAER+PIG E V++T  P+ +K+
Sbjct  157   ADINSERGIVLEEARLGKGASDRMNKILYPKLLNGSRYAERMPIGKESVLKTFKPEAIKR  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+ VGD    Q+  +LI+ HFG   +P  P P  Y  VP   +     
Sbjct  217   FYKDWYRPDLMAVMVVGDVEPKQA-EKLIQQHFGKLKNPVKPRPRLYAEVPQRSQTEALV  275

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA    V I   +    E  T+ DYR  + E+++   L+ R  +++++ +PP+   
Sbjct  276   ITDKEAPDDTVFIRYPIRAAQEPVTIADYRRQMIENLYGQMLSARMQELTQQANPPFIQG  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              ++   LVR  +++   +   + G   A+++++ E  R R  GFS+ E+   R  ++   
Sbjct  336   GSSMGKLVRGYESFSAYALLGKGGVQPAVDALVQEDERARRFGFSQDELDRARKNMLRNY  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E AY ERD+  S     EY ++FL  E + GI  E    + LLP ++  E+++   +   
Sbjct  396   ERAYSERDKSDSAGFVAEYSRNFLEQEAIPGIANELLYAQELLPQVTLQEINETVAKVIP  455

Query  1411  -GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
                    V    EP+A A+V   + ++  +   EQ Q+I P  E+ +  +++   P+ G 
Sbjct  456   DQQKKLVVFMGAEPKAGASVPTQQQLLDAVAKAEQ-QTIEPRTEKVLASKLMDGPPAGGS  514

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I  +     +G  E  L NG+RV  K T+F +DQVL     +GG S   +++ ++    S
Sbjct  515   IASEKLNSAIGVTELTLGNGVRVLLKPTDFKNDQVLMGSTRFGGQSLFGDADIYNARYAS  574

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
              + G +G+    P  L  +LAGK   VG  LG     F G  S +D+E  LQLVY L+  
Sbjct  575   AVVGSMGLKDLAPLDLQKVLAGKTVNVGASLGELSEGFGGSASSADVEAMLQLVY-LYFN  633

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI-RIRDLQKVNP  2124
             +V          +   ++        P   F + ++   +G++     + R+ D  KV  
Sbjct  634   DVRKDAGLYQSFIGKQQDLAKNSMAQPEAVFYDAIQHAMFGDNPRVDGVPRVADFDKVGL  693

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              ++ E F   F      T +  G+ +     PLI  YLG +P    P  H  RD    + 
Sbjct  694   DRSLEIFRQRFSSARGMTFIFTGSFELDKIKPLIASYLGTLPVADVP--HAYRD----VG  747

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              +  + I+++ ++    E + ++ + F  ++   D  E    +  L ++L  K+++VLR 
Sbjct  748   MRPVTGIVKKDIYMGS-EPKSTISITFNGDVAYSD--EQKLTLQALGEVLNLKVIEVLRE  804

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             K   IY  G    +G +           + +N    P+    ++  A  EI +++ DGPS
Sbjct  805   KMSMIYGGGFETSMGQHPYGHY-----SVALNLPTGPENVDKVIAAAFAEINKMKTDGPS  859

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSY-QSRIYSGDVGDSFKVQDEARSKVRKL  2841
               D+  V        +  L+EN YW+++++ S  Q R    D     + +   R+     
Sbjct  860   AADLEKVKLNWITRQQKSLRENNYWMNQLMGSVTQGR----DPAHILRYEQRVRA-----  910

Query  2842  LTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             +TP   ++A QR L       Y  V+L P+
Sbjct  911   ITPQAVKLAAQRYLDM---HNYVQVVLYPE  937



>ref|WP_036678440.1| peptidase M16 [Pedobacter oryzae]
Length=905

 Score =   402 bits (1033),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 256/873 (29%), Positives = 449/873 (51%), Gaps = 28/873 (3%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NG TYY+R N++PK RA L LA + GS+LE +E++G+AH +EH++F+ T+ +  +D
Sbjct  10    GKLSNGFTYYIRRNTEPKERAQLYLANKVGSILETDEQQGLAHFLEHMSFNGTKNFPKND  69

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             +V +L+  G  FGA  NA TS DETVY+L +P D PE+    + I+ +++ +V   E ++
Sbjct  70    LVNYLQKAGVRFGADLNAYTSFDETVYQLPIPTDDPEVFKNGLQIMRDWAQDVTLEESEI  129

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG V+EE R  + A  RMQD +  ++   S+Y+ RLPIG E V++    + +++FY 
Sbjct  130   DKERGVVIEEKRLGKGAQQRMQDKYLPMLFNNSRYSSRLPIGTEDVLKNFKYETLRKFYT  189

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY     ++I VGD  +   V ++IK  F    +P  P P   Y +P   + +F    +
Sbjct  190   DWYRPDLQSLIVVGDV-NIAEVEQMIKNKFSDLKNPDKPTPRTQYSIPLTGKNQFVAVTD  248

Query  889   SEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAA  1068
              E   +   I  K P   +KT  D R+ +  S++      RF +++++ +PPY    ++ 
Sbjct  249   KEFPVTVAQIIIKHPETVVKTTADLRNNMIRSLYNQMTAARFSELTKQANPPYLQGGSSI  308

Query  1069  DCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAY  1248
                +  + A       K     +  +++LTE  R++  GF++ E+   +   M+  ESAY
Sbjct  309   GGFLAGLDAATSYVVAKPGELEKGFKTVLTETERIKRFGFTQSELERAKTAFMTAQESAY  368

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--GTSS  1422
              E+D+  S    +EYLQHFL+ E   GI+YE    K  +  I+ +E++  ++++    + 
Sbjct  369   KEKDKTSSERFVNEYLQHFLKGEASPGIQYEFDFYKNNIEGIAVAEINNIAKKYISDVNR  428

Query  1423  SCVIKTIEPRATATVDD--LRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
               +I   E       D+  + S +  + T    ++I  + ++   + ++S K   G +  
Sbjct  429   DVIIMGPEKDKDNMPDEATVNSWITSVTT----ENITAYVDQVSDKPLLSSKLVAGKVTG  484

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             + + +++G  E  LSNG++V  K T+F +D++ F+  S GG S    +++ S S  +TI 
Sbjct  485   ETKTESLGITELKLSNGVKVILKPTDFKNDEISFSAISPGGTSLYSNADFQSASNAATIV  544

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                G+  +    L  +L GK+ +V   +     S  G  +P DLETALQ+V+  FT   +
Sbjct  545   SRSGLGDFNSIQLSKLLTGKQVQVQPSINERNESLVGFTNPKDLETALQMVHLYFTQPRK  604

Query  1957  PGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRP-IRIRDLQKVNPYKA  2133
               E     + Q+ + ++  +  DP   FA+    +  GN    R    +  ++++N  +A
Sbjct  605   DAEIFEGYITQL-KGSLANRSNDPNNVFADTAAAV-LGNYNVRRTGPTLEKVEQINLDRA  662

Query  2134  CEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDL-KGLPFK  2310
                F   F D S FT   VGN DP    PL+ QY+  +P         NR++  K L  K
Sbjct  663   YAIFKERFADASDFTFTFVGNFDPQQIKPLLEQYIASLP-------ALNRNEQPKDLDIK  715

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
              P+  I++ V     E + +V+L F  +    +   + + +  L+++L  K+++ LR   
Sbjct  716   TPAGKIQKSVFKGQ-EPKANVRLVFSGDYTYNE--SNNNQLDALAEVLTIKLIERLREDE  772

Query  2491  GQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDE  2670
             G +Y AG          S+    R  + I+F+C P+    L+   LDEI ++++ G    
Sbjct  773   GGVYGAGARASY-----SKYPQGRYSMNISFACAPENVEKLIASTLDEISKVKKSGAQSV  827

Query  2671  DVSTVLEIEQRAHENGLQENCYWLDRILRSYQS  2769
             D+   L  E+R+ E  L++N +WL  +  + Q+
Sbjct  828   DIEKFLAEERRSTETQLKDNGFWLGYLTNAVQN  860



>ref|WP_016193785.1| putative Zinc protease pqqL [Arcticibacter svalbardensis]
 gb|EOR96301.1| putative Zinc protease pqqL [Arcticibacter svalbardensis MN12-7]
Length=926

 Score =   401 bits (1031),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 264/877 (30%), Positives = 451/877 (51%), Gaps = 31/877 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G L+NG  Y++R N +P+ RA   LA++AGS+LE EEE G+AH +EH+AF+ T+ Y
Sbjct  30    AVKTGTLENGFRYFIRKNIEPQKRATFYLAMKAGSILENEEELGLAHFLEHMAFNGTKNY  89

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               ++++ +L++ G  FGA  NA TS DETVY+L +P D PE++   I IL ++S  +  +
Sbjct  90    PKNELINYLQTNGVRFGADLNAYTSFDETVYQLPIPTDNPEIVKNGIQILRDWSQNILLA  149

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               ++ KERG +MEE R  + A  RMQ  +  ++   S+YAERLPIG E ++ +  P+ ++
Sbjct  150   TEEINKERGVIMEEKRLGKGAGERMQSKYLPVLFNHSRYAERLPIGKENILLSFKPETIR  209

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
             QFY KWY     A+I VGD  D + + +LI A F    +P D P    Y +P +   +F 
Sbjct  210   QFYSKWYRPDLQALIVVGDI-DVEEIEKLIIAKFSDLKNPKDAPERKEYSIPLNGSNQFI  268

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + E   + + +  K    + KT  D+R+ L + +F + ++ R  +I ++ DPP+   
Sbjct  269   SVTDKENTSTVIQVLMKHDAPDFKTTIDFRESLKKVLFNNLMSSRISEIRKQADPPFLQG  328

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              ++    +  ++   + +S K        +++ TE  R++  GF++ E+  ++  ++   
Sbjct  329   GSSIGDFMAGLEVASVVASVKPGQLERGFKAVWTETERIKKFGFTQTELDRMKNTVLVYQ  388

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             ES++ ER++  S +  +EYL  FL+     G EYE    K +LP I   EV+  + ++ T
Sbjct  389   ESSFKEREKTHSNNYVNEYLALFLKGNASPGKEYEYNFYKNVLPGIMLEEVNALANKYFT  448

Query  1417  SSSCVIKTIEPRATA-TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
              S+  I  + P +   ++ D ++V+  I      + I  +D+    + +++ +P PG + 
Sbjct  449   ESNRDILVMAPESQKDSLPDEQTVLTWIKEVTSTK-ILAYDDAVSDKPLMANEPIPGKVT  507

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
                E +++G  E  LSNG++V  K TNF +D++LF  FS GG S   +++Y S      I
Sbjct  508   SVKEIKSLGIKELTLSNGIKVVLKPTNFKNDEILFGSFSPGGNSLYSDAKYQSAVNAVPI  567

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
                 G+  +    L  +L+GK   +   +       +G  S +DLETA++LV   FT   
Sbjct  568   IASSGLGQFNSKELPKVLSGKMVSISPYISERYEGINGSASHADLETAMKLVNLFFT---  624

Query  1954  EPGEEDVNI---VMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI--RIRDLQKV  2118
             EP   D NI   ++   + ++  +   P + F++ V  +    SY  R     I    ++
Sbjct  625   EP-RVDRNIFDGLITNYKSSLINRSNSPSSVFSDTVSAI--LGSYHVRRTGPSIEKANQI  681

Query  2119  NPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNR-DDLK  2295
             +  +A + + + F D S F    VG+    +  P + +YLG +P         NR +  +
Sbjct  682   SMPEAMDIYKDRFADASDFIFFFVGSFKVDSIQPFLEKYLGSLP-------SINRHEQWQ  734

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
              L  + P    ++VV     E + +VQL F  + K  +  E+VH +  L ++L+ ++ + 
Sbjct  735   DLGIRIPKGRFKKVVKKGS-EDKATVQLVFSGDYKYRE-KENVH-MDALEEILKIRLTER  791

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR   G +Y    SV    N PS+       I I+F C PD    L+   LDEI +LQ++
Sbjct  792   LREDEGGVYTPSASVSYSKN-PSKY-----TISISFGCAPDNVDKLIAATLDEIEKLQKN  845

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQ  2766
             G   ED+  V+   +R  E   + N +WL  +   YQ
Sbjct  846   GAKKEDLIKVVSESKRTRETRSKTNGFWLGYLSAQYQ  882



>ref|WP_018621945.1| peptidase M16 [Spirosoma luteum]
Length=957

 Score =   400 bits (1029),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 266/899 (30%), Positives = 451/899 (50%), Gaps = 33/899 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G L NGLTYY+R N++PK RA L L +RAGSVLE + ++G+AH +EH+ F+ T+ +
Sbjct  58    AVKVGVLSNGLTYYIRKNAEPKNRAELRLVIRAGSVLENDNQQGLAHFMEHMEFNGTKNF  117

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +++V FL+S G  FGA  NA T  DETVY+L VP D   +      IL +++      
Sbjct  118   PKNELVNFLQSAGVRFGADLNAYTGFDETVYQLPVPTDSANVFKGGFQILEDWAHNATLD  177

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
               +++KERG V+EE R  R A  RM+D ++  ++  S+YA+RLPIG E+V+ T  P  ++
Sbjct  178   PAEIDKERGVVLEERRLGRGAGQRMRDKYFPALLNDSQYAKRLPIGTEQVLTTFKPATLE  237

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
             QFYK WY    MAVIAVGDF +   V  +I+  FG   +   P P   Y +P H++ +  
Sbjct  238   QFYKDWYRPDLMAVIAVGDF-NISEVEGIIREKFGRIPAVKMPKPRTEYEIPPHKDTKVV  296

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
                + E   + V +  K P  + KT+ D R+ +   +F   L  R  +++++ DPP+   
Sbjct  297   IVTDPEQPNTVVQVIYKRPEIKEKTLNDLRESIKRGLFNTMLGNRIQELTQQADPPFLGG  356

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              +     +  + A+   +  KE     A++++L E ARV+  GF+  E++  +   M+ +
Sbjct  357   YSNYSDFLGNLDAFTSIAIAKEGNVERAIKAVLDENARVKQFGFTPTELARAKQEFMTSV  416

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E AY ER++ +S +  +EY+Q+F   EP   IE+     K     I   EV+   + F  
Sbjct  417   EQAYSERNKTRSVNYVNEYVQNFTDKEPYTSIEFYYDFLKREQDGIKLPEVNALVDLFIH  476

Query  1417  SSSCVIKTIEPRATATVDDLRSVVLK-INTFEQKQSIPPWDEENIPEEIVSVKPSPGWIM  1593
             + +  +  + P          + +L  +N  +  + +  +D++ +   +++  P+   ++
Sbjct  477   NDNRAVIVLAPEKDKDKLPTEAQILSYVN--DAGKGLTAYDDKTLDSPLLAKVPTGLPVV  534

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
             ++ + +++G  E+ L NG+ V  K T+F +DQ+LF+  S+GG S     ++ S    ST+
Sbjct  535   EEKKIKDIGVTEWTLKNGVHVVVKPTDFKNDQILFSATSFGGSSLYDLKDFPSARFASTL  594

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
             A   G   Y    L   L+GK+  V   +G       G  +P +LETA+QL+Y  FT   
Sbjct  595   AAMGGTGAYNQIQLGKFLSGKQVSVYPFVGELNEGIGGSTAPKELETAMQLIYSYFT---  651

Query  1954  EPGEEDVNIVMQMAEEAIHAQER----DPYTAFANRVRELNYGNSYFFRPIRIRDLQKVN  2121
             +P ++   I   ++ +    Q R     P   F + V      N+   +P+   DL K++
Sbjct  652   QPRKDADVIKGFLSNQRSALQNRINTPTPQQVFQDTVTVTLGSNNPRRQPLTPADLDKID  711

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               +A + +   F +   FT   VGNI   T  PL+ +YLGG+P          ++  K L
Sbjct  712   LDRAIQIYQERFANAGDFTFFFVGNIKEETLKPLVEKYLGGLPATD------TKEKFKDL  765

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFP--VELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
               + P   + + V+  + + + SVQL +   +    E  M+    +  L ++LE K+++ 
Sbjct  766   GIRAPKGEVSKTVYKGL-DPKASVQLIYSGDITWSPETTMQ----LDALGEVLEIKLIEK  820

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR +   +Y  GVS        ++    R    INF C P+    L+      I  L++ 
Sbjct  821   LREEESGVY--GVS---ANGAYAKYPVPRYTFRINFGCAPENVDKLIAKTQALINDLKQK  875

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKV  2832
             G    D++      +R  E  L++N +WL  +    Q++ Y+GD  D    +D   +KV
Sbjct  876   GALPTDIAKFKAETRRETELQLKDNQFWLGYL----QNQYYNGDAPDEVLHEDAQLAKV  930



>ref|WP_028607772.1| peptidase M16 [Olleya sp. VCSM12]
Length=949

 Score =   400 bits (1028),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 270/934 (29%), Positives = 461/934 (49%), Gaps = 81/934 (9%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGL YY+++N KP+ +  L L + AGS+LE+E++ G+AH +EH+ F+ T+ + 
Sbjct  48    VKTGVLSNGLKYYIKNNGKPENKVELRLVINAGSILEDEDQLGLAHFMEHMNFNGTKNFK  107

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P + PE L +   IL +++     +E
Sbjct  108   KNELVDYLQSIGVKFGAHLNAYTSFDETVYILPIPSEDPEKLEKGFQILEDWAHNALLTE  167

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++ ERG V+EE R  + AN RM   +   +M GS+YA+RLPIG ++ I   S + +++
Sbjct  168   EEIDNERGVVLEELRLGKGANERMMQRYLPKLMYGSQYAKRLPIGTQENIENFSYESLRR  227

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    M+V+AVGD  D  ++ E IK HFG      +P     + VP+HEE   + 
Sbjct  228   FYKDWYRPDLMSVMAVGDV-DVATLEEKIKTHFGRIAPAKNPRKREVFNVPNHEETFIAI  286

Query  880   FVESEAAGSAVMISCKMPVDEL--KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ S V +  K   +    +TV+DYR+ + + +F   +N R  ++   ++PP+ +
Sbjct  287   ESDKEASFSQVQVMFKDSENAKLEETVEDYRESMVKKLFSQMINTRLGELRNSENPPFVF  346

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S       R   AY   + C E   ++AL+++L E  RV+  GF E E    +  +++
Sbjct  347   GSSYYGGTWARTKNAYQSFAMCSETDQLKALKALLEENERVKRFGFQEGEFDRAKKRMLA  406

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E ++  +D+M+S  +  EY++HFL  E + GI +E  + K  LP+I+  EV+   + +
Sbjct  407   NMEKSFKNKDKMESKRVIGEYVRHFLTGEVMPGITWEYDMYKKELPNITLEEVNGLIKNY  466

Query  1411  -----------GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEE  1557
                        G     + K  E +  A +D L+              I P+++E +   
Sbjct  467   LRNDNRVIVITGPEKEGLTKVKEKQVKALLDGLKDA-----------DIKPYEDEVVASS  515

Query  1558  IVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPE  1737
             ++S  P  G I    + + +G     LSNG  V YK T+F +++++F  FS+GG S    
Sbjct  516   LISKLPPKGSITNIVKDEKLGTTTLTLSNGATVTYKKTDFKNNEIMFEAFSFGGNSLYST  575

Query  1738  SEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETA  1917
             ++Y + +  +    E GV G+  + +  ML+GK   V   +G Y  +F G+ +P DLE  
Sbjct  576   ADYKATTFANGALAEAGVNGFNKTQIDKMLSGKIVNVRPSIGTYSENFRGNSTPKDLEEL  635

Query  1918  LQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS----YFF  2085
              QL + L+ T++   ++  N  +   +  I     +P T F+  + +  YG S     F 
Sbjct  636   FQLTH-LYFTSLNKDDKAYNSFINKQKAFIGNMLSNPQTFFSIEMGKFMYGKSPRYMGFP  694

Query  2086  RPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEP  2265
              P    D      YK    +   F D   F    VGN+D         +YL  +P     
Sbjct  695   TPEAYDDADYDLAYKK---YKERFADAGDFKFYFVGNVDEVKIKAFSEKYLASLPTN---  748

Query  2266  ILHFNRDDLKGLPFKFPSSIIREVV--HSPMVEA----QCSVQLCF--PVELKSEDMMED  2421
                 N ++      K+  +  R +   H+ +VE     + SV++ +  P         ++
Sbjct  749   ----NSNE------KYKVTDFRPLTGQHTKIVEKGTDEKSSVRITYHGPTTYDG----KE  794

Query  2422  VHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG------DIGINF  2583
              H +  L ++L  K+V+ LR + G +Y AG             GNI           INF
Sbjct  795   AHALASLGEILTIKLVEKLREEEGGVYGAGAR-----------GNISKMPYGWFSFNINF  843

Query  2584  SCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS-  2760
              C P+    L + AL E+ +L ++GP+++D++ V E +    +  L++N +W+  I  + 
Sbjct  844   PCGPENVEKLKNAALAEVEKLIKNGPTEKDLAKVKEAQLLERKEQLKQNRFWMSLIKNAD  903

Query  2761  YQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQ  2862
             YQ +    D    F  +D+  +  +  L  +  +
Sbjct  904   YQDK----DAKKIFTFEDDVNNLTKDYLQSIAKK  933



>dbj|GAL75740.1| probable zinc protease pqqL [Nonlabens ulvanivorans]
Length=919

 Score =   399 bits (1026),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 275/934 (29%), Positives = 465/934 (50%), Gaps = 44/934 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY+++N KP+ +  L LA+ AGS+LE+++++G+AH++EH+ F+ T  + 
Sbjct  18    VKTGVLSNGLTYYIQNNGKPEDKVELRLAINAGSILEDDDQQGLAHMMEHMNFNGTTNFQ  77

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+ IG +FGA  NA TS DETVY L +P D PE L    +IL++++       
Sbjct  78    KNELVDYLQGIGVKFGADLNAYTSFDETVYILPIPSDDPEKLDNGFTILSDWAGGALLET  137

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +  ERG ++EE R  + AN RM    + ++   SKYAERLPIG +++I    P  +++
Sbjct  138   EAINDERGVILEESRTGKGANDRMNKVTFPVIFANSKYAERLPIGKDEIIANFDPDAIRR  197

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             F K WY    MAVIAVGD  D  ++   IK HFG   +  +P     + +P+HEE   + 
Sbjct  198   FQKDWYRPDLMAVIAVGDL-DVATLEAKIKEHFGDIPAAENPRKREEFGLPNHEETLIAI  256

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ + V I  K     +   TV D RD L   +F   +N R  +++ K +PP+ +
Sbjct  257   AQDPEASFAQVRIQYKDSKKAEPTTTVSDLRDDLVNGLFSQMMNNRLQELTTKPNPPFIF  316

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S+     +R   +Y   +     G + AL+++L E  RV+L+GF   E    +    S
Sbjct  317   GSSSYGGTGIRGKNSYSSFAGTSPDGQLTALKTLLEENQRVKLYGFQASEFERAKTSYKS  376

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               E+ Y +RD+ +S  +   Y+ HFL  + V  +EY  ++   L+P I+  E++     +
Sbjct  377   FYETFYKDRDKRESGRIVGAYVNHFLVGDMVPSVEYSYEMAMKLMPTITIEEINAKMADY  436

Query  1411  --GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
                 + S V+   E     T  D    +LKI        I  + +  + E ++   P+ G
Sbjct  437   IHDDNRSIVLTGPETENKPTEAD----ILKILNDVANSKIDNYQDTEVRENLIEKLPTAG  492

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS--  1758
              I +  +   +G   + LSNG  +  K T+F +D++L T +SYGG S   ++EY + S  
Sbjct  493   AIAKTTKNDKLGTTTYTLSNGATITTKKTDFKNDEILMTAYSYGGTSLFSDAEYKAVSQA  552

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             MG    G  GV G   + +   ++GK   V  ++G+   +F+G  +P DLET  QL++ L
Sbjct  553   MGGVTQG--GVAGMNQTDMGKYMSGKLVRVSPRVGSISENFNGSSTPDDLETMFQLIH-L  609

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKV  2118
             + T++   +E     +   +  + +    P + F+N V +  + +S  +      ++   
Sbjct  610   YFTDINKDDEAYQSYIDKQKSFLGSYLSRPESYFSNEVNKYRFESSPRYTGFPTPEMMDA  669

Query  2119  NPY-KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLK  2295
               Y KA E F   F D   F   +VGNID A        Y+  +P   +  ++      K
Sbjct  670   ADYDKAYELFKERFSDAGDFNFYLVGNIDDAQIQEFAKTYIASLPSSGKKEMY------K  723

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
                ++  +S  R+ +    +E + +VQ+ +  E  S    E++     L ++   KI++ 
Sbjct  724   MNEWREDTSKPRKKIVKKGLEEKSTVQIVWTGEANSYSAKENMALDA-LGEIATIKIIET  782

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR + G IY  G    L     S++   R +  I+F C PD    LV  AL+E+  ++ D
Sbjct  783   LREQEGGIYGGGARGSL-----SKITYPRYNFSISFPCGPDNVDKLVAAALNELEMIKND  837

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDV--GDSFKVQDEARSK  2829
             GP+D+D++ V E     ++  L+ N +WL+         +YS D    D  K+ D   S 
Sbjct  838   GPTDKDMNKVKEAYLLEYKENLESNRFWLN--------SLYSADYEQKDPNKILDFEASV  889

Query  2830  VRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
              +  LT    Q A ++ +     + Y + +L+P+
Sbjct  890   AK--LTKADVQAAAKKYI----DENYLLAVLLPE  917



>ref|WP_019942309.1| peptidase M16 [Dyadobacter beijingensis]
Length=936

 Score =   399 bits (1026),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 280/936 (30%), Positives = 474/936 (51%), Gaps = 50/936 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG+TYY++ N++PK RA L LAV+AGSVLE + ++G+AH +EH+ F+ T  + 
Sbjct  37    VKTGKLKNGITYYIKKNTEPKNRAELRLAVKAGSVLETDAQQGLAHFMEHMNFNGTTHFP  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+  G  FGA  NA T  DETVY L +P D   LL + I +L ++++      
Sbjct  97    KNELVNFLQKTGVRFGADLNAYTGFDETVYMLPIPTDSAGLLEKGIQVLEDWANGALLDP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG V+EE R  R A  RM+D    +++  S+YAERLPIG + ++++  P+ +K 
Sbjct  157   AEIDKERGVVLEESRMGRGAQQRMRDKFLKVILNNSRYAERLPIGKDSILKSFKPETIKA  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAVIAVGDF D   V  +I   F     P +P     Y +P     + + 
Sbjct  217   FYQDWYRPDLMAVIAVGDF-DVAKVESIITQKFSSIKPPVNPKKRVRYDIPLDGSTKVAI  275

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-YSC  1056
               + E   + + +  K P  + KT++D R+  A+ ++   + QR  ++++K +PP+ Y  
Sbjct  276   VTDPEYPQNLIQLIYKQPNSKEKTLQDVRNNFAQELYNAMMGQRIQELTQKANPPFLYGA  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
             +   D L   + +Y   +  K+  +++ AL ++L E ARV+  GF++ E+   +    + 
Sbjct  336   TEYGDFLGN-LDSYTSFALAKDAASMKTALTALLEENARVQKFGFTQPELDRAKKDFYNG  394

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
             IE  Y ERD+ +S +   EYL HFL ++P +G     +  K  L  ++ +EV+  ++++ 
Sbjct  395   IEEYYKERDKTKSANHVQEYLNHFLHDKPFMGAGAYFEFVKKHLDGVTLAEVNALAKKYI  454

Query  1414  TSSSCVIKTIEPR----ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSP  1581
             T  +  +  + P     A  T  D+ S++      E  + +  + ++ +   ++  +P+P
Sbjct  455   TDKNRAVVIMGPEKSKDALPTEADITSLL-----SEAGKDVTAYVDDVVDAPLLKAEPTP  509

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I  +     +G  E  LSNG++V  K T+F +D++L    + GG S  P  E  +   
Sbjct  510   GKITAEKTLDKLGVTEITLSNGVKVLLKPTDFKNDEILIKATAKGGYSLFP-GERETGIF  568

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
              S +    GV  Y  + L   LAGK A  G  L        G+ +P DLET LQL+Y  F
Sbjct  569   TSYLVQSGGVGPYNQTQLQKFLAGKTAGAGPYLSELTEGIGGNTNPKDLETTLQLIYAYF  628

Query  1942  TTNVEPGEEDVNIVMQ-MAEEAIHAQERD----PYTAFANRVRELNYGNSYFFRPIRIRD  2106
             T   EP  +D ++V   +A +  + +       P   +++ +  +   ++   +P++   
Sbjct  629   T---EP-RKDADVVTGILANQKAYLENMQKTLTPEKVYSDSLNAVLTSHNPKRQPLKPES  684

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD  2286
             + KV+  +A E + N F D S F   IVG   P T  PL+ +YLG +P         +RD
Sbjct  685   IDKVSLDRAFEIYKNRFADASDFVFTIVGAFKPETLKPLLEKYLGSLPSS-------DRD  737

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
             D    P  +P     E V    +E +  V +    E       E+   +  L ++L+ K+
Sbjct  738   DTFNHPNIYPPKGRIEKVIYKGLEPKSRVTMVSSGEYDYNP--ENNIQIEALQEVLQIKL  795

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNK-PSRVGNIRGDIGINFSCDPDISSTLVDLALDEILR  2643
             ++ LR +   +Y  GVSV  G +K P+  G+ R  IG  F C P+    LV    +EI +
Sbjct  796   IESLREEESGVY--GVSVSEGTDKFPT--GHYRFSIG--FGCAPENVDKLVKRTQEEIAK  849

Query  2644  LQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEAR  2823
             ++++G   +D+   +   QR  E  L+ N +WLD +        + GD  +    QD   
Sbjct  850   IKQNGADPKDIEKFVAETQRKTEIALKTNGFWLDYL----DDNTFLGDDLNEIFEQD---  902

Query  2824  SKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
              ++ K +T  + + A Q+         +  V+LMP+
Sbjct  903   -RLLKSITVASTKAAAQKYF---NDDNFIKVVLMPE  934



>ref|WP_034749717.1| peptidase M16 [Janthinobacterium lividum]
 gb|EZP40335.1| Zinc protease PqqL [Janthinobacterium lividum]
Length=944

 Score =   399 bits (1025),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 266/930 (29%), Positives = 460/930 (49%), Gaps = 35/930 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N++P  +  L L V+AGS+LE+++++G+AH  EH+AF+ +  + 
Sbjct  37    VTVGKLPNGLTYYIKKNARPAQKVELRLVVKAGSILEDDDQQGLAHFTEHMAFNGSTHFK  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++++ +L+SIG +FGA  NA TS DETVY L +P +K E L +   +L +++  ++ + 
Sbjct  97    RNELISYLQSIGVKFGADLNAYTSFDETVYVLPIPTNKKENLEKGFLVLEDWAHGLKFNP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+  ERG V+EE R  + A+ RM    +  ++ GS+YAER+PIG E V++T  P+ +K+
Sbjct  157   ADINSERGIVLEEARLGKGASDRMNKVLYPKLLNGSRYAERMPIGKESVLKTFKPEAIKR  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+ VGD    Q+  +LI+ HFG   +P  P P  Y  VP   +     
Sbjct  217   FYKDWYRPDLMAVMVVGDVEPKQA-EKLIQQHFGKLKNPAKPRPRLYAEVPQRSQTEALV  275

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA   +V I   +    E  T+ DYR  + E+++   L+ R  +++++ +PP+   
Sbjct  276   ITDKEAPDDSVFIRYPIRAAQEPVTIADYRRQMIENLYGQMLSARMQELTQQANPPFIQG  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              ++   LVR  +++   +   + G   A+++++ E  R R  GFS+ E+   R  ++   
Sbjct  336   GSSMGKLVRGYESFSAYALLGKGGVQPAVDALVQEDERARRFGFSQDELDRARKDMLRNY  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E AY ERD+  S     EY ++FL  E + GI  E    + LLP ++  E+++   +   
Sbjct  396   ERAYSERDKSDSAGFVAEYSRNFLEQEAIPGIANELLYAQELLPQVTLQEINETVAKVIP  455

Query  1411  -GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
                    V    EP+A A+V   + ++  +   EQ Q + P  E+ +  +++   P+ G 
Sbjct  456   DQQKKLVVFMGAEPKAGASVPTQQQLLDAVAKAEQ-QKVEPRTEKVLASKLMDGPPAGGS  514

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I+ +     +G  E  L NG+RV  K T+F +DQVL     +GG S   +++ ++    S
Sbjct  515   IVSEKLNSAIGVTELTLGNGVRVLLKPTDFKNDQVLMGSTRFGGQSLFGDADIYNARYAS  574

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
              + G +G+    P  L  +LAGK   VG  LG     F G  S +D+E  LQLVY L+  
Sbjct  575   AVVGSMGLKDLAPLDLQKVLAGKTVNVGASLGELSEGFGGSASSADVEAMLQLVY-LYFN  633

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI-RIRDLQKVNP  2124
             +V          +   ++        P   F + ++   +G++     + R  D  KV  
Sbjct  634   DVRKDAGLYQSFIGKQQDLAKNSMAQPEAVFYDAIQHAMFGDNPRVDGVPRAADFDKVGL  693

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              ++ + F   F      T +  G+ +     PLI  YLG +P    P  H  RD    + 
Sbjct  694   DRSLDIFRQRFSSARGMTFIFAGSFELDKIKPLIASYLGTLPVGDVP--HAYRD----VG  747

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              +  + ++++ ++    E + ++ + F  ++   D  E    +  L ++L  K+++VLR 
Sbjct  748   MRPVTGVVKKDIYMGS-EPKSTISITFNGDVAYSD--EQKLTLQALGEVLNLKVIEVLRE  804

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             K   IY  G    +G +           + +N    P+    ++  A  EI +++ DGPS
Sbjct  805   KMSMIYGGGFETSMGQHPYGHY-----SVALNLPTGPENVDKVIAAAFAEINKMKMDGPS  859

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRSY-QSRIYSGDVGDSFKVQDEARSKVRKL  2841
               D+  V        +  L+EN YW+ +++ S  Q R    D     + +   R+     
Sbjct  860   AADLEKVKLNWITRQQKSLRENRYWMSQLMGSVTQGR----DPAHILRYEQRVRA-----  910

Query  2842  LTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             +TP   ++A QR L       Y  V+L P+
Sbjct  911   ITPQAVKLAAQRYLDM---HNYVQVVLYPE  937



>ref|WP_027880659.1| peptidase M16 [Mesoflavibacter zeaxanthinifaciens]
Length=951

 Score =   398 bits (1023),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 263/884 (30%), Positives = 452/884 (51%), Gaps = 47/884 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY+++N KP+ +  L L V+AGS+LE+E++RG+AH +EH+ F+ T+ + 
Sbjct  51    VKKGVLSNGLTYYIKNNGKPENKVELRLVVKAGSILEDEDQRGLAHFMEHMNFNGTKNFK  110

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P D PE L +   IL +++     +E
Sbjct  111   KNELVNYLQSIGVKFGAHLNAYTSFDETVYMLPIPSDDPEKLEKGFQILEDWAHNALLTE  170

