BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29602_g1_i1 len=995 path=[1:0-994]

Length=995
                                                                      Score     E

ref|XP_009600017.1|  PREDICTED: uncharacterized protein LOC104095569    344   1e-114   
ref|XP_004244866.2|  PREDICTED: uncharacterized protein LOC101244211    335   6e-111   
emb|CDP17471.1|  unnamed protein product                                300   3e-97    
gb|KDP38014.1|  hypothetical protein JCGZ_04657                         297   3e-96    
ref|XP_007024970.1|  Uncharacterized protein TCM_029413                 296   7e-96    
ref|XP_010090450.1|  hypothetical protein L484_011425                   294   7e-95    
ref|XP_002532981.1|  conserved hypothetical protein                     292   2e-94    Ricinus communis
ref|XP_008225529.1|  PREDICTED: uncharacterized protein LOC103325162    288   1e-92    
ref|XP_008371643.1|  PREDICTED: uncharacterized protein LOC103435024    281   6e-90    
ref|XP_003542955.1|  PREDICTED: uncharacterized protein LOC100800...    280   1e-89    
ref|XP_003593866.1|  hypothetical protein MTR_2g018670                  280   1e-89    
ref|XP_010655693.1|  PREDICTED: uncharacterized protein LOC104880522    279   4e-89    
ref|XP_008371795.1|  PREDICTED: uncharacterized protein LOC103435177    279   6e-89    
ref|XP_006448966.1|  hypothetical protein CICLE_v10016395mg             278   1e-88    
ref|XP_003546064.1|  PREDICTED: uncharacterized protein LOC100795...    276   4e-88    
ref|XP_010054251.1|  PREDICTED: uncharacterized protein LOC104442529    276   6e-88    
ref|XP_004293621.1|  PREDICTED: uncharacterized protein LOC101293374    276   7e-88    
ref|XP_006468263.1|  PREDICTED: uncharacterized protein LOC102621618    275   9e-88    
ref|XP_009360941.1|  PREDICTED: uncharacterized protein LOC103951317    275   1e-87    
gb|EYU25674.1|  hypothetical protein MIMGU_mgv1a0192431mg               273   2e-87    
ref|XP_011010577.1|  PREDICTED: uncharacterized protein LOC105115401    270   6e-86    
ref|XP_010275041.1|  PREDICTED: uncharacterized protein LOC104610227    269   6e-85    
ref|XP_007159379.1|  hypothetical protein PHAVU_002G233300g             265   9e-84    
ref|XP_004504546.1|  PREDICTED: uncharacterized protein LOC101501830    264   2e-83    
ref|XP_003531167.2|  PREDICTED: uncharacterized protein LOC100804600    264   4e-83    
ref|XP_007158737.1|  hypothetical protein PHAVU_002G177900g             259   2e-81    
ref|XP_003524872.2|  PREDICTED: uncharacterized protein LOC100786682    256   3e-80    
ref|XP_006364879.1|  PREDICTED: uncharacterized protein LOC102587686    252   3e-79    
emb|CBI30947.3|  unnamed protein product                                248   4e-77    
ref|XP_009767389.1|  PREDICTED: uncharacterized protein LOC104218562    246   8e-77    
gb|KEH20520.1|  hypothetical protein MTR_8g079475                       244   2e-75    
ref|XP_007214788.1|  hypothetical protein PRUPE_ppa015981mg             243   1e-74    
ref|XP_009385193.1|  PREDICTED: uncharacterized protein LOC103972565    233   2e-71    
gb|AES64118.2|  hypothetical protein MTR_2g018670                       197   6e-58    
gb|KGN65879.1|  hypothetical protein Csa_1G536320                       196   4e-57    
ref|XP_006597508.1|  PREDICTED: uncharacterized protein LOC100795...    194   9e-57    
ref|XP_008444703.1|  PREDICTED: uncharacterized protein LOC103487959    193   5e-56    
ref|XP_003542956.1|  PREDICTED: uncharacterized protein LOC100800...    191   1e-55    
ref|XP_006836353.1|  hypothetical protein AMTR_s00092p00107280          190   9e-55    
ref|XP_007159378.1|  hypothetical protein PHAVU_002G233300g             179   7e-51    
gb|KEH36684.1|  hypothetical protein MTR_2g018670                       166   3e-46    
ref|XP_003593867.1|  hypothetical protein MTR_2g018670                  158   2e-43    
emb|CAN78178.1|  hypothetical protein VITISV_006271                     158   3e-43    Vitis vinifera
gb|KHN12432.1|  NIPA-like protein                                       160   9e-40    
ref|XP_002317289.1|  hypothetical protein POPTR_0011s02480g             135   7e-35    Populus trichocarpa [western balsam poplar]
gb|KHN38159.1|  hypothetical protein glysoja_007201                     125   1e-31    
ref|XP_006377239.1|  hypothetical protein POPTR_0011s02500g             122   1e-30    
gb|ACU18132.1|  unknown                                               94.7    9e-21    Glycine max [soybeans]
gb|ACU20257.1|  unknown                                               94.0    3e-20    Glycine max [soybeans]