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+++ERG V+EE+R  + A+ RM   +   +M GSKYAERLPIG ++ +     + ++ 
Sbjct  171   KDIDEERGVVLEEFRLGQGADERMMQNYLPKLMYGSKYAERLPIGTKENLENFDYESLRS  230

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             +YK WY    MAVIAVGD  D +++   IK+HFG   +P  P P   + VP+H+E   + 
Sbjct  231   YYKDWYRPDLMAVIAVGDI-DVETLENKIKSHFGGIKNPDTPKPREVFYVPNHDETFVAI  289

Query  880   FVESEAAGSAVMISCKMPVD--ELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ S V +  K   +  E +T++++R  + ES+F   +N R  ++   ++PP+ Y
Sbjct  290   ETDKEASFSQVRVLFKDESNSKEDETLEEFRHSIVESLFSQMINNRLDELRNSENPPFVY  349

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S           AY   +     G ++AL+ +L E  RV+ +GF + E    +  L++
Sbjct  350   GYSFHGGTWADTKDAYQSFAMTSPDGQLKALKVLLEENERVKKYGFGQGEFERAKKDLIA  409

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E ++ ++D+ +S  +  EY+++FL NEP+ GIE+E    K  LP I  +EV++    +
Sbjct  410   RLEKSFKDKDKTESNRVLGEYIRNFLVNEPMPGIEWEYNFHKEQLPTIKLNEVNQLISDY  469

Query  1411  GTSSSCVIKTIEPR----ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                ++ V+    P        T  ++R ++  +    + + I P++++ +   +++  P 
Sbjct  470   IKDTNRVVVLTGPDKEDIKKVTEKEVRDLLETV----KNEDIKPYEDKEVASSLITNSPP  525

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G I+++ +   +G     LSNG  V YK T+F +D++LF  FS+GG S   + +Y    
Sbjct  526   KGSIVKETQNNKLGTTTLTLSNGATVTYKKTDFKNDEILFDAFSFGGSSLYSDEDYLETV  585

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
               +    + GV G+    L  M++GK   V  ++G      SG  +P D E   QL +  
Sbjct  586   FANNGLTDAGVNGFSKVDLGKMMSGKIVSVRPRVGGITEEISGSSTPKDFEELFQLTHLY  645

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGN----SYFFRPIRIRD  2106
             FT  +   E+     +   +  I      P   F ++  +  YG     S F  P +   
Sbjct  646   FTA-LNKDEKAFASYINKQKAFIGNMLSSPQFYFQDQYSKFVYGANPRYSGFPTPEK---  701

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD  2286
             L + N   A + F   F +   F    VGNID         +YL  +P   +      ++
Sbjct  702   LDQANYDLAYQKFKERFANAGDFKFYFVGNIDENKIKEYSEKYLANLPSTGK------QE  755

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
               K   F+ P S     +     + + SV++ +  E  + D  ED + +  L ++L  K+
Sbjct  756   TYKKTDFR-PLSGSHTKIVEKGTDPKSSVRIVYQGET-TYDEKED-YALSSLGEILTIKL  812

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG------DIGINFSCDPDISSTLVDLAL  2628
             ++ LR + G +Y  G             GNI           I+F C P+    L + A+
Sbjct  813   IEKLREEEGGVYGVGAR-----------GNINKIPYGWYSFSISFPCGPENVEKLKNAAI  861

Query  2629  DEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS  2760
              E+ ++  +GP++ED++ V E +    +  L+EN +WL R+L++
Sbjct  862   AEVEKIVANGPTEEDLAKVKEAQLLERKEDLKENRFWL-RLLKN  904



>ref|WP_028290501.1| peptidase M16 [Olleya sp. VCSA23]
Length=949

 Score =   398 bits (1022),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 268/934 (29%), Positives = 461/934 (49%), Gaps = 81/934 (9%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGL YY+++N KP+ +  L L + AGS+LE+E++ G+AH +EH+ F+ T+ + 
Sbjct  48    VKTGVLSNGLKYYIKNNGKPENKVELRLVINAGSILEDEDQLGLAHFMEHMNFNGTKNFK  107

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P + PE L +   IL +++     ++
Sbjct  108   KNELVDYLQSIGVKFGAHLNAYTSFDETVYILPIPSEDPEKLEKGFQILEDWAHNALLTD  167

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++ ERG V+EE R  + AN RM   +   +M GS+YA+RLPIG ++ I   S + +++
Sbjct  168   EEIDNERGVVLEELRLGKGANERMMQRYLPKLMYGSQYAKRLPIGTQENIENFSYESLRR  227

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    M+V+AVGD  D  ++ E IK HFG      +P     + VP+HEE   + 
Sbjct  228   FYKDWYRPDLMSVMAVGDV-DVATLEEKIKTHFGRIAPAKNPRKREVFNVPNHEETFIAI  286

Query  880   FVESEAAGSAVMISCKMPVDEL--KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ S V +  K   +    +TV+DYR+ + + +F   +N R  ++   ++PP+ +
Sbjct  287   ESDKEASFSQVQVMFKDSENAKLEETVEDYRESMVKKLFSQMINTRLGELRNSENPPFVF  346

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S       R   AY   + C E   ++AL+++L E  RV+  GF E E    +  +++
Sbjct  347   GSSYYGGTWARTKNAYQSFAMCSETDQLKALKALLEENERVKRFGFQEGEFDRAKKRMLA  406

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E ++  +D+M+S  +  EY++HFL  E + GI +E  + K  LP+I+  EV+   + +
Sbjct  407   NMEKSFKNKDKMESKRVIGEYVRHFLTGEVMPGITWEYDMYKKELPNITLEEVNGLIKNY  466

Query  1411  -----------GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEE  1557
                        G     + K  E +  A +D L+              I P+++E +   
Sbjct  467   LRNDNRVIVITGPEKEGLTKVKEKQVKALLDGLKDA-----------DIKPYEDEVVASS  515

Query  1558  IVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPE  1737
             ++S  P  G I    + + +G     LSNG  V YK T+F +++++F  FS+GG S    
Sbjct  516   LISKLPPKGSITNIVKDEKLGTTTLTLSNGATVTYKKTDFKNNEIMFEAFSFGGNSLYST  575

Query  1738  SEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETA  1917
             ++Y + +  +    E GV G+  + +  ML+GK   V   +G Y  +F G+ +P DLE  
Sbjct  576   ADYKATTFANGALAEAGVNGFNKTQMDKMLSGKIVNVRPSIGTYSENFRGNSTPKDLEEL  635

Query  1918  LQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS----YFF  2085
              QL + L+ T++   ++  N  +   +  I     +P T F+  + +  YG S     F 
Sbjct  636   FQLTH-LYFTSLNKDDKAYNSFINKQKAFIGNMLSNPQTFFSIEMGKFMYGKSPRYMGFP  694

Query  2086  RPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEP  2265
              P    D      YK    +   F D   F    VGN+D         +YL  +P     
Sbjct  695   TPEAYDDADYDLAYKK---YKERFADAGDFKFYFVGNVDEVKIKAFSEKYLASLPTN---  748

Query  2266  ILHFNRDDLKGLPFKFPSSIIREVV--HSPMVEA----QCSVQLCF--PVELKSEDMMED  2421
                 N ++      K+  +  R +   H+ +VE     + SV++ +  P         ++
Sbjct  749   ----NSNE------KYKVTDFRPLTGQHTKIVEKGTDEKSSVRITYHGPTTYSG----KE  794

Query  2422  VHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG------DIGINF  2583
              H +  L ++L  K+V+ LR + G +Y AG             GNI           INF
Sbjct  795   AHALASLGEILTIKLVEKLREEEGGVYGAGAR-----------GNISKMPYGWFSFNINF  843

Query  2584  SCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS-  2760
              C P+    L + AL E+ +L ++GP+++D++ V E +    +  +++N +W+  I  + 
Sbjct  844   PCGPENVEKLKNAALAEVEKLIKNGPTEKDLAKVKEAQLLERKEQVKQNRFWMSLIKNAD  903

Query  2761  YQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQ  2862
             YQ +    D    F  +D+  +  +  L  +  +
Sbjct  904   YQDK----DAKKIFTFEDDVNNLTKDYLQSIAKK  933



>ref|WP_026838967.1| peptidase M16 [Gillisia sp. JM1]
Length=946

 Score =   398 bits (1022),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 260/870 (30%), Positives = 440/870 (51%), Gaps = 24/870 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L+NGLTYY+R+N KP+ +  L LA+ AGS+LE E+++G+AH VEH+ F+ T+ + 
Sbjct  44    VKIGKLENGLTYYIRNNGKPEDKVELRLAINAGSILENEDQQGLAHFVEHMNFNGTKNFE  103

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA T  DETVY L +P D PE L +   IL +++     ++
Sbjct  104   KNELVDYLQSIGVKFGADLNAYTGFDETVYILPIPSDNPETLEKGFQILEDWAHNALMTD  163

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+++ERG VMEEYR     + RM   +   +M GS+YAERLPIG ++VI     + V+ 
Sbjct  164   KDIDEERGVVMEEYRLGLGPDKRMMTEYLPKLMYGSQYAERLPIGKQEVIENADYETVRN  223

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             +YK WY    MAV+AVGD  D + + + IK HF       +P     + +P+H+E   + 
Sbjct  224   YYKDWYRPDLMAVVAVGDL-DPEVMEQKIKDHFSKLKPVANPRERKVFDLPNHDETFVAI  282

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA  S V +  K      ++ T  DYRD L +++F   +N R  ++    +PP+ Y
Sbjct  283   ASDKEAPFSQVRVYYKDLENAKDIVTTNDYRDQLVKNLFSTMINNRLDELRNSANPPFTY  342

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S+      R   AY   +       +++L ++L E  RV+ +GF+  E+   +   ++
Sbjct  343   GFSSYGGTYARSKNAYQSFAMSGAGEQLKSLRALLEENERVKRYGFNSGELERAKKEYLA  402

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
             +++  + +RD+ +S  +   Y+ H+L N P+ GIE+ +Q     LP I   EV+K    F
Sbjct  403   QLDRQFKDRDKQESGRIVGSYVSHYLSNSPIPGIEWISQFASADLPGIKLEEVNKLINDF  462

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
                 + VI    P            VL +    +   I P+ E +I E +++  P  G I
Sbjct  463   LHEENRVIILTGPEKEDITQVKEDEVLAMLKEVENSEIEPYQETDIRENLITNAPKAGTI  522

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
              +      VG  +  LSNG  V YK T+F +D+VLF+ +S GG S   + +Y +    ++
Sbjct  523   TKVVSNDKVGFKKLLLSNGATVVYKNTDFKNDEVLFSAYSPGGTSLYSDEDYLNTGFANS  582

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
                E G+     + +  M++GK   V   +G+    F+G  +P DLET  Q+V+ L+ T+
Sbjct  583   GLAEAGIADLSLNDMSKMMSGKLVSVSPNIGSISEGFNGSSTPQDLETLFQMVH-LYFTD  641

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYF--FRPIRIRDLQKVN  2121
             +   EE  N  +   +  +     +P   F N + +  N GN  +  F      D Q  +
Sbjct  642   LNKDEEAYNSFVTKQKNFLGNLLSNPNFYFQNELGKFRNEGNPRYLGFPTPEAFDSQDYD  701

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
                A E +   F +   FT   VGNID A        YL  +P   +      +++ K  
Sbjct  702   --LAYEKYKERFSNAGDFTFYFVGNIDEAKLKEFASTYLASLPSSGK------KEEYKVS  753

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
              F+  +   ++V++    + +  V + +  E  S +  ED      L ++L  K+V+ LR
Sbjct  754   EFREVNEYRKKVINKG-ADPKSQVTILWNGET-SYNQEEDFALEA-LGEVLTIKLVEKLR  810

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              + G +Y  G    +     S+V     +  I+F C P+    L   AL E+ +++ +GP
Sbjct  811   EEEGGVYGVGARGSM-----SKVPYGSYNFSISFPCGPENVDKLTAAALAEVEKIKNEGP  865

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             S++D++ + E      +  +++N +WL+++
Sbjct  866   SEKDMAKIKESLLLNRKESIKQNRFWLNQL  895



>ref|WP_036173780.1| peptidase M16, partial [Massilia sp. 9096]
Length=941

 Score =   397 bits (1021),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 265/870 (30%), Positives = 426/870 (49%), Gaps = 31/870 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYYV  N KP+ +  L L V+AGS+LE+E+++G+AH  EH+AF+ +  + 
Sbjct  42    VKVGKLANGLTYYVERNRKPEHKLELRLVVKAGSILEDEDQQGLAHFTEHMAFNGSTHFK  101

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              H++V +L+SIG +FGA  NA TS DETVY L VP D+P  L +A  +L +++  +    
Sbjct  102   KHELVSYLQSIGVKFGADLNAYTSFDETVYVLPVPSDRPADLDKAFLVLEDWAHGLTLDA  161

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++KER  V+EE R  + A  RMQ      +  GS+YAERLPIG E +I    P  +++
Sbjct  162   ADIDKERDIVLEEARLGKGAGNRMQKVLMPKIYNGSRYAERLPIGQEDIIHDFQPDALRR  221

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+AVGD  D     +LIK HFG   +P    P  Y  +P+        
Sbjct  222   FYRDWYRPDLMAVVAVGDI-DPAQAEQLIKRHFGGLKNPEHERPRTYAGIPARNGTEAVV  280

Query  880   FVESEAAGSAVMISCK-MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA  ++V+I    +P  E +T+  YR+ L E +    LN R  ++S+   PP+ + 
Sbjct  281   VTDKEAGPASVLIRYPVLPWQERQTLGGYREQLVEILVTGMLNARLQELSQLPAPPFMAA  340

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             S+A   L    ++Y   ++  +KG   A+++++ E  R R  GFS  E+   +  ++   
Sbjct  341   SSALSPLTPRYRSYNAMAALGDKGAGPAIDALVQENERARKFGFSAAELERAKKNVLRAY  400

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E  Y ER++  S     EY+++FL  E + GI+ E +    ++P I+  E++ ++ R   
Sbjct  401   ERGYAEREKTDSADHAAEYMRNFLEGESIPGIDNEYRYANEMIPSITLDEINAWAHRTIP  460

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
               S   V+ T   +A A       ++  +   E K  +   DE+ +   ++   P+PG I
Sbjct  461   ADSGKLVVYTGPAKADAPAPSGEQLLAAVAGAE-KADVTARDEKAVAGTLMERAPAPGKI  519

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
             + + +   +G     LSNG++V  K T F +DQ+L +   +GG +   E +  S     +
Sbjct  520   VAESQDARLGITRLSLSNGVKVILKPTAFRNDQILMSAARHGGQNLFDERDMVSARYADS  579

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             I   +G+  + P  +  +LAGK A V   LGA     +G    SDLET LQ+V+  F   
Sbjct  580   IVAAMGLKNFSPLEMSKVLAGKAASVSAGLGANTDVVAGSAGASDLETMLQMVWLKF-DG  638

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNS----YFFRPIRIRDLQKV  2118
             V   E      +    E    +   P   F + V    Y N+    +  RP    D++K+
Sbjct  639   VRRDENLYKSFIGKQMELARNRLSQPGAVFGDTVLATLYANNPRAPHATRP---EDIRKI  695

Query  2119  NPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKG  2298
             +  +A   +   F      T + VG+ D     PL+  YLG +P P  P       DL  
Sbjct  696   DLDRAIAIYRQRFSSARDLTFIFVGSFDANAIKPLLATYLGSLPTPDIPT---GFRDLGI  752

Query  2299  LPFKFPSSIIREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLETKIVQ  2472
              P +    + REV     +E + +V L F  P E+   + +     +  L++++  +I+ 
Sbjct  753   RPVR--GVVKREVKIG--LEDRSTVSLVFTGPTEVGEPEELR----LAALTEIMNIRIID  804

Query  2473  VLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQE  2652
             VLR K G IY  G+   +     +R+        +     P     ++     EI R++ 
Sbjct  805   VLREKLGLIYGGGMESSM-----TRIPYSNYIANMTLPTGPANVDKVIAATFGEIERMRT  859

Query  2653  DGPSDEDVSTVLEIEQRAHENGLQENCYWL  2742
             +GP   D+  V    ++     LQEN YWL
Sbjct  860   EGPDPLDLDKVKRNWRQNFRKSLQENGYWL  889



>dbj|GAK94093.1| probable zinc protease PqqL [Nonlabens ulvanivorans]
Length=969

 Score =   397 bits (1021),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 274/951 (29%), Positives = 468/951 (49%), Gaps = 41/951 (4%)
 Frame = +1

Query  103   SLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEE  282
             S+  V +++   +   P  V  G L NGLTYY+++N KP+ +  L LA+ AGS+LE++++
Sbjct  50    SMTAVGIDLNAKIPLDP-TVKTGVLSNGLTYYIQNNGKPEDKVELRLAINAGSILEDDDQ  108

Query  283   RGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPEL  462
             +G+AH++EH+ F+ T  +  +++V +L+ IG +FGA  NA TS DETVY L +P D PE 
Sbjct  109   QGLAHMMEHMNFNGTTNFQKNELVDYLQGIGVKFGADLNAYTSFDETVYILPIPSDDPEK  168

Query  463   LSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAER  642
             L    +IL++++         +  ERG ++EE R  + AN RM    + ++   SKYAER
Sbjct  169   LDNGFTILSDWAGGALLETDAINDERGVILEESRTGKGANDRMNKVTFPVIFANSKYAER  228

Query  643   LPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppd  822
             LPIG + +I+  +P  +++F K WY    MAVIAVGD  D  ++   IK HFG   +  +
Sbjct  229   LPIGKDDIIQNFNPDAIRRFQKDWYRPDLMAVIAVGDL-DVATLEAKIKEHFGDIPAAEN  287

Query  823   pppipYYLVPSHEEPRFSCFVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFH  996
             P     + +P+HEE   +   + EA+ + V I  K     +   TV D RD L   +F  
Sbjct  288   PRKREEFGLPNHEETLIAIAQDPEASFAQVRIQYKDSKKAEPTTTVSDLRDDLVNGLFSQ  347

Query  997   ALNQRFFKISRKKDPPY-YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARV  1173
              +N R  +++ K +PP+ +  S+     +R   +Y   +     G + AL+++L E  RV
Sbjct  348   MMNNRLQELTTKPNPPFIFGSSSYGGTGIRGKNSYSSFAGTAPDGQLTALKTLLEENQRV  407

Query  1174  RLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQ  1353
             +L+GF   E    +    S  E+ Y +RD+ +S  +   Y+ HFL  + V  +EY  ++ 
Sbjct  408   KLYGFQASEFERAKTSYKSFYETFYKDRDKRESGRIVGAYVNHFLVGDMVPSVEYSYEMA  467

Query  1354  KTLLPHISASEVSKYSERF--GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIP  1527
               L+P I+  E++     +    + S V    E     T  D    +LKI        I 
Sbjct  468   MKLMPTITIEEINAKMADYIHDDNRSIVFTGPETENKPTEAD----ILKILNDVANSKID  523

Query  1528  PWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGF  1707
              + +  + E ++   P+ G I +  +   +G   + LSNG  +  K T+F +D++L + +
Sbjct  524   NYQDTEVRENLIEKLPTAGAIAKTTKNDKLGTTTYTLSNGATITTKKTDFKNDEILMSAY  583

Query  1708  SYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSG  1887
             SYGG S   + EY + +       E G+ G   + +   ++GK   V  ++G+   +F+G
Sbjct  584   SYGGTSLFSDEEYLAVNQAMGGVTEGGIAGLNQTDMGKYMSGKLVRVSPRVGSISENFNG  643

Query  1888  DCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY  2067
               +P DLET  QL++ L+ T++    E     +   +  + +    P + F+N V    +
Sbjct  644   SSTPDDLETMFQLIH-LYFTDINKDTEAYKSYIDKQKSFLGSYLSRPESYFSNEVNNYRF  702

Query  2068  GNSYFFRPIRIRDLQKVNPY-KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGG  2244
             G+S  +      ++     Y KA + F   F D   F   +VGNID A        Y+  
Sbjct  703   GSSPRYTGFPTPEMMDAADYDKAYQLFKERFSDAGDFNFYLVGNIDDAQIQKFAKTYIAS  762

Query  2245  IPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDV  2424
             +P   +  ++      K   ++  +S  R+ V    +E + +VQ+ +  E  S    E++
Sbjct  763   LPSSGKKEMY------KINEWREDTSKPRKKVVKKGLEEKSTVQIVWTGEATSYSAKENM  816

Query  2425  HFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDIS  2604
                  L ++   KI++ LR + G IY  G    L     S++   R +  I+F C PD  
Sbjct  817   ALDA-LGEIATIKIIETLREQEGGIYGGGARGSL-----SKITYPRYNFSISFPCGPDNV  870

Query  2605  STLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSG  2784
               LV  AL+E+  ++ DGP+D+D++ V E     ++  L+ N +WL+         +YS 
Sbjct  871   DKLVAAALNELEMIKNDGPTDKDMNKVKEAYLLEYKENLESNRFWLN--------SLYSA  922

Query  2785  DV--GDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             D    D  K+ D   S  +  LT    Q A  + +     + Y + +L+P+
Sbjct  923   DYEQKDPNKILDFEASVAK--LTKADVQAAAMKYI----DENYLLAVLLPE  967



>ref|WP_013452711.1| peptidase M16 [Marivirga tractuosa]
 ref|YP_004052668.1| peptidase m16 domain protein [Marivirga tractuosa DSM 4126]
 gb|ADR20560.1| peptidase M16 domain protein [Marivirga tractuosa DSM 4126]
Length=942

 Score =   397 bits (1019),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 263/939 (28%), Positives = 456/939 (49%), Gaps = 57/939 (6%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L+NGLTYY+R N KP+ +    L + AGS+ E +++ G+AH  EH+AF+ TE + 
Sbjct  41    VKVGQLENGLTYYIRQNEKPEDKVEFRLVINAGSMQENDKQLGLAHFTEHMAFNGTENFK  100

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+S G +FGA  NA TS DETVY L +P D+ E L   +++L +++  +  + 
Sbjct  101   KNELVDYLQSAGVKFGADLNAYTSFDETVYILPIPTDE-ETLDNGLTVLEDWAGGLLMTG  159

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG V+EE+R  + A  RM+D ++ ++ + S+YAERLPIG ++++     + ++ 
Sbjct  160   DEIDKERGVVLEEWRLGQGAGQRMRDEYFPVLFKDSRYAERLPIGKKEILENFEYETLRS  219

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAVIAVGD  D   + + IKA FG   +P        Y VP+HEE   S 
Sbjct  220   FYEDWYRPNLMAVIAVGDI-DPAEMEKEIKARFGDLQNPKKAKKKKLYEVPAHEETYVSI  278

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + EA  + + +  K   +E+KT+ D R  L  S++   L QR  ++ +  +PP+   S
Sbjct  279   VTDKEANFNQIQLYYKHDNEEMKTLSDMRRDLVYSLYNGMLGQRLDELRQSANPPFLFAS  338

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
              +   +VR   AY   +   E G  + ++ +  E  R++ HGF+  E+   +   ++  E
Sbjct  339   TSFSQMVRNKSAYSSFAVVGENGFEKGVQVLAEENKRIKEHGFTASELDRYKKTFLNNAE  398

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
                 E D+ +ST     Y+QHFL   P+ G E+E +  + L+  I+  E++  + ++ T 
Sbjct  399   KRVKELDKTESTRFASAYIQHFLSENPIPGAEFEFEFYQNLINTITLPEINMLASKWVTD  458

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
              + V+                 +L I    +   + P+ +E++ E  ++  P  G +  +
Sbjct  459   ENRVVVLTGAEKEGVEMPSEEEILSILEEVENSDLEPYKDEDVAESFMTTAPKAGKVQNR  518

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
               +  +G  E +L+NG+RV  K T F +D+V    +S+GG S+    +Y+S S  +++  
Sbjct  519   VVHDELGVTELELNNGVRVILKPTQFKNDEVKMRAYSFGGHSQYEMEDYYSASNATSLIT  578

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
             E GV  +  + +  ML+GK   V   + +    F  + SP DLE   QL +  FT     
Sbjct  579   EAGVADFSNTEIKKMLSGKTVRVSPYISSLSEGFRAEASPQDLEEMFQLTHLYFT-----  633

Query  1960  GEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI------------RIR  2103
                      +M EEA  +        F N +    +  S     I            +  
Sbjct  634   -------APRMDEEAFGSYVSKNKMLFGNLMSNPQFYYSDKLSMILSQDNPRGGGFPKAE  686

Query  2104  DLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNR  2283
             DL K++  +A   +   F D S FT V VGN D     P++  YLG +P          +
Sbjct  687   DLDKIDFQRAYNIYKERFADASDFTFVFVGNFDVEGITPMLETYLGSLPTIER------K  740

Query  2284  DDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMED---VHFVGFLSKLL  2454
             D+   L  + P  I++E +       + + Q  +   L   D   D    +++  L +L+
Sbjct  741   DNWVDLGIRPPEGIVKEEI------IKGTDQKSYATILYHGDTEYDKQKSYYLKSLGELV  794

Query  2455  ETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDE  2634
               +++ +LR +   +Y  G S  +     SR+   R    I F C P+    LV    + 
Sbjct  795   TNELIDILREEKSGVYGVGASGSM-----SRLPESRYSFRIAFPCGPENVDELVKTTHEI  849

Query  2635  ILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQD  2814
             +  ++ +G  +ED+  V E + +  +  L++N YWL+R+   Y    Y  D+ +    +D
Sbjct  850   LADIKANGVKEEDLDKVKEAQLKGLKEDLKKNDYWLNRLYSFY---YYDDDLSNFIVTED  906

Query  2815  EARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             + +S     L+    +MA    L    + Q+   IL+P+
Sbjct  907   KIQS-----LSADDLKMAANEFL---NEDQFVEAILLPE  937



>ref|WP_036585478.1| peptidase M16, partial [Nonlabens ulvanivorans]
Length=918

 Score =   395 bits (1015),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 274/934 (29%), Positives = 463/934 (50%), Gaps = 44/934 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY+++N KP+ +  L LA+ AGS+LE+++++G+AH++EH+ F+ T  + 
Sbjct  18    VKTGVLSNGLTYYIQNNGKPEDKVELRLAINAGSILEDDDQQGLAHMMEHMNFNGTTNFQ  77

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+ IG +FGA  NA TS DETVY L +P D PE L    +IL++++       
Sbjct  78    KNELVDYLQGIGVKFGADLNAYTSFDETVYILPIPSDDPEKLDNGFTILSDWAGGALLET  137

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +  ERG ++EE R  + AN RM    + ++   SKYAERLPIG +++I    P  +++
Sbjct  138   EAINDERGVILEESRTGKGANDRMNKVTFPVIFANSKYAERLPIGKDEIIANFDPDAIRR  197

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             F K WY    MAVIAVGD  D  ++   IK HFG   +  +P     + +P+HEE   + 
Sbjct  198   FQKDWYRPDLMAVIAVGDL-DVATLEAKIKEHFGDIPAAENPRKREEFGLPNHEETLIAI  256

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ + V I  K     +   TV D RD L   +F   +N R  +++ K +PP+ +
Sbjct  257   AQDPEASFAQVRIQYKDSKKAEPTTTVSDLRDDLVNGLFSQMMNNRLQELTTKPNPPFIF  316

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S+     +R   +Y   +     G + AL+++L E  RV+L+GF   E    +    S
Sbjct  317   GSSSYGGTGIRGKNSYSSFAGTSPDGQLTALKTLLEENQRVKLYGFQASEFERAKTSYKS  376

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               ++ Y +RD+ +S  +   Y+ HFL  + V  +EY  ++   L+P I+  E++     +
Sbjct  377   FYKTFYKDRDKRESGRIVGAYVNHFLVGDMVPSVEYSYEMAMKLMPTITIEEINAKMADY  436

Query  1411  --GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
                 + S V    E     T  D    +LKI        I  + +  + E ++   P+ G
Sbjct  437   IHDDNRSIVFTGPETENKPTEAD----ILKILNDVANSKIDNYQDTEVRENLIEKLPTAG  492

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS--  1758
              I +  +   +G   + LSNG  +  K T+F +D++L T +SYGG S   ++EY + S  
Sbjct  493   AIAKTTKNDKLGTTTYTLSNGATITTKKTDFKNDEILMTAYSYGGTSLFSDAEYKAVSQA  552

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             MG    G  GV G   + +   ++GK   V  ++G+   +F+G  +P DLET  QL++ L
Sbjct  553   MGGVTQG--GVAGMNQTDMGKYMSGKLVRVSPRVGSISENFNGSSTPDDLETMFQLIH-L  609

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKV  2118
             + T++   +E     +   +  + +    P + F+N V +  + +S  +      ++   
Sbjct  610   YFTDINKDDEAYQSYIDKQKSFLGSYLSRPESYFSNEVNKYRFESSPRYTGFPTPEMMDA  669

Query  2119  NPY-KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLK  2295
               Y KA E F   F D   F   +VGNID A        Y+  +P   +  ++      K
Sbjct  670   ADYDKAYELFKERFSDAGDFNFYLVGNIDDAQIQEFAKTYIASLPSSGKKEMY------K  723

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
                ++  +S  R+ +    +E + +VQ+ +  E  S    E++     L ++   KI++ 
Sbjct  724   MNEWREDTSKPRKKIVKKGLEEKSTVQIVWTGEANSYSAKENMALDA-LGEIATIKIIET  782

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR + G IY  G    L     S++   R +  I+F C PD    LV  AL+E+  ++ D
Sbjct  783   LREQEGGIYGGGARGSL-----SKITYPRYNFSISFPCGPDNVDKLVAAALNELEMIKND  837

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDV--GDSFKVQDEARSK  2829
             GP+D+D++ V E     ++  L+ N +WL+         +YS D    D  K+ D   S 
Sbjct  838   GPTDKDMNKVKEAYLLEYKENLESNRFWLN--------SLYSADYEQKDPNKILDFEASV  889

Query  2830  VRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
                 LT    Q A ++ +     + Y + +L+P+
Sbjct  890   AN--LTKADVQAAAKKYI----DENYLLAVLLPE  917



>dbj|BAO56405.1| probable zinc protease pqqL [Nonlabens marinus S1-08]
Length=958

 Score =   396 bits (1018),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 265/875 (30%), Positives = 444/875 (51%), Gaps = 29/875 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G LDNGLTYYV++N KP+ +  L LAV AGSVLE+++++G+AH +EH+ F+ T  + 
Sbjct  58    VRMGVLDNGLTYYVKNNGKPEDKVELRLAVNAGSVLEDDDQQGLAHFMEHMNFNGTTNFE  117

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+ IG +FGA  NA TS DETVY L +P D PE L +  +IL +++       
Sbjct  118   KNELVDYLQGIGVKFGADLNAYTSFDETVYILPIPSDDPEKLEKGFTILEDWAHGALLKT  177

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +  ERG V+EE R  + A  RM      +   GSKYAERLPIG +++++   P+++K+
Sbjct  178   DAINDERGVVLEESRNGKGAGDRMNKVTIPVQFYGSKYAERLPIGKDEILKNFEPEVLKR  237

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY  WY    MAV+AVGD  D   + + IK HF       +P   P + +P+H++ + + 
Sbjct  238   FYNDWYRPDLMAVVAVGDL-DPAVLEQKIKDHFSGIEPNKNPRERPEFNLPNHQDTKVAV  296

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA  +++ +S K     +   TV DYRD L   +F   +N R  ++++K +PP+ +
Sbjct  297   AQDPEATFASINVSYKDTFESEPTSTVGDYRDDLVNGLFSFMINNRLQELTQKPNPPFIF  356

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
             + S+    + +   AY   +     G + AL+++L E  RV+L+GF E E+   +A   S
Sbjct  357   ASSSYGGTVAKNKNAYSSFAGSAPDGQLGALKAVLEENQRVKLYGFGEAELERAKAAYKS  416

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               ES Y  RD+ +S  L  +Y+  +L        E+  +    LLP I  SEV+   +++
Sbjct  417   SFESFYANRDKTESGRLVGQYVNDYLNGGVTPSPEWRYETTMDLLPGIEVSEVNAKIQKY  476

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
                 +  I    P  T       + +LK+        + P+++  + E ++   P+ G I
Sbjct  477   IHDDNRTIVFTGP--TTENKPTEAEILKVVNEVASAEVAPYEDAVVRENLIETLPAAGSI  534

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
              +    + +G   + LSNG+ V  K T+F +D++L + +SYGG S   + +Y +    + 
Sbjct  535   TKTETNEKLGTTTYTLSNGITVTTKKTDFKNDEILMSAYSYGGSSLYSDEDYMATVFANG  594

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
                E GV G   + +   + GK   V   +G+   + SG  +P DLET  QLV+ L+ T+
Sbjct  595   GLTEAGVAGLSQTDMDKYMTGKLVNVRPSIGSTTENLSGSATPQDLETMFQLVH-LYFTD  653

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYF--FRPIRIRDLQKVN  2121
             +   EE  +  +   +  +     +P T F+N V E+ + GN  +  F      D    N
Sbjct  654   LNKDEEAYSSFISKQKSFVGRMMSNPQTYFSNEVNEMRFKGNPRYAGFPDEAAYDAADYN  713

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILH--FNRDDLK  2295
               KA E +   F +   F   +VGN+D      L  +YL  +P   E  ++  F+  + +
Sbjct  714   --KAYELYKERFANAGDFNFFLVGNVDDQVIMDLSKKYLANLPSTGEKEMYKTFDWKEKQ  771

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
             G          RE+  +   E +  VQ+ +  ++ + +  ED+  V  L + L  +I++V
Sbjct  772   G---------TREITVNKGTEEKSLVQMRWDYDIATYNAEEDLA-VDALGEALTIRIIEV  821

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR + G IY  G    +     S++     +  I+F C PD    L+     EI  L+E+
Sbjct  822   LREQEGGIYGGGARGSM-----SKIPEPGFNFSISFPCGPDNVEKLIAATQKEIAALKEN  876

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS  2760
             GPSD  ++ V E     ++  L+ N YWL+ ++ +
Sbjct  877   GPSDIILNKVKEGYLLEYKEDLKSNRYWLNNLVSA  911



>ref|WP_016193858.1| putative Zinc protease [Arcticibacter svalbardensis]
 gb|EOR96204.1| putative Zinc protease [Arcticibacter svalbardensis MN12-7]
Length=924

 Score =   395 bits (1015),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 253/872 (29%), Positives = 437/872 (50%), Gaps = 22/872 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG TYY+R N++PK R  L LA++AGS+LE + ++G+AH +EH++F+ T+ Y 
Sbjct  18    VRTGKLANGFTYYIRKNTEPKNRVQLYLALKAGSILENDTQQGLAHFMEHMSFNGTKNYP  77

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+  G  FGA  NA TS DETVY+L +P D PELL   + I+ +++ +     
Sbjct  78    KNELVNYLQKSGIRFGADLNAYTSFDETVYQLPLPTDDPELLKNGMQIMRDWAQDALLDP  137

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++ KERG V+EE R  + A  RMQ+ +   ++  S+YA+RLPIG ++V+    P  + Q
Sbjct  138   SEITKERGVVLEEKRLGKGAQERMQNKYLPAILNQSRYAKRLPIGTDEVLNNFKPATLTQ  197

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     A+I VGD  D   + ++IK  F    +P + P    Y +P   + +F  
Sbjct  198   FYKDWYRPNLQALIVVGDI-DVAQMEKMIKDKFSDLKNPANAPKRIEYKIPLLNKNQFIA  256

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E   +   +  K P  E+ T  D R+ +  S++   ++ RF ++ ++ DPP+    
Sbjct  257   VTDKEMQYTVAQVIIKHPGTEIITTTDLRNSIIRSLYNQMMDARFSELMKQADPPFLQGG  316

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             +     +  + A       K     +  +++ TE+ +V+  GF+  E++ V+   ++ +E
Sbjct  317   SDIGNFLAGLDAATAVVVAKPGELEKGFKAVFTELEKVKKFGFTSTELNRVKETYLTGME  376

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
             +A  E+D+  S +   EY+Q FL+     GIEYE    K  LP +S +EV+  ++R+ T 
Sbjct  377   AALKEKDKTSSENYVQEYVQLFLKGSASPGIEYEYNYAKKTLPGVSLAEVNGLTKRYLTD  436

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
              +  +  + P          ++V          ++  + ++   + ++ VKP PG I+ +
Sbjct  437   VNRDVIIMAPEKDLASLPKEAIVNSWIKDVTNSNVLAYIDQISDKPLMDVKPQPGKIVAE  496

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
              +   VG  E  LSNG++V  K T+F +D++L   FS GG S  P+S Y S S  S +  
Sbjct  497   KKDDKVGFTELTLSNGVKVILKPTDFKNDEILINAFSPGGTSLYPDSLYESASWASALVA  556

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
               G+  +    L  +L GK   +   +       +G  +P DLETA QL+  L+ T    
Sbjct  557   RSGLASFNSIQLPKLLNGKLVSINPYITERTEGIAGSSAPKDLETAFQLI-NLYFTQPRL  615

Query  1960  GEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKA--  2133
              +E    V+Q    A+  +  DP + F++ +  +  GN    R      L+K+N  KA  
Sbjct  616   DQEIFQSVIQQQRGALANRSDDPNSVFSDTISAV-MGNHNVRRTGPT--LEKLNQVKADQ  672

Query  2134  -CEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFK  2310
               + + + F D   FT   VGN D     PL+ QYLG +P           ++ + L   
Sbjct  673   VLKVYKDRFADAGDFTFSFVGNFDIEKIKPLLEQYLGSLPTTKR------VEEARDLNIN  726

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
              P  ++ + V+    E + +V+L F          E+ + +  L+++L+ K++  LR + 
Sbjct  727   APLGLLEKKVYKGQ-EPKATVRLVFGGYYTYN--AENNNQIDALAEVLQIKLIDRLREEE  783

Query  2491  GQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDE  2670
               +Y+ G          ++    +    ++F C P+    L+   LDEI +L+ +G    
Sbjct  784   SGVYSPGARASY-----TKFPKNKFSFTVSFGCGPENVDKLIAATLDEINKLKTNGAQAS  838

Query  2671  DVSTVLEIEQRAHENGLQENCYWLDRILRSYQ  2766
             D+   L  E+R+ E  L++N +W   +  SYQ
Sbjct  839   DIGKFLAEEKRSTEVQLKQNGFWSGYLSSSYQ  870



>ref|WP_038493568.1| peptidase M16 [Janthinobacterium agaricidamnosum]
 emb|CDG83860.1| insulinase family protein [Janthinobacterium agaricidamnosum 
NBRC 102515 = DSM 9628]
Length=948

 Score =   395 bits (1016),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 258/877 (29%), Positives = 445/877 (51%), Gaps = 27/877 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N KP+ +  L L V+AGS+LE+E+++G+AH  EH+AF+ +  + 
Sbjct  37    VTVGKLANGLTYYIQKNGKPEKKVELRLVVKAGSILEDEDQQGLAHFTEHMAFNGSTHFK  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++++ +L+SIG +FGA  NA TS DETVY L +P DK E L +   +L +++  +  ++
Sbjct  97    RNELISYLQSIGVKFGADLNAYTSFDETVYVLPIPTDKKENLERGFLVLEDWAHGLSFND  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++ ER  ++EE R  + A  RM       ++ GS+YAER+PIG E +I+      +++
Sbjct  157   ADIDSERAIILEEARLGKGAGDRMNKVLLPKLLNGSRYAERMPIGKEDIIQHFHYDAIRR  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+ VGD  +  +  ++I+AHFG  T+P +  P  Y  VP  ++     
Sbjct  217   FYRDWYRPDLMAVVVVGDI-EPAAAEKMIQAHFGKLTNPVNERPRLYAKVPVRDQTEALV  275

Query  880   FVESEAAGSAVMISCKMPVDELK---TVKDYRDLLAESMFFHALNQRFFKISRKKDPPYY  1050
               + EA  ++V I  + P+ E +   T+ DYR  + E+++   L  R  +++++ +PP+ 
Sbjct  276   ITDKEADSNSVFI--RYPIREAREPVTIADYRQKMIENLYGGMLGARMQELTQQANPPFI  333

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
                     LVR  +++   +   + G V A+ +++ E  R R  GFS+ E+   RA ++ 
Sbjct  334   QGGGGIGKLVRGYESFSAYAMIGKAGVVPAINALVQEDERARRFGFSQAELDRARANMLR  393

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSE-R  1407
               E  Y ERD+  S++   E++++FL  E + GI  E    + LLP +S +EV++ +  +
Sbjct  394   NYERMYKERDKSDSSAYVAEFMRNFLERESIPGIANEYSYARELLPQVSLAEVNQVAATQ  453

Query  1408  FGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIP--PWDEENIPEEIVSVKPSP  1581
                    ++  +     A  D +      +   +  + +P     E+ + ++++   P  
Sbjct  454   IPAGQKKLVVYMGTEHGANSDGVPGSASLLAAVDAAERLPLVARQEKVLSKQLMDAPPPA  513

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I  +     +G  E  LSNG++V  K T+F +DQVL +   +GG S  P+++ F+   
Sbjct  514   GAIASEKTIAELGVTELTLSNGVKVMLKPTDFQNDQVLMSATRFGGQSLFPDADVFNARY  573

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
              ++IAG++G+  + P  L  MLAGK   +G  LG    S  G  S +D+ET LQLVY  F
Sbjct  574   AASIAGQMGLKTFSPFDLQKMLAGKTVYLGASLGNLSESLRGGSSSADIETMLQLVYLNF  633

Query  1942  TTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYG-NSYFFRPIRIRDLQKV  2118
             T   +      + + +  + A +   + P   FA+ V+   +  N    +  R  D  KV
Sbjct  634   TAPRKDSAVYQSFISRQQDMARNNMAQ-PEAVFADTVQSALFNDNPRVAKVARPEDFDKV  692

Query  2119  NPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKG  2298
                +  E +   F      T  IVG+ D A   PLI  YL  +P  +   +     DL  
Sbjct  693   GLDRTLEIYRQRFSSAKDMTFFIVGSFDLARIKPLIATYLASLPAGN---IRTTYQDLGV  749

Query  2299  LPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHF-VGFLSKLLETKIVQV  2475
              P +    ++++ V +   EA+  V + F     +    ED +  +  L++++  ++++ 
Sbjct  750   RPVE---GVVKKQVFAG-AEAKSDVSITF---TGNAAYGEDANMKLMALTEVMNIRLIEE  802

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR K G IY  G+   L     S+       I  N    P+    ++    D I ++Q D
Sbjct  803   LREKRGLIYGGGLRADL-----SKFPYGHYTISANLPTGPEKVDQVIASTFDVIRQMQAD  857

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQ  2766
             GP   D+  V E   +     L+EN YWL+R+  + Q
Sbjct  858   GPLASDLDKVKENWIKNQGKSLRENSYWLNRLQGAVQ  894



>ref|WP_035820302.1| peptidase M16 [Janthinobacterium sp. RA13]
Length=947

 Score =   395 bits (1015),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 266/933 (29%), Positives = 458/933 (49%), Gaps = 38/933 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N++P  +  L L V+AGS+LE+++++G+AH  EH+AF+ +  + 
Sbjct  37    VTVGKLPNGLTYYIKKNARPAQKVELRLVVKAGSILEDDDQQGLAHFTEHMAFNGSTHFK  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              ++++ +L+SIG +FGA  NA TS DETVY L +P +K E L +   +L +++  ++ + 
Sbjct  97    RNELISYLQSIGVKFGADLNAYTSFDETVYVLPIPTNKKENLEKGFLVLEDWAHGLKFNP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+  ERG V+EE R  + A+ RM    +  ++ GS+YAER+PIG E V++T  P+ +K+
Sbjct  157   ADINSERGIVLEEARLGKGASDRMNKVLYPKLLNGSRYAERMPIGKESVLKTFKPEAIKR  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+ VGD    Q+   +I+ HFG   +P  P P  Y  VP   +     
Sbjct  217   FYKDWYRPDLMAVVVVGDVEPKQAEA-MIRQHFGKLKNPAKPRPRLYAEVPQRSQTEALV  275

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA    V I   +    E  T+ DYR  + E+++   L+ R  +++++ +PP+   
Sbjct  276   ITDKEAPDDTVFIRYPIRAAQEPVTIADYRRQMIENLYGQMLSARMQELTQQANPPFIQG  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              ++   LVR  +++   +   + G   A+++++ E  R R  GFS+ E+   R  ++   
Sbjct  336   GSSMGKLVRGYESFSAYALLGKGGVQPAVDALVQEDERARRFGFSQDELDRARKNMLRNY  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E AY ERD+  S     EY ++FL  E + GI  E    + LLP ++  E+++   +   
Sbjct  396   ERAYSERDKSDSAGFVAEYSRNFLEQEAIPGIANELLYAQELLPQVTLQEINETVAKVIP  455

Query  1411  -GTSSSCVIKTIEPR---ATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                    V    EP+   A +TV   + ++  +   EQ Q+I P  E+ +  +++   P 
Sbjct  456   DQQKKLVVFMGAEPKAGGAASTVPTQQQLLDAVAKAEQ-QTIEPRTEKVLASKLMDAPPD  514

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G I+ +     +G  E  L NG+RV  K T+F +DQVL     +GG S   +++ ++  
Sbjct  515   GGSIVAEKLNSAIGVTELTLGNGVRVLLKPTDFKNDQVLMGSTRFGGQSLFGDADIYNAR  574

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
               S + G +G+    P  L  +LAGK   VG  LG     F G  S +D+E  LQLVY L
Sbjct  575   YASAVVGSMGLKDLAPLDLQKVLAGKTVNVGASLGELSEGFGGSASSADVEAMLQLVY-L  633

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI-RIRDLQK  2115
             +  +V          +   ++        P   F + ++   +G++     + R  D  K
Sbjct  634   YFNDVRKDAGLYQSFIGKQQDLAKNSMAQPEAVFYDAIQHAMFGDNPRVDGVPRAADFDK  693

Query  2116  VNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLK  2295
             V   ++ + F   F      T +  G+ +     PLI  YLG +P    P  H  RD   
Sbjct  694   VGLDRSLDIFRQRFSSARGMTFIFAGSFELDKIKPLIASYLGTLPVADVP--HAYRD---  748

Query  2296  GLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQV  2475
              +  +  + ++++ ++    E + ++ + F  ++   D  E    +  L ++L  K+++V
Sbjct  749   -VGMRPVTGVVKKDIYMGS-EPKSTISITFNGDVAYSD--EQKLTLQALGEVLNLKVIEV  804

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR K   IY  G    +G +           + +N    P+    ++  A  EI +++ D
Sbjct  805   LREKMSMIYGGGFETSMGQHPYGHY-----SVALNLPTGPENVDKVIAAAFAEINKMKTD  859

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY-QSRIYSGDVGDSFKVQDEARSKV  2832
             GPS  D+  V        +  L+EN YW+ +++ S  Q R    D     + +   R+  
Sbjct  860   GPSAADLEKVKLNWITRQQKSLRENRYWMSQLMGSVTQGR----DPAHILRYEQRVRA--  913

Query  2833  RKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
                +TP   ++A QR L       Y  V+L P+
Sbjct  914   ---ITPQAVKLAAQRYLDM---HNYVQVVLYPE  940



>gb|AHG90196.1| peptidase M16 domain protein [Gemmatimonadetes bacterium KBS708]
Length=939

 Score =   394 bits (1013),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 270/924 (29%), Positives = 445/924 (48%), Gaps = 33/924 (4%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             GRL NG+ Y +R N +P+ R AL LAV AGSVLE+E++RG+AH VEH+AF+ T ++    
Sbjct  44    GRLPNGVRYLLRRNGRPEKRVALRLAVNAGSVLEDEDQRGLAHFVEHMAFNGTRRFAKQG  103

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             IV FLE  G  FG   NA TS DETVY+L VP D  ++L  A+ ILA+++  +     ++
Sbjct  104   IVDFLERSGVRFGPDLNAGTSFDETVYQLDVPSDSAKVLETAVQILADWAHGLTFDSAEV  163

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIG-LEKVIRTVSPQIVKQFY  705
              +ERG V+EE+R  + A  R+ +    ++++GS+YA RLPIG    ++R  +P++ ++FY
Sbjct  164   VRERGVVLEEWRQGQGAGSRIANQQRPIVLQGSRYAVRLPIGDTATIVRADAPRL-RRFY  222

Query  706   KKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFV  885
               WY    M VIAVGD  D + + +L+   F    +P  P   P + VP+H  P  S   
Sbjct  223   DTWYRPDLMTVIAVGDA-DPRRLRDLVAREFSSIPAPRAPRARPTFDVPAHAAPLVSVVT  281

Query  886   ESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAA  1065
             + EA  + V +  K P   L TV+  R  + E++    LN+R  +I+++ DPPY      
Sbjct  282   DREATSTLVSVLYKQPARPLGTVRAARREIVEALADIMLNERLSEIAQRADPPYLGAGVG  341

Query  1066  ADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESA  1245
                 VR  + +  ++  ++ G +  L ++LTEV RVR  GF+  E+   R  L+   E  
Sbjct  342   GGQWVRSAELFSASARVRDDGVLRGLAAVLTEVERVRRTGFTASELDRARRNLLRAFEQQ  401

Query  1246  YLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSS  1425
             Y ERD+  S +L    + + L  +P+    +E    + ++P ++ ++V+         +S
Sbjct  402   YAERDKTSSDALVSRLVDYALTGDPLPSPAWEWAEAQRVVPAVTLADVNASLAARLDGAS  461

Query  1426  CVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFE  1605
              VI    P +       R  +L +       ++  + +      +V   P+ G I     
Sbjct  462   RVITVQGPESARGAMPTREQLLAVFDQVSGATLAAYADSASDVPLVPTMPTAGRITAART  521

Query  1606  YQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEI  1785
                +G  E+ LSNG RV  K T+F  D+VLF  F  GG+S + +++Y + S+ + I  + 
Sbjct  522   IPELGVTEWTLSNGARVLLKPTDFKADEVLFQAFGPGGVSAVGDTDYVAASLAAQIVPQG  581

Query  1786  GVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGE  1965
             G+  +    L   LAG  A V   +G+  +   G  SP DL T  +L Y L  T      
Sbjct  582   GLGAFDRIALQKRLAGTAATVSPFIGSRWQGLVGSSSPKDLRTMFELAY-LTLTAPRADS  640

Query  1966  EDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEYF  2145
                  V    +  +  +   P   F + V      +    RP+    +++++  +A   +
Sbjct  641   TAYAAVRARLDAFLATRGNSPQAVFQDTVMVTMAQHHPHARPLTPALVREIDLPRAMRVY  700

Query  2146  NNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSI  2325
              + F     FT V+VG   P +  PL+ QY+  +P PS P     RDD      + P+ +
Sbjct  701   RDRFAGAGGFTYVLVGAFQPDSVRPLVEQYVASLPAPSRP--DSARDD----GMRPPTGV  754

Query  2326  IREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQI  2499
             +   V   + E + S QL F  P++    + +     +G L ++LE ++ + +R      
Sbjct  755   VERTVRKGL-EPRASTQLVFTGPMQYSRAEHVA----LGALGEVLEIRLRERIREALSGT  809

Query  2500  YNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVS  2679
             Y  GVS         RV      + I F+  PD +  L    L E+  ++  GP+ +++ 
Sbjct  810   YGVGVSA-----SAQRVPWPSYQLAIGFTSAPDRADELTTAVLQELDSMRTKGPTADEIQ  864

Query  2680  TVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTA  2859
              V E   R  E   ++N +WL  +  + QS       G+  +   + R ++ + LTP   
Sbjct  865   KVRETGLRELETAEKQNRWWLGSLAEAVQS-------GEDPRTIVDGREQLAR-LTPALV  916

Query  2860  QMALQRILPFPCKKQYTVVILMPQ  2931
             Q A ++ L       Y    LMP+
Sbjct  917   QEAARKYL---NAANYAHFTLMPE  937



>ref|WP_013445902.1| peptidase m16 domain-containing protein [Paludibacter propionicigenes]
 ref|YP_004043518.1| peptidase m16 domain-containing protein [Paludibacter propionicigenes 
WB4]
 gb|ADQ80533.1| peptidase M16 domain protein [Paludibacter propionicigenes WB4]
Length=938

 Score =   394 bits (1012),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 255/925 (28%), Positives = 468/925 (51%), Gaps = 33/925 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             + YG+LDNGLTYY+R+N++PK RA   +A   GS+LE + + G+AH +EH+AF+ T+ + 
Sbjct  35    IRYGKLDNGLTYYIRANAEPKQRAEFFIAQNVGSILENDNQNGLAHFLEHMAFNGTKNFP  94

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRAS  516
                ++ FLE  G +FG   NA T+ DETVY L  VP  +  ++  A+ +L ++SS +   
Sbjct  95    GKGVISFLEKHGVKFGENINAYTALDETVYNLSDVPTIQEGVVDSALLVLHDWSSYITLD  154

Query  517   EHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
             + +++ ERG +MEE+R    A+ RM      +   GS+Y  R  IG   VI+     +++
Sbjct  155   DKEIDSERGVIMEEWRTRFGADRRMWKESNKIKYPGSQYGIRDGIGDTAVIKHFKYDVIR  214

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              +YKKWY     A++ VGD  D   +   IK  F       +    P Y V  +++P  +
Sbjct  215   DYYKKWYRPDLQAILVVGDI-DVDKIEAKIKTLFSSIPKKENAGERPIYTVADNDKPIVA  273

Query  877   CFVESEAAGSAVMISCK---MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY  1047
                + EA  + + +  K   +P +   +V+ Y   +A+++    + +RF +I+++ + P+
Sbjct  274   LVSDKEANVTRITLEYKHEKLPAEIQLSVQGYAKGIADNLISTIIGERFNEITQQANAPF  333

Query  1048  YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLM  1227
                 A    LV+   A+ M +  +E    E L ++L E  +++  GF+  E+   +  ++
Sbjct  334   VGAMAGYGELVKSKDAFTMLAVPREGKEAEGLNALLLEAEKIKRFGFTNAELERAKTNML  393

Query  1228  SEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER  1407
              + E++Y +RD  ++ SL  EY+++FL NEPV GIE+E Q  + +LP+++ + +++ ++ 
Sbjct  394   KQFETSYKDRDHRKNNSLVTEYVRNFLHNEPVPGIEWEYQTIQAILPNLTVNVINQVAKS  453

Query  1408  FGTSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
             + T  + ++    P + T  V +   V+  I T   K  +    EE + + +V   P  G
Sbjct  454   YITEKNLLVTITSPEKPTVKVPNNDQVLAAI-TEAGKAQLTAKAEETLNKPLVEKAPVAG  512

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYF-SCSM  1761
              ++++ +   +G  E+ LSNG+RV +K T F  D++L + +S GGLS++ +     S ++
Sbjct  513   KVIKKGQNPKLGTTEWTLSNGVRVIFKPTTFKQDEILLSAYSEGGLSKVKDISLLPSATL  572

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
              STI G  G+  Y    L  +L GK   V  ++  Y   F G  S +D ET +QLVY  +
Sbjct  573   ASTIVGNNGLGSYSQVDLNKILTGKVVSVQPQITNYEEGFGGKSSVNDFETMMQLVYLYY  632

Query  1942  TTNVEPGEED--VNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQK  2115
             T    P ++D   + ++ M   ++     DP  AF++ +  L    +     + +  + K
Sbjct  633   TA---PRKDDNAFSALINMYRTSLANSATDPRKAFSDTINTLVTNRNPRTVIMNLNTITK  689

Query  2116  VNPYKACEYFNNCFKDPSTFTVVIVGNIDPAT--AFPLILQYLGGIPRPSEPILHFNRDD  2289
             V+  KA  +F   F +P+ FT ++ GN+DP        I  YLGG+ + ++ +  F  ++
Sbjct  690   VDQDKALAFFKERFANPADFTFILAGNVDPNNVKVSNAICTYLGGL-KTTKVLEKFTDNN  748

Query  2290  LKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIV  2469
             ++      P   +       M  A+ S  + +   +     + +   VG +  +L+ +  
Sbjct  749   IRK-----PQGKVSNTFEKDMKTAKASNLVLYNGAMPYN--IVNNTLVGAIGDILDIRYT  801

Query  2470  QVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQ  2649
             + +R K G  Y  GV     G     + N    + + F  DP   + L+ +  DE+  + 
Sbjct  802   ESIREKEGGTYGVGVR---AGISHQPIDN--ATLLMQFDTDPAKQAKLIGMIYDEVNEIV  856

Query  2650  EDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARS-  2826
             ++GP  EDV  V +   + +   L+EN +WL+ +   Y ++I   +  D++K   EA + 
Sbjct  857   KNGPKTEDVQKVKQNLLKTYNENLRENGWWLNTVESYYHNQI---NYVDNYKNAVEAITP  913

Query  2827  -KVRKLLTPLTAQMALQRILPFPCK  2898
               ++  L  L +Q  +  ++  P K
Sbjct  914   QSIQSTLAKLVSQGNVMEVVMKPTK  938



>dbj|GAK90566.1| probable zinc protease PqqL [Nonlabens ulvanivorans]
Length=969

 Score =   395 bits (1014),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 269/932 (29%), Positives = 462/932 (50%), Gaps = 40/932 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGL YY+++N KP+ +  L LA+ AGS+LE+++++G+AH++EH+ F+ T  + 
Sbjct  68    VKTGVLSNGLIYYIQNNGKPEDKVELRLAINAGSILEDDDQQGLAHMMEHMNFNGTTNFQ  127

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+ IG +FGA  NA TS DETVY L +P D PE L    +IL++++       
Sbjct  128   KNELVDYLQGIGVKFGADLNAYTSFDETVYILPIPSDDPEKLDNGFTILSDWAGGALLET  187

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               +  ERG ++EE R  + AN RM    + ++   SKYAERLPIG + +I+  +P  +++
Sbjct  188   DAINDERGVILEESRTGKGANDRMNKVTFPVIFANSKYAERLPIGKDDIIQNFNPDAIRR  247

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             F K WY    MAVIAVGD  D  ++   IK HFG   +  +P     + +P+HEE   + 
Sbjct  248   FQKDWYRPDLMAVIAVGDL-DVATLEAKIKEHFGDIPAAENPRKREEFGLPNHEETLIAI  306

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA+ + V I  K     +   TV D RD L   +F   +N R  +++ K +PP+ +
Sbjct  307   AQDPEASFAQVRIQYKDSKKAEPTTTVSDLRDDLVNGLFSQMMNNRLQELTTKPNPPFIF  366

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S+     +R   +Y   +     G + AL+++L E  RV+L+GF   E    +    S
Sbjct  367   GSSSYGGTGIRGKNSYSSFAGTAPDGQLTALKTLLEENQRVKLYGFQASEFERAKTSYKS  426

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               E+ Y +RD+ +S  +   Y+ HFL  + V  +EY  ++   L+P I+  E++   + +
Sbjct  427   FYETFYKDRDKRESGRIVGAYVNHFLVGDMVPSVEYSYEMAMKLMPTITIEEINAKMDDY  486

Query  1411  --GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
                 + S V    E     T  D    +LKI        I  + +  + E ++   P+ G
Sbjct  487   IHDDNRSIVFTGPETENKPTEAD----ILKILNDVANSKIDNYQDTEVRENLIEKLPTAG  542

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMG  1764
              I +  +   +G   + LSNG  +  K T+F +D++L + +SYGG S   + EY + +  
Sbjct  543   AIAKTTKNDKLGTTTYTLSNGATITTKKTDFKNDEILMSAYSYGGTSLFSDEEYLAVNQA  602

Query  1765  STIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFT  1944
                  E G+ G   + +   ++GK   V  ++G+   +F+G  +P DLET  QL++ L+ 
Sbjct  603   MGGVTEGGIAGLNQTDMGKYMSGKLVRVSPRVGSISENFNGSSTPDDLETMFQLIH-LYF  661

Query  1945  TNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNP  2124
             T++    E     +   +  + +    P + F+N V    +G+S  +      ++     
Sbjct  662   TDINKDTEAYKSYIDKQKSFLGSYLSRPESYFSNEVNNYRFGSSPRYTGFPTPEMMDAAD  721

Query  2125  Y-KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
             Y KA + F   F D   F   +VGNID A        Y+  +P   +  ++      K  
Sbjct  722   YDKAYQLFKERFSDAGDFNFYLVGNIDDAQIQEFAKTYIASLPSSGKKEMY------KIN  775

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
              ++  +S  R+ V    +E + +VQ+ +  + +S    E++     L ++   KI++ LR
Sbjct  776   EWREDTSKPRKKVVKKGLEEKSTVQIVWTGKAESYSAKENMALDA-LGEIATIKIIETLR  834

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              + G IY  G    L     S++   R +  I+F C PD    LV  AL+E+  ++ DGP
Sbjct  835   EQEGGIYGGGARGSL-----SKITYPRYNFSISFPCGPDNVDKLVAAALNELEMIKNDGP  889

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDV--GDSFKVQDEARSKVR  2835
             +D+D++ V E     ++  L+ N +WL+         +YS D    D  K+ D   S  +
Sbjct  890   TDKDMNKVKEAYLLEYKENLESNRFWLN--------SLYSADYEQKDPNKILDFEASVAK  941

Query  2836  KLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
               LT    Q A ++ +     + Y + +L+P+
Sbjct  942   --LTKADVQAAAKKYI----DENYLLAVLLPE  967



>gb|ADE77112.1| unknown [Picea sitchensis]
Length=269

 Score =   372 bits (954),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/265 (70%), Positives = 215/265 (81%), Gaps = 0/265 (0%)
 Frame = +1

Query  2269  LHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSK  2448
             +HFNRD+LK LPF FP S++REVV S MVEAQCSVQ+ FPVELK   +ME++HFVGFLSK
Sbjct  1     MHFNRDELKALPFTFPKSVVREVVRSQMVEAQCSVQITFPVELKGPHVMEEIHFVGFLSK  60

Query  2449  LLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLAL  2628
             LLET+I+QVLRFK+GQIY+  VSVFLGGNKPSR GN+RGDI +NFSCDPD S  LV L+L
Sbjct  61    LLETRIMQVLRFKHGQIYSVNVSVFLGGNKPSRTGNVRGDITVNFSCDPDSSWRLVGLSL  120

Query  2629  DEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKV  2808
             DEIL LQE GPSD DVST+LEIEQRA+ENGLQEN YWLDRILR YQSRIY+GD+  S K 
Sbjct  121   DEILCLQEQGPSDGDVSTILEIEQRAYENGLQENGYWLDRILRGYQSRIYAGDLNVSLKA  180

Query  2809  QDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLKSLVCSAPKRYC  2988
             QDE R+KVR  LT +T Q ALQRILP PC KQYTVVILMP+  R++RLKS++ S  KR  
Sbjct  181   QDEWRNKVRSFLTKVTMQEALQRILPSPCTKQYTVVILMPKLPRLQRLKSVLFSGEKRLG  240

Query  2989  TDAKIlagtagvavllltlWRYSRS  3063
              + K+L GTAG  VL    W+YSR+
Sbjct  241   IEGKVLIGTAGTLVLAAFWWKYSRA  265



>gb|AHF14446.1| peptidase M16 [Niabella soli DSM 19437]
Length=940

 Score =   392 bits (1006),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 256/888 (29%), Positives = 444/888 (50%), Gaps = 61/888 (7%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NGLTYY+R N KP+ +  L L V AGS+LE++ ++G+AH+ EH+AF+ T+ +  +D
Sbjct  42    GKLSNGLTYYIRQNKKPENKVELRLVVNAGSILEDDNQQGLAHMAEHMAFNGTKNFKKND  101

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             I+ FL+SIG  FG   NA TS DETVY L +P DKP  L +   IL +++  V  +  D+
Sbjct  102   IISFLQSIGVGFGNDLNAYTSFDETVYMLPIPTDKPGNLEKGFQILEDWAHNVTYNTDDI  161

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
               ER  ++EE R  + A  RM    +  +  GSKYA+R+PIG++ +IRT +P ++++FYK
Sbjct  162   NGERKVILEESRMGKGAEDRMFRQIYPKLFAGSKYADRIPIGIDSIIRTYNPDLIRKFYK  221

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY    MAVI VGD  D  +   ++K HF     P +  P  +  V  +         +
Sbjct  222   DWYRPDLMAVIVVGDV-DPATAETMVKKHFSAIADPANERPRTFADVKPYSSNEGMVVTD  280

Query  889   SEAAGSAVMIS-CKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-----Y  1050
              EA    V ++    P  E +TV +Y   L +++F   LNQR   ++++ +PP+     Y
Sbjct  281   KEATNYTVNVAYSAFPSKEAQTVGEYEADLIKNIFTSMLNQRLRDLTQQANPPFLYGYTY  340

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S A +       A + T++  +KG    L  ++ E+ + +  GF++ E+  V+ ++ +
Sbjct  341   LGSYARNYDQFNAGAGVATAADAQKG----LMVLVEEIEKAKRFGFTQSELGRVKKMMEA  396

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E ++ ERD+ +S++  +EY+++FL NEP  GI  E++  K LLP I+  EV+ +++  
Sbjct  397   SMEKSFNERDKTESSNYVNEYVRNFLTNEPTPGIATESEYYKELLPQITLKEVNNFAQSL  456

Query  1411  GTSSSCVIKTIEPRATA--TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
               + +  +    P AT   T  +L + V  +     +  +    E+ I  ++++ +P PG
Sbjct  457   QKNPNYFVTLTGPAATGLPTTTELVNTVAAV---AARTDLKADVEKTIATDLLTKQPQPG  513

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMG  1764
              I+++     +G   ++LSNG  V +K T+F DD++   G  YGG +E   ++ F+    
Sbjct  514   KIVKETADAKLGTKTWELSNGTTVTFKKTDFKDDEIQMGGRRYGGTNEYGVADKFNAQYA  573

Query  1765  STIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVY----  1932
              ++ G +G   + P+ L   LAGK    G    A    FSG  S  DLET LQL+Y    
Sbjct  574   LSVVGAMGYGNFSPTDLQKALAGKTVSAGASFTAITDGFSGSSSKKDLETMLQLLYLKAT  633

Query  1933  ------QLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI  2094
                    L+ + V+  +  V  ++            DP  +F + + +  Y N+    P+
Sbjct  634   APRIDTGLYRSFVQKNKAGVAFILA-----------DPQASFVDTLLKTVYQNN----PL  678

Query  2095  ------RIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRP  2256
                   R     ++N  +A + +   F D S      VG+ID A   PL+ +Y+GG+P  
Sbjct  679   APTAIPRPEYFDQINMSRAIQIYKEHFGDASGMQFAFVGSIDEAVLKPLVEKYIGGLP-A  737

Query  2257  SEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVG  2436
             ++    F  + ++    K   ++ +      ++ +  S Q  +     S D+  ++  V 
Sbjct  738   TKRRFAFKDNGVRPAKGKVDLTVYKGEAEKSLILSMISGQAPY-----SPDLALNMRAV-  791

Query  2437  FLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLV  2616
               S +L  ++++ LR K   IY+ G S  L      +               P    TL+
Sbjct  792   --SDVLNIRVIEELREKIQGIYSGGTSARL-----DQYPYAHFTFFAQLPTGPAAVDTLL  844

Query  2617  DLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRS  2760
                 +E   ++ +GPS E+++ V +     ++  +++N  WLD IL +
Sbjct  845   KAMTEETNSIKNNGPSAENLNKVKQQWIEHNKVSMKQNGTWLDYILSA  892



>ref|WP_020896085.1| putative Zinc protease pqqL [Winogradskyella psychrotolerans]
 gb|EPR74306.1| putative Zinc protease pqqL [Winogradskyella psychrotolerans 
RS-3]
Length=947

 Score =   391 bits (1005),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 268/880 (30%), Positives = 445/880 (51%), Gaps = 44/880 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NGLTYY+++N KP+ +  L L + AGS+LE+E++ G+AH +EH+ F+ T+ + 
Sbjct  47    VKTGTLSNGLTYYIQNNPKPENKVELRLVINAGSILEDEDQLGLAHFMEHMCFNGTKNFK  106

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P D PE L +   I+ +++     ++
Sbjct  107   KNELVDYLQSIGVKFGAHLNAYTSFDETVYILPIPSDDPEKLEKGFQIIEDWAHNALLTD  166

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++ ERG V+EEYR  + A+ RM   +   MM GS YAERLPIG ++ + T   + +K+
Sbjct  167   EEIDNERGVVLEEYRLGKGADERMMQEYLPKMMHGSMYAERLPIGTKENLETFKYESLKR  226

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAVIAVGD  D   + E IK+HFG+  +P +P P P + +P+H+E   + 
Sbjct  227   FYKDWYRPDLMAVIAVGDI-DVSVLEEKIKSHFGHIKNPKNPKPRPSFDLPNHKETFVAI  285

Query  880   FVESEAAGSAVMISCKMPVDELK--TVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA  S V +  K  V+     T  DYR  + E++F   +N R  +I    +PP+ Y
Sbjct  286   ESDKEAPFSNVQLMFKDKVNSKPDVTYADYRKSMVENLFSQMINNRLDEIRNGDNPPFVY  345

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               +       R   A+  ++     G ++AL+++L E  RV  HGF E E +  +  +++
Sbjct  346   GFTYYGGTYARTKNAFQSSAMTSPTGQLDALKTLLVENQRVLQHGFFEGEFNRAKKDIIA  405

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E A+ +RD+M+S  +   Y+ +FL   P+  +++        LP I+  EV+   + +
Sbjct  406   NMERAFKDRDKMESNRIVGRYVSNFLEQNPIPSMDWRFDFMNAQLPTITLDEVNALIKSY  465

Query  1411  GTSSSCVIKTIEPRATATVDDLRSV----VLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                 + VI    P      DDL  V    VL++        + P++++ +   +++  PS
Sbjct  466   IKEDNRVIILTGPEK----DDLEQVKEAEVLELLDSVNAMDLKPYEDKAVASSLMTKMPS  521