>ref|XP_009600017.1| PREDICTED: uncharacterized protein LOC104095569 [Nicotiana tomentosiformis]
Length=252

 Score =   344 bits (883),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 204/254 (80%), Gaps = 9/254 (4%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF PFN RNLD SFFIFRPTIVIVD LV+ LK+FS  TE+LGCVHSAIFRSIHG+++I
Sbjct  1    MACFFPFNSRNLDASFFIFRPTIVIVDDLVEALKNFSFCTESLGCVHSAIFRSIHGNMMI  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAWIK+S + ++DLL A LLSML+ VSSMAI++E GFY+A+AGE +D +PAAKFYTGD
Sbjct  61   WYGAWIKRSGE-NKDLLDAALLSMLTNVSSMAILMEHGFYDAYAGETKDHSPAAKFYTGD  119

Query  440  TVSMNALSFSTREVDL--NRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWR  267
             VSMN+ +  + + D+    FSYACLAIFKDRF +MDGA  G CLK + + KV A+FVW+
Sbjct  120  IVSMNSAASCSHQHDMPIEHFSYACLAIFKDRFNKMDGAVAGVCLKCQTIPKVAAIFVWK  179

Query  266  SLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLES--  93
            SLQ CY+YILN D R SVLPY DG SLD+KYD+FRVVYVSG+ A++FHF+PPH++LE   
Sbjct  180  SLQCCYNYILNQDSR-SVLPYFDGFSLDLKYDVFRVVYVSGDGALNFHFYPPHKMLEGKE  238

Query  92   ---NGVHDSNKVAD  60
               N   D N+VA+
Sbjct  239  GLYNVTQDLNRVAE  252



>ref|XP_004244866.2| PREDICTED: uncharacterized protein LOC101244211 [Solanum lycopersicum]
Length=268

 Score =   335 bits (860),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 198/241 (82%), Gaps = 3/241 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M CF P+N RNLD SFFIFRPTIVIVD +V+ LKHFS ST+ LGCV SAIFRSIHG++I+
Sbjct  27   MTCFFPYNSRNLDTSFFIFRPTIVIVDDVVEALKHFSFSTQNLGCVQSAIFRSIHGNMIV  86

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAWIK+  + ++D L+ TL+SML+ VSSMAI+LE GF++A+AGE++D +PA KFYTG+
Sbjct  87   WYGAWIKRCIE-NKDSLATTLVSMLTSVSSMAILLEYGFFDAYAGESKDHSPAGKFYTGN  145

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             VSMN+ SFS  ++ +  F+YACLAIFKDRF  M+GA  G C KS+ LSKV AVFVW+SL
Sbjct  146  IVSMNSASFSHHDMPIEDFTYACLAIFKDRFHNMNGAVSGVCFKSQQLSKVAAVFVWKSL  205

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLE-SNGV  84
            Q CY+YILN D R SVLPY DG SLD+KYD+F+VVYVSG++A++FH FPPH++LE   G+
Sbjct  206  QCCYNYILNQDSR-SVLPYFDGFSLDLKYDVFKVVYVSGDSALNFHIFPPHKMLEDKQGL  264

Query  83   H  81
            H
Sbjct  265  H  265



>emb|CDP17471.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   300 bits (768),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 186/237 (78%), Gaps = 1/237 (0%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN  N+++S  +FRPT+V VD +V+ LKHFS  TE  GC+HSAI RSIHG++II
Sbjct  1    MACFVPFNTTNMEISLLVFRPTVVEVDDVVESLKHFSLCTEGHGCLHSAILRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+K+S D+ +D LSA   SML+ VSSMAI+++Q F+EA+AGE+R+G  AAK +TGD
Sbjct  61   WYGAWMKRS-DEKKDSLSAAFSSMLTNVSSMAILIDQSFFEAYAGESREGCQAAKIFTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             VS+N+ + ST +++ N FSYACLAIF+ RFL+M+GA  G CLKS+ +S+V  +FVW+SL
Sbjct  120  IVSLNSTTLSTDDMNKNYFSYACLAIFRTRFLKMEGATAGVCLKSQTMSRVVGLFVWKSL  179

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESN  90
              CYSYILN DYR ++LPYL+G SLDIKYDIFRV YVS  NA D  FF   RL +++
Sbjct  180  HHCYSYILNTDYRETILPYLEGHSLDIKYDIFRVAYVSSNNAADIQFFSSSRLWQND  236