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G I      + +G     LSNG  V YK T+F +D++LF  FSYGG S   + +Y + S
Sbjct  522   KGSIADYKTDETLGTTTLLLSNGATVTYKKTDFKNDEILFDAFSYGGTSLYTDEDYKATS  581

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
               +    E GV G+    L  M++GK A V   +G Y    SG+ +P DLET  QL +  
Sbjct  582   NANGGLTEAGVNGFDKIELGKMMSGKIANVRLSIGTYSEGLSGNTTPKDLETLFQLTHLH  641

Query  1939  FTTNVEPGEEDVNIVMQMAEEA---IHAQERDPYTAFANRVRELNYG-NSYFFRPIRIRD  2106
             FT       +D N     A++    +      P   F +++ E  YG N  +       D
Sbjct  642   FTA----LNKDENAFKSFADKQKAFLGNLLSSPQFYFQDQLSEFIYGKNPRYTGFPTAED  697

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD  2286
             +   +   A E +   F D   F    VGNID      L   YL  +P  ++    +N  
Sbjct  698   MDNADYNLAYEKYKERFADAGDFHFYFVGNIDETKFVELCETYLASLPS-TKSNESYNVS  756

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLET  2460
             D +  P       I E    P    + SV++ +  P +       ++ H +  L+++L  
Sbjct  757   DFR--PLTGSHKKIIEKGEDP----KSSVRITYHGPTDYSE----KEAHALKSLAEVLSI  806

Query  2461  KIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGD---IGINFSCDPDISSTLVDLALD  2631
             K+++ LR + G +Y AG +        + + N+  D     I+F C P+    L+   + 
Sbjct  807   KLIEKLREEEGGVYGAGAN--------ASISNMPYDWFRFNISFPCGPENVDKLITATMK  858

Query  2632  EILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             E+  L ++GP+++D+  V + +   ++  L+ N +WL ++
Sbjct  859   EVDLLVKEGPTEKDLEKVKKAQILDYKEDLKTNRFWLGQL  898



>ref|WP_026327018.1| peptidase M16 [Proteiniphilum acetatigenes]
Length=934

 Score =   391 bits (1004),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 270/919 (29%), Positives = 444/919 (48%), Gaps = 32/919 (3%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L+NGLTYY+R N+ P+ RA   +A + GS+ EE+ + G+AH +EH+AF+ T  +    
Sbjct  33    GKLENGLTYYIRQNNLPENRADFYIAQKVGSMQEEDNQAGLAHFLEHMAFNGTTNFPGKS  92

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRASEHD  525
             ++ +L+  G +FG   NA TS DETVY +  +P     L+  A+ +L ++S+ +   E +
Sbjct  93    MLNYLQDNGIKFGTNINAYTSFDETVYYISNIPTTNKNLVDSALLVLHDWSNAIALEEEE  152

Query  526   LEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFY  705
             LE ERG + EE+R    A  R+ D     M   SKYA R+PIG   VI    P+ ++ +Y
Sbjct  153   LENERGVIREEWRTRGGAQQRLWDQLLPKMYPDSKYANRMPIGSIDVINNFKPEEIRAYY  212

Query  706   KKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFV  885
              KWY      +I VGD  D   + + IK  F       +     YY VP +++P  +   
Sbjct  213   HKWYRPDLQGIIVVGDI-DVDEMEQKIKELFSPIQLDEERAEREYYPVPDNKDPIVAIAT  271

Query  886   ESEAAGSAVMISCK---MPVDELKTVKDYRDLLAESMFFHA---LNQRFFKISRKKDPPY  1047
             + EA  + +M+  K   MP DE +  +     + E +   A   +NQRF +I +K D P+
Sbjct  272   DKEARNTQIMLFYKHDTMP-DEFRNTQ--MGYITEYILNAAAAMMNQRFAEIIQKPDAPF  328

Query  1048  YSCSAAAD--CLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRAL  1221
              S  A  D   + +   A+ + +   E     AL +M+ E  RV+ HGF+  E  V R  
Sbjct  329   TSAFAYNDDYFVAKTKDAWTVVAGSAEDKIESALAAMVRETERVKQHGFTASEYEVARTN  388

Query  1222  LMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYS  1401
             ++   E AY  RD+ +++S   EY++ F   EP+ GIE+E Q  + ++P+I    +++  
Sbjct  389   ILKGYEDAYNNRDKQRNSSYSQEYVRAFTDGEPIPGIEFEYQFLQAVVPNIPVEAINQTI  448

Query  1402  ERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSP  1581
             ++     + VI    P           V+L +    Q ++I P+ EE I E +V+  P+P
Sbjct  449   QQLIGDENIVIAVTGPEKEGLGYPAEDVLLNVLASVQAETIEPYAEEVIDEPLVATPPTP  508

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I++  + + + A  + L NG++V  K T+F DDQ++ TG S GG S     +  +  +
Sbjct  509   GKIIKAEKDEAMDATVWTLENGIKVILKNTDFKDDQIVMTGTSAGGYSHYGAQDPVNSRL  568

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
              S +A   GV  +  + L  +LAGK A     +    + F+G  S  D ET LQLVY  F
Sbjct  569   MSNVATLGGVGNFSATDLPKVLAGKTASAHPGISLTTQDFNGSSSIRDFETMLQLVYLYF  628

Query  1942  TTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVN  2121
             T   +  +   + + +M E  +  QE +P  AF++ V    YG++   + I+  DL+KVN
Sbjct  629   TAPRQDNDAFQSFIQRM-ETQLKNQEAEPMVAFSDSVSSALYGDNPLTKRIKADDLKKVN  687

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               +  E +   F +P +F    VGNID     P++ QYL  +P  +       + +   +
Sbjct  688   YNRIMEMYAERFSNPGSFVFTFVGNIDEEKVRPVVEQYLASLPGKA------GKGEFAKI  741

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
             P  F       +    M   + SV     +  K+   M++   +    ++L+    + +R
Sbjct  742   PMDFQEGSFENIFQREMQNPKASV--FNTITGKTTREMKNRILMSMFDQILDIIYTEKVR  799

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
              + G  Y     V+ GG+  SR    +  + I F  DP+    L  + L+ +     DGP
Sbjct  800   EEEGGTY----GVYAGGSI-SRYPEGQTILQIMFDTDPERMEHLNQIVLNVLKEFAADGP  854

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSF--KVQDEARSKVR  2835
              D D + V E   +++   L+EN YWL+ +   Y    Y  D    +   V    +  +R
Sbjct  855   RDSDFAKVKEYMNKSYNENLKENSYWLNILDNKY---FYGEDNHTQYIETVNAITKDDLR  911

Query  2836  KLLTPLTAQMALQRILPFP  2892
                  L  Q  L+ I+  P
Sbjct  912   SFAKALLDQGNLKTIVMMP  930



>ref|WP_035727097.1| hypothetical protein [Flexibacter elegans]
Length=937

 Score =   390 bits (1003),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 254/883 (29%), Positives = 448/883 (51%), Gaps = 31/883 (4%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G L NG+ YY+R NS+P+ R  L LAV AGS+LE+E++ G+AH VEH+ F+ T+ +  ++
Sbjct  42    GILPNGMKYYLRQNSRPEKRVELRLAVNAGSLLEDEDQLGLAHFVEHMCFNGTKNFAKNE  101

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             IV +L+S+G  FGA  NA TS DETVY L +P DKPE++ Q + IL +++  V     ++
Sbjct  102   IVSYLQSVGVAFGADLNAYTSFDETVYILPIPTDKPEIVQQGLQILEDWAHLVSFEGEEI  161

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG ++EE+R       RM   +  ++  GS+Y ERLPIG  ++I+    + ++++Y 
Sbjct  162   DKERGVIVEEWRSRLGGEERMMRQYLPVLYYGSRYPERLPIGDVELIKNFKHEAIRRYYN  221

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY    MA++AVGD  D   +   IKA FG   +  +P     + VP H E       +
Sbjct  222   DWYRPDLMAIMAVGDI-DLDQMEAQIKAQFGAIPTKQNPRERTVFEVPGHAETLVKVAKD  280

Query  889   SEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAA  1068
              EA  + V +  K P+   +T+ D R+ LA  +    LN R  +  +K+  P  S SA  
Sbjct  281   KEANFTTVRLYYKHPLKPTQTLDDLRNDLAVELVSQMLNARLSEWMQKEGTPLVSASAGD  340

Query  1069  DCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAY  1248
               L R    + + S+  E    EAL+ +L E  R R+HGF+E E+   + +++   E AY
Sbjct  341   GSLGRESSVFQLFSATNESKVREALKILLEEAKRARIHGFTEGELVRAQKVVLQRYEKAY  400

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSC  1428
              +R+  +S  L ++Y+QHFL  +P+ G E+     +  LP++  S ++  ++   +  + 
Sbjct  401   KDRNTTESARLVNQYIQHFLTQQPIPGAEFMYAFVQEQLPNLELSMLNSLAQSLISKENR  460

Query  1429  VIKTIEPRA----TATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
             VI    P        T +D++ ++ +++       + P+ ++ + +++++  P PG I +
Sbjct  461   VIIVTAPEKEELEIPTEEDIQKIIKQVDI----NRVEPYQDKVLADKLMTALPKPGSIKK  516

Query  1597  QFEYQNV-GAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
                   + G   + LSNG+ V  K T F DD++L   ++ GG S L E +       ++I
Sbjct  517   TKNLSELPGVQHWVLSNGVEVIVKPTKFKDDEILVYAYTPGGYSVLTEEQQRHAFFATSI  576

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNV  1953
               E G+  +  + L  ML+GK A V   +    +  +   +P+DLETALQL++ L+ TN 
Sbjct  577   VAEGGIAEFDNTDLQKMLSGKNARVTPFITTTNQGINVSTNPTDLETALQLLH-LYITNP  635

Query  1954  EPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYK-  2130
                E+  N         +     +    F   + +L Y + +   PI +  ++ +N  + 
Sbjct  636   RYSEQAFNTWRDKTAGIVQNLGANTQFYFLVELNKLFYQD-HPRAPIVLPSVEILNSLQA  694

Query  2131  --ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
               A E + N   D S  TVV+ GN+D      L +QYL  +P      +   ++  K L 
Sbjct  695   QTAFEVYKNRLCDASKMTVVVAGNVDETQLRELSVQYLASLP------VSNRKEAPKDLG  748

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
              +F +  + + +     + +  V + +   +      +++  +  L  LL  K+++ LR 
Sbjct  749   LRFTTQPLSQTLQKGS-DPKSYVGIAYGGSMPYS--TQNILKLSALGSLLTNKLIEQLRE  805

Query  2485  KYGQIYNAGVSVFLGGN-KPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
             + G +Y  G +  L  +  PS        + ++F C P+  +TL +    EI ++Q+   
Sbjct  806   EIGGVYGTGANASLTASPNPSYT------VVVSFPCAPENVNTLREAVFAEIAKIQQGQI  859

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDV  2790
             S++D++ V E  +R  E   Q N +W++ +   +Q ++   D+
Sbjct  860   SEKDMTKVTETLKRDWETNQQRNQFWVNALSDMFQHKLPLSDL  902



>ref|WP_026914815.1| peptidase M16 [Gramella portivictoriae]
Length=943

 Score =   390 bits (1003),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 257/890 (29%), Positives = 443/890 (50%), Gaps = 33/890 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+LDNGLTYY+R+N KP+ +  L LA++AGS+LE ++++G+AH +EH+ F+ T+ + 
Sbjct  36    VKIGKLDNGLTYYIRNNGKPEDKLELRLALKAGSILENDDQQGLAHFIEHMNFNGTKNFE  95

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P D PE L +  +IL +++     +E
Sbjct  96    KNELVDYLQSIGVKFGADLNAYTSFDETVYILPIPSDDPEKLEKGFTILEDWAHNALLTE  155

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               ++ ERG V+EEYR     + RM   +   +M  S+YAERLPIG + VI     + ++ 
Sbjct  156   EAIDGERGVVLEEYRLGLGPDKRMMQEYLPKVMYNSRYAERLPIGKKDVIENADYETIRN  215

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             +Y  WY    MAVIAVGD  D +++ + IK+HF    +  +P     Y VP+H+    + 
Sbjct  216   YYNDWYRPGLMAVIAVGDL-DVETIEQKIKSHFSNLEARENPVERKEYGVPNHDSTFVAI  274

Query  880   FVESEAAGSAVMISCKMPVDELK---TVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-  1047
               + EA  S + I  K  +DE +   T+ DY+  L ++MF   +N R  +++    PP+ 
Sbjct  275   ASDPEANFSQIRIYYK-DMDEAENVVTIADYKKQLEKNMFSSMINNRLQELANSSTPPFT  333

Query  1048  YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLM  1227
             Y  S           AY   +   E   ++AL++++TE  RV+ +GFSE E    +   +
Sbjct  334   YGFSYYGGTYSPKKNAYQSFAMAGENSQMDALKALVTENERVKRYGFSEAEFERAKKEYL  393

Query  1228  SEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER  1407
             + +E +Y +RD+ +S  +  +Y+ HFL + P+ G E+  +  K  L  I    ++     
Sbjct  394   ARLEKSYKDRDKQESNRIIGQYVSHFLEDSPIPGTEWTYEFAKNNLDDIKLENINGLINN  453

Query  1408  FGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
             F    + VI    P   +        VL +    +   I  + +E + E +++  P+ G 
Sbjct  454   FLHDENRVIVFTGPEKESIKKISEDQVLAVLDEVKNSEIEEYADEEVRENLITEMPTKGS  513

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I +    + +G     LSNG +V  K T+F +D++LF+ +S GG S   + E+ S    +
Sbjct  514   IKESSVNKELGITTMILSNGAKVMLKKTDFKNDEILFSAYSKGGSSLYSDDEFMSTVYAN  573

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
                 E GV G   + +  +++GK   V  ++  Y    +G  +P D ET +Q+++ L+ T
Sbjct  574   AGLNEAGVGGLNKNDMNKLMSGKIVNVNPQISTYSEGLNGSSTPKDFETLMQMIH-LYFT  632

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYFFRPIRIRDLQKVNP  2124
             ++   EE     +   +  +     +P   F N + +  N GN  +          +++ 
Sbjct  633   DLNKDEEAYQSFVTKQKNFLGNLMSNPNFYFQNELGKFRNEGNPRYVGFPTPEKFDEMDY  692

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSE------PILHFNRD  2286
               A + +   F D S FT   VGN+D A        Y+  +P  +       P+   N D
Sbjct  693   DLAYQKYQERFADASDFTFFFVGNVDEAQLKEYASTYIASLPASNSEEEYKAPVFRENTD  752

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
             + +           + V      ++Q S+      E   E    D+ F   L ++L  K+
Sbjct  753   EQR----------TKTVYKGSDPKSQVSIIWNGETEYDKE---ADLAFSA-LGEVLTIKL  798

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRL  2646
             V+ LR + G +Y  G      GN  S++     +  I+F C P+    L   AL E+ +L
Sbjct  799   VEQLREEEGGVYGVGAR----GNM-SQIPYDSYNFSISFPCGPENVDKLTKAALAEVEKL  853

Query  2647  QEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGD  2796
             + DGP++ED++ V E  +   +  LQEN +W+ ++ ++ +      ++G+
Sbjct  854   RTDGPTEEDLAKVKETFKVQRKEQLQENRFWMQQLRKAEEEGFKLSEIGE  903



>ref|WP_028068907.1| peptidase M16 [Sphingobacterium thalpophilum]
Length=951

 Score =   391 bits (1004),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 253/873 (29%), Positives = 449/873 (51%), Gaps = 24/873 (3%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NG TY++R N++PK R  + LA++AGS+LE E++ G+AH +EH+ F+  + +  ++
Sbjct  56    GKLKNGFTYFIRKNAEPKGRVTMYLAMKAGSILENEKQLGLAHFLEHMNFNGLKHFPKNE  115

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             +V +L+  G  FG+  NA T  D+TVY+L +P D+PELL   + ++ +++ +      ++
Sbjct  116   LVNYLQKAGVRFGSDLNAYTGFDQTVYQLPIPSDEPELLKNGLQVMRDWAQDALLDGEEI  175

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG ++EE RG R    R+QD ++ +++ GS YA RLPIG E++++T     +++F++
Sbjct  176   DKERGVILEEKRGGRGVQQRLQDQYFPMLLNGSLYARRLPIGTEEILKTFPHTEIRKFHQ  235

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY     A+I VGD  D Q + + +K  F   T P    P   + V    + +F    +
Sbjct  236   DWYRPDLQALIVVGDI-DPQEMEQKVKTLFSDMTMPKKVLPRKEHRVDLLNKNQFLAISD  294

Query  889   SEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAA  1068
              E   +   I  K   +++ TV DYR+ L +++F   +  RF ++ ++ +PP+     + 
Sbjct  295   PELPYTVAQILIKNEKEKVTTVSDYRNELLKNVFNQLVAGRFSELMQQPNPPFMQAGGSI  354

Query  1069  DCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAY  1248
                +  +  + +    K        ++MLTE  R++ +GF++ E+    A +    E AY
Sbjct  355   GDFLANLNTFSLLVVPKPGELESGFKAMLTEFERIQKYGFTQTELERALADMKKSNEMAY  414

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSC  1428
             +ERD+ +S S  + YL +F+ ++P +  E   +L K LLP +   EV+   +++ T  + 
Sbjct  415   IERDKQKSDSYVNRYLNYFIDDQPALSNEDAYRLTKQLLPTLKLEEVNALFKKYYTDLNR  474

Query  1429  VIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFE  1605
              I  + P +  A++   ++V+  + + E+   +  ++++     ++S +P  G +M   E
Sbjct  475   DILIMGPEKDKASLPKEQTVLAWVKSVEEG-VVSAYEDKVSKLPLLSKEPVRGRLMAAKE  533

Query  1606  YQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEI  1785
                V A E  LSNG++V  K T+F +D++    +S GG S  P+++YFS S  S++    
Sbjct  534   IDAVHAKELTLSNGVKVILKPTDFKNDEIQIMAYSPGGTSLYPDADYFSASNASSLVDAS  593

Query  1786  GVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPG-  1962
             GV       L   LAGK   +   +       SG      L++A +L+Y  FT   EP  
Sbjct  594   GVGQMSNVELSKYLAGKDISISPYISERYEGISGSTDKEGLKSAFELIYGYFT---EPRL  650

Query  1963  EEDV-NIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACE  2139
             ++D+    M   + A+  +  +P   F+++V+ + YGN+   +   +  + K++  +A  
Sbjct  651   DQDIFQSTMTRTKGALENRLSNPNNVFSDKVKSVLYGNNVRRQNPTVETIAKIDRDRALA  710

Query  2140  YFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPS  2319
              +   F D S F   IVG+ D A   P I  YL  +P           ++ K L    P+
Sbjct  711   IYKERFADASDFVFTIVGSFDEAQIMPFIETYLASLPATKRA------ENYKDLNILEPT  764

Query  2320  SIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQI  2499
                R VVH    E + S QL +  +  S +  E+V+    L  +L  K+++ LR K   +
Sbjct  765   KGERVVVHKGK-EEKASTQLAYYGDY-SYNEGENVNMEA-LESILTIKLLERLREKESGV  821

Query  2500  YNAGV-SVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDV  2676
             Y  G  + F    KP      R    I F    D +  L+  ALDE+ ++Q+ GP   D+
Sbjct  822   YGVGARASFAKLPKP------RYAFSIGFGSAVDKNDALIASALDEVRKIQDHGPDQADI  875

Query  2677  STVLEIEQRAHENGLQENCYWLDRILRSYQSRI  2775
                +  ++R +E  L+EN YWL+ I  SYQ+ +
Sbjct  876   EKFVAEQKRQNELNLRENGYWLNYISSSYQNDL  908



>ref|WP_006987279.1| peptidase M16 [Gillisia limnaea]
 gb|EHQ04387.1| peptidase M16 domain protein [Gillisia limnaea DSM 15749]
Length=941

 Score =   390 bits (1002),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 251/868 (29%), Positives = 436/868 (50%), Gaps = 20/868 (2%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L+NGLTYY+R+N KP+ +  L LA+ AGS+LE E+++G+AH VEH+ F+ T+ + 
Sbjct  39    VKIGKLENGLTYYIRNNGKPEDKVELRLAINAGSILENEDQQGLAHFVEHMNFNGTKNFE  98

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA T  DETVY L +P D  E L +   IL +++     ++
Sbjct  99    KNELVDYLQSIGVKFGADLNAYTGFDETVYILPIPSDNSETLEKGFQILEDWAHNALMTD  158

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+++ERG VMEEYR     + RM   +   +M GS+YAERLPIG ++VI     + V+ 
Sbjct  159   KDIDEERGVVMEEYRLGLGPDKRMMTEYLPKLMYGSQYAERLPIGKQEVIENADYETVRN  218

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             +YK WY    MAV+AVGD  D + + + IK HF       +      + +P+H+E   + 
Sbjct  219   YYKDWYRPDLMAVVAVGDL-DPEVMEQKIKDHFSKLIPVENARERKVFDLPNHDETFVAI  277

Query  880   FVESEAAGSAVMISCK--MPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-Y  1050
               + EA  S V +  K      ++ T  DYRD L +++F   +N R  ++    +PP+ Y
Sbjct  278   ASDKEAPFSQVRVYYKDLENAKDIVTTNDYRDQLVKNLFSTMINNRLDELRNSANPPFTY  337

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
               S+      R   AY   +       +++L ++L E  RV+  GF+  E+   +   ++
Sbjct  338   GFSSYGGTYARSKNAYQSFAMSGAGEQLKSLRALLEENERVKRFGFNSGELERAKKEYLA  397

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
             +++  + +RD+ +S  +   Y+ H+L N P+ GIE+ +Q     LP I   EV+K    F
Sbjct  398   QLDRQFKDRDKQESGRIVGSYVSHYLSNAPIPGIEWVSQFAGATLPGIKLEEVNKLINDF  457

Query  1411  GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
                 + VI    P            VL +    +   I  + E +I E +++  P  G I
Sbjct  458   LHEENRVIILTGPEKEDITQVKEEEVLALLKEVENSEIEAYQESDIRENLITNAPKAGTI  517

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
              +      VG  +  LSNG  V YK T+F +D++LF+ +S GG S   + +Y +    ++
Sbjct  518   KKVESNDKVGFKKLLLSNGATVVYKNTDFKNDEILFSAYSPGGTSLYSDEDYLNTGFANS  577

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
                E G+     + +  M++GK   V   +G+    F+G  +P DLET  Q+V+ L+ T+
Sbjct  578   GLAEAGIADLSLNDMSKMMSGKLVSVSPNIGSISEGFNGSSTPQDLETLFQMVH-LYFTD  636

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYFFRPIRIRDLQKVNPY  2127
             +   EE  N  +   +  +     +P   F N + +  N GNS +            N  
Sbjct  637   LNKDEEAYNSFVTKQKNFLGNLLSNPNFYFQNELGKFRNEGNSRYLGFPTPEAFDSQNYD  696

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
              A E +   F +   FT   VGNID A        YL  +P  ++      +++ K   F
Sbjct  697   LAYEKYKERFSNAGDFTFYFVGNIDEAKLKEFASTYLASLPSSAK------KEEYKVPEF  750

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFK  2487
             +      ++V++    + +  V + +  E  ++   E+   +  L ++L  K+V+ LR +
Sbjct  751   REVDEYRKKVINKG-TDPKSQVTILWNGE--TDYNQEEDFALEALGEVLTIKLVEQLREE  807

Query  2488  YGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSD  2667
              G +Y  G    +     +++     +  I+F C P+    L   AL E+ +++++GPS+
Sbjct  808   EGGVYGVGARGSM-----AKIPYGSYNFSISFPCGPENVDKLTAAALKEVEKIKKEGPSE  862

Query  2668  EDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             +D++ + E      +  +++N +WL+++
Sbjct  863   KDLAKIKESLLLNRKESIKQNRFWLNQL  890



>ref|WP_018526805.1| hypothetical protein [Spirochaeta alkalica]
Length=1030

 Score =   391 bits (1005),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 271/898 (30%), Positives = 451/898 (50%), Gaps = 35/898 (4%)
 Frame = +1

Query  121   VNMEEALSQTPYGVDY--GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVA  294
             +++EE L   P+  D   G L+NGL ++++S+S P+    L L V AGS+LEEE++RG+A
Sbjct  95    LSLEEPL---PFSRDIRRGTLENGLEFFLKSHSWPEETVVLRLVVDAGSILEEEDQRGLA  151

Query  295   HIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQA  474
             H VEH+AF+ TE +   ++V +LES+G  FG   NA TS DETVY+L +P    E L Q 
Sbjct  152   HFVEHMAFNGTESFPEGELVAYLESLGRRFGPDINAYTSFDETVYKLELPGGDTEALHQG  211

Query  475   ISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIG  654
               ++ E++S +   +  +++ERG ++EE+R  R A  R+ D H  ++ +GS+YA RLPIG
Sbjct  212   FRVMQEWASALTFDDDAIDRERGVIVEEWRRGRGAGARIMDTHIPVIFQGSRYARRLPIG  271

Query  655   LEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppi  834
               +V+RT   + +  F+++WY   NMA+I VGD    + + EL + + G   +P  P   
Sbjct  272   DMEVVRTAPRERLVDFFERWYRPDNMALIVVGDL-PLEELEELTRRYLGAIPAPDTPLER  330

Query  835   pYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRF  1014
               Y  PS E  R S   + EA  + + +    P + L TV DYR  L E +FF  +N+R 
Sbjct  331   TRYPGPSGEGTRISIASDPEATVNRLSLYALAPHEPLVTVGDYRQALVEXLFFSVMNERL  390

Query  1015  FKISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSE  1194
              + +R    P  S        +   +  +  +  ++    EAL+ ++T++ RVR  G ++
Sbjct  391   REEARSPGSPLSSGGTGXSSFLHDTQIAVAQAVARDDLVREALDVLVTKLERVRRFGINQ  450

Query  1195  REISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHI  1374
              E++  RA ++  I++A +  D  +S+SL DE ++H  R EPV GI +E +L  TLLP I
Sbjct  451   AELNRARARMIQAIDNALINADTRESSSLADEVVRHRTRQEPVPGIAFEHRLYHTLLPEI  510

Query  1375  SASEVSKYSERFGTSSSCVI----------KTIEPRATATVDDLRSVVLKINTFEQKQSI  1524
             S  EVS    R   S   V+          +     A  + ++LR ++ +  T    + +
Sbjct  511   SLEEVSAVVSRVLESPELVVLASLRDDGQGRLPGGGAIPSREELREIIDEART----RPL  566

Query  1525  PPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTG  1704
              P DEE+ P  + S  P  G I+++  +  V   E+ LSNG+R+  + +++  D++LF  
Sbjct  567   TPPDEEDQPSLLPSAPPRAGEIVEKRSHPRVETEEYLLSNGIRLFIRPSDYRSDEILFAA  626

Query  1705  FSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFS  1884
              S GGL ++ +    +  + + +AGE G+     S L   LAG+   + T +G      S
Sbjct  627   HSPGGLQKISDPFLSAARLATAVAGESGLGELSASALERALAGRSVRISTDIGLTSERLS  686

Query  1885  GDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELN  2064
             G     DLET  QL+Y L  T+    ++ +  V Q   +A+  ++  P   F  R +EL+
Sbjct  687   GSTRQEDLETLFQLIY-LSLTSPRFDQDALETVRQQHIQALRGRDASPQGIFQRRFQELS  745

Query  2065  YGNSYFFRPIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGG  2244
                     P+ I +++ V   +     +  F D     +   G++DP     L  +YLGG
Sbjct  746   SAGDPRKAPLSIEEIEAVTLEEITSAHSRWFSDTREIALFFTGSLDPDETARLAARYLGG  805

Query  2245  IPRPSEPILHFNRDDLKGLP---FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMM  2415
             I  P +P      +D +  P   F  P  ++RE V +   E    V + F          
Sbjct  806   IAPPDDPRQPPREED-RDFPSRAFSLPDDLLRETVRA-GTEEIAQVAILFHSXYSWS--Q  861

Query  2416  EDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDP  2595
              + H    +  LL  ++ +V+R + G  Y    + +       R+ + +  + I+F  DP
Sbjct  862   RENHRWNSVGDLLNLRLREVIREEEGGTYGVRATTWR-----QRLPDPQAFLQISFGMDP  916

Query  2596  DISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRA-HENGLQENCYWLDRILRSYQ  2766
               S  L+   L E+L+   D P+ E     ++ +QR  +    +EN YWL  +L S++
Sbjct  917   GRSQDLIARTL-EVLQEVLDEPASESALQRIKAQQRERYRRNQRENSYWLGSLLFSWE  973



>ref|WP_028663749.1| peptidase M16 [Runella zeae]
Length=934

 Score =   389 bits (998),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 249/875 (28%), Positives = 440/875 (50%), Gaps = 29/875 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V YG+L NG+TYY+R N +PK RA L L  + G++ EE++E G+AH  EH+AF+ T+ + 
Sbjct  35    VRYGKLPNGMTYYIRKNEEPKKRAELYLVNKVGAIQEEDKENGLAHFTEHMAFNGTKNFP  94

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+  G +FG   NA T  D+TVY+L VP D  ++ ++A  +L +++  +    
Sbjct  95    KNELVSFLQRAGIKFGDDLNAFTGQDQTVYQLPVPTDSADIFNKAFVVLEDWAHNLSMDG  154

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG ++EE RG + A  RM+D    +++  SKY +R  IG E +++  S + ++ 
Sbjct  155   EEIDKERGVILEELRGGKGAQQRMRDKWLPILVGDSKYGKRNIIGTEDILKNFSHETIRN  214

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     A++AVGDF D   V + IK  FG       P P   + +   +  R + 
Sbjct  215   FYKTWYRPDLQAIVAVGDF-DIDQVEKTIKQRFGSIPKAVKPKPFGKFPIADFKGSRVAI  273

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E       I  K+P  E KT+ D R+ L  ++F   L  R  +++++ DPP+   +
Sbjct  274   VTDPEFPYMMAQIITKLPKAEEKTLNDSRESLKRNLFNQMLQARLQELTQQADPPFLFGN  333

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A+    +    ++   +  K+     A++++L E  R +  GF+E E+   +A LM+ +E
Sbjct  334   ASYSGFLGDYDSFFNIAVAKDGNLERAVKAVLDEGVRAKNFGFTETELERAKAQLMTSVE  393

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
               + E+D+ +S +  +EY+ HFL   P  GIE++ +  K  L  I  +EV+  + ++ T+
Sbjct  394   KRFKEKDKTRSANYVNEYMSHFLEENPTPGIEFQYEFVKEQLGGIKLNEVNTLANKYLTN  453

Query  1420  SS-CVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
              +  VI     +  A + +  +V+  INT    + +  + ++ + + +V   P+ G  + 
Sbjct  454   DNRTVIVMSSEKDKAKLPNEATVLEWINT--AGKGVTAYVDKVVNKPLVENLPAAGRTVS  511

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
               E   VG  E  LSNG++V  K T+F +D++L    S GG S   E ++ S  +   + 
Sbjct  512   TKEIPEVGVTELTLSNGVKVVLKPTDFKNDEILIGARSQGGTSLYDEKDFMSAGLSDAVV  571

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
              E GV  +  + L   L+GK   V   +G     FSG+ SP D+ETALQL+Y  FT   +
Sbjct  572   EESGVGEFSQNALKKYLSGKVVNVSPFVGEIEEGFSGNTSPKDVETALQLIYAYFT---K  628

Query  1957  PGEED--VNIVMQMAEEAIHAQERDPY--TAFANRVRELNYGNSYFFR-PIRIRDLQKVN  2121
             P ++D  +   +     AI   +  P     F + +  +  GN  F R PI +     VN
Sbjct  629   PRKDDDVIKGFLNTQRSAIQNMKASPSPEMVFQDSLNTV-LGNYNFRRLPISVERWDMVN  687

Query  2122  PYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGL  2301
               +A   +   F +P+ FT    G+       PL+ +YLG +P  ++      ++  + L
Sbjct  688   ADRAYAIYKERFANPADFTFFFTGSFKVEQLKPLLEKYLGALPTQNQ------KESFRDL  741

Query  2302  PFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHF-VGFLSKLLETKIVQVL  2478
               + P   I + V+   +E +      F  +    D  +D ++ +  L ++L  K+++V+
Sbjct  742   GIRAPKGKIDKKVYKG-IEQKSQATFVFSGDY---DYNDDNNWQLDALEEILNIKLIEVI  797

Query  2479  RFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDG  2658
             R K   +Y  G          S++   R  + I +   PD    L    L  I  ++++G
Sbjct  798   REKESGVYGIGARASY-----SKIPAPRYSLRIGYGTGPDRVEELGVKTLAVIDEIKKNG  852

Query  2659  PSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
              +  D+       +RA E  ++EN +W ++++ +Y
Sbjct  853   ATQADIDKFKAETRRATEVQMKENGFWQNQLIDAY  887



>ref|WP_039142542.1| peptidase M16 [Flavihumibacter solisilvae]
 gb|KIC93257.1| peptidase M16 [Flavihumibacter solisilvae]
Length=954

 Score =   389 bits (999),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 284/949 (30%), Positives = 472/949 (50%), Gaps = 49/949 (5%)
 Frame = +1

Query  121   VNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             V ++  LS  P  V  G+LDNGLTYY+R N KP+ +  L LA+ AGS+ E++++ G+AH+
Sbjct  28    VKLDSELSPDP-AVRIGKLDNGLTYYIRQNKKPEQKVELRLALNAGSINEDDDQLGLAHM  86

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAIS  480
              EH+AF+ T+ +  ++I+ FL+ IG  FG+  NA TS DETVY L +P DKPE L +   
Sbjct  87    AEHMAFNGTKNFKKNEIISFLQDIGVGFGSDLNAYTSFDETVYILPIPTDKPENLEKGFQ  146

Query  481   ILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLE  660
             +L +++ +V   + D++ E+  ++EE R  + A  RM    +  +  GS+YAERLPIG +
Sbjct  147   VLEDWAHQVTYLDEDIQSEKAIILEESRLGKGAQDRMFRQIYPKLFAGSRYAERLPIGSD  206

Query  661   KVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY  840
              +I+   P ++++FYK WY    MAV  VGD  D    +E+IK HF    +PP+     +
Sbjct  207   SIIKNFKPDVIRRFYKDWYRPNLMAVAVVGDI-DPDKALEMIKKHFSGMKNPPNERKREF  265

Query  841   YLVPSHEEPRFSCFVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFF  1017
               +P++         + EA G ++ I+  + P    KTV DYR  L   +F + LNQR  
Sbjct  266   VTIPAYSSSEAVVVTDKEATGYSISINYPIYPAAPEKTVGDYRRNLVRQLFTNMLNQRLQ  325

Query  1018  KISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSER  1197
             +++++++PP+   +      +R  + +   +          LE++  E+ R +  GF+  
Sbjct  326   ELTQQQNPPFVGAATGMGNFIRGSENFRAFAGVGTGDIKRGLEALTEEIERAKRFGFTAT  385