>gb|KDP38014.1| hypothetical protein JCGZ_04657 [Jatropha curcas]
Length=247

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 185/238 (78%), Gaps = 3/238 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+P N RNLD+SFF+FRPT+V+VD+L++ LK FS STE LGCVHS+I +SIHG++II
Sbjct  1    MACFLPLNSRNLDVSFFVFRPTVVLVDELLETLKQFSGSTENLGCVHSSILKSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+KKSS+ +++LL+  LLSML+ +SSMAI++E GF++A+AGE+RDG+ AAKF TGD
Sbjct  61   WYGAWMKKSSE-NKELLTEALLSMLTNISSMAILIEHGFFDAYAGESRDGSSAAKFSTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +SMN +       D+N  SYA LAIFK  F++M GA  G CLK ++  +V  ++VW+SL
Sbjct  120  AISMNMI--VPESGDINEISYANLAIFKSHFVKMGGATAGVCLKCQSKPRVACLYVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNG  87
            Q CYS+I+N D+R ++LPYL+  S DIKYDIFRV++VS EN   +    P+ +L++ G
Sbjct  178  QFCYSWIINSDHRKTMLPYLERFSFDIKYDIFRVIFVSSENVSSYKHRSPNHMLQNGG  235



>ref|XP_007024970.1| Uncharacterized protein TCM_029413 [Theobroma cacao]
 gb|EOY27592.1| Uncharacterized protein TCM_029413 [Theobroma cacao]
Length=244

 Score =   296 bits (758),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 188/238 (79%), Gaps = 3/238 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNLD++ F+FRPT+V+VD+LVD LK F   TETLGCV S+IF+SIHG+LII
Sbjct  1    MACFVPFNNRNLDVTLFVFRPTVVLVDELVDSLKQFCVCTETLGCVQSSIFKSIHGNLII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYG W+KK+++ ++++L+ATLLSML+ +SSMA+++E  F++A+AGE++DG+ AAK+ TGD
Sbjct  61   WYGGWMKKATE-NKEVLTATLLSMLASMSSMAVLIEHSFFDAYAGESKDGSNAAKYSTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             VSMN ++ S+   D+N  SYA LA+FK RFL+M+GA  G CLK +++  V  ++VW+SL
Sbjct  120  IVSMNVIASSSS--DINDVSYANLALFKSRFLKMEGATAGVCLKCQSMPMVACLYVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNG  87
              CYS+IL  DYR ++LPYL+  SL +KYDIF VVYVS EN  ++   P H +LE+ G
Sbjct  178  LLCYSWILASDYRKTMLPYLERFSLSVKYDIFWVVYVSSENVHNYQIPPHHHVLENRG  235



>ref|XP_010090450.1| hypothetical protein L484_011425 [Morus notabilis]
 gb|EXB39508.1| hypothetical protein L484_011425 [Morus notabilis]
Length=245

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 181/238 (76%), Gaps = 2/238 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACFIPFN+RNLD+SFF FRPT+V+V  L+D LKHFS  TETLGCV S++ +SIHG++I+
Sbjct  1    MACFIPFNNRNLDISFFAFRPTVVLVGDLIDALKHFSLCTETLGCVQSSLIQSIHGNMIL  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+KKS + ++D L+ TLLSML+ +SSMAI++E  F+ ++AG++RDG  AAKF  GD
Sbjct  61   WYGAWLKKSCE-NKDALTVTLLSMLANISSMAILVEHTFFGSYAGDSRDGGLAAKFCAGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVS+   S +    D+N  SYACLA+FK  FL++DG   G CLK ++   V    VW+SL
Sbjct  120  TVSIRIASLTVGN-DMNDLSYACLALFKSSFLKVDGVTSGVCLKCQSKPTVACFLVWKSL  178

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNG  87
            QSCYS++L  + RSS+LPYL+   LD+KYDIFRVVYVSG+NA++  FF P ++ E  G
Sbjct  179  QSCYSWVLGSNQRSSILPYLERFPLDLKYDIFRVVYVSGDNALNIRFFSPRQMFEQGG  236



>ref|XP_002532981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29405.1| conserved hypothetical protein [Ricinus communis]
Length=247

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 186/240 (78%), Gaps = 3/240 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M CF+PFN+RNLD+SFF+ RPT V+VD++V  LK FS STE+LGCV S+IF+SIHG++II
Sbjct  1    MGCFVPFNNRNLDISFFVLRPTAVLVDEIVGSLKQFSGSTESLGCVQSSIFKSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLS-GVSSMAIILEQGFYEAFAGEARDGTPAAKFYTG  444
            WYGAWIKKSS +++DLL+A LLSML+   SS+AI+ E GF++A+AGE+RDG+ AAKF TG
Sbjct  61   WYGAWIKKSS-QNKDLLTAVLLSMLTKATSSIAILSEHGFFDAYAGESRDGSAAAKFSTG  119

Query  443  DTVSMNALS-FSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWR  267
            DT+SMN +S   +R  ++N  SYA LA+FK RFL+M+GA  G CL  +++ +V  ++VWR
Sbjct  120  DTISMNIISPHQSRSNNINDLSYANLALFKSRFLKMEGANAGVCLNCQSIPRVACLYVWR  179

Query  266  SLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNG  87
            SL  CYS+I+  D+R +VLPYL+  SLD+KYDIFRVV+VS +N + +     +  +  NG
Sbjct  180  SLHFCYSWIITSDHRKTVLPYLERFSLDVKYDIFRVVFVSSDNVVSYPHLASNNQMLQNG  239



>ref|XP_008225529.1| PREDICTED: uncharacterized protein LOC103325162 [Prunus mume]
Length=253

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 185/236 (78%), Gaps = 4/236 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNLD+S F+FRPT+V+VD L++ LK FS  TE+LGCV S+I +SIHG++II
Sbjct  1    MACFVPFNNRNLDISIFVFRPTVVLVDDLLNALKQFSLCTESLGCVQSSILQSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            W+GAW+K+S + ++D L+A+LLSML+ +SSMAI+LE  F++A+ GE+RD + AAKF  GD
Sbjct  61   WFGAWLKRSCE-NKDSLTASLLSMLTNMSSMAILLEHSFFDAYGGESRDRSCAAKFCRGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVSM+    +    ++N  SYACLA+FK  F +M+G   G CLK +   ++ ++FVW+SL
Sbjct  120  TVSMSTAVVNGG--NMNNVSYACLAMFKSGFQKMEGVAAGVCLKCQTKPRIASLFVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFF-PPHRLLE  96
            Q CYS+ILN D R ++LPY + +S++IKYDIFRVVYVSG+N + F FF PPH++LE
Sbjct  178  QYCYSWILNSDQRKAMLPYFESVSIEIKYDIFRVVYVSGDNDLKFQFFYPPHQMLE  233



>ref|XP_008371643.1| PREDICTED: uncharacterized protein LOC103435024 [Malus domestica]
Length=252

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 184/245 (75%), Gaps = 4/245 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN +NLD+S F+FRPTIV VD L++ LK FS  TE+LGCV S+I +SIHG++ I
Sbjct  1    MACFVPFNSKNLDISMFVFRPTIVFVDDLLNALKQFSVCTESLGCVQSSILQSIHGNMFI  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            W+GAW+K+S + ++D L+A+LLSML+ +S+MAI+L+  F++A+AGE+RDG+ AAKF  GD
Sbjct  61   WFGAWLKRSCE-NKDSLTASLLSMLTNLSNMAILLDHSFFDAYAGESRDGSCAAKFRRGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVS++    +    D+N  SYACLA+FK  F RM G   G CLK +   ++ ++FVW+SL
Sbjct  120  TVSLSTALINGG--DINNVSYACLALFKSGFQRMQGVTAGVCLKCQTGPRIASLFVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH-FFPPHRLLESNGV  84
              CYS+ILN D R ++LPYL+ +S++IKYDIFRVVYVSG++ M+    +PPH++LE    
Sbjct  178  HYCYSWILNSDQRKAMLPYLESVSIEIKYDIFRVVYVSGDSDMNLQALYPPHQMLEPAAC  237

Query  83   HDSNK  69
             +  +
Sbjct  238  ENKEE  242



>ref|XP_003542955.1| PREDICTED: uncharacterized protein LOC100800652 isoform 1 [Glycine 
max]
 gb|KHN47356.1| hypothetical protein glysoja_020224 [Glycine soja]
Length=246

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 183/244 (75%), Gaps = 4/244 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MAC +PFN++NLD+SFF+F+PTIVI+D LV  LKHFS +TE+LGCV S+IFRSIHG++II
Sbjct  1    MACSVPFNNKNLDISFFVFKPTIVIIDDLVHGLKHFSLTTESLGCVQSSIFRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW ++SS K+++ L++TL SMLS +SSMA+++E  F EA+ GE+RDG+  AKF TGD
Sbjct  61   WYGAWQRRSS-KEKEELTSTLKSMLSNISSMAVLIEHSFLEAYGGESRDGSSTAKFSTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +S+N+   +T   DLN   YA LAI + RF +M+G   G C K ++  +V  + VW+SL
Sbjct  120  IISLNSAVTTTN--DLNDLCYAVLAILRSRFAKMEGITAGLCFKGQSKPRVVCIHVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNGVH  81
              CYS+ILN D+R+ ++PYL+  S+++KYDIFRVVYV G+N +D +    H++LE NG  
Sbjct  178  HFCYSWILNSDHRNWMMPYLERFSINMKYDIFRVVYVRGDNVVDLNCISTHQMLE-NGKE  236