Query  1198  EISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHIS  1377
             E+   R   +S +E  Y  RD+ +S+   +EY+++FL  E + GIE E  L K LLP I+
Sbjct  386   ELDRARKSSLSSMERMYNNRDKTESSLYVEEYVRNFLTGEMMPGIEKEFSLYKELLPGIT  445

Query  1378  ASEVSKYSERFGTSSSCVIKTIEPRA-TATVDDLRSVVLKINTFEQKQSIPPWDEENIPE  1554
               EV+K +    +  + ++    P + TA V     ++  I + E  + + P++E+ +  
Sbjct  446   LDEVNKLAASVASDKNRLVYVTGPESGTAAVPAPADLLATIASRESAE-LKPYEEKAVAA  504

Query  1555  EIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELP  1734
              +++  P PG ++++ E + +G  +  LSNG+ V  K T+F +DQ++      GG +   
Sbjct  505   SLLTTLPKPGKVVKRSEDKLMGTTKLTLSNGVTVTLKSTDFKNDQIVMGASRPGGKNYYG  564

Query  1735  ESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLET  1914
              ++ ++   G      +GV  + P+ L   LAGK   V   +G     F+G+    D+ET
Sbjct  565   AADRYNVEYGIQAVSAMGVGEFSPTDLRKALAGKSVSVSPTMGDITDGFNGNSGNKDVET  624

Query  1915  ALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPI  2094
               QL++ L+ T+        N  +Q  +    A   +P TAF + + ++ Y N+    PI
Sbjct  625   MFQLIH-LYVTSPRKDTALFNSFIQRNKSQFAAIGSNPQTAFIDTLFKVMYNNNP-LAPI  682

Query  2095  RIRD---LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEP  2265
              +       K+N  +    +     D S      VG+    +  PLI  YLG +P   + 
Sbjct  683   AVPQSAYFDKLNVDRILSIYKERIGDASGMHFAFVGSFKTDSMIPLIETYLGSLPSSGK-  741

Query  2266  ILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCF-----PVELKSEDMMEDVHF  2430
                F   D K  P +    +   VVH    + Q S+ L F     P    SED+    + 
Sbjct  742   --VFQVKDNKVRPVQGEKKL---VVHKG--KEQKSLILAFYSGEVPY---SEDLELKANA  791

Query  2431  VGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISST  2610
             +G   ++L  +I++ LR K   IY  G   F    + +   N    + +   C P+   T
Sbjct  792   IG---EILNIRIIEELREKIQGIYGGG---FFTSVEKTPYQNY--SMVLQLPCGPEKVDT  843

Query  2611  LVDLALDEILRLQEDGPSDEDVSTVLE--IEQRAHENGLQENCYWLDRILRSYQSRIYSG  2784
             L+  A  EI  L + GP+   +  V +  IEQ   E  ++EN  WL  +L   Q  I   
Sbjct  844   LLKAAKSEIAILVQKGPAASYLEKVKKQWIEQYKTE--IKENSTWLSELLD--QQSI---  896

Query  2785  DVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
             +    + +Q EA   V+K LT    Q A +++  F  K  +T V LMPQ
Sbjct  897   NADPKYFLQYEAM--VQK-LTVQDIQQAAKKL--FDGKNLFTAV-LMPQ  939



>ref|WP_008270970.1| peptidase M16 [Flavobacteriales bacterium ALC-1]
 gb|EDP70288.1| putative zinc protease [Flavobacteriales bacterium ALC-1]
Length=951

 Score =   389 bits (999),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 260/881 (30%), Positives = 447/881 (51%), Gaps = 31/881 (4%)
 Frame = +1

Query  139   LSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAF  318
             L  TP  V  G+L NGLTYY+++N KP  +  L LA++AGS++E E++RG+AH +EH+ F
Sbjct  43    LPTTP-DVKIGKLSNGLTYYIQNNGKPADKVELRLALKAGSIVETEDQRGLAHFMEHMNF  101

Query  319   SATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFS  498
             + T  +  +++V +L+SIG EFGA  NA T  D+TVY L +P D P  L +   IL +++
Sbjct  102   NGTTNFKKNELVDYLQSIGVEFGADLNAYTGFDQTVYILPIPSDDPAKLDKGFQILQDWA  161

Query  499   SEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTV  678
                  ++ D++ ERG V+EEYR    A  RMQ  +   +   SKYA+RLPIG ++ + T 
Sbjct  162   GGALLTDKDIDDERGVVIEEYRTRLGAATRMQSKYLDKIAYKSKYADRLPIGTKENLETF  221

Query  679   SPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSH  858
               + ++ F K WY    MAVIAVGD  D +++ + IK +F    +P +P     Y   +H
Sbjct  222   KYKSLRNFQKDWYRPDLMAVIAVGDL-DVETLEKKIKENFSGLKNPKNPKLREEYGSENH  280

Query  859   EEPRFSCFVESEAAGSAVMI--SCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRK  1032
             E    +   + EA GS V I    K  V++ +T++DYRD + E +F   +N R  + S K
Sbjct  281   EGTFVAVEWDEEATGSQVQIYYKDKGEVEKTRTIQDYRDNMVEGLFTQMINNRLGEYSNK  340

Query  1033  KDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVV  1212
              +PP+    +    ++    AY   +   E G ++AL+++L E  RV+ +GF   E+   
Sbjct  341   PNPPFIYGFSYHGGIIGNKTAYQSVAQTNETGQLDALKTLLEENERVKRYGFKASELKRA  400

Query  1213  RALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVS  1392
             +   ++ +E  +  +D+ +S  + + Y+Q+FL+  P+ GIE+     +  LP+I   EV+
Sbjct  401   KKDYIARLERGFKNKDKQESNRIVNSYIQNFLQERPIPGIEWSFNYAQAELPNIKLEEVN  460

Query  1393  KYSERFGTSSSCVIKTIEPRATATVDDLRSV----VLKINTFEQKQSIPPWDEENIPEEI  1560
                  F    + ++    P+     D+L+ V    V+ +    +K  I  +++E + E +
Sbjct  461   GLISDFLHDDNRLVILTGPKK----DNLKKVTEQEVIDLLDEVKKSDIKDYEDEAVRENL  516

Query  1561  VSVKPSPGWI--MQQFEYQNVG-AFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSEL  1731
             +SVKP+ G I  ++   ++ +       LSNG +V YK T+F +D++LF  FSYGG S  
Sbjct  517   MSVKPNKGSITGVKVNNHEKINETVTISLSNGAKVTYKKTDFKNDEILFEAFSYGGTSLY  576

Query  1732  PESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLE  1911
              +      +  +    E G+ G   + +  +++GK A V   +G       G  SP DLE
Sbjct  577   SDDVLKQTASANGGLFEAGIDGLTKNDMTKLMSGKIARVRPYIGGLDEGMRGSASPKDLE  636

Query  1912  TALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYFFR  2088
             T  Q+++ L+ T ++   E     +   +  +     +P  +F+  + +  N GN  +  
Sbjct  637   TMFQMIH-LYFTKLDKDPEAFKSFISKQKAFLGNILSNPNISFSIALGKFSNEGNPRYTG  695

Query  2089  PIRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPI  2268
                   L K N   A E F   F +   F    VGN+D A        Y+  +P   E  
Sbjct  696   FPTAEKLDKANYDLAYEKFKERFANAGDFNFYFVGNVDEAKIAEYAETYIASLPGNGE--  753

Query  2269  LHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSK  2448
                 R+  K   F+ P S   E  ++   E +  V L +  E K +  + +   +  + +
Sbjct  754   ----REMYKVSSFR-PKSGAHEFTYNKGTEPKSQVNLIYRGETKYD--VNEARAMNAVGE  806

Query  2449  LLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLAL  2628
             +L  K+++ LR + G +Y AG    +     S++   R +  I+F C P+ +  L + A+
Sbjct  807   VLSIKLIEKLREEEGGVYGAGARGSI-----SKMPYGRYNFSISFPCAPENAEKLANAAI  861

Query  2629  DEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
              E+ ++ +DGP++ D+  V +      ++ L++N +WL  I
Sbjct  862   AELKKIVKDGPTETDLEKVKKALLLTRKDQLEQNRFWLSAI  902



>ref|WP_020702247.1| hypothetical protein [Oxalobacteraceae bacterium AB_14]
Length=941

 Score =   388 bits (997),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 258/889 (29%), Positives = 448/889 (50%), Gaps = 37/889 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYYV+ N++P+ +  L L V+AGS+LE+++++G+AH  EH+AF+ +  + 
Sbjct  41    VKVGQLANGLTYYVQKNTRPEKKLELRLVVKAGSILEDDDQQGLAHFTEHMAFNGSTHFK  100

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA T+ ++TVY L +P DKPE++ Q   +L +++  +  ++
Sbjct  101   RNELVSYLQSIGVKFGADLNAYTTFNQTVYILPLPTDKPEVVKQGFQVLEDWAHGLSLND  160

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D++ ERG V+EE R  +  + RM       ++ GS+YA+R+PIG E +++T     VK+
Sbjct  161   ADIDSERGIVLEELRMGKGVDDRMNKVLLPKVLNGSRYAQRMPIGKEDILKTFKHDAVKR  220

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY+ WY    MAV+ VGD  +     +LI  HFG   +P +  P  Y  +P   E     
Sbjct  221   FYRDWYRPDLMAVVVVGDI-EPADAEKLITQHFGGLKNPQNERPREYAKIPVRAESEGVV  279

Query  880   FVESEAAGSAVMISCKMPVDEL---KTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYY  1050
             F + E   ++V I  + P+ E     T+ DYR  L E+++   L+QR  +++++ +PP+ 
Sbjct  280   FTDKEIGANSVYI--RYPIQEWPAGTTIADYRQKLIENIYSFILSQRMHELTQQANPPFL  337

Query  1051  SCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMS  1230
                +    ++R  +++   +   + G   A+ +++ E  R R +GF+  E+   +  ++ 
Sbjct  338   QGGSGMSSVMRGYRSFGAGAVLGKGGATPAINALVKEDQRARQYGFTTSEVERAKKGILR  397

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
               E  Y ERD+  S     EY+++FL  E + GI  E +    L+P I+ SEV+      
Sbjct  398   NYERMYNERDKSDSAGYAAEYIRNFLDRESIPGIAMEYRYASELIPGIALSEVNAAVRAA  457

Query  1411  --GTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
                + +  VI T    A         ++      E K S+   +E+    ++++  P  G
Sbjct  458   VPDSQNKLVIYTGTEVAGVPAPTAGELLATAGAAE-KISVKAPEEKVYASQLMAAPPKAG  516

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMG  1764
              I+ +     +G  E  LSNG++V  K T+F +DQV+  G  YGG S   + + F+    
Sbjct  517   SIVGESVNARLGLTELTLSNGVKVVLKPTDFNNDQVILAGLRYGGWSLFGDQDLFNARYA  576

Query  1765  STIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFT  1944
             S I  ++GV  Y PS L+ +LAGK A     + +   + SG     D+ET LQLVY    
Sbjct  577   SNIVHQMGVRDYTPSDLVKVLAGKTAGANASVSSINETVSGGSGSGDVETMLQLVY----  632

Query  1945  TNVEPGEEDVNI----VMQMAEEAIHAQERDPYTAFANRVRELNYGNS-YFFRPIRIRDL  2109
              N+    +D  I    V +  E A +   R P + F++ +    Y N+    R  +  D 
Sbjct  633   LNMTQPRKDAAIYSAYVDRQRELAKNNMAR-PESIFSDTITATLYNNNPRVQRAPKPADF  691

Query  2110  QKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDD  2289
              ++   +  + +N+       FT  + G+ D     PLI  YL  +P    P+       
Sbjct  692   DQLGMDRVVDIYNSRMSSAKGFTFFMAGSFDVEKVKPLIATYLASLPVGEIPVA------  745

Query  2290  LKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVE--LKSEDMMEDVHFVGFLSKLLETK  2463
              K +  +    +I++ VH+   E + ++ L F  E    S++ M     +  L ++L  K
Sbjct  746   FKDVGVRPVRGVIKKEVHAGS-EPKSTISLSFTGEAPFSSQERMR----LQALIEVLNIK  800

Query  2464  IVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILR  2643
             +++VLR K G +Y+ GV     GN   R+      I  N  C P+    ++     EI +
Sbjct  801   LIEVLREKMGAMYSGGVR----GNM-ERIPYPNYSITANLPCAPENVDKVLAATFAEIDK  855

Query  2644  LQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDV  2790
             ++E+G  D D++ V       +  GL+EN YW+  ++ ++ ++    DV
Sbjct  856   IKENGAEDADLAKVKASWIENYRKGLRENGYWMAVLMNAFFNKTDPADV  904



>ref|WP_028892645.1| peptidase M16 [Tenacibaculum sp. 47A_GOM-205m]
Length=942

 Score =   388 bits (997),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 257/907 (28%), Positives = 455/907 (50%), Gaps = 48/907 (5%)
 Frame = +1

Query  64    ESSQMLPKKHRFRSLKLVNVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALAL  243
             E+ Q L KK +  ++ +           T   V  G+L NG+TYY++ N KP  +  L L
Sbjct  24    ETQQKLNKKEKVTAMNI----------PTDSSVKIGKLSNGMTYYIKQNPKPANKVELRL  73

Query  244   AVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADET  423
              V AGS+LE++++ G+AH +EH+ F+ T+ +  +++V +L+SIG +FGA  NA T  DET
Sbjct  74    VVNAGSILEDDDQLGLAHFMEHMNFNGTKNFKKNELVDYLQSIGVKFGAHLNAYTGFDET  133

Query  424   VYELFVPIDKPELLSQAISILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAH  603
             VY L +P D  E L +   IL +++        D+++ERG V+EEYR  R A+ RM + +
Sbjct  134   VYILPIPSDDKEKLEKGFQILEDWAHGALLEGKDIDEERGVVLEEYRSRRGADSRMLEKY  193

Query  604   WVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVEL  783
                +M GSKYAERLPIG ++ I     + +++F+K WY    MAV+AVGD    + + E 
Sbjct  194   LPKVMHGSKYAERLPIGTKENIENFKHESIRRFHKDWYRPDLMAVVAVGDV-SVEILEEK  252

Query  784   IKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELK---TV  954
             IK+HF    +  +P       + +H+E   +   + EA  ++V +  K   DE K   TV
Sbjct  253   IKSHFNKIPAVKNPRKREVAPLKNHKETFIAIEADKEAPFASVQLMYK-DYDEAKPETTV  311

Query  955   KDYRDLLAESMFFHALNQRFFKISRKKDPPY-YSCSAAADCLVRPVKAYIMTSSCKEKGT  1131
              DYR+ + +S+F   +N R  ++   ++PP+ Y  S       R  +AY   +S    G 
Sbjct  312   ADYRNSIVQSLFAQMINNRLDELRNSENPPFVYGFSYHGGTWARGKEAYQSRASVSADGQ  371

Query  1132  VEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLR  1311
             ++ L+++L E  RV+ +GF + E+   +  + + +E A+ ++D+ +S  +  +Y+ +FL 
Sbjct  372   LKGLQALLDESERVKRYGFQQGELDRAKMNVSARMEKAFKDKDKRESNRIISQYVNNFLE  431

Query  1312  NEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVL  1491
              EP+ GIE+E Q  +TLLP +   EV+   + +    + V+    P+   T   +   + 
Sbjct  432   QEPIPGIEWEYQAHQTLLPSVKLEEVNNLIKNYLHDDNRVVVITGPKKVVTEQQVLDALN  491

Query  1492  KINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCT  1671
              + T E K    P++++ +   +++ +P PG I +  E +++G     LSNG +V YK T
Sbjct  492   NVKTKELK----PYEDKAVAASLITKQPIPGAITKVTENKDLGTKTMILSNGAKVTYKKT  547

Query  1672  NFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVG  1851
             +F +D++LF  FS+GG S   + E  + +  ++   E G+ G+  + L  M++GK   V 
Sbjct  548   DFKNDEILFEAFSFGGTSLYSDEELKATAFANSGLSEAGINGFSKTDLSKMMSGKIVRVS  607

Query  1852  TKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPY  2031
               + +    F G  +P DLE   Q+V+ L+ T++   E+     +   +  +      P 
Sbjct  608   PYISSLSEGFRGTATPKDLEELFQMVH-LYFTSLNKDEKAFGSYVNKQKSFLGNLLASPN  666

Query  2032  TAFANRVRELNYGNSYFFRPIRIRDLQKVNPYKACEY------FNNCFKDPSTFTVVIVG  2193
               F   + E  YG     +  R         Y+A +Y      +   F D   F    VG
Sbjct  667   FFFQKEMSEFTYG-----KDPRYTGFPSPEKYEAADYNLAYQKYQERFADAGDFNFYFVG  721

Query  2194  NIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSV  2373
             N+D         +Y+ G+P  +      + +  K   F+  S    +VV     + + +V
Sbjct  722   NVDEKKLAEYATKYIAGLPGKN------SNEKYKVTDFRPLSGSHTKVVEKGK-DPKSNV  774

Query  2374  QLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNK-PSRV  2550
             ++ +  E       +D      L +++  K+++ LR + G +Y+AG    L  NK P   
Sbjct  775   RITYQGEANYNK--KDALAFKVLGEVVGIKLIEKLREQEGGVYSAGARGSL--NKMPYGW  830

Query  2551  GNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQEN  2730
              N      I++ C P+    L ++++ E+  + ++GP+ ED+    +     ++  L++N
Sbjct  831   YNFT----ISYPCAPENVEKLKNISVAEVASVVKNGPTKEDLMKAQKGMIADYKEDLKKN  886

Query  2731  CYWLDRI  2751
              +WL  I
Sbjct  887   RFWLSTI  893



>ref|WP_035135023.1| peptidase M16 [Flavobacterium beibuense]
 gb|KGO79522.1| peptidase M16 [Flavobacterium beibuense F44-8]
Length=938

 Score =   388 bits (996),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 269/928 (29%), Positives = 448/928 (48%), Gaps = 32/928 (3%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NGLTYY+R N+KP+ +  L L + AGS+LE ++++G+AH +EH+ F+ T+ +  + 
Sbjct  37    GKLKNGLTYYIRKNNKPEDKVDLRLVINAGSILENDDQQGLAHFMEHMCFNGTKNFPKNK  96

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             +V +L+SIG +FG   NA TS DETVY L +P D PE L +  SI+ +++     +  ++
Sbjct  97    LVDYLQSIGVKFGQHLNAYTSFDETVYFLPIPSDDPEKLEKGFSIIEDWAFNAVLTPEEI  156

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG V+EEYR    A+ RM+      +M  S YA R+PIG ++++   +   +  FYK
Sbjct  157   DKERGVVLEEYRLGLGADDRMRKQFMPKVMYQSHYANRMPIGKKEILENFTYDKITSFYK  216

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY    MAVI VGD  D   + + +K HF    +P +  P   + VP+HEE       +
Sbjct  217   DWYRPDLMAVIVVGDI-DVDEMEKKVKKHFASYKNPKNERPRKVFDVPNHEETFVCVETD  275

Query  889   SEAAGSAVMISCKMPVDELK--TVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-YSCS  1059
              EA+GS V +  K   +  K  TV DY++ L  S+F   LN R  +I    +PP+ +  S
Sbjct  276   KEASGSQVQVLYKDYTEPKKMVTVNDYKESLERSLFATMLNNRLEEIRNSPNPPFTFGYS  335

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
                  +VR  +AY+  +   E   ++AL+ ++ E  RVR +GFS+ E+   +   ++ +E
Sbjct  336   YHGGAMVRSKEAYMSFAMTSEDKQLDALKVLVEESERVRKYGFSQNELERAKTERLAYLE  395

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              +Y ERD+  S+    EY  HFL  EP+ GIE+E    K LL   S   ++  + ++   
Sbjct  396   KSYNERDKTYSSRFVGEYQSHFLEKEPMPGIEWEYNATKELLDKASLENINALAGKYLKK  455

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQQ  1599
              + V+    P            +L I       +I P++++ I   ++  + +PG ++++
Sbjct  456   DNRVVIFTGPEKEGLKKPTEKEILSIIDM-SADNITPYEDKEIASSLLRNEVTPGSVVKK  514

Query  1600  FEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIAG  1779
              +   VG     LSNG +V YK T+F +D+++    S+GG +     EY           
Sbjct  515   EQDDEVGTTTLYLSNGAKVVYKKTDFKNDEIIMKAISFGGNNLYSNEEYKKIQFAMNGLN  574

Query  1780  EIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVEP  1959
             E G  G   + +   + GK A V   +G       G C+P D+E  +Q++Y  F T++  
Sbjct  575   EAGFSGLNLNDINKFMTGKIARVSPFVGGTTEQMDGSCTPKDMEYMMQMMYAYF-TDLNY  633

Query  1960  GEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYFFRPIRIRDLQKVNPYK-A  2133
              EE  N   Q            P   F   +    Y  N  F   I  ++      YK A
Sbjct  634   DEEAFNSYKQKQSAFFDNMASQPSFYFQQELYSFLYKDNPRFNGIIPTKETWAEADYKLA  693

Query  2134  CEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFKF  2313
              + +   F + + F    VGNID A       +Y+  +     P +   ++ +  L F+ 
Sbjct  694   YDKYKERFANAADFEFYFVGNIDDAKMEEYAAKYIASL-----PAVKGEKEKMTDLGFRL  748

Query  2314  PSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKYG  2493
              S   ++VV+    + + +V++ F  E    D  E +     L ++L  K+++ LR    
Sbjct  749   LSGEHKKVVNKG-TDPKSTVRIMFYGEPTKYDANEALAMRA-LGEVLTIKLLEELRENES  806

Query  2494  QIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDED  2673
              +Y    S  +G     +V        I F C P+ +  L + AL E+ ++  +GP ++D
Sbjct  807   GVYGVNASGSIG-----KVPYAWYSFNIGFPCGPENAEKLTESALRELDKIIANGPEEKD  861

Query  2674  VSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPL  2853
             ++   E E   ++  ++EN YW+      + +     D+ D FKV+    SKV  L T  
Sbjct  862   LNKFKEGELLDYKKKIKENSYWMSYFNWCFNT---GDDLSDIFKVE----SKVNALTTK-  913

Query  2854  TAQMALQRILPFPCKKQYTVVILMPQAS  2937
                  LQ +      K   V +LMP+ +
Sbjct  914   ----DLQAVAKKYLTKDKVVAMLMPEEA  937



>ref|WP_011708720.1| peptidase M16 [Gramella forsetii]
 ref|YP_860850.1| zinc protease PqqL [Gramella forsetii KT0803]
 emb|CAL65783.1| zinc protease PqqL [Gramella forsetii KT0803]
Length=943

 Score =   388 bits (996),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 261/872 (30%), Positives = 438/872 (50%), Gaps = 21/872 (2%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+LDNGLTYY+R+N KP+ +  L LA++AGS+LE E+++G+AH +EH+ F+ T+ + 
Sbjct  36    VKIGKLDNGLTYYIRNNGKPEDKLELRLAIKAGSILENEDQQGLAHFIEHMNFNGTKNFE  95

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA TS DETVY L +P D  E L    +IL +++     +E
Sbjct  96    KNELVDYLQSIGVKFGADLNAYTSFDETVYILPIPSDDSEKLESGFTILEDWAHNALLTE  155

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               ++ ERG V+EEYR     + RM   +   +M  S+YAERLPIG ++VI     + V+ 
Sbjct  156   EGIDGERGVVLEEYRLGLGPDKRMMQEYLPKVMYNSRYAERLPIGKKEVIENADYETVRS  215

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAVIAVGD  D +++   I++HF    +  DP     Y VP+H+E   + 
Sbjct  216   FYKDWYRPGLMAVIAVGDL-DIETIENKIRSHFSNLEARKDPKKREEYDVPNHDETFVAI  274

Query  880   FVESEAAGSAVMISCKMPVDELK---TVKDYRDLLAESMFFHALNQRFFKISRKKDPPYY  1050
               + +A  S V I  K  +D+ +   T+ DY++ L +SMF   +N R  +++   +PP+ 
Sbjct  275   ASDPDANFSQVRIYYK-DLDKARDVVTIGDYKEQLEQSMFSSMINNRLDELANSSNPPFT  333

Query  1051  SCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLM  1227
                +       P+K AY   +   E   + AL++++TE  RV+ +GF   E    +   +
Sbjct  334   YGFSYYGGTYSPMKNAYQSFAMAGENSQLLALKALVTENERVKRYGFKNSEFERAKKEYL  393

Query  1228  SEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER  1407
             + +E ++ +RD+ +S  +  +Y+ HFL + P+ G E+  +  K  L  I    ++     
Sbjct  394   ARLEKSFKDRDKQESNRIIGQYVNHFLEDSPIPGTEWTYEFAKNNLDAIKLENINGLIND  453

Query  1408  FGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
             F    + V+    P   +        VL +        I  + EE + E++++  P  G 
Sbjct  454   FLHEENRVVVLTGPEKESVAKITEKQVLAVLNEVGNAEIEEYLEEEVREDLITNMPPKGS  513

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I        +G     LSNG +V YK T+F +D++LF+ +S GG S   + EY S    +
Sbjct  514   ITDSKANNELGIITLTLSNGAKVIYKKTDFKNDEILFSAYSEGGTSLYSDEEYQSTVFAN  573

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
                GE G+ G   + L  M++GK   V  ++G+Y    SG  +P D ET +Q++  L+ T
Sbjct  574   AGLGEAGIGGLDKNDLNKMMSGKIVNVRPQIGSYSEGLSGTSTPKDFETMMQMI-NLYFT  632

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVREL-NYGNSYFFRPIRIRDLQKVNP  2124
              +   EE     +   +  +     +P   F N + +  N GN  +          +++ 
Sbjct  633   GLNKNEEAYQSFVTKQKNFLGNLMSNPNFYFQNELGKFRNEGNPRYTGFPTPEKYDEMDY  692

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
               A   +   F D S FT   VGN+D A       +Y+  +P  +   ++      +   
Sbjct  693   NLAYTKYQERFADASDFTFFFVGNVDEAQLKDYATKYIASLPSSNSKEVY------EAPE  746

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
             F+  +   RE       + +  V + +  E  +E   ED   +  L ++L  K+V+ LR 
Sbjct  747   FREDTGSKREKTVYKGSDPKSQVSILWNGE--TEYDKEDEFALTALGEVLTIKLVEQLRE  804

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             + G +Y  G      GN  S +        I+F C P+    L + AL E+ +++ +GPS
Sbjct  805   EEGGVYGVGAR----GNM-SEIPYDSYSFSISFPCGPENVEKLTNAALAEVEKIRNNGPS  859

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLDRILRS  2760
              ED++ + E  +   +  L+EN +WLD+I ++
Sbjct  860   QEDLAKIKETFKVQRKEQLKENKFWLDQIEKA  891



>ref|WP_012780235.1| peptidase M16 [Pedobacter heparinus]
 ref|YP_003090344.1| peptidase M16 domain-containing protein [Pedobacter heparinus 
DSM 2366]
 gb|ACU02282.1| peptidase M16 domain protein [Pedobacter heparinus DSM 2366]
Length=938

 Score =   385 bits (990),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 250/874 (29%), Positives = 436/874 (50%), Gaps = 23/874 (3%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+L NGLTYY+R NS+P  RA L L    GS++E++++ G+AH  EH+AF+ T  +
Sbjct  38    AVKIGKLPNGLTYYIRKNSEPAKRAVLYLVTHVGSLMEDDDQLGLAHFTEHMAFNGTRDF  97

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +++V +L+  G +FGA  NA TS +ET+Y+L +P D   +  ++ S++A ++  V   
Sbjct  98    PKNELVNYLQKAGVKFGADVNASTSFNETIYKLPLPTDSMAVFKKSFSMMANWAGLVTFE  157

Query  517   EHDLEKERGAVMEEYRG-SRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
             E  + +ERG ++EE R   +N   R+Q      ++  S+YA R+PIG +++++T  P ++
Sbjct  158   EGAINRERGIILEEERSRGKNVAERIQKQVIPALLNNSRYASRMPIGKDELLKTFKPDVI  217

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             K+FYK WY     AVIAVGDF D + V  LI+ +F    +P        Y +P  +  + 
Sbjct  218   KRFYKDWYRPDLQAVIAVGDF-DPKLVERLIRENFSTLKNPMHSRKRINYSIPPDKGTQI  276

Query  874   SCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYS  1053
                 + E   + + I  +     ++T  D  + L+ S+    L  R  ++ ++ + P   
Sbjct  277   KIITDPEQTSTRMQIIVRHQGKAVRTSADLIESLSRSLLNRMLGSRVAELRQQANAPLLI  336

Query  1054  CSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSE  1233
              S      +  + A+ +  + K     +A + +L    + R  GF++ E+   +  L + 
Sbjct  337   GSIGYGRFLADIDAFTIAVTAKPGQLEQAAKKILAVNEQARQFGFTQAELESAKKSLFNT  396

Query  1234  IESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFG  1413
             IE  + ERD+  S +   EYL HF + E + GI+YE    K  L  I   ++ K      
Sbjct  397   IERQWKERDKNSSAAYVTEYLNHFTKGEAIPGIDYEYHFLKNNLAKIKLEQLDKLIRALN  456

Query  1414  TSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWI  1590
             ++ + VI    P +  A + D + ++  I+  +  +++ P+  E +P +++   P  G I
Sbjct  457   STENRVIIIEAPEKDKALLPDQKKLLSWIS--DSGRNLQPYRSEAVPSKLLDNLPEGGVI  514

Query  1591  MQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGST  1770
                      G  E  L NG RV  K T F +DQ++  G+SYGG S   +S Y S ++ + 
Sbjct  515   SAAKTNVGTGVSELILGNGARVILKPTRFKNDQIIINGYSYGGTSIAADSIYHSAALAAL  574

Query  1771  IAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTN  1950
             +    G+     + L  ML+G+   +   +  +    SG  SP++LETALQL+Y  FT  
Sbjct  575   LVNRSGLGKLTRAQLNKMLSGRSVNLSASISDFTEGLSGSASPAELETALQLIYLYFTQP  634

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPYK  2130
              +  E  + I+ Q  E ++  +   P   F + V  +   NSY  R     +L   +  +
Sbjct  635   RKDPEAWLAIISQQ-EASMANRSASPNLVFQDTVTAV--LNSYNPRKT-AGNLDGTSIDQ  690

Query  2131  ACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPFK  2310
             A  ++ + F D S FT ++VG ID A A PLI +YLG +     P +H  ++  K   F 
Sbjct  691   AYRFYQDRFADASDFTFILVGAIDTAKAIPLIKKYLGNL-----PAIH-RKEHYKDAGFG  744

Query  2311  FPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRFKY  2490
              P   + + V+   +EA+  VQL +       D + ++     L +++  +I+  LR K 
Sbjct  745   TPRGQVSKTVYKG-IEAKSRVQLVYSGTYTYND-LNNIQLEA-LKEMINYRILNRLRAKE  801

Query  2491  GQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPSDE  2670
               +Y   V+V   GN P +    R  I I+F+C P+    L++ + +E+ RL+ +GP   
Sbjct  802   SGVYTPSVNVGY-GNIPVQ----RYSITISFNCAPENVQHLIEASKEEVERLKREGPEPA  856

Query  2671  DVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR  2772
             ++   +  + R  E  ++ N +W+  +   Y +R
Sbjct  857   EIQKFMAAQLRMRETQVESNTWWVYYLRNQYMNR  890



>ref|WP_028889299.1| peptidase M16 [Tenacibaculum ovolyticum]
Length=940

 Score =   384 bits (986),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 262/909 (29%), Positives = 450/909 (50%), Gaps = 51/909 (6%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG+TYY+++N KP  +  L L V  GS+LE++++ G+AH +EH++F+ T+ + 
Sbjct  44    VKIGKLSNGMTYYIQNNPKPANKVELRLVVNVGSILEDKDQLGLAHFMEHMSFNGTKNFK  103

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+SIG +FGA  NA T  DETVY L +P D    L +   IL +++       
Sbjct  104   KNELVDYLQSIGVKFGAHLNAYTGFDETVYILPIPSDDNTKLEKGFQILEDWAHGALLEG  163

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+++ERG V+EEYR  R A+ RM + +   +M GSKYAERLPIG ++ ++T   + +++
Sbjct  164   KDIDEERGVVLEEYRSRRGADSRMLEKYLPKVMHGSKYAERLPIGTKENLKTFKHESLRR  223

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAVIAVGD  D   + E IK HF    +  +P       + +H+E   + 
Sbjct  224   FYKDWYRPDLMAVIAVGDV-DVNILEEKIKKHFNQIPTAKNPRKREVAPLKNHKETFIAI  282

Query  880   FVESEAAGSAVMISCKMPVDELK---TVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-  1047
               + EA  S V +  K   D+ K   TV DYR+ L +S+F   LN R  ++   + PP+ 
Sbjct  283   EADKEAPFSRVQLMYK-DYDKAKPETTVGDYRNSLVKSLFSQMLNNRLDELRNSETPPFV  341

Query  1048  YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLM  1227
             Y  S       R   AY   +     G ++ L+++L E  RV+ +GF + E+   +  ++
Sbjct  342   YGYSYHGGTWARAKNAYQSMAGTSADGQLKGLQALLDESERVKRYGFKQGELDRAKKNVI  401

Query  1228  SEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER  1407
             + +E ++ ++D+  S  +  EY+ +FL  EP+ GI +E +  + LLP I   EV+   + 
Sbjct  402   ARVEKSFKDKDKRDSNRIIGEYVNNFLEQEPIPGITWEYKTHQMLLPSIKIDEVNNIIKN  461

Query  1408  FGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGW  1587
             F    + V+    P+   T    + V+  +N  + K+ +  + +E I   +++  P+PG 
Sbjct  462   FLHDDNRVVVITGPKKVVTE---QQVLDALNNVKTKK-LEDYKDEVITTSLITKVPTPGK  517

Query  1588  IMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGS  1767
             I+   E +++G   F LSNG +V +K T+F +D++LF  FS+GG S   + E  + S  +
Sbjct  518   IINASENKDLGTKTFTLSNGAKVTFKKTDFKNDEILFDAFSFGGTSLYSDKELKATSFAN  577

Query  1768  TIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT  1947
                 + GV  Y  + L  M++GK A V   +      F G  SP DLE   Q+V+ L+ T
Sbjct  578   GALSQAGVNSYTKTDLSKMMSGKIARVNPYISGLSEGFRGSASPKDLEELFQMVH-LYFT  636

Query  1948  NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRE-LNYGNSYFFRPIRIRDLQKVNP  2124
             ++   ++  N  +   +  +      P   F   + E +N GNS      R         
Sbjct  637   SLNKDQKAFNSYVNKQKSFLGNLLASPNFFFQKEMSEFMNEGNS------RYTGFPTPEK  690

Query  2125  YKACEY------FNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRD  2286
             Y+  +Y      +   F D   F    VGN+D        ++YL  +P  +      +++
Sbjct  691   YETADYDLAYKKYQERFADAGDFHYYFVGNVDEKKLAEFSMKYLASLPAKN------SKE  744

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEA----QCSVQLCFPVELKSEDMMEDVHFVGFLSKLL  2454
               K   F+  S       HS  V+     + +V + +  + K+    +D      L +++
Sbjct  745   TYKVSSFRPLSG-----AHSKTVQKGKDPKSNVNITY--QGKANYNKKDALAFSSLGEIV  797

Query  2455  ETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDE  2634
               K+ + LR + G +Y++      G       G  R    I+F C P+    L  +++D+
Sbjct  798   GIKLTEKLREQEGGVYSSRTR---GSISKMPYGWYR--FNISFPCAPENVEKLKTISVDQ  852

Query  2635  ILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILR-SYQSRIYSGDVGDSFKVQ  2811
             +  + ++GP++ED+    +     H+  L++N +WL  I    YQ      D  D+   +
Sbjct  853   VASIVKNGPTEEDLMKTKKAIILDHKEDLKKNRFWLRTIKNVDYQ----KNDATDALSFE  908

Query  2812  DEARSKVRK  2838
             D   +  +K
Sbjct  909   DRVNALTKK  917



>ref|WP_015692628.1| peptidase M16 [Saprospira grandis]
 ref|YP_005322597.1| peptidase m16 domain protein [Saprospira grandis str. Lewin]
 gb|AFC25013.1| peptidase m16 domain protein [Saprospira grandis str. Lewin]
Length=985

 Score =   385 bits (989),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 263/890 (30%), Positives = 441/890 (50%), Gaps = 34/890 (4%)
 Frame = +1

Query  127   MEEALSQTPY--GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             ME AL   P+   +  G+L+NG+ YY+R N+KP+ R  L LA+ AGS+ EE+ +RG+AH 
Sbjct  68    MEAAL---PFDESIRTGQLENGMRYYLRKNAKPENRIELRLAIDAGSMQEEDSQRGLAHF  124

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAIS  480
             VEH+ F+ T  +  +++V FLE  G  FGA  NA TS DETVY L +P DK  L+ + + 
Sbjct  125   VEHMCFNGTANFKKNELVDFLEKTGVRFGADLNAYTSFDETVYMLQLPTDKEGLVDKGLV  184

Query  481   ILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLE  660
             ++ +++S V   E +++KERG ++ E+R    A+ RM+  +W  +   S+YA RLPIG  
Sbjct  185   VMQDWASAVSFEEEEIDKERGVILSEWRTRLGADERMRQVYWPKLFYNSRYANRLPIGTT  244

Query  661   KVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY  840
             +VI+    + +  FYK WY    MA+I VGD  D   +   IK +F    +P +P     
Sbjct  245   EVIQNAPYERLTTFYKDWYRPNLMALIVVGDI-DLDEIEAKIKTNFSKMENPENPKEKKL  303

Query  841   YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFK  1020
             + VP H+E   +   + EA   +  +  K     +KT+ D+R  +   ++   LN R+ +
Sbjct  304   FEVPGHKETFVAVATDKEATNVSFQMIHKHAPKSIKTLDDFRTSITHQLYNIMLNARYNE  363

Query  1021  ISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSERE  1200
             +S+    P+    +     VR   AY + ++ KE    EA+  +L E  RV  HGF++ E
Sbjct  364   LSQDPKAPFLYAGSGYGNYVRNSDAYFIQAAAKENSIEEAIALVLREQKRVLEHGFTDTE  423

Query  1201  ISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISA  1380
             +   +A  ++ +E AY +RD++ S S+  E + HFL++ P+ GIE E QL K  LP I  
Sbjct  424   LERAKAEYLNYVEQAYRKRDKVTSASIASECVSHFLQDAPLFGIEKELQLVKEFLPSIKL  483

Query  1381  SEVSKYSERFGTSSSCVIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWDEENI  1548
              E++   + + T  +       P        T D +R ++ +     +K  +  + ++ +
Sbjct  484   KEMNALPKAWITKENRTAILTAPAKEGLKIPTEDRIRELLAE----NEKIEVEAYKDKFL  539

Query  1549  PEEIVSVKPSPGWIMQQFEY--QNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGL  1722
                ++   P  G +  Q E   + +   E+ LSNG +V  K T+F  DQ++   +S GG 
Sbjct  540   DMPLLEKAPKTGKVTAQKEVKEKELNITEWTLSNGAKVILKPTDFEGDQIMLQAYSPGGH  599

Query  1723  SELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPS  1902
             S     ++ + S  + +    GV  +    L   L  K   +   +      FSG  S +
Sbjct  600   SIYDVKDFLTASSAAELIDRSGVGQFDLIALEKKLTAKTVSISPYISELSEGFSGRSSTA  659

Query  1903  DLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYF  2082
             D ET L+L+Y L+ T     E+     ++ A E       +P   F N  ++     ++ 
Sbjct  660   DFETMLKLLY-LYATQSRLDEKAYEAYLEEAIEQSRNALSNPQQYFFNEYQKA-LSQNHP  717

Query  2083  FRP--IRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRP  2256
              RP  +    ++ ++  +A E +   F D S FT V+VGN  P      + QY+  +P  
Sbjct  718   RRPGLLSEEQIRSIDMKRAHEIYKERFADFSDFTFVLVGNFKPEEIKGQVEQYIASLPST  777

Query  2257  SEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVG  2436
             +       +++ K    KFP+  + + +   +   Q +V L F  E+      E+   + 
Sbjct  778   N------RKENYKDPEVKFPAKGMTKNLKKGLA-PQSNVILSFAQEVNWS--AEEAFKLD  828

Query  2437  FLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLV  2616
                 +L   + + LR   G +Y    S F+GG   SR       I + F C PD    LV
Sbjct  829   AAISVLSIMVRENLREDKGGVY----SPFVGGGM-SREPKGTSQIIVFFQCAPDDVEVLV  883

Query  2617  DLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQ  2766
             +   +E+ +LQ+DGPS+E++  V E ++R  E  L+EN +W+ ++L  Y+
Sbjct  884   EAVKEEVAKLQKDGPSEENLEKVRETKRRGLETSLKENRFWIGQLLNKYR  933



>ref|WP_027395655.1| peptidase M16 [Aquimarina latercula]
Length=945

 Score =   384 bits (986),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 268/960 (28%), Positives = 463/960 (48%), Gaps = 65/960 (7%)
 Frame = +1

Query  118   NVNMEEALSQTPYGVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAH  297
             NV  E+ +   P  V  G+L NGLTYY+R+N KP+ +  L L V AGS+LE+E + G+AH
Sbjct  27    NVKNEDKIPVDP-NVKIGKLKNGLTYYIRNNGKPEDKVELRLVVNAGSILEDENQLGLAH  85

Query  298   IVEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAI  477
              +EH+ F+ T+ +  +D+V +L++IG +FGA  NA TS D+TVY L +P D PE L +  
Sbjct  86    FMEHMNFNGTKNFKKNDLVDYLQTIGVKFGADLNAYTSFDQTVYILPIPSDDPEKLEKGF  145

Query  478   SILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGL  657
              I+ +++     +E  ++ ERG V+EEYR  + AN RM   +  ++   S+Y+ERLPIG 
Sbjct  146   QIIEDWAHNAELTEEAIDGERGVVLEEYRLGKGANERMLQEYLPIIAYNSRYSERLPIGT  205

Query  658   EKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppip  837
             +K++     + V+ FYK WY    M+V+AVGD  D  ++ + IK HF     P +P    
Sbjct  206   KKILENFKYEDVRSFYKDWYRPDLMSVVAVGDL-DVATLEQKIKDHFSGLQMPLNPKKRE  264

Query  838   YYLVPSHEEPRFSCFVESEAAGSAV--MISCKMPVDELKTVKDYRDLLAESMFFHALNQR  1011
              Y  P+H+E   +   + EA+ S V  M   +   + + TV DYR  + E +F   +N R
Sbjct  265   TYDTPNHKETLIAVVSDKEASNSVVRLMYKDREVSEPMTTVGDYRKAIVERVFTQMMNSR  324

Query  1012  FFKISRKKDPPY-YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGF  1188
               ++  K +PP+ ++ S+ +    R  +AY   +   E G + AL+++L E  RV+ HGF
Sbjct  325   LNELRNKPNPPFVFAGSSHSGTFARNREAYQSFALTSETGQLIALKTILQENKRVQKHGF  384

Query  1189  SEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLP  1368
                E+   +  + +  E  + ++D+ +S  +  EY+ ++L  EP+ GIE+E Q   + LP
Sbjct  385   KASELERAKKQISANWEKQFKDKDKRESARIIGEYINNYLEQEPIPGIEWEYQYTMSQLP  444

Query  1369  HISASEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENI  1548
              I+  EV+   + F    +  +    P         +  +L +    +   I  + +E +
Sbjct  445   TITLEEVNGLIKDFLHDDNRAVVMTGPEKDGLKQVTKEEILALLKEIETADIEDYKDEKV  504

Query  1549  PEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSE  1728
              E ++   PSPG ++   + + +     +LSNG ++ YK T+F +D++LF+ +SYGG S 
Sbjct  505   RENLIEKMPSPGTVVSSKKDEKLDVTILELSNGAKITYKKTDFKNDEILFSAYSYGGSSL  564

Query  1729  LPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDL  1908
                 +Y   S G     + G+ G   + +  ++AGK A V   +      F+G  +P DL
Sbjct  565   FSLEDYKQVSFGLGSIAQTGLGGLSLNDMNKVMAGKIARVRPYINNLSEGFNGSATPKDL  624

Query  1909  ETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYF--  2082
             E   Q ++  FT+            +   E+A  + +       AN    L+   SYF  
Sbjct  625   EVLFQQIHLYFTS------------LNKDEKAFRSDQEKTKGFLANY---LSNPQSYFRE  669

Query  2083  -FRPIRI------------RDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPL  2223
              F   +               L  VN   A E +   F     F    VGNID +     
Sbjct  670   EFNKFQFEKNPRYTGFPTPEKLDAVNYDLAYEKYKERFAGAGGFNFYFVGNIDESKLKQY  729

Query  2224  ILQYLGGIPRPSEPILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVEL--  2397
                Y+  +P   +    +   D + L      ++ R        + + SV + +  E   
Sbjct  730   AETYIASLPDTGKDET-YKVSDFRPLSGAHEKTVYR------GKDPKSSVNIIWRGETTY  782

Query  2398  -KSEDMMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRG-DI  2571
              KSE +      +  L ++L  K+++ LR + G +Y  G    +    PS  G   G   
Sbjct  783   NKSEKLA-----IEALGEILSIKLIEKLREEEGGVYGVGARGNMYKIGPS--GGYSGYRF  835

Query  2572  GINFSCDPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
              I+F C P+    L D A+ E+  +  +GP+D+D++ + E     ++   ++N +WL  +
Sbjct  836   SISFPCGPENVKKLTDAAIAEVKTIITEGPTDKDLAKIKESRLLDYKEQSKQNSFWLGNL  895

Query  2752  LRSYQSRIYSGDVGDSFKVQDEARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
               +  ++I   ++GD++         ++KL     ++  +Q+I        Y + +LMP+
Sbjct  896   QNADYNQI-KLEIGDTYA------ETIQKL-----SKQDIQKIAQKYVDTGYILGVLMPE  943



>ref|WP_028523129.1| peptidase M16 [Runella limosa]
Length=934

 Score =   383 bits (983),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 243/876 (28%), Positives = 444/876 (51%), Gaps = 31/876 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V YG+L NG+TYY+R N +PK RA L L  + G++ EE++E G+AH  EH+AF+ T+ + 
Sbjct  35    VRYGKLPNGMTYYIRKNEEPKKRAELYLINKVGAIQEEDKENGLAHFTEHMAFNGTKNFP  94

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+  G +FG   NA T  D+TVY+L VP D  ++ ++A  +L +++  +    
Sbjct  95    KNELVSYLQRAGVKFGDDLNAFTGQDQTVYQLPVPTDSADIFNKAFVVLEDWAHNITFEG  154

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              +++KERG ++EE RG + A  RM+D    +++  SKY +R  IG E +++  S + ++ 
Sbjct  155   AEIDKERGVILEELRGGKGAPQRMRDKWLPILVGDSKYGKRNIIGTEDILKNFSHETIRN  214

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     A+ AVGDF D   V ++IK  FG       P P+  + V   +  R + 
Sbjct  215   FYKTWYRPDLQAIAAVGDF-DIDQVEKMIKQRFGAIPKAAKPRPLGKFPVADFKGTRVAI  273

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E       I  K+P  E KT+ D R+ +  ++F   L  R  + +++ +PP+    
Sbjct  274   VTDPEQPYMVAQIITKLPKAEEKTLGDSRESIKRNLFNQMLQARLQEQTQQANPPFLYGG  333

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A     +    ++I  +  K+     A++++L E ARV+  GF+  E+   +  L++  E
Sbjct  334   AGYGGFIGDYDSFINIAVAKDGNLERAVKAVLDEGARVKKFGFTATELDRTKKQLLTATE  393

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
               + ERD+ +S S  +EY+ +FL   P+ GIE++ +  +  L  I+ +E++  + ++  +
Sbjct  394   KRFKERDKTKSASYVNEYMGNFLEESPIPGIEFQFEFVQGQLDGITIAEINALANKYLIA  453

Query  1420  SS-CVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
              +  V+     +  A +    +++  INT    + +  ++++ + + ++   P+ G  + 
Sbjct  454   DNRTVLVLASEKDKAKLPTEATILEWINT--AGKDVTAYEDKVVNKPLIENLPAAGRTVS  511

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
               +   +G  E  LSNG++V  K T+F +D++L    S GG S   E +Y S  M   + 
Sbjct  512   TKQIPEIGVTELTLSNGVKVVLKPTDFKNDEILIGARSQGGTSLYDEKDYMSAGMADAVV  571

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
              E G+  +    L   L GK A V   +G     FSG+CSP DLETALQLVY  FT   +
Sbjct  572   EESGIGEFNTPALKKYLTGKVANVSPFVGENEEGFSGNCSPKDLETALQLVYGYFT---K  628

Query  1957  PGEEDVNIVMQMAEEAIHAQERD----PYTAFANRVRELNYGNSYFFRPIRIRDLQKVNP  2124
             P ++D  I   +  +    + R+    P   F + +  +   N++  +PI +     +NP
Sbjct  629   PRKDDDIIKGFLTSQRSAIKNRNASPSPEVVFQDSLSRILGNNNFRRQPISVERWDMINP  688

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              +A + +   F D S FT    G+       PL+ +YLG +P  ++      +++ + L 
Sbjct  689   DRAYQIYKERFADASDFTFFFTGSFKVDEVKPLLEKYLGALPSQNK------KENFRDLG  742

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMM--EDVHF-VGFLSKLLETKIVQV  2475
              + PS  + + V+   +E +    L F     S D +  ED ++ +  L ++L  K+++V
Sbjct  743   IRTPSGRLDKKVYKG-IEQKSQASLIF-----SGDYVYNEDNNWQLDALEEILNIKLIEV  796

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             +R K   +Y  G          S+    R  + I +   P+    L    L  +  ++++
Sbjct  797   IREKESGVYGIGARASY-----SKTPAPRYTLRIGYGTGPERVEELATKTLAVLDEIKKN  851

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             G +  D+       +R+ E  ++EN +W ++++ +Y
Sbjct  852   GATQVDIDKFKAETRRSMEVQMKENGFWQNQLIGAY  887



>ref|WP_025763593.1| peptidase M16 [Dyadobacter tibetensis]
Length=936

 Score =   382 bits (982),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 263/937 (28%), Positives = 465/937 (50%), Gaps = 52/937 (6%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+R N +P+ RA L L ++AGS+LE EE++G+AH +EH+ F+ T+ + 
Sbjct  37    VKMGKLKNGLTYYIRQNKEPEKRAELRLVIKAGSILETEEQQGLAHFMEHMNFNGTKNFP  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V FL+  G  FGA  NA TS DETVY L +P D   LL + + +L ++S +    +
Sbjct  97    KNELVNFLQKTGVRFGADLNAYTSFDETVYMLPIPTDSAGLLEKGLQVLEDWSHDALLED  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++EKERG V+EE R  R A  RM+D +   ++  S+YAERLPIG +++++   P  +K 
Sbjct  157   SEIEKERGVVLEESRLGRGAQQRMRDQYLTQILNNSRYAERLPIGKDEILKNFKPATLKS  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY  WY    MAVIAVGDF D   V  +IK  FG   +P        Y V    +   + 
Sbjct  217   FYTDWYRPDLMAVIAVGDF-DAAEVERIIKDKFGSIPAPKQAKARTKYEVKLDGKNNVAV  275

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E     V +  K+P  + KT+KD +D +A+ ++   + QR  ++++K +PP+   +
Sbjct  276   VTDPEFPQYVVQMIYKLPGQQEKTLKDVKDHIAQGLYNAMIGQRIQELTQKPNPPFLFAN  335

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
             ++    +  + AY   +  K+   +E A+ +++TE  R +  GF+E E    ++   + +
Sbjct  336   SSYGDFLGGLDAYTSVALAKDAAGLEPAMVALVTENMRAQKFGFTEAEFQRAKSDFSTNV  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGT  1416
             E    E+D+ +S+S   EY+ HFL  +  +G E  +   +  L  +S SEV+  ++++ +
Sbjct  396   ERQLKEKDKTRSSSHVQEYINHFLHEDAFMGAEAYSDFVQKHLGSVSLSEVNALAKKYIS  455

Query  1417  SSSCVIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPG  1584
             +++  I  + P        + + + S+V  +      + +  + ++ +   ++  +P+PG
Sbjct  456   NTNRSIVVMAPEQGKDKLPSAEQIESIVATVG-----KDVVAYVDDALDAPLLPNEPTPG  510

Query  1585  WIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMG  1764
              I+++         +  LSNG+ V  K T F +D++L      GG S  P+    +    
Sbjct  511   KIVKESVISKAKITQLVLSNGVTVLLKPTEFKNDEILIKATGKGGYSLFPKDRE-TGMFT  569

Query  1765  STIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFT  1944
             S +    GV  Y  + L   LAGK    G  L       + + +P DLET+L+L++  FT
Sbjct  570   SYLVQSGGVGPYNQTQLQKYLAGKTVNAGPYLSELSEGINSNTNPKDLETSLKLIHAYFT  629

Query  1945  TNVEPGEEDVNIVMQMAEEAIHAQERD----PYTAFANRVRELNYGNSYFFRPIRIRDLQ  2112
                EP ++   +   ++ +  + +       P   F++ +  +   +     P++  D+ 
Sbjct  630   ---EPRKDAAVVEGILSNQKAYLENMQKTLTPEKIFSDSLNAVVTSHDPRREPLKPNDID  686

Query  2113  KVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDL  2292
             K++  KA   +N+ F D S F   +VG     +  PL+ +YLG +P          RDD 
Sbjct  687   KIDLEKALGIYNDRFSDASDFVFTMVGAFKIDSIKPLLEKYLGSLPSTE-------RDDT  739

Query  2293  KGLPFKFPSS--IIREVVHSPMVEAQCSVQLCFP--VELKSEDMMEDVHFVGFLSKLLET  2460
                P  FP S  II+ V     +E +  V + F    +   E+ ++    +  L + L+ 
Sbjct  740   FDHPNIFPPSGRIIKTVYKG--LEPKSRVAMIFSGTYDYSPENNVQ----LEALQEALQI  793

Query  2461  KIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEIL  2640
             K+++ LR +   +Y  GVS       PS  G+ R  I + F C P+    L+   L EI 
Sbjct  794   KLIESLREEESGVYGVGVSQNT-DKLPS--GHYR--ISVQFGCGPENVDKLIKRTLAEID  848

Query  2641  RLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEA  2820
             +++E G   +D+       +R  E   + N +W++ I ++    ++ GD  D    QDE 
Sbjct  849   KIKEKGADPQDIEKFTAETKRKLEVASKTNGFWINYIDKN----VFIGDDLDELYRQDE-  903

Query  2821  RSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
                   LL  ++ +   +    +   + Y  ++LMP+
Sbjct  904   ------LLGSVSVKSTQEAAKKYFNDQNYIQMVLMPE  934



>gb|ETZ19524.1| peptidase M16 [Pedobacter sp. V48]
Length=955

 Score =   382 bits (982),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 272/933 (29%), Positives = 465/933 (50%), Gaps = 41/933 (4%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY+R N +PK RA L LA R GS++EE++++G+AH  EH+AF+ T+ + 
Sbjct  53    VKIGKLANGLTYYIRKNVEPKNRAELYLATRIGSLMEEDDQQGLAHFTEHMAFNGTKDFP  112

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +DI+ +L+  G  FGA  NA T  ++TVY+L +P D   +      ILA ++ +V    
Sbjct  113   KNDIINYLQKAGVRFGADLNAYTGFEQTVYQLPIPTDSALVFKTGFKILANWAGKVVMEG  172

Query  520   HDLEKERGAVMEEYRG-SRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVK  696
              +++KERG ++EE R   +NA  RM      L+++GS+Y  RLPIG   ++++ S   ++
Sbjct  173   EEIDKERGVIIEEDRQRGKNAQERMSKQLLPLLLKGSRYENRLPIGKIDILKSFSHDRIR  232

Query  697   QFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFS  876
              FYK WY     AVIAVGDF D   V +LIK +F   T+P +P P   Y +P ++EP   
Sbjct  233   SFYKDWYRPNLQAVIAVGDF-DVNEVEQLIKVNFSDLTNPANPKPRLNYDLPDNKEPLVK  291

Query  877   CFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYY--  1050
                + E      +I  K+  +  KT  D++  +  SM    L  RF +I +K++ P+   
Sbjct  292   VITDPEQPYDVAIIMYKLRGNATKTTADFKKRIMYSMVNSMLGARFEEILQKENAPFIFG  351

Query  1051  --SCSAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRAL  1221
               S       LV  + A+    + K    +E A    L E  R+   GF + E+ V +  
Sbjct  352   QSSFGPYQGGLVSGINAFQTVVAAKSGEQLEKAFTGALAENERMSKFGFVQSELDVAKKN  411

Query  1222  LMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYS  1401
             +++  E  Y E+D+  S++   +YL +FL+   +  I+Y     +  + +I+  E++   
Sbjct  412   ILAGNEKQYKEKDKTASSNFVQQYLNNFLKGSTIPSIDYTYAETQKAVANITLEEINALV  471

Query  1402  ERFGTSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
             +      + +I    P +  A++     +V  +        I  + + ++ + ++  KP+
Sbjct  472   KTLTPKENQIIVVQAPEKDKASLPTEAQLVAAVKN--AGAGITAYVDNSLNKPLLEKKPT  529

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G ++ + +   VG  E  LSNG++V  K T+F +DQV+F+ FS GG+S + + +  S  
Sbjct  530   AGKVVSERKIDAVGVTELTLSNGIKVLLKPTDFKNDQVIFSSFSKGGMSVVNDEDLESAQ  589

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             M S IA + GV  + P+ L  +LAG     G  +    + FSG  SP D+ETA Q++Y  
Sbjct  590   MVSLIA-QSGVGEFNPTQLSKLLAGNTGRAGAYVDDLYQGFSGSSSPKDIETAFQMIYA-  647

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKV  2118
             + TN     E  N  +   +  +  +  +P + F++ V+ +    +    P  ++DL KV
Sbjct  648   YATNPRKDSEIFNKNISDYKVVLGNKNANPNSVFSDTVQAVLSSYNKRAMPTNLQDLDKV  707

Query  2119  NPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKG  2298
             +  KA +++ + F D S  T +IVG  D     P I  Y+  +P  ++      + D   
Sbjct  708   SLDKAFDFYKDRFADASEQTFIIVGAFDINAIKPFIETYIASLPALNK------KQDFID  761

Query  2299  LPFKFPSSIIREVVHSPMVEAQCSVQLCFPVE--LKSEDMMEDVHFVGFLSKLLETKIVQ  2472
                + P   I + V+  + E + +V+L    +    +++ ++    +  L   LE KI++
Sbjct  762   RGVRAPKGKISKTVYKGL-EDKAAVELYIHGDYTFNADNNIQ----LDALKGALEIKILE  816

Query  2473  VLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQE  2652
              LR K   +Y+  V + L   +    G+      I+FSC P     L+  ALDE+ +++ 
Sbjct  817   RLREKESGVYSPQVGLSL---EKYPAGHYY--FNISFSCAPANVEKLITAALDEVNKIKA  871

Query  2653  DGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARSKV  2832
              G S +D++      QR  E  L+ N YWL  +     SR+ +G+  D    + +  + V
Sbjct  872   SGASVDDITKFKSEAQRQFELNLRNNNYWLSYL----SSRLKNGENLDQLLGEKQRLNSV  927

Query  2833  RKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
                 T  TAQ  L        +  Y  ++L+PQ
Sbjct  928   SVESTKTTAQKYLN-------EDNYIRLVLLPQ  953



>ref|WP_002658415.1| peptidase M16 [Saprospira grandis]
 gb|EJF53033.1| putative Zn-dependent peptidase [Saprospira grandis DSM 2844]
Length=985

 Score =   383 bits (984),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 261/886 (29%), Positives = 440/886 (50%), Gaps = 26/886 (3%)
 Frame = +1

Query  127   MEEALSQTPY--GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             ME AL   P+   +  G+L+NG+ YY+R N+KP+ R  L LA+ AGS+ EE+ +RG+AH 
Sbjct  68    MEAAL---PFDESIRTGQLENGMRYYLRKNAKPENRIELRLAIDAGSMQEEDSQRGLAHF  124

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAIS  480
             VEH+ F+ T  +  +++V FLE  G  FGA  NA TS DETVY L +P DK  L+ + + 
Sbjct  125   VEHMCFNGTANFKKNELVDFLEKTGVRFGADLNAYTSFDETVYMLQLPTDKEGLVDKGLV  184

Query  481   ILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLE  660
             ++ +++S V   E +++KERG ++ E+R    A+ RM+  +W  +   S+YA RLPIG  
Sbjct  185   VMQDWASAVSFEEDEIDKERGVILSEWRTRLGADERMRQVYWPKLFYNSRYANRLPIGTT  244

Query  661   KVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipY  840
             +VI+    + +  FYK WY    MA+I VGD  D   +   IK +F    +P +P     
Sbjct  245   EVIQHAPYERLTTFYKDWYRPNLMALIVVGDI-DLDEIEAKIKTNFSKMENPENPKEKKL  303

Query  841   YLVPSHEEPRFSCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFK  1020
             + VP H+E   S   + EA   +  +  K     +KT+ D+R  +A  ++   LN R+ +
Sbjct  304   FEVPGHKETFVSVATDKEATNVSFQMIHKHAPKSIKTLDDFRSSIAHQLYNIMLNARYDE  363

Query  1021  ISRKKDPPYYSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSERE  1200
             +S+    P+    +     VR   AY + +  KE    EA+  +L E  RV  HGF++ E
Sbjct  364   LSQDPKAPFLYAGSGYGNYVRNSDAYFIQAGAKENSIEEAIALVLREQKRVLEHGFTDTE  423

Query  1201  ISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISA  1380
             +   +A  ++ +E AY +RD++ S S+  E + HFL++ P+ GIE E QL K  LP I  
Sbjct  424   LERAKAEYLNYVEQAYRKRDKVTSASIAGECVSHFLQDAPLFGIEKELQLVKEFLPSIKL  483

Query  1381  SEVSKYSERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEI  1560
              E++   + + T  +       P            + ++    +K  +  + ++ +   +
Sbjct  484   KEMNALPKTWITKENRTAILTAPAKEGLKIPTEERIRELLAENEKIEVEAYKDKFLDMPL  543

Query  1561  VSVKPSPGWIMQQFEY--QNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELP  1734
             +   P+ G +  Q E   +++   E+ LSNG +V  K T+F  DQ++   +S GG S   
Sbjct  544   LEKAPTAGKVTAQKEVKEKDLNITEWTLSNGAKVILKPTDFEGDQIMLQAYSPGGHSIYD  603

Query  1735  ESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLET  1914
               ++ + S  + +    GV  +    L   L  K   +   +      FSG  S +D ET
Sbjct  604   IKDFLTASSAAELVNRSGVGQFDRIALDKKLTAKTVSISPYISELSEGFSGRSSTADFET  663

Query  1915  ALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRP-  2091
              L+L+Y L+ T     ++  +  ++ A E       +P   F N  ++     ++  RP 
Sbjct  664   MLKLLY-LYATQSRLDKKAYDAYLEEAIEQSRNALSNPQQYFFNEYQKA-LSQNHPRRPG  721

Query  2092  -IRIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPI  2268
              +    ++ ++  +A E +   F D S FT V+VGN  P      + QY+  +P  +   
Sbjct  722   LLSEEQIRSIDMNRAQEIYKERFADFSDFTFVLVGNFKPEEIKGQVEQYIASLPSTN---  778

Query  2269  LHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSK  2448
                 +++ +    KFP+  + + +   +   Q +V L F  E  +    E       +S 
Sbjct  779   ---RKENYRNPEVKFPAKGMTKNLKKGLA-PQSNVILSFAQET-NWSAQEAFKLDAAIS-  832

Query  2449  LLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLAL  2628
             +L   + + LR   G +Y    S F+GG   SR       I + F C PD    LV+   
Sbjct  833   VLSIMVRENLREDKGGVY----SPFVGGGM-SREPKGTSQIIVFFQCAPDDVEVLVEAVK  887

Query  2629  DEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQ  2766
             +E+ +LQ++GPS+E++  V E ++R  E  L+EN +WL ++L  Y+
Sbjct  888   EEVAKLQKEGPSEENLEKVRETKRRGLETSLKENRFWLGQLLNKYR  933



>ref|WP_025018449.1| peptidase M16 [Bacteroides sartorii]
Length=939

 Score =   382 bits (981),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 263/881 (30%), Positives = 452/881 (51%), Gaps = 42/881 (5%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH +EH+ F+ T+ +
Sbjct  35    NVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHFLEHMCFNGTKNF  94

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRA  513
              +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   + IL +++ ++  
Sbjct  95    PDKALIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCLLILHDWADDLTL  154

Query  514   SEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
                +++ ERG + EE+R S NA  RM +     +  GSKYA RLPIG+ +VI     Q +
Sbjct  155   DPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPGSKYAYRLPIGIMEVIDNFPYQAL  214

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             + +Y+KWY      ++ VGD  D   + E IK  F     P +P    Y+ VP ++E   
Sbjct  215   RDYYEKWYRPDQQGIVVVGDI-DVDKIEEKIKKIFSPIKMPENPAEREYFQVPDNKETIV  273

Query  874   SCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQRFFKISRKKDPP  1044
             +   + E A     +  K     +E K   DY  +   +SM  + LN R  ++++  +PP
Sbjct  274   AVETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNARLNELTQTANPP  333

Query  1045  Y-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRA  1218
             + ++  +  + LV   K A+    + KE G   A+ +++ E+ R    GF+  E +  +A
Sbjct  334   FIFAQVSDQEYLVSKTKDAFTGIVASKEDGIDSAITAIVREIERAHKFGFTASEYARAKA  393

Query  1219  LLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKY  1398
               +  +ESAY ER+++++ S  DEY++HF+ NEP+ GIE E  +   ++P++S   ++  
Sbjct  394   DYLRMLESAYNERNKVKNGSYVDEYVRHFIDNEPIPGIENEYAIMNQIVPNLSVEMINSL  453

Query  1399  SERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                  T S+ V+    P         +  VL      + +++  ++++   E ++S  P 
Sbjct  454   IPALVTDSNLVVNVFFPEKEGLKAPSKEEVLAAINKVKAETLTAYEDKVSDEPLISEMPQ  513

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G + ++ E    G+    LSNG+RV  K T+F  D++    FS GG S  P  E  + S
Sbjct  514   GGKVTKK-ENGPFGSTVLTLSNGVRVILKSTDFKADEIRMRAFSPGGNSLFPNDEIINIS  572

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             + + +AG  G+  +    L  +LAGK+A V   +G      +G CSP D ET +QLVY  
Sbjct  573   VMNDVAGIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLNGSCSPKDFETLMQLVYLS  632

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYFFRPIRIRD--L  2109
             FT      +   +   ++ + ++  QE +P TA  + +++  Y G+    R IR++   +
Sbjct  633   FTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP---RAIRMKADMV  688

Query  2110  QKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS-EPILHFNRD  2286
              K++  K  E + + FKD S FT + VGNI P    PLI  YLG +P  + +     N  
Sbjct  689   DKIDYAKIMEMYKDRFKDASDFTFIFVGNIKPEEVEPLIATYLGALPSVNRKETFRDNHI  748

Query  2287  DLKGLPFKFPSSIIREVVHSP------MVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSK  2448
             +++   +K   +I  + + +P      +   QC+        L+++ MM        LS+
Sbjct  749   EMRQGDYK---NIFNKKLETPKATVLVINNGQCAYT------LRNQIMM------SMLSQ  793

Query  2449  LLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLAL  2628
             +L     + +R K G  Y  GVS F    K  +    +  + I F  DP   + + D+ L
Sbjct  794   ILNIMYTESVREKEGGTY--GVSAFGSLTKYPKE---KAVLQIYFDTDPAKRAKMTDIIL  848

Query  2629  DEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             +E+ +   +GPS E+++ V E   + ++   +EN YW++ +
Sbjct  849   NELNQFANEGPSAENLNKVKEFMLKKYKENAKENSYWVNML  889



>ref|WP_032951224.1| peptidase M16 [Bacteroides dorei]
 gb|AII69614.1| peptidase M16 [Bacteroides dorei]
Length=939

 Score =   382 bits (980),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 268/894 (30%), Positives = 457/894 (51%), Gaps = 49/894 (5%)
 Frame = +1

Query  136   ALSQTPY-----GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             A  QTP       V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH 
Sbjct  23    AQQQTPPIPTDPNVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHF  82

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAI  477
             +EH+ F+ T+ + +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   +
Sbjct  83    LEHMCFNGTKNFPDKTLIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCL  142

Query  478   SILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGL  657
              IL +++ ++     +++ ERG + EE+R S NA  RM +     +  GSKYA RLPIG+
Sbjct  143   LILHDWADDLTLDPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPGSKYAYRLPIGI  202

Query  658   EKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppip  837
              +V+     Q ++ +Y+KWY      ++ VGD  D   +   IK  F     P  P    
Sbjct  203   MEVVDNFPYQALRDYYEKWYRPDQQGIVVVGDI-DVDKIEAKIKKIFSPIKMPETPAERE  261

Query  838   YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQ  1008
             Y+ VP ++E   +   + E A     +  K     +E K   DY  +   +SM  + LN 
Sbjct  262   YFQVPDNKETIVAIETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNA  321

Query  1009  RFFKISRKKDPPY-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLH  1182
             R  ++++  +PP+ ++  +  + L+   K A+    + KE G   A+ +++ E+ R    
Sbjct  322   RLNELTQTANPPFIFAQVSDQEFLISKTKDAFTGIVASKEDGIDSAITAIVREIERAHKF  381

Query  1183  GFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTL  1362
             GF+  E +  +A  +  +ESAY ER+++++ +  DEY++HF+ NEP+ GIE E  +   +
Sbjct  382   GFTASEYARAKADYLRMLESAYNERNKVKNGAYVDEYVRHFIDNEPIPGIENEYAIMNQI  441