Query  80   DSNK  69
             S +
Sbjct  237  SSRQ  240



>ref|XP_003593866.1| hypothetical protein MTR_2g018670 [Medicago truncatula]
 gb|AES64117.1| hypothetical protein MTR_2g018670 [Medicago truncatula]
Length=246

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 182/236 (77%), Gaps = 2/236 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MAC + FN++NL++SFF+F+PTIVI+D LV  LK FS +TETLGCV S+IFRSIHG++II
Sbjct  1    MACSVAFNNKNLEISFFVFKPTIVIIDDLVHGLKQFSLTTETLGCVQSSIFRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW +K S K+++LL+ TL SML+ VS+MA ++E  F EA+AGE+RDG+  AKF TGD
Sbjct  61   WYGAW-QKQSTKEKELLTLTLKSMLTKVSTMAKLIEHSFLEAYAGESRDGSSTAKFSTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +S+N+   ++R+ DLN  SYA LA+F+ RF +M+G   G CLK ++   V  + VW+SL
Sbjct  120  ILSINSAGTNSRD-DLNDLSYAVLALFRSRFAKMEGMTSGLCLKGQSRPIVVCIHVWKSL  178

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLES  93
              CYS+ILN D+R  ++PYL+  ++D+KYDIF+VVYVSG+N +D ++   H++LE+
Sbjct  179  HFCYSWILNSDHRKWMMPYLEKFAIDMKYDIFKVVYVSGDNVVDVNYISHHQMLEN  234



>ref|XP_010655693.1| PREDICTED: uncharacterized protein LOC104880522 [Vitis vinifera]
Length=253

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 183/245 (75%), Gaps = 3/245 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M CF+PF++RNLD+S  +F P +V+VD L+D LK FSSSTE++GCVHS+IFRSIHG++II
Sbjct  1    MPCFVPFSNRNLDISILVFIPMVVVVDDLIDALKLFSSSTESMGCVHSSIFRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+K+SS+ +++ L A  L ML+ VSSMAI+ +  F++A+AGE++DG PAAKF TG 
Sbjct  61   WYGAWMKRSSE-NKEFLHAAFLQMLTNVSSMAILADHSFFDAYAGESKDGFPAAKFSTGG  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +S+   + ++  +D    S+A LA+FK  F +M+GA  G CL+     +V  +FVW+SL
Sbjct  120  IISIGTAALASDNLD--ELSHANLALFKAYFQKMEGAISGVCLRCEMSPRVACLFVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNGVH  81
             +CYS+ILN DYR++VLPYL+ ++ DIK+DIFRV+YVS +N   F + PP ++LE+ G  
Sbjct  178  HACYSWILNTDYRATVLPYLNRLTPDIKFDIFRVLYVSDDNVPSFQYLPPQQMLENGGGS  237

Query  80   DSNKV  66
              +KV
Sbjct  238  KQDKV  242



>ref|XP_008371795.1| PREDICTED: uncharacterized protein LOC103435177 [Malus domestica]
Length=252

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 184/240 (77%), Gaps = 6/240 (3%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN +NLD+S F+FRPTIV+VD L++ LK FS  TE+LGCV S+I +SIHG++ I
Sbjct  1    MACFVPFNSKNLDISIFVFRPTIVLVDDLLNALKQFSLCTESLGCVQSSILQSIHGNMFI  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            W+GAW+K++ + ++D L+A LLSML+ +S+MAI+++  F++A+AGE+RDG+ AAKF  GD
Sbjct  61   WFGAWLKRTCE-NKDSLTARLLSMLANISNMAILVDHSFFDAYAGESRDGSSAAKFRRGD  119

Query  440  TVSMN-ALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRS  264
            TVS++ AL +     D+N  SYACLA+FK  F RM GA  G CLK +   +  ++FVW+S
Sbjct  120  TVSLSTALIYGG---DINNVSYACLALFKSGFQRMQGATAGVCLKCQTGQRTASLFVWKS  176

Query  263  LQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH-FFPPHRLLESNG  87
            LQ CYS+ILN D R ++ PYL+ +S++IKYDIFRVVYVSG++ +D    +P H++LE  G
Sbjct  177  LQYCYSWILNSDQRKALSPYLESVSIEIKYDIFRVVYVSGDSDIDLQVLYPRHQMLEQAG  236



>ref|XP_006448966.1| hypothetical protein CICLE_v10016395mg [Citrus clementina]
 gb|ESR62206.1| hypothetical protein CICLE_v10016395mg [Citrus clementina]
Length=248

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 178/226 (79%), Gaps = 3/226 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNLD+SFF+FRPT+V+V++LVD LK FS+ TETLGCV+S+IFRSIHG+LII
Sbjct  1    MACFVPFNNRNLDISFFVFRPTVVLVEELVDALKVFSACTETLGCVNSSIFRSIHGNLII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WY AW+K+S + ++++L ++LL ML  +S+  +++E  F +A+AGE+++G+  AKFYTGD
Sbjct  61   WYAAWMKRSRE-NKEMLISSLLQMLKSLSNKGVLVEYRFVDAYAGESKEGSCVAKFYTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             + +N  + +    DLN  SYA LAIFKDRF +M+GA  G CLK + +  V  ++VW+SL
Sbjct  120  VICLNVATSTAG--DLNDVSYANLAIFKDRFWKMEGAVSGVCLKLQDMPAVSCLYVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH  123
            Q CYS+ILN D+R +++PYLD   LDIKYDIFRVVYVS E A+ +H
Sbjct  178  QHCYSWILNADHRKTMVPYLDRFKLDIKYDIFRVVYVSTEAALSWH  223



>ref|XP_003546064.1| PREDICTED: uncharacterized protein LOC100795398 isoform X1 [Glycine 
max]
 gb|KHN06944.1| hypothetical protein glysoja_032787 [Glycine soja]
Length=246

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 181/244 (74%), Gaps = 4/244 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MAC +PFN++NLD+SFF+F+PTIVI+D LV  LK FS +TE+LGCV S+IFRSIHG++II
Sbjct  1    MACSVPFNNKNLDISFFVFKPTIVIIDDLVHGLKAFSLTTESLGCVQSSIFRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW ++SS K+++ L++TL SML+ +SSMA+++E  F EA+ GE+RDG+  AKF TGD
Sbjct  61   WYGAWQRRSS-KEKEELTSTLKSMLTSISSMAVLIEHSFLEAYGGESRDGSSTAKFSTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +S+N+   +T   DLN   YA LAI + RF +M+G   G C K ++  +V  + VW+SL
Sbjct  120  IISLNSAVTTTN--DLNDLCYAVLAILRSRFAKMEGITAGLCFKGQSKPRVVCIHVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNGVH  81
              CY +ILN D+R  ++PYL+  S+D+KYDIFRVVYVSG+N +D +    H++LE NG  
Sbjct  178  HFCYCWILNSDHRKWMMPYLERFSIDMKYDIFRVVYVSGDNVVDLNCISTHQMLE-NGNE  236

Query  80   DSNK  69
             S +
Sbjct  237  SSRQ  240



>ref|XP_010054251.1| PREDICTED: uncharacterized protein LOC104442529 [Eucalyptus grandis]
 gb|KCW75881.1| hypothetical protein EUGRSUZ_D00266 [Eucalyptus grandis]
Length=244

 Score =   276 bits (705),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 176/226 (78%), Gaps = 5/226 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M+CF+PF+ RNLD SFF+FRPT    D+LVD LK FS ST+ LGCV S+IFRSIHG++II
Sbjct  1    MSCFVPFSWRNLDTSFFVFRPTFA--DELVDALKRFSVSTKVLGCVQSSIFRSIHGNMII  58

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW +KSSD +++ L+ATLLSML+ VSSMAI+LE  F E +AGE+RDG+ AAKF TGD
Sbjct  59   WYGAWTRKSSD-NKESLNATLLSMLTDVSSMAILLEHSFVEPYAGESRDGSLAAKFSTGD  117

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +S++A   +  E+     +YACLAIFK RF++++G   G C++S    KV  V+VW+SL
Sbjct  118  IISVHAAESTNGEI--GDLAYACLAIFKSRFMKIEGVSAGVCMRSENRPKVACVYVWKSL  175

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH  123
            Q CYS+ILN +YR ++LPYLD  SLD+KYDIF+VVYVS +N++ ++
Sbjct  176  QFCYSWILNSEYRKAMLPYLDRFSLDLKYDIFKVVYVSSDNSVSYY  221



>ref|XP_004293621.1| PREDICTED: uncharacterized protein LOC101293374 [Fragaria vesca 
subsp. vesca]
Length=254