Query  1363  LPHISASEVSKYSERFGTSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDE  1539
             +P++S   V+       T S+ V+    P +    V   + V+  IN   + +++  +++
Sbjct  442   VPNLSVEMVNSLIPALVTDSNLVVNVFFPEKEGLKVPSKKEVLAAINKV-KAETLTAYED  500

Query  1540  ENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGG  1719
             +   E ++  KP  G I +Q E    G+    LSNG+RV  K T+F  D++    FS GG
Sbjct  501   KVSDEPLIPEKPQGGKITKQ-ENGPFGSTILTLSNGVRVILKQTDFKADEIRMRAFSPGG  559

Query  1720  LSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSP  1899
              S  P  E  + ++ + +A   G+  +    L  +LAGK+A V   +G      SG CSP
Sbjct  560   SSLFPNDEIININVMNDVASIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLSGSCSP  619

Query  1900  SDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNS  2076
              D ET +QLVY  FT      +   +   ++ + ++  QE +P TA  + +++  Y G+ 
Sbjct  620   KDFETLMQLVYLSFTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP  678

Query  2077  YFFRPIRIRD--LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP  2250
                R IR++   + K++  +  E + + FKD S FT + VGNI P    PLI  YLG +P
Sbjct  679   ---RTIRMKADMVDKIDYARIMEMYKDRFKDASDFTFIFVGNIKPEETEPLIATYLGALP  735

Query  2251  RPS-EPILHFNRDDLKGLPFKFPSSIIREVVHSP------MVEAQCSVQLCFPVELKSED  2409
               + +     N  D++   +K   +I  + + +P      +   QC+        LK++ 
Sbjct  736   SVNRKETFRDNHIDMRQGDYK---NIFNKKLETPKATVLVINNGQCAYT------LKNQI  786

Query  2410  MMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSC  2589
             MM        LS++L     + +R K G  Y  GVS F    K  +   +   + I F  
Sbjct  787   MM------SMLSQILNIMYTESVREKEGGTY--GVSAFGSLTKYPKEKAV---LQIYFDT  835

Query  2590  DPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             DP   + + D+ L+E+ +   +GPS E+++ V E   + ++   +EN YW++ +
Sbjct  836   DPAKRAKMTDIILNELNQFANEGPSTENLNKVKEFMLKKYKENAKENSYWVNML  889



>ref|WP_016198467.1| peptidase M16 domain-containing protein [Elizabethkingia meningoseptica]
 gb|EOR30539.1| peptidase M16 domain-containing protein [Elizabethkingia meningoseptica 
ATCC 13253 = NBRC 12535]
Length=951

 Score =   382 bits (981),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 272/939 (29%), Positives = 456/939 (49%), Gaps = 53/939 (6%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NG+ YY++ N+ P+ +    LA+ AGS+LE+E +RG+AH +EH+ F+ T+ + 
Sbjct  29    VRIGTLQNGMKYYIKKNTLPEKKVDFRLAINAGSILEDENQRGLAHFMEHMNFNGTKNFP  88

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
             ++ +V FL+SIG +FG   NA TS DETVY L VP+DKP  L   + ++ +++     S+
Sbjct  89    DNKLVDFLQSIGVKFGQHLNAYTSFDETVYMLPVPLDKPGNLDAGLKVMEDWAFNATLSD  148

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
               ++KERG V+EE R    A+ RM D +   M+  S+YAERLPIG ++V+ T  P ++++
Sbjct  149   EQIDKERGVVLEELRLGLGADKRMMDKYLPKMLYKSQYAERLPIGKKEVLETFKPDVIRK  208

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             F+K WY    MA++ VGD  +   + + IKA+FG   +P  P     + +P+H+E   + 
Sbjct  209   FHKDWYRPDLMAIVVVGDI-NVDEIEQKIKANFGKYANPKQPRERKVFDLPNHKETLVAI  267

Query  880   FVESEAAGSAV---MISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-  1047
               + +A  S V   M        ++ TV+ Y   L E++    LN R  ++    +PP+ 
Sbjct  268   EADPDATSSVVRFIMKDAGAYTPDV-TVEQYNQSLVENITSAMLNNRLRELINSNNPPFT  326

Query  1048  YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLM  1227
             Y          R  +A+   +  K+ G + AL+ +L EV R +  GF++ E+   +A ++
Sbjct  327   YGSVYHGGTYARSKEAFQGFAMTKDGGQLSALKVLLEEVERAKRFGFTQSELDRAKAQVL  386

Query  1228  SEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER  1407
             S +E +Y  RD+ +S  L DEY+++FL  EP+ GI +E    K  LP ++ ++ +   ++
Sbjct  387   SGLERSYNNRDKTESGMLVDEYVRNFLEQEPMPGIIWEYDHTKQFLPSVTLAQTNDIIKK  446

Query  1408  FGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQ--SIPPWDEENIPEEIVSVKPSP  1581
                  S VI    P+         ++V+K  TFE  +   + P++E+   + +V    S 
Sbjct  447   MVKDDSRVIVMTGPKKDNVTMPTEAMVMK--TFEDVKLADLKPYEEKATIKNLVKPFKSD  504

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I +      +G   + LSNG +V +K T+F DD++LFT  S GG S +P+++Y     
Sbjct  505   GKIAKTETDAKLGTTTWTLSNGAKVTFKKTDFKDDEILFTARSLGGSSLIPDADYNKTQF  564

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
               +   E GV G   + L + LAGK+  V   +       SG  +  DL TA++LVY  F
Sbjct  565   AFSALSEAGVNGLSKTDLTNYLAGKQVSVNPFISNLTEGISGRTNQKDLGTAMELVYAYF  624

Query  1942  TT-NVEPGEEDVNIVMQMAEEAIHAQERDPYTAFAN-RVRELNYGNSYFFRPIRI-RDLQ  2112
             T  N  P  E  N         ++    +P   F++   + LN  N  F   I + +D  
Sbjct  625   TGLNYSP--EAFNAYKMKQSAMLNNLNSNPQFYFSDEHAKFLNQKNPRFIGMIPMEKDWA  682

Query  2113  KVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDL  2292
               +  KA + +   F +   F    VGNID A     +LQY+  +P              
Sbjct  683   NTDYKKAYDIYKEKFANAGNFQFYFVGNIDEAKFKNDVLQYIASLPSA------------  730

Query  2293  KGLPFKFPSSIIREV------VHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLL  2454
              G    F  +  R +      V+    + +  V + F  E    +  +D   +  L ++ 
Sbjct  731   -GKARTFKDTGYRSITGDYNKVYKKGKDPKSMVSITFSGEAPYNE--KDALALSALGEVA  787

Query  2455  ETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDE  2634
               K+++ LR     IY  G    +     ++V       GI F C P+ +  L   AL E
Sbjct  788   TIKVIEKLREDESGIYGGGARGGM-----NKVPYGTYSFGIQFPCGPENAEKLTKSALAE  842

Query  2635  ILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQD  2814
             + +L ++GP  +D+    E E    +  L++N YW++ + ++        D  D +++ D
Sbjct  843   LQKLIDNGPEQKDLDKYKEGEYNDDKTNLKDNAYWMNALAKN------QLDGSDKYEILD  896

Query  2815  EARSKVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
               + KV+ L         LQ +      K   +  LMP+
Sbjct  897   -YQEKVKTLTVK-----DLQNVAKKYLSKGKIIATLMPE  929



>ref|WP_016277918.1| zinc protease [Bacteroides massiliensis]
 gb|EOS09528.1| zinc protease [Bacteroides massiliensis dnLKV3]
Length=939

 Score =   381 bits (979),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 265/882 (30%), Positives = 454/882 (51%), Gaps = 44/882 (5%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH +EH+ F+ T+ +
Sbjct  35    NVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHFLEHMCFNGTKNF  94

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRA  513
              +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   + IL +++ ++  
Sbjct  95    PDKALIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCLLILHDWADDLTL  154

Query  514   SEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
                +++ ERG + EE+R S NA  RM +     +  GSKYA RLPIG+ +VI     Q +
Sbjct  155   DPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPGSKYAYRLPIGIMEVIDNFPYQAL  214

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             + +Y+KWY      ++ VGD  D   + E IK  F     P +P    Y+ VP ++E   
Sbjct  215   RDYYEKWYRPDQQGIVVVGDI-DVDKIEEKIKKIFSPIKMPENPAEREYFQVPDNKETIV  273

Query  874   SCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQRFFKISRKKDPP  1044
             +   + E A     +  K     +E K   DY  +   +SM  + LN R  ++++  +PP
Sbjct  274   AVETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNARLNELTQTANPP  333

Query  1045  Y-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRA  1218
             + ++     + LV   K A+    + KE G   A+ +++ E+ R    GF+  E +  +A
Sbjct  334   FIFAQVNDQEYLVSKTKDAFTGIVASKEDGIDSAITAIVREIERAHKFGFTASEYARAKA  393

Query  1219  LLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKY  1398
               +  +ESAY ER+++++ S  DEY++HF+ NEP+ GIE E  +   ++P++S   ++  
Sbjct  394   DYLRMLESAYNERNKVKNGSYVDEYVRHFIDNEPIPGIENEYAIMNQIVPNLSVEMINSL  453

Query  1399  SERFGTSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKP  1575
                  T S+ V+    P +    V     V+  IN   + +++  ++++   E ++S  P
Sbjct  454   IPALVTDSNLVVNVFFPEKEGLKVPSKEEVLAAINKV-KAETLTAYEDKVSDEPLISEMP  512

Query  1576  SPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSC  1755
               G + ++ E    G+    LSNG+RV  K T+F  D++    FS GG S  P  E  + 
Sbjct  513   QGGKVTKK-ENGPFGSTVLTLSNGVRVILKSTDFKADEIRMRAFSPGGNSLFPNDEIINI  571

Query  1756  SMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQ  1935
             S+ + +AG  G+  +    L  +LAGK+A V   +G      +G CSP D ET +QLVY 
Sbjct  572   SVMNDVAGIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLNGSCSPKDFETLMQLVYL  631

Query  1936  LFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYFFRPIRIRD--  2106
              FT      +   +   ++ + ++  QE +P TA  + +++  Y G+    R IR++   
Sbjct  632   SFTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP---RAIRMKADM  687

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS-EPILHFNR  2283
             + K++  K  E + + FKD S FT + VGNI P    PLI  YLG +P  + +     N 
Sbjct  688   VDKIDYAKIMEMYKDRFKDASDFTFIFVGNIKPEEVEPLIATYLGALPSVNRKETFRDNH  747

Query  2284  DDLKGLPFKFPSSIIREVVHSP------MVEAQCSVQLCFPVELKSEDMMEDVHFVGFLS  2445
              +++   +K   +I  + + +P      +   QC+        L+++ MM        LS
Sbjct  748   IEMRQGDYK---NIFNKKLETPKATVLVINNGQCAYT------LRNQIMM------SMLS  792

Query  2446  KLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLA  2625
             ++L     + +R K G  Y  GVS F    K  +    +  + I F  DP   + + D+ 
Sbjct  793   QILNIMYTESVREKEGGTY--GVSAFGSLTKYPKE---KAVLQIYFDTDPAKRAKMTDII  847

Query  2626  LDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             L+E+ +   +GPS E+++ V E   + ++   +EN YW++ +
Sbjct  848   LNELNQFANEGPSAENLNKVKEFMLKKYKENAKENSYWVNML  889



>gb|EIY34189.1| hypothetical protein HMPREF1065_03594 [Bacteroides dorei CL03T12C01]
Length=932

 Score =   381 bits (979),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 268/894 (30%), Positives = 457/894 (51%), Gaps = 49/894 (5%)
 Frame = +1

Query  136   ALSQTPY-----GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHI  300
             A  QTP       V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH 
Sbjct  16    AQQQTPPIPTDPNVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHF  75

Query  301   VEHLAFSATEKYTNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAI  477
             +EH+ F+ T+ + +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   +
Sbjct  76    LEHMCFNGTKNFPDKTLIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCL  135

Query  478   SILAEFSSEVRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGL  657
              IL +++ ++     +++ ERG + EE+R S NA  RM +     +  GSKYA RLPIG+
Sbjct  136   LILHDWADDLTLDPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPGSKYAYRLPIGI  195

Query  658   EKVIRTVSPQIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppip  837
              +V+     Q ++ +Y+KWY      ++ VGD  D   +   IK  F     P  P    
Sbjct  196   MEVVDNFPYQALRDYYEKWYRPDQQGIVVVGDI-DVDKIEAKIKKIFSPIKMPETPAERE  254

Query  838   YYLVPSHEEPRFSCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQ  1008
             Y+ VP ++E   +   + E A     +  K     +E K   DY  +   +SM  + LN 
Sbjct  255   YFQVPDNKETIVAIETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNA  314

Query  1009  RFFKISRKKDPPY-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLH  1182
             R  ++++  +PP+ ++  +  + L+   K A+    + KE G   A+ +++ E+ R    
Sbjct  315   RLNELTQTANPPFIFAQVSDQEFLISKTKDAFTGIVASKEDGIDSAITAIVREIERAHKF  374

Query  1183  GFSEREISVVRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTL  1362
             GF+  E +  +A  +  +ESAY ER+++++ +  DEY++HF+ NEP+ GIE E  +   +
Sbjct  375   GFTASEYARAKADYLRMLESAYNERNKVKNGAYVDEYVRHFIDNEPIPGIENEYAIMNQI  434

Query  1363  LPHISASEVSKYSERFGTSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDE  1539
             +P++S   V+       T S+ V+    P +    V   + V+  IN   + +++  +++
Sbjct  435   VPNLSVEMVNSLIPALVTDSNLVVNVFFPEKEGLKVPSKKEVLAAINKV-KAETLTAYED  493

Query  1540  ENIPEEIVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGG  1719
             +   E ++  KP  G I +Q E    G+    LSNG+RV  K T+F  D++    FS GG
Sbjct  494   KVSDEPLIPEKPQGGKITKQ-ENGPFGSTILTLSNGVRVILKQTDFKADEIRMRAFSPGG  552

Query  1720  LSELPESEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSP  1899
              S  P  E  + ++ + +A   G+  +    L  +LAGK+A V   +G      SG CSP
Sbjct  553   SSLFPNDEIININVMNDVASIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLSGSCSP  612

Query  1900  SDLETALQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNS  2076
              D ET +QLVY  FT      +   +   ++ + ++  QE +P TA  + +++  Y G+ 
Sbjct  613   KDFETLMQLVYLSFTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP  671

Query  2077  YFFRPIRIRD--LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP  2250
                R IR++   + K++  +  E + + FKD S FT + VGNI P    PLI  YLG +P
Sbjct  672   ---RTIRMKADMVDKIDYARIMEMYKDRFKDASDFTFIFVGNIKPEETEPLIATYLGALP  728

Query  2251  RPS-EPILHFNRDDLKGLPFKFPSSIIREVVHSP------MVEAQCSVQLCFPVELKSED  2409
               + +     N  D++   +K   +I  + + +P      +   QC+        LK++ 
Sbjct  729   SVNRKETFRDNHIDMRQGDYK---NIFNKKLETPKATVLVINNGQCAYT------LKNQI  779

Query  2410  MMEDVHFVGFLSKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSC  2589
             MM        LS++L     + +R K G  Y  GVS F    K  +   +   + I F  
Sbjct  780   MM------SMLSQILNIMYTESVREKEGGTY--GVSAFGSLTKYPKEKAV---LQIYFDT  828

Query  2590  DPDISSTLVDLALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             DP   + + D+ L+E+ +   +GPS E+++ V E   + ++   +EN YW++ +
Sbjct  829   DPAKRAKMTDIILNELNQFANEGPSTENLNKVKEFMLKKYKENAKENSYWVNML  882



>ref|WP_018631205.1| peptidase M16 [Niabella aurantiaca]
Length=940

 Score =   381 bits (979),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 268/927 (29%), Positives = 456/927 (49%), Gaps = 59/927 (6%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NG TYY+R N KP  +  L L V AGS+LE+++++G+AH+ EH+AF+ T  + 
Sbjct  39    VTIGTLPNGFTYYIRQNRKPGNKVELRLVVNAGSILEDDDQQGLAHMAEHMAFNGTRNFK  98

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +DIV FL+SIG  FG   NA TS DETVY L +P DKP  L +   IL +++ +V  + 
Sbjct  99    KNDIVSFLQSIGVGFGNDLNAYTSFDETVYMLPIPTDKPGNLEKGFQILEDWAHQVTYNT  158

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+  ER  ++EE R  + A+ RM    +  +  GS+YA RLPIG++ +IR   P ++++
Sbjct  159   DDINGERNVILEESRLGKGADDRMFRQIYPKLFAGSRYANRLPIGVDSIIRAYDPGLIRK  218

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MA + VGD  +  +   LIK HF    +P DP    Y  V  +       
Sbjct  219   FYKDWYRPNLMAAVVVGDV-EPATAEALIKKHFSGMANPADPRARDYSDVKPYSSNDGMV  277

Query  880   FVESEAAGSAVMIS-CKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY---  1047
               + EA   +V I+    P  E +TV +Y   L +++F   LNQR   ++++ +PP+   
Sbjct  278   VTDKEATNYSVGIAYSAFPSKEAQTVGEYEQDLIKNIFSSILNQRLRDLTQQPNPPFLYG  337

Query  1048  --YSCSAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRAL  1221
               Y  S A +       A + T++  +KG    LE+++ E+ + +  GF++ E+  V+  
Sbjct  338   YTYFGSYARNYDQFNAGAGVATAADAKKG----LETLVEEIEKAKRFGFTQAELDRVKKT  393

Query  1222  LMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYS  1401
             + + ++ AY ER++ +S +  +EY+++FL  EP+ GI  E +  K LLP ++  E++ ++
Sbjct  394   MEAGMDKAYNEREKTESANYVNEYVRNFLTGEPIPGIAKEREYVKELLPQVALPEINAFA  453

Query  1402  ERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSP  1581
                   S+  +    P A A +   + +V        +  I   +E+ I  +++S KP P
Sbjct  454   RSLQKQSNYFVTLTGPVA-AKLPAAQDLVNAAGAVMARTDIRANEEKIIATDLLSTKPKP  512

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I+++     +G   ++LSNG  V +K T+F DD++      YGG +    ++ ++   
Sbjct  513   GKILKETIDSKLGTKTWELSNGTFVTFKKTDFKDDEIRMGARRYGGTNGYGVADKYNAQY  572

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVY---  1932
               ++AG +G   + P+ L   LAGK A  G  L      FSG  S  DLET LQL+Y   
Sbjct  573   ALSVAGAMGYGAFSPTDLQKALAGKTASAGVSLTGTTDGFSGSSSVKDLETMLQLLYLKA  632

Query  1933  -------QLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRP  2091
                     LF + V+  +  V  ++            +P T F + + +  Y N+    P
Sbjct  633   TAPRVDTALFHSFVQKNKASVAYILS-----------NPETVFIDTLLKTVYRNNP-LAP  680

Query  2092  I---RIRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSE  2262
             +   R     +++  +A + +   F D S      VG+ID A   PL+  Y+GG+P  ++
Sbjct  681   VAVPRPEYFDQIDMRRAVQIYKEHFGDASGMQFGFVGSIDEAVLKPLVETYIGGLP-ATK  739

Query  2263  PILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFL  2442
                 F  + ++ +  K   ++ +      ++ +  + +L +     S D++ ++  V   
Sbjct  740   KKFAFKDNGVRPVKGKVDLTVYKGEAEKSLILSLVTGELAY-----SPDLVLNMRAV---  791

Query  2443  SKLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDL  2622
             S++L  ++++ LR K   IY  G SV +      R               P    TL+  
Sbjct  792   SEVLNIRVIEELREKIQGIYGGGTSVSI-----DRFPYAHYSFFTQLPTGPAKVDTLLKA  846

Query  2623  ALDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSF  2802
                EI  ++  GPS E++  V +     ++  +++N  WL+ IL    +R+   D  D F
Sbjct  847   MSAEIRNIETRGPSKENLDKVKQQWLERNKVAIEQNGTWLEYIL---SARLEKKDP-DRF  902

Query  2803  KVQDEARSKVRKLLTPLTAQMALQRIL  2883
                +    K    LTP + + A Q+I 
Sbjct  903   LNSE----KYINALTPESVKAAAQKIF  925



>ref|WP_010399558.1| peptidase M16 domain-containing protein [Janthinobacterium lividum]
Length=947

 Score =   381 bits (979),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 270/939 (29%), Positives = 453/939 (48%), Gaps = 50/939 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NGLTYY++ N++P  +  L L V+AGS+LE+++++G+AH  EH+AF+ +  + 
Sbjct  37    VTVGKLPNGLTYYIKKNARPAQKVELRLVVKAGSILEDDDQQGLAHFTEHMAFNGSTHFK  96

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              + ++ +L+SIG +FGA  NA TS DETVY L +P  K   L +   +L +++  +  + 
Sbjct  97    RNQLISYLQSIGVKFGADLNAYTSFDETVYILPIPTTKKGNLEKGFLVLEDWAHGLNLNP  156

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              D+  ERG V+EE R  + A+ RM    +  ++ GS+YA+R+PIG E V++T  P+ +K+
Sbjct  157   ADINSERGIVLEEARLGKGASDRMNKVLYPKLLNGSRYAQRIPIGKESVLKTFKPEAIKR  216

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY    MAV+ VGD    Q+  +LIK HFG   +P  P P  Y  VP   +     
Sbjct  217   FYKDWYRPDLMAVMVVGDVEPKQA-EKLIKQHFGKLKNPVHPRPRLYAEVPPRAQTEALV  275

Query  880   FVESEAAGSAVMISCKM-PVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSC  1056
               + EA+   V I  ++ P  EL T+ DYR  + E+++   L+ R  +++++ +PP+   
Sbjct  276   ITDKEASVDTVFIRYQIRPAQELVTIADYRRQMIENLYGQMLSARMQELTQQANPPFIDG  335

Query  1057  SAAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEI  1236
              ++   LVR  +++   +   + G   A+E+++ E  R R  GFS+ E+   R   +   
Sbjct  336   GSSMGKLVRGYESFSAYALLGKGGVQPAIEALVQEDERARRFGFSQDELDRARKNSLRNY  395

Query  1237  ESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF--  1410
             E AY ERD+  S     EY  +FL  E + GI  E    + L+P +S  E++  + R   
Sbjct  396   ERAYSERDKSDSAGFVAEYALNFLEQEAIPGIANEFLYAQELMPQLSLEEINAAAARGIP  455

Query  1411  -GTSSSCVIKTIEPRA--TATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSP  1581
                    V    EP+A  TA+    +  +L      ++Q + P  E+    +++   P+ 
Sbjct  456   DQQKKLVVFMGAEPKAGDTASTVPTQQQLLDAVARAEQQKVEPRKEKVFASKLMDGPPAG  515

Query  1582  GWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSM  1761
             G I+ +      G  +  L NG+RV  K T+F +DQVL     +GG S   +++ ++   
Sbjct  516   GSIVAEKLNSATGVTQLTLGNGVRVLLKPTDFQNDQVLMGSTRFGGQSLFGDADIYNARY  575

Query  1762  GSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLF  1941
              S + G +G+    P  L  +LAGK   VG  LG     F G  S +D+E  LQLV   F
Sbjct  576   ASAVVGSMGLKDLAPLDLQKVLAGKTVNVGASLGELSEGFGGSSSSADVEAMLQLVTLYF  635

Query  1942  TTNVEPGEEDVNIVMQMAEEAIHAQE-------RDPYTAFANRVRELNYGNSYFFRPI-R  2097
                      DV     + +  I  Q+         P   F + ++   +G++     + R
Sbjct  636   --------HDVRQDAGLYQSFIGKQQDFAKNSMAQPEAVFYDAIQHAMFGDNPRVDGVPR  687

Query  2098  IRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHF  2277
             + D  KV+  ++ E F   F      T +  G+ +     PLI  YLG +P    P  H 
Sbjct  688   VADFDKVSLERSLEIFRQRFSSARDMTFIFAGSFELDKIKPLIASYLGTLPVAELP--HA  745

Query  2278  NRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLE  2457
              RD    +  +  + I+++ ++    E + ++ + F   +   D  E    +  L ++L 
Sbjct  746   YRD----VGMRPVAGIVKKDIYMGS-EPKSTISITFNGAVAYSD--EQKLTLQALGEVLN  798

Query  2458  TKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEI  2637
              K+++VLR K   IY  G   F+G +           + +N    P+    ++  A  EI
Sbjct  799   LKVIEVLREKMSMIYGGGFETFMGQHPYGHY-----SVALNLPTGPENVDKVIAAAFAEI  853

Query  2638  LRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDE  2817
              +++ +GPS  D+  V        +  L+EN YW+ +++         G V     ++  
Sbjct  854   NKMKAEGPSIADLEKVKLNWITRQQKSLRENGYWMKQLM---------GSVTQGRDLEHT  904

Query  2818  ARSKVR-KLLTPLTAQMALQRILPFPCKKQYTVVILMPQ  2931
              R   R   +TP   + A QR L       Y  V+L P+
Sbjct  905   LRYAQRVGAITPQAVKQAAQRYLDL---HNYVQVVLYPE  940



>ref|WP_015030544.1| peptidase M16 [Emticicia oligotrophica]
 ref|YP_006874883.1| peptidase M16 domain protein [Emticicia oligotrophica DSM 17448]
 gb|AFK04856.1| peptidase M16 domain protein [Emticicia oligotrophica DSM 17448]
Length=933

 Score =   381 bits (978),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 258/883 (29%), Positives = 433/883 (49%), Gaps = 41/883 (5%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G L NG  YY+  N++PK R  L L V AGS+LE + ++G+AH +EH+ F+ T+++
Sbjct  31    AVKVGTLKNGFKYYILKNAEPKNRMELRLVVNAGSILETDAQQGLAHFMEHMNFNGTKEF  90

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRAS  516
               +D+V FL+  G +FGA  NA TS DET+Y+L VP D  +L  +A  ILA++S+     
Sbjct  91    PKNDLVNFLQKSGMKFGADLNASTSFDETIYQLQVPTDSVKLFERAFQILADWSNYATLD  150

Query  517   EHDLEKERGAVMEEYRG-SRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
               ++ KERG ++EE R   +NA  R+Q     ++   S+YA R+PIG   +I+   P+ +
Sbjct  151   TAEINKERGIILEEERARGKNAQARIQQKVLPILFNNSRYANRIPIGKTDIIQNFKPEEI  210

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
              +FYK WY    MAVIAVGDF D + V  LIK  F     P + P    Y +P+    + 
Sbjct  211   IKFYKDWYRPDLMAVIAVGDF-DAEKVENLIKEKFSAIKMPKNAPKRIQYEIPATTGTQT  269

Query  874   SCFVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYS  1053
             +  ++ E   +   +  ++P ++ KT  DYR  +AE+++   ++ R  ++S+K + P+  
Sbjct  270   AVILDKEIPQNTFQMFTRLPKEKTKTQSDYRTDIAEALYNQLISNRLQELSKKPNAPFVV  329

Query  1054  CSAAADCLVRPVKAYIMTSSCKEKGTVE-ALESMLTEVARVRLHGFSEREISVVRALLMS  1230
                     +  + A+      K    +E A++S++ E  R++  GF++ E+   +    +
Sbjct  330   AIMNYGSFLGGLDAFQTIVLPKNADGLEAAIKSVIDEQNRIKKFGFTKGELERAKKDYFT  389

Query  1231  EIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERF  1410
              +E  + E+D+ +S +     +Q++L+       ++  +  K  L  I+  EV+  S + 
Sbjct  390   GVEKGFKEKDKTKSAAFVGGLVQNYLQGTAYTNADFRYEFTKAQLDGITIDEVNAISNKV  449

Query  1411  GTSSSCVIKTIEPRAT-------ATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSV  1569
                 + V   +            A + +L S V           + P++++     I+  
Sbjct  450   MKEDNRVAMVVGSEKDKDKLPNEAKIKELVSYV--------NPDLKPYEDDIALTPILEK  501

Query  1570  KPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYF  1749
              P    ++ + +   +G  E  L NG++V  K TNF +DQ+LF+  S GG S   +++Y 
Sbjct  502   IPVGTKVISEKQIPEIGVTELVLGNGVKVALKPTNFKNDQILFSATSKGGTSLYSDADYI  561

Query  1750  SCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLV  1929
             S  + ST+  + GV       L   LAGK A+V T +G       G  SP DLETALQL+
Sbjct  562   SAELASTLVSQGGVSKLSDVQLDKALAGKVAQVYTYIGEISEGIGGSTSPKDLETALQLM  621

Query  1930  YQLFTTNVEPGEEDVNIVMQMAEE----AIHAQERDPYTAFANRVRELNYGNSYFFRPIR  2097
             Y   T   +P  +D  I   +  E    A  A+   P   F++ V  + Y N +  +P +
Sbjct  622   YAYVT---QPRRDDEVIKNFLKNEKELLANAAKTLTPEKVFSDTVTTVLYQNHFRRQPTK  678

Query  2098  IRDLQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHF  2277
               D+ K N  +A E F   F D S FT V VG  +     PLI +Y+GG+P         
Sbjct  679   PEDIDKANVDRAFEIFKERFADFSDFTFVFVGTFEIEKIKPLIEKYIGGLPSTKR-----  733

Query  2278  NRDDLKGLPF-KFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLL  2454
              ++  K L   K    I + V      +A+ S+Q         E+++     +  LS++L
Sbjct  734   -QETFKDLGISKVKGKIEKNVYKGLEDKARVSLQFNGDFGYSEEELIN----LDALSEVL  788

Query  2455  ETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDE  2634
             + K+ + LR + G +Y   +          ++     ++ I+F C P     LV + LDE
Sbjct  789   DIKLTEKLREEAGGVYTPSIRASY-----EKLPKSTYNLTISFGCSPANVDKLVKITLDE  843

Query  2635  ILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
             I +++ +GP   DV  V+  E+R  E  ++EN +W   +L  Y
Sbjct  844   IAKIKANGPEKVDVEKVIAEEKREVELQVKENGFWNSYLLDQY  886



>ref|WP_031266645.1| peptidase M16, partial [Cytophagales bacterium B6]
Length=920

 Score =   380 bits (976),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 245/870 (28%), Positives = 432/870 (50%), Gaps = 28/870 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G+L NG TYY+R N +PK R    LA + GSVLE++ +RG+AH +EH++F+ T+ + 
Sbjct  22    VRTGKLPNGFTYYIRHNEEPKKRVTFYLANKVGSVLEDDTQRGLAHFMEHMSFNGTKNFP  81

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+  G  FGA  NA TS DETVY+L +P D P++L   I I+ +++ +     
Sbjct  82    KNELVNYLQKSGVRFGADLNAYTSFDETVYQLPLPSDNPDILKNGIQIMRDWAQDATLDV  141

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++ KERG V+EE R  + A  RMQ  +   ++  S+Y+ RLPIG ++V+    P+ +++
Sbjct  142   TEINKERGVVLEEKRLGKGAQERMQRQYLPTILNHSRYSLRLPIGTDEVLNNFKPETIRK  201

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FY  WY     A+I VGD  D   + + IKA F    +P    P   Y VP   + +F  
Sbjct  202   FYHDWYRPDLQALIVVGDI-DVNQMEKTIKAKFSDLKNPVGEKPRTKYTVPLLGQNQFLA  260

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E   +   +  K P  +L T  DYRD +   +F      R+ +I R+ +PPY    
Sbjct  261   VTDKEMTVTVAQVMMKQPAAKLHTAADYRDNIVRGLFNRMTGARYAEIMRQANPPYLQGG  320

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A     +  +  Y + +  K        ++   E  R+R  GF++ E+   +   +S++E
Sbjct  321   AEVSDFLGGLDNYGLYAVAKPGELENGFKAAWRETERIRRFGFTQTELDRAKQAYLSDME  380

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
             ++  E+++  S S  +EYLQ+FL+     GI YE +L K  LP ++ +EV+  S+    +
Sbjct  381   ASLKEKNKTNSDSYVNEYLQYFLKGTAAPGISYEYELVKNDLPGVTLAEVNAVSKSSIKN  440

Query  1420  SSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
             ++  +  + P +  AT+    +V   I   E  + + P+++E   + +++  P  G I  
Sbjct  441   TNRDVLLLAPEKDKATLPSEATVNGWIKAVES-EDLKPYNDEVSKQPLLANAPVAGKITA  499

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             + +   +G     LSNG++V  K T+F D+++LF+  + GG S   +++Y S +  S + 
Sbjct  500   ETKDAALGTTTLTLSNGVKVVLKPTDFKDNEILFSASAPGGTSLYSDADYQSAANASGMI  559

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                GV  Y P+ L   L+GK+  V   +    +   G+ +P DLETA +L+Y   T   E
Sbjct  560   ESFGVGNYNPTQLEKYLSGKQLSVSPFISERTQGVGGNSTPKDLETAFELIYGYLT---E  616

Query  1957  PGEEDVNI---VMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNPY  2127
             P  +D ++   ++  ++ ++  +  DP   F + +  +   ++       I  ++++N  
Sbjct  617   P-RKDADLFQGIITRSKASLANRGNDPNAVFQDTLSAVLGDHNIRRTGPSIAKIEQINLE  675

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLPF  2307
             +    +   F D S  T   VGNID     PLI +Y+  +P  +        +  K L  
Sbjct  676   REYAIYKERFADASGMTFTFVGNIDIEKVKPLIEKYIASLPSKNL------GEQAKDLGI  729

Query  2308  KFPSSIIREVVHSPMVEAQCSVQLCF--PVELKSEDMMEDVHFVGFLSKLLETKIVQVLR  2481
               P   I + V+    E + +V + +  P E  + + ++    +  L + LE ++++ LR
Sbjct  730   HIPEGQITKNVYKGS-EPKATVDMIWSGPFEYSAAEKIQ----LDALKECLEIRLIERLR  784

Query  2482  FKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGP  2661
                  +Y+ G          S+    R  + + F CDP  +  LV   LDEI +L+ +GP
Sbjct  785   EDESGVYSPGAFA-----NSSKFPTSRYSMFVYFGCDPKNADKLVASTLDEINKLKTNGP  839

Query  2662  SDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             +  ++        R  E  ++ N +WL  I
Sbjct  840   TQVNIDKWRAESIRTRETSVRTNGFWLGYI  869



>ref|WP_036984999.1| peptidase M16 [Prolixibacter bellariivorans]
Length=908

 Score =   380 bits (975),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 247/867 (28%), Positives = 431/867 (50%), Gaps = 25/867 (3%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYT  339
             V  G L NG TYY+R N++PK R  + L  + GS+LE+E +RG+AH +EH++F+ T  + 
Sbjct  7     VKIGHLPNGFTYYIRRNTEPKDRVTMYLVNKVGSILEDEGQRGLAHFMEHMSFNGTTHFP  66

Query  340   NHDIVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASE  519
              +++V +L+  G  FG   NA T+ DETVYEL +P D P LL     I+ +++ +   S 
Sbjct  67    KNELVDYLQKAGVRFGGDLNAYTNFDETVYELPIPADDPTLLHNGFQIMRDWAQDATLSP  126