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 185/243 (76%), Gaps = 1/243 (0%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNLD+S F+FRPT+V V++L+  LK FS  TETLGCV S+I +SIHG++II
Sbjct  1    MACFVPFNNRNLDISIFVFRPTVVHVEELLVGLKQFSLCTETLGCVQSSILQSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            W+GAW+K+SS+ +++ L+A+LLSMLS +++ AI+++  F++A+AGE+R+G+ AAKF TGD
Sbjct  61   WFGAWLKRSSE-NKESLTASLLSMLSNLATKAILVDHTFFDAYAGESREGSCAAKFCTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVSM+  SF+     +   SYACLA+FK  F +M+G + G C+K +    + + +VW+SL
Sbjct  120  TVSMSVASFNGAGDVIADVSYACLALFKSGFHKMEGVRSGVCMKCQTKPSIASFYVWKSL  179

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNGVH  81
            Q CYS+IL+ D R  +LPY +  S+D+KYDIFRVVYVSG++  +F FF PH++LE     
Sbjct  180  QYCYSWILSSDQRKILLPYFESYSIDVKYDIFRVVYVSGDSEPEFPFFYPHQILEKTAGG  239

Query  80   DSN  72
            +S 
Sbjct  240  ESK  242



>ref|XP_006468263.1| PREDICTED: uncharacterized protein LOC102621618 [Citrus sinensis]
 gb|KDO75353.1| hypothetical protein CISIN_1g025792mg [Citrus sinensis]
Length=248

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNLD+SFF+FRPT+V+V++LV+ LK FS+ TETLGCV+S+IFRSIHG+LII
Sbjct  1    MACFVPFNNRNLDISFFVFRPTVVLVEELVNALKDFSACTETLGCVNSSIFRSIHGNLII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WY  W+K+S + ++++L ++LL ML  +S+  +++E  F +A+AGE+++G+  AKFYTGD
Sbjct  61   WYALWMKRSRE-NKEMLISSLLQMLKNLSNKGVLVEYRFVDAYAGESKEGSSVAKFYTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             + +N  + +    DLN  SYA LAIFKDRF +M+GA  G CLK + +  V  ++VW+SL
Sbjct  120  VICLNVATSTAG--DLNDVSYANLAIFKDRFWKMEGAVSGVCLKLQDIPAVSCLYVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH  123
            Q CYS+ILN D+R +++PYLD   LDIKYDIFRVVYVS E A+ +H
Sbjct  178  QHCYSWILNADHRKTMVPYLDRFKLDIKYDIFRVVYVSTEAALSWH  223



>ref|XP_009360941.1| PREDICTED: uncharacterized protein LOC103951317 [Pyrus x bretschneideri]
 ref|XP_009377488.1| PREDICTED: uncharacterized protein LOC103966084 [Pyrus x bretschneideri]
Length=252

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 183/245 (75%), Gaps = 4/245 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN +NLD+S F+FRPTIV VD L++ LK FS  TE+LGCV S+I +SIHG++ I
Sbjct  1    MACFVPFNSKNLDISMFVFRPTIVFVDDLLNALKQFSVCTESLGCVQSSILQSIHGNMFI  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            W+GAW+K+S + ++D L+A+LLSML+ +S+MAI+L+  F++A+AGE+ DG+ AAKF  GD
Sbjct  61   WFGAWLKRSCE-NKDSLTASLLSMLTNLSNMAILLDHSFFDAYAGESSDGSCAAKFRRGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVS++    +    D+N  SYACLA+F+  F RM G   G CLK +   ++ ++FVW+SL
Sbjct  120  TVSLSTALINGG--DINNVSYACLALFRSGFQRMQGVTAGVCLKCQTGPRIASLFVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH-FFPPHRLLESNGV  84
              CYS+ILN D R ++LPYL+ +S++IKYDIFRVVYVSG++ ++    +PPH++LE    
Sbjct  178  HYCYSWILNSDQRKAMLPYLESVSIEIKYDIFRVVYVSGDSDINLQVLYPPHQMLEPAAC  237

Query  83   HDSNK  69
             +  +
Sbjct  238  ENKEE  242



>gb|EYU25674.1| hypothetical protein MIMGU_mgv1a0192431mg, partial [Erythranthe 
guttata]
Length=207

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 166/206 (81%), Gaps = 1/206 (0%)
 Frame = -1

Query  797  ACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLIIW  618
            +C++PFN RNLD+SFF+FRPT+V VD L+  LK FSS T+TLGCVHS+I RSIHG++I+W
Sbjct  3    SCYVPFNSRNLDISFFVFRPTVVYVDDLLHALKQFSSYTQTLGCVHSSILRSIHGNMIVW  62

Query  617  YGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDT  438
            YGAW+K++ + ++ LL   LLS+L+ V+ MAI+++  F++AF GE+RDGTPAAKF+TGD 
Sbjct  63   YGAWMKRTHE-NKQLLIDALLSVLTNVAGMAILIDHSFFDAFTGESRDGTPAAKFFTGDI  121