Query  520   HDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQ  699
              ++EKERG ++EE R       R++D ++ +++ GSKYA R+PIGLE +I+    + +++
Sbjct  127   VEIEKERGVILEEKRLRDGVQQRLRDRYFPIVLNGSKYAYRVPIGLESIIKDFKYETLRR  186

Query  700   FYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSC  879
             FYK WY     A+I VGD  D Q   ++I   F     P  P     Y +P   + +F  
Sbjct  187   FYKDWYRPDLQALIVVGDI-DVQETEKMIVDMFSDLKMPAKPRERKIYTIPLLNKNQFFS  245

Query  880   FVESEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCS  1059
               + E     + +  K P + +K+  D+R  L  S+    L  R++++S++ +PP+    
Sbjct  246   ATDKELQTETIEVLVKHPEEIIKSDDDFRKALILSLLNRMLGSRYYELSQQANPPFIQAG  305

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
             A     +  ++      S K     +  +++ TE+ R+R  GF++ E+   ++ L+   E
Sbjct  306   ADITSFIANLEVADAQVSVKPGEEEKGFKALWTEIERIRKFGFTKTELERAKSDLLMAYE  365

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSER-FGT  1416
             S+Y E+D+  S +   EY+ +FL+   + GI++E Q  K  LPH +  +V++  +  F T
Sbjct  366   SSYKEKDKTPSDTYVKEYMDNFLKGNAIPGIDFEYQFVKKALPHFTVDDVNRIMKTYFNT  425

Query  1417  SSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
              ++  I  + P  +      ++ V +        ++ P+ +    + ++  K + G I+ 
Sbjct  426   VTNRDILVMAPETSKGKLPSQTDVEQWMKEVADSALTPYKDSVSGQTLLPKKITGGKIVS  485

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             + E + +G  E  LSNG++V  K T+F DD++ F  +S GG S   + ++ S    + + 
Sbjct  486   ERELKELGITELKLSNGLKVLLKPTDFKDDEISFFAYSPGGTSLSGDKDFESADAAARLV  545

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                G+  +    L   L GKR  V   +        G  SP D++TA Q++Y  F    E
Sbjct  546   NNSGLGNFNAIELSKFLNGKRVNVSPFMSERFEGLQGQMSPKDMKTAFQMMYGYFE---E  602

Query  1957  PGEEDVNIVMQMAEEAIHAQER--DPYTAFANRVRELNYGNSYFFRP-IRIRDLQKVNPY  2127
             P  + V     +++E    + R  +P   F + V  +  GN    R    ++ L ++N  
Sbjct  603   PRADSVVFTGLLSKEKAILENRSNNPTLVFRDSVSAI-LGNYNIRRTGPSVKKLDEINIS  661

Query  2128  KACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLK-GLP  2304
             KA   +   F D S FT V VG+    +  P + +YLG +P         NR +    L 
Sbjct  662   KAFSIYKERFADASDFTFVFVGSFKVDSIKPFVAKYLGALP-------QLNRKEQACNLN  714

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKIVQVLRF  2484
               FPS  I++ + S  ++ + +V+L F  +  +   +E+   +  LS++L  ++ + LR 
Sbjct  715   IHFPSGRIKKEIFSG-IDNRSTVELVFSGKY-NYTTLENTR-MNALSRILTIRLTEDLRE  771

Query  2485  KYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQEDGPS  2664
             K   +Y  G          S+    R  + I+FSC P     L+D  L ++  L+++GPS
Sbjct  772   KESGVYGVGAYAHY-----SKYPENRYSLFISFSCKPGNVQKLIDETLKQVKELEKEGPS  826

Query  2665  DEDVSTVLEIEQRAHENGLQENCYWLD  2745
               DV+       R  E  L+ N +WL+
Sbjct  827   LVDVNKFKAERTRQLEVSLKSNDFWLN  853



>gb|EFG19351.1| peptidase M16 inactive domain protein [Bacteroides vulgatus PC510]
Length=932

 Score =   380 bits (976),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 265/880 (30%), Positives = 452/880 (51%), Gaps = 33/880 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH +EH+ F+ T+ +
Sbjct  28    NVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHFLEHMCFNGTKNF  87

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRA  513
              +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   + IL +++ ++  
Sbjct  88    PDKTLIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCLLILHDWADDLTL  147

Query  514   SEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
                +++ ERG + EE+R S NA  RM +     +   SKYA RLPIG+ +V+     Q +
Sbjct  148   DPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPESKYAYRLPIGIMEVVDNFPYQAL  207

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             + +Y+KWY      ++ VGD  D   +   IK  F     P +P    Y+ VP ++E   
Sbjct  208   RDYYEKWYRPDQQGIVVVGDI-DVDKIEAKIKKIFSPIKMPDNPAEREYFQVPDNKETIV  266

Query  874   SCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQRFFKISRKKDPP  1044
             +   + E A     +  K     +E K   DY  +   +SM  + LN R  ++++  +PP
Sbjct  267   AIETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNARLNELTQTANPP  326

Query  1045  Y-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRA  1218
             + ++  +  + L+   K A+    + KE G   A+ +++ E+ RV   GF+  E +  +A
Sbjct  327   FIFAQVSDQEFLISKTKDAFTGIVASKEDGIDSAITAIVREIERVHKFGFTASEYARAKA  386

Query  1219  LLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKY  1398
               +  +ESAY ER+++++ +  DEY++HF+ NEP+ GIE E  +   ++P++S   V+  
Sbjct  387   DYLRMLESAYNERNKVKNGAYVDEYVRHFIDNEPIPGIENEYAIMNQIVPNLSVEMVNSL  446

Query  1399  SERFGTSSSCVIKTIEP-RATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKP  1575
                  T S+ V+    P +    V     ++  +N   + +++  ++++   E ++S KP
Sbjct  447   IPALVTDSNLVVNVFFPEKEGLKVPSKEEILAAVNKV-KAETLTAYEDKVSDEPLISEKP  505

Query  1576  SPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSC  1755
               G I +Q E    G+    LSNG+RV  K T+F  D++    FS GG S  P  E  + 
Sbjct  506   QGGKITKQ-ENGPFGSTILTLSNGVRVILKSTDFKADEIRMRAFSPGGSSLFPNDEIINI  564

Query  1756  SMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQ  1935
             ++ + +A   G+  +    L  +LAGK+A V   +G      SG CSP D ET +QLVY 
Sbjct  565   NVMNDVASIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLSGSCSPKDFETLMQLVYL  624

Query  1936  LFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYFFRPIRIRD--  2106
              FT      +   +   ++ + ++  QE +P TA  + +++  Y G+    R IR++   
Sbjct  625   SFTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP---RTIRMKADM  680

Query  2107  LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS-EPILHFNR  2283
             + K++  K  E + + FKD S FT + VGNI P    PLI  YLG +P  + +     N 
Sbjct  681   VDKIDYTKVMEMYKDRFKDASDFTFIFVGNIKPEEVEPLIATYLGALPSVNRKETFRDNH  740

Query  2284  DDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETK  2463
              D++   +K   +I  + + +P               LK++ MM        LS++L   
Sbjct  741   IDMRQGDYK---NIFSKKLETPKASVLVINNGKCAYTLKNQIMM------SMLSQILNIM  791

Query  2464  IVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILR  2643
               + +R K G  Y  GVS F    K  +    +  + I F  DP   + + D+ L+E+ +
Sbjct  792   YTESVREKEGGTY--GVSAFGSLTKYPKE---KAVLQIYFDTDPAKRAKMTDIILNELNQ  846

Query  2644  LQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
               + GPS E+++ V E   + ++   +EN YW++ IL  Y
Sbjct  847   FVDQGPSAENLNKVKEFMLKKYKENAKENSYWVN-ILGEY  885



>gb|EOS04640.1| zinc protease [Bacteroides vulgatus dnLKV7]
Length=932

 Score =   380 bits (976),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 264/879 (30%), Positives = 449/879 (51%), Gaps = 31/879 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH +EH+ F+ T+ +
Sbjct  28    NVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHFLEHMCFNGTKNF  87

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRA  513
              +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   + IL +++ ++  
Sbjct  88    PDKTLIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCLLILHDWADDLTL  147

Query  514   SEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
                +++ ERG + EE+R S NA  RM +     +   SKYA RLPIG+ +V+     Q +
Sbjct  148   DPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPESKYAYRLPIGIMEVVDNFPYQAL  207

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             + +Y+KWY      ++ VGD  D   +   IK  F     P +P    Y+ VP ++E   
Sbjct  208   RDYYEKWYRPDQQGIVVVGDI-DVDKIEAKIKKIFSPIKMPDNPAEREYFQVPDNKETIV  266

Query  874   SCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQRFFKISRKKDPP  1044
             +   + E A     +  K     +E K   DY  +   +SM  + LN R  ++++  +PP
Sbjct  267   AIETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNARLNELTQTANPP  326

Query  1045  Y-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRA  1218
             + ++  +  + L+   K A+    + KE G   A+ +++ E+ RV   GF+  E +  +A
Sbjct  327   FIFAQVSDQEFLISKTKDAFTGIVASKEDGIDSAITAIVREIERVHKFGFTASEYARAKA  386

Query  1219  LLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKY  1398
               +  +ESAY ER+++++ +  DEY++HF+ NEP+ GIE E  +   ++P++S   V+  
Sbjct  387   DYLRMLESAYNERNKVKNGAYVDEYVRHFIDNEPIPGIENEYAIMNQIVPNLSVEMVNSL  446

Query  1399  SERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                  T S+ V+    P         +  +L      + +++  ++++   E ++S KP 
Sbjct  447   IPALVTDSNLVVNVFFPEKEGLKVPSKEEILAAVNKVKAETLTAYEDKVSDEPLISEKPQ  506

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G I +Q E    G+    LSNG+RV  K T+F  D++    FS GG S  P  E  + +
Sbjct  507   GGKITKQ-ENGPFGSTILTLSNGVRVILKSTDFKADEIRMRAFSPGGSSLFPNDEIININ  565

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             + + +A   G+  +    L  +LAGK+A V   +G      SG CSP D ET +QLVY  
Sbjct  566   VMNDVASIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLSGSCSPKDFETLMQLVYLS  625

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYFFRPIRIRD--L  2109
             FT      +   +   ++ + ++  QE +P TA  + +++  Y G+    R IR++   +
Sbjct  626   FTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP---RTIRMKADMV  681

Query  2110  QKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS-EPILHFNRD  2286
              K++  K  E + + FKD S FT + VGNI P    PLI  YLG +P  + +     N  
Sbjct  682   DKIDYTKVMEMYKDRFKDASDFTFIFVGNIKPEEVEPLIATYLGALPSVNRKETFRDNHI  741

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
             D++   +K   +I  + + +P               LK++ MM        LS++L    
Sbjct  742   DMRQGDYK---NIFSKKLETPKASVLVINNGKCAYTLKNQIMM------SMLSQILNIMY  792

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRL  2646
              + +R K G  Y  GVS F    K  +    +  + I F  DP   + + D+ L+E+ + 
Sbjct  793   TESVREKEGGTY--GVSAFGSLTKYPKE---KAVLQIYFDTDPAKRAKMTDIILNELNQF  847

Query  2647  QEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
              + GPS E+++ V E   + ++   +EN YW++ IL  Y
Sbjct  848   VDQGPSAENLNKVKEFMLKKYKENAKENSYWVN-ILGEY  885



>ref|WP_002995276.1| peptidase M16 [Sphingobacterium spiritivorum]
 gb|EFK56588.1| peptidase M16 inactive domain protein [Sphingobacterium spiritivorum 
ATCC 33861]
Length=956

 Score =   381 bits (978),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 251/879 (29%), Positives = 437/879 (50%), Gaps = 38/879 (4%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G+L NG  Y++R N++P+ R  + LA + GSVLE EE+ G+AH +EH+ F+  + +  + 
Sbjct  58    GKLKNGFQYFIRKNTEPEKRVVMYLANKVGSVLESEEQLGLAHFLEHMNFNGLKHFPKNA  117

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             +V +L+  G  FG+  NA TS DET+Y+L +P D PELL   + ++ +++ +   +  ++
Sbjct  118   LVDYLQKAGVRFGSDLNAYTSFDETIYQLPIPSDDPELLKNGLQVMRDWAQDALLTTEEI  177

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
             +KERG V+EE RG + A  RM+D +  L++  S YA RLPIG EK I T  P++++QF+K
Sbjct  178   DKERGIVLEEMRGGKGAQQRMRDQYLPLLLNNSHYANRLPIGTEKSISTFKPEVLRQFHK  237

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
              WY     ++I VGD    Q   E+I+     K      P + Y +  +++  +F    +
Sbjct  238   DWYRPDLQSIIIVGDIDVKQMEAEVIRLFSDLKAPAKPRPHVKYKVDLANKN-QFMAVTD  296

Query  889   SEAAGSAVMISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPYYSCSAAA  1068
              E + +   I  K P ++ +TV DYR  L +S++   +N R  +I ++ +PP+       
Sbjct  297   PEMSYTVGQIIIKHPEEKTETVGDYRRALLKSVYNGMINARMSEILQQSNPPFIQAGGGV  356

Query  1069  DCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIESAY  1248
             +  +  +    +    K        ++++ E+ R++  GF++ E   V + +    E+AY
Sbjct  357   EEFLGGLDNLGLYFVAKPGEFENGFKTLVREMDRIQKFGFTQTEFDRVISSIRKNNETAY  416

Query  1249  LERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTSSSC  1428
              ERD+ +S S    Y+ +FL  +P +  EY  QL   LLP ++  EV +  +++   ++ 
Sbjct  417   TERDKKKSESYVQGYMNYFLEKDPALSNEYRYQLTNQLLPSLTLKEVEQIGQKYYVDNNR  476

Query  1429  VIKTIEP-RATATVDDLRSVVLKINTF---EQKQSIPPWDEENIPEEIVSVKPSPGWIMQ  1596
              +  + P    A + D      KINT+     K+ I  ++++     +++ +P  G I++
Sbjct  477   DVLILAPENQKANLPD----EAKINTWFAEVDKEEITAYEDKVSKLPLLAKQPVKGSIVK  532

Query  1597  QFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTIA  1776
             +     +G  E  LSNG++V  K T F +D++L + FS GG S   +++Y S S  + + 
Sbjct  533   EGAANTIGVKELVLSNGVKVLLKPTTFKNDEILISAFSPGGTSLYADADYNSASNAAGLV  592

Query  1777  GEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTTNVE  1956
                GV       L   L GKR  +   +      FSG      L+T  +L+Y  FT   E
Sbjct  593   DASGVGQLNNVELQKYLTGKRVGITPYISERSEGFSGQSDKEGLKTMFELLYGYFT---E  649

Query  1957  PGEED----VNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRIRDLQKVNP  2124
             P  +D     NI   ++  +I   E DP   F   V    YGN+   +P     +Q++N 
Sbjct  650   PRLDDDVFQSNITKSLS--SIANMENDPNFVFRKSVFSTLYGNNIRRQPASKESIQQINK  707

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              +A E + + F D S FT  IVG+       PL+ +Y+  +P  +       ++  K L 
Sbjct  708   DRALEIYKDRFADASDFTFTIVGSFTEEEIKPLLEEYIASLPSKNR------QEKAKDLG  761

Query  2305  FKFPSSIIREVVHSPMVEAQCSVQLCFPVEL---KSEDMMEDVHFVGFLSKLLETKIVQV  2475
              + P+  +  VV+    E + +VQL +  +    + E+M  D      L  +L   +++ 
Sbjct  762   IQEPAKGVETVVNKGK-EQKATVQLAYYGDYAYSEEENMNLDA-----LESILNITLIER  815

Query  2476  LRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRLQED  2655
             LR     +Y  G      G    +    R    I F    D +  L+   LDEI +++++
Sbjct  816   LREDESGVYGVG-----AGANYRKFPKPRYSFSIGFGSAVDKAQPLIASTLDEINKIKKN  870

Query  2656  GPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSR  2772
             GP+  D+   +  ++R  E  L+EN +WL  I+ S Q++
Sbjct  871   GPTKVDLEKFVIEQKRQLEVQLRENGFWLGHIVNSAQNQ  909



>dbj|GAE15600.1| probable zinc protease pqqL [Bacteroides pyogenes JCM 6292]
Length=917

 Score =   380 bits (975),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 268/882 (30%), Positives = 451/882 (51%), Gaps = 41/882 (5%)
 Frame = +1

Query  160   VDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY-  336
             V  G+LDNGLTYY+R N+ P+ R    +A + GS+LEE E+RG+AH +EH+AF+ T+ + 
Sbjct  5     VRIGKLDNGLTYYIRHNALPEKRVEFYIAQKVGSILEEPEQRGLAHFLEHMAFNGTKNFP  64

Query  337   ---TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSE  504
                T   IV + E+ G +FG   NA TS D+TVY +  VP D   ++   + IL ++SS 
Sbjct  65    GDETGLGIVPWCETKGIKFGVNLNAYTSVDQTVYNISNVPTDNMNVVDSCLLILHDWSSA  124

Query  505   VRASEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSP  684
             ++ SE +++KERG + EE+R   +   R+      +M   SKYA+ +PIG   VI     
Sbjct  125   IKLSEKEIDKERGVIREEWRSRNSGIMRIYTNAQPVMYPDSKYADCMPIGSIDVINNFPY  184

Query  685   QIVKQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEE  864
             Q ++ +Y KWY      ++ VGD  +   +   +K  F    +P +P    YY V  +E+
Sbjct  185   QAIRDYYAKWYRPDQQGIVIVGDI-NVDEIEAKLKHIFADVKAPVNPAERIYYPVADNEK  243

Query  865   PRFSCFVESEAAGSAVMISCKMPV--DELKT-VKDYRDLLAESMFFHALNQRFFKISRKK  1035
             P      + E    ++    K     D LK  +  Y      +M    LN RF ++ ++ 
Sbjct  244   PLIYIGTDKEVTTPSINFFFKHDATPDSLKNNIGYYATQYMLNMATGMLNSRFSELLQQA  303

Query  1036  DPPYYSCSAAADC--LVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISV  1209
             +PP+   SA      L +   A+ +++S K  G   A++++L E  R R  GF+E E   
Sbjct  304   NPPFTGASAGFGNYFLAKTKDAFSLSASSKADGIETAMKTILEEAERARRFGFTETEYER  363

Query  1210  VRALLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEV  1389
              RA  +  +ESAY ER++M+S S   EY+ HFL NEP+ GIEY+  +   + P+I    +
Sbjct  364   ARANYLQGLESAYNEREKMKSGSYVGEYINHFLDNEPIPGIEYDYAIMNQMAPNIPVQAI  423

Query  1390  SKYSERFGTSSSCVIKTIEPRATA----TVDDLRSVVLKINTFEQKQSIPPWDEENIPEE  1557
             ++  ++  T ++ V     P        T +++ +++ ++ +F+ K    P +++   E 
Sbjct  424   NQVMQQLLTDNNQVALIAGPEKEGIKYPTKEEIEALLKQLKSFDLK----PHEDKVSNEP  479

Query  1558  IVSVKPSPGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPE  1737
             ++S +P  G I+ +      G  +  LSNG++V  K T+F  DQ+L  G S GG S   +
Sbjct  480   LISKEPEGGKIVSEKAEDIYGTTKLVLSNGVKVYVKVTDFKADQILMKGTSLGGSSLFAD  539

Query  1738  SEYFSCSMGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETA  1917
             +E  + S  +++AG  GV  +    L   LAGKRA V   +G    + SG+CSP D ET 
Sbjct  540   NEALNISQLNSVAGVGGVGNFSKVDLTKALAGKRASVSASIGGNTENISGNCSPKDFETM  599

Query  1918  LQLVYQLFTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIR  2097
             +QL Y  FT   +  E   +   ++  +  +A + +P  AF + +    Y N    R I 
Sbjct  600   MQLTYLSFTAPRKDNEAFESYKNRLKAQLQNA-DANPMRAFGDTMTYALYNNHP--RAIN  656

Query  2098  IRD--LQKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIP--RPSEP  2265
             +++  ++ ++  +  E + + +KD S FT  +VGN+D     PLI +YLGG+P  +  E 
Sbjct  657   LKEHMVENIDYDRIIEMYKDRYKDASDFTFYLVGNVDLENMKPLIAKYLGGLPAIKRQET  716

Query  2266  ILHFNRDDLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLS  2445
                 + D  KGL +K   +  +E   +PM     ++   F  E K    + +   + FL 
Sbjct  717   FRDTHMDIRKGL-YKNEFTKKQE---TPM----ATILFFFNGECKYN--LRNNLLLSFLD  766

Query  2446  KLLETKIVQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLA  2625
             + L+    + +R K G  Y  GVS   G +K  +    R  + I F  DP   + L ++ 
Sbjct  767   QALDMVYTEEIREKEGGTY--GVSCRGGLSKYPKE---RLTLQIVFQTDPAKRNKLSEIV  821

Query  2626  LDEILRLQEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRI  2751
             L+++ ++ ++GPS E +  + E   + +++  +EN YWL+ +
Sbjct  822   LEQLNKMAQEGPSAEHMQKIKEYMLKKYKDAQKENSYWLNNL  863



>gb|KDS26008.1| peptidase M16 inactive domain protein [Bacteroides vulgatus str. 
3775 SR(B) 19]
Length=932

 Score =   380 bits (976),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 264/879 (30%), Positives = 449/879 (51%), Gaps = 31/879 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH +EH+ F+ T+ +
Sbjct  28    NVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHFLEHMCFNGTKNF  87

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRA  513
              +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   + IL +++ ++  
Sbjct  88    PDKTLIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCLLILHDWADDLTL  147

Query  514   SEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
                +++ ERG + EE+R S NA  RM +     +   SKYA RLPIG+ +V+     Q +
Sbjct  148   DPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPESKYAYRLPIGIMEVVDNFPYQAL  207

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             + +Y+KWY      ++ VGD  D   +   IK  F     P +P    Y+ VP ++E   
Sbjct  208   RDYYEKWYRPDQQGIVVVGDI-DVDKIEAKIKKIFSPIKMPDNPAEREYFQVPDNKETIV  266

Query  874   SCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQRFFKISRKKDPP  1044
             +   + E A     +  K     +E K   DY  +   +SM  + LN R  ++++  +PP
Sbjct  267   AIETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNARLNELTQTANPP  326

Query  1045  Y-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRA  1218
             + ++  +  + L+   K A+    + KE G   A+ +++ E+ RV   GF+  E +  +A
Sbjct  327   FIFAQVSDQEFLISKTKDAFTGIVASKEDGIDSAITAIVREIERVHKFGFTASEYARAKA  386

Query  1219  LLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKY  1398
               +  +ESAY ER+++++ +  DEY++HF+ NEP+ GIE E  +   ++P++S   V+  
Sbjct  387   DYLRMLESAYNERNKVKNGAYVDEYVRHFIDNEPIPGIENEYAIMNQIVPNLSVEMVNSL  446

Query  1399  SERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                  T S+ V+    P         +  +L      + +++  ++++   E ++S KP 
Sbjct  447   IPALVTDSNLVVNVFFPEKEGLKVPSKEEILAAVNKVKAETLTAYEDKVSDEPLISEKPQ  506

Query  1579  PGWIMQQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCS  1758
              G I +Q E    G+    LSNG+RV  K T+F  D++    FS GG S  P  E  + +
Sbjct  507   GGKITKQ-ENGPFGSTILTLSNGVRVILKSTDFKADEIRMRAFSPGGSSLFPNDEIININ  565

Query  1759  MGSTIAGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQL  1938
             + + +A   G+  +    L  +LAGK+A V   +G      SG CSP D ET +QLVY  
Sbjct  566   VMNDVASIGGLGNFSNVDLEKVLAGKKASVSASVGGNTEGLSGSCSPKDFETLMQLVYLS  625

Query  1939  FTTNVEPGEEDVNIVMQMAEEAIHAQERDPYTAFANRVRELNY-GNSYFFRPIRIRD--L  2109
             FT      +   +   ++ + ++  QE +P TA  + +++  Y G+    R IR++   +
Sbjct  626   FTAPRMDNDAFTSFKNRL-QASLANQEANPMTALQDTLQKALYMGHP---RTIRMKADMV  681

Query  2110  QKVNPYKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPS-EPILHFNRD  2286
              K++  K  E + + FKD S FT + VGNI P    PLI  YLG +P  + +     N  
Sbjct  682   DKIDYAKVMEMYKDRFKDASDFTFIFVGNIKPEEVEPLIATYLGALPSVNRKETFRDNHI  741

Query  2287  DLKGLPFKFPSSIIREVVHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
             D++   +K   +I  + + +P               LK++ MM        LS++L    
Sbjct  742   DMRQGDYK---NIFSKKLETPKASVLVINNGKCAYTLKNQIMM------SMLSQILNIMY  792

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRL  2646
              + +R K G  Y  GVS F    K  +    +  + I F  DP   + + D+ L+E+ + 
Sbjct  793   TESVREKEGGTY--GVSAFGSLTKYPKE---KAVLQIYFDTDPAKRAKMTDIILNELNQF  847

Query  2647  QEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSY  2763
              + GPS E+++ V E   + ++   +EN YW++ IL  Y
Sbjct  848   VDQGPSAENLNKVKEFMLKKYKENAKENSYWVN-ILGEY  885



>ref|WP_024566159.1| peptidase M16 [Elizabethkingia anophelis]
 gb|AIL46847.1| putative zinc protease pqqL [Elizabethkingia anophelis NUHP1]
Length=949

 Score =   380 bits (977),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 269/943 (29%), Positives = 463/943 (49%), Gaps = 51/943 (5%)
 Frame = +1

Query  169   GRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKYTNHD  348
             G L NG+ YY++ N+ P+ +    LA+ AGS+LE+E +RG+AH +EH+ F+ T+ + ++ 
Sbjct  32    GTLPNGMKYYIKKNTMPEKKVDFRLAINAGSILEDENQRGLAHFMEHMNFNGTKNFPDNK  91

Query  349   IVKFLESIGAEFGACQNAVTSADETVYELFVPIDKPELLSQAISILAEFSSEVRASEHDL  528
             +V FL+SIG +FG   NA TS DETVY L VP+DKP  L   + ++ +++     S+  +
Sbjct  92    LVDFLQSIGVKFGQHLNAYTSFDETVYMLPVPLDKPGNLDSGLKVMEDWAFNATLSDEQI  151

Query  529   EKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIVKQFYK  708
              KERG V+EE R    A+ RM D +   M+  S+YA+RLPIG ++V+    P ++++F+K
Sbjct  152   NKERGVVLEELRLGLGADKRMMDRYLPKMLYKSQYADRLPIGKKEVLENFKPDVIRKFHK  211

Query  709   KWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRFSCFVE  888
             +WY    MA++ VGD  +   V + IK +FG   +P +      + +P+H E   +   +
Sbjct  212   EWYRPDLMAIVVVGDI-NVDEVEQKIKTNFGKYPNPKNVRERKSFDLPNHAETLVAIETD  270

Query  889   SEAAGSAV--MISCKMPVDELKTVKDYRDLLAESMFFHALNQRFFKISRKKDPPY-YSCS  1059
              +A  S V  +I  K       T++ Y   L E++    LN R  ++    +PP+ Y   
Sbjct  271   PDATSSMVRFIIKDKETYKPDVTIEQYDQSLVENISAAMLNNRLRELVNSTNPPFTYGSV  330

Query  1060  AAADCLVRPVKAYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRALLMSEIE  1239
                    R  +A+   +  KE G V AL+ +L EV R +  GF++ E+   +A  +S +E
Sbjct  331   YHGGTYARSKEAFQGFAMTKEGGQVSALKVLLEEVERAKRFGFTQSELDRAKAQTLSNLE  390

Query  1240  SAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKYSERFGTS  1419
              +Y  RD+ +S  L DEY+++FL +EP+ GI +E +  K  LP ++ ++ ++  ++    
Sbjct  391   RSYNNRDKTESGMLVDEYVRNFLEHEPIPGIVWEYEHTKKSLPAVTLAQTNEVIKKLVKD  450

Query  1420  SSCVIKTIEPRATATVDDLRSVVLKINTFEQKQ--SIPPWDEENIPEEIVSVKPSPGWIM  1593
              S VI    P+         ++VLK  TF+  +   + P++E+   + +V    S G I 
Sbjct  451   DSRVIVITGPKKDNVTMPTEAMVLK--TFDDVKVADLKPYEEKATIKNLVKPFKSEGKIA  508

Query  1594  QQFEYQNVGAFEFDLSNGMRVCYKCTNFLDDQVLFTGFSYGGLSELPESEYFSCSMGSTI  1773
             +      +G   + LSNG +V +K T+F DD+++FT  S GG S +P+++Y       + 
Sbjct  509   KTDTDAKLGTTTWTLSNGAKVTFKKTDFKDDEIVFTARSLGGSSLIPDADYNKTQFAFSA  568

Query  1774  AGEIGVFGYRPSVLMDMLAGKRAEVGTKLGAYMRSFSGDCSPSDLETALQLVYQLFTT-N  1950
               E GV G   + L + LAGK+  V   +  Y    SG  +  DL T ++L+Y  FT  N
Sbjct  569   LSEAGVNGLNKTELTNYLAGKQVSVNPFISNYTEGISGRTTQKDLGTTMELIYAYFTGLN  628

Query  1951  VEPGEEDVNIVMQMAEEAIHAQERDPYTAFAN-RVRELNYGNSYFFRPIRI-RDLQKVNP  2124
               P     N   +     ++    +P   F++   + +N  N  F   I + +D    + 
Sbjct  629   YNPAA--FNAYKEKQSAMLNNLLSNPQFYFSSEHAKFMNQKNPRFIGIIPMEKDWANTDY  686

Query  2125  YKACEYFNNCFKDPSTFTVVIVGNIDPATAFPLILQYLGGIPRPSEPILHFNRDDLKGLP  2304
              KA + + + F +   F    VGNID A     +LQY+  +P               G  
Sbjct  687   KKAYDIYKDKFSNAGNFHFYFVGNIDEAKFKNEVLQYIASLPSA-------------GKS  733

Query  2305  FKFPSSIIREV------VHSPMVEAQCSVQLCFPVELKSEDMMEDVHFVGFLSKLLETKI  2466
               +  S  R++      V+    + +  V + +  E    +  +D   +  L ++   K+
Sbjct  734   TTYKDSGYRQITGDYNKVYKKGKDPKSLVTISYSGEAPYSE--KDALALSALGEVATIKV  791

Query  2467  VQVLRFKYGQIYNAGVSVFLGGNKPSRVGNIRGDIGINFSCDPDISSTLVDLALDEILRL  2646
             ++ LR     IY  G    +     S+V     +  I+F C P+ +  L   AL E+ +L
Sbjct  792   IEKLREDESGIYGGGARGGM-----SKVPYGSFNFSISFPCGPENAEKLTKSALAELQKL  846

Query  2647  QEDGPSDEDVSTVLEIEQRAHENGLQENCYWLDRILRSYQSRIYSGDVGDSFKVQDEARS  2826
              ++GP  +D+    E E    +  L++N YW++ + ++     Y G   D +++ +  + 
Sbjct  847   IDNGPEQKDLDKYKEGEYNDDKTNLKDNMYWMNALTKNQ----YDG--SDKYEILN-YQE  899

Query  2827  KVRKLLTPLTAQMALQRILPFPCKKQYTVVILMPQASRMKRLK  2955
             KV+ L T       LQ I      K   V +LMP+    + +K
Sbjct  900   KVKALTTK-----DLQAIAKKYLTKDKIVAVLMPEDGWQENVK  937



>ref|WP_032952413.1| peptidase M16 [Bacteroides vulgatus]
 gb|KDS56127.1| peptidase M16 inactive domain protein [Bacteroides vulgatus str. 
3975 RP4]
Length=939

 Score =   380 bits (976),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 264/879 (30%), Positives = 449/879 (51%), Gaps = 31/879 (4%)
 Frame = +1

Query  157   GVDYGRLDNGLTYYVRSNSKPKMRAALALAVRAGSVLEEEEERGVAHIVEHLAFSATEKY  336
              V  G+LDNGLTYY+R N  P+ RA   +A + GS+LEE+ +RG+AH +EH+ F+ T+ +
Sbjct  35    NVRIGKLDNGLTYYIRHNELPEKRADFYIAQKVGSILEEDNQRGLAHFLEHMCFNGTKNF  94

Query  337   TNHDIVKFLESIGAEFGACQNAVTSADETVYELF-VPIDKPELLSQAISILAEFSSEVRA  513
              +  ++++LESIG +FG   NA TS DETVY +  VP+ +  ++   + IL +++ ++  
Sbjct  95    PDKTLIQYLESIGVKFGENLNAYTSIDETVYNISNVPVIRDGVVDSCLLILHDWADDLTL  154

Query  514   SEHDLEKERGAVMEEYRGSRNANGRMQDAHWVLMMEGSKYAERLPIGLEKVIRTVSPQIV  693
                +++ ERG + EE+R S NA  RM +     +   SKYA RLPIG+ +V+     Q +
Sbjct  155   DPKEIDSERGVIHEEWRTSTNAMMRMYEKALPTLYPESKYAYRLPIGIMEVVDNFPYQAL  214

Query  694   KQFYKKWYHLRNMAVIAVGDFPDTQSVVELIKAHFGYKTSppdpppipYYLVPSHEEPRF  873
             + +Y+KWY      ++ VGD  D   +   IK  F     P +P    Y+ VP ++E   
Sbjct  215   RDYYEKWYRPDQQGIVVVGDI-DVDKIEAKIKKIFSPIKMPENPAEREYFQVPDNKETIV  273

Query  874   SCFVESEAAGSAVMISCKMPV--DELKTVKDYRDL-LAESMFFHALNQRFFKISRKKDPP  1044
             +   + E A     +  K     +E K   DY  +   +SM  + LN R  ++++  +PP
Sbjct  274   AIETDKEQANPVAYLCYKHEAIPNEQKGNMDYLVVNYMKSMIENMLNARLNELTQTANPP  333

Query  1045  Y-YSCSAAADCLVRPVK-AYIMTSSCKEKGTVEALESMLTEVARVRLHGFSEREISVVRA  1218
             + ++  +  + L+   K A+    + KE G   A+ +++ E+ RV   GF+  E +  +A
Sbjct  334   FIFAQVSDQEFLISKTKDAFTGIVASKEDGIDSAITAIVREIERVHKFGFTASEYARAKA  393

Query  1219  LLMSEIESAYLERDQMQSTSLRDEYLQHFLRNEPVIGIEYEAQLQKTLLPHISASEVSKY  1398
               +  +ESAY ER+++++ +  DEY++HF+ NEP+ GIE E  +   ++P++S   V+  
Sbjct  394   DYLRMLESAYNERNKVKNGAYVDEYVRHFIDNEPIPGIENEYAIMNQIVPNLSVEMVNSL  453

Query  1399  SERFGTSSSCVIKTIEPRATATVDDLRSVVLKINTFEQKQSIPPWDEENIPEEIVSVKPS  1578
                  T S+ V+    P         +  +L      + +++  ++++   E ++S KP 
Sbjct  454   IPALVTDSNLVVNVFFPEKEGL