Query  437  VSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQ  258
            VSM++ + S    D N+ SYACLAIFKDRF +M GA+ G C KS+++ ++  +FVW+SLQ
Sbjct  122  VSMSSATLSANNDDENKVSYACLAIFKDRFNKMSGARAGVCFKSQSVPRIVCLFVWKSLQ  181

Query  257  SCYSYILNDDYRSSVLPYLDGMSLDI  180
             CY+YIL  DYR+++LPYLDG +LD+
Sbjct  182  FCYTYILTSDYRNTILPYLDGFALDV  207



>ref|XP_011010577.1| PREDICTED: uncharacterized protein LOC105115401 [Populus euphratica]
Length=223

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 177/225 (79%), Gaps = 4/225 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNL++SFFIFRP + +VD+LV+ LKHFSS TE+LGCV S+IF+SIHG++I+
Sbjct  1    MACFVPFNNRNLEISFFIFRPIVALVDELVETLKHFSSCTESLGCVQSSIFKSIHGNMIV  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+KKS + +++ L+  L+SMLS +SSMAI++E  F++A+AGE+RD + AA+  T D
Sbjct  61   WYGAWMKKSCE-NKEELTGELVSMLSNISSMAILIEHSFFDAYAGESRDDSSAARLSTED  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACL--KSRALSKVCAVFVWR  267
            T+SM+ +  S R  D+N  SYA LA+FK +FL+M+GA  G CL  KS    +V  ++VW+
Sbjct  120  TISMSII-VSPRADDINDLSYANLALFKSQFLKMEGANSGVCLTCKSVQQPRVACLYVWK  178

Query  266  SLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAM  132
            SL+ CYS+ILN DYR ++LPYL+  S  IKYD+FRV++VS +N +
Sbjct  179  SLRFCYSWILNSDYRRTILPYLERFSFVIKYDMFRVIFVSSDNVL  223



>ref|XP_010275041.1| PREDICTED: uncharacterized protein LOC104610227 [Nelumbo nucifera]
Length=256

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 174/246 (71%), Gaps = 5/246 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M+CF+PFND+NLD+S F+FR  +VI++ L+D LK FS   E LGC H +IF+SIHG++I+
Sbjct  1    MSCFVPFNDKNLDISLFVFRSVVVIIEDLMDALKQFSVCCERLGCAHCSIFKSIHGNMIV  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+K+ SD+ + LL ATL+SML  VSSMAI+L+  F+ A+AGE++DG   AKF TGD
Sbjct  61   WYGAWLKR-SDEQKKLLDATLMSMLQDVSSMAILLDHSFFNAYAGESKDGFSGAKFSTGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVS+NAL  S+   D    SY CLA+FK  FL+M+G  GG C K   L +V  ++VW+SL
Sbjct  120  TVSLNALLQSSD--DSADLSYLCLALFKSYFLKMEGVTGGVCFKCDDLPRVVCLYVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAM--DFHFFPPHRLLESNG  87
             SCYS++L  D R ++ PYL+  S DIKYDIFRVVYV  E  M    H FP  ++ E+ G
Sbjct  178  HSCYSWLLTTDIRRTIKPYLEPFSPDIKYDIFRVVYVRNEENMLNTHHLFPSPKMQENVG  237

Query  86   VHDSNK  69
             ++  +
Sbjct  238  NNEGGQ  243



>ref|XP_007159379.1| hypothetical protein PHAVU_002G233300g [Phaseolus vulgaris]
 ref|XP_007159380.1| hypothetical protein PHAVU_002G233300g [Phaseolus vulgaris]
 gb|ESW31373.1| hypothetical protein PHAVU_002G233300g [Phaseolus vulgaris]
 gb|ESW31374.1| hypothetical protein PHAVU_002G233300g [Phaseolus vulgaris]
Length=247

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 178/243 (73%), Gaps = 5/243 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MAC + FN +NLD+SFF+F+PTIVI+D LV  LKHFS +TE+LGCV S+IFRSIHG++II
Sbjct  1    MACSVSFNKKNLDISFFVFKPTIVIIDHLVQGLKHFSLTTESLGCVQSSIFRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSG-VSSMAIILEQGFYEAFAGEARDGTPAAKFYTG  444
            WYGAW ++SS K+++ L++TL +ML+  +S+M ++++  F EA+ GE+RDG+  AKF TG
Sbjct  61   WYGAWPRQSS-KEKEELTSTLKTMLTNSISTMGVLIDHSFLEAYGGESRDGSSTAKFSTG  119

Query  443  DTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRS  264
            D +S+N+   +T   DLN   YA LAI + RF +M+G   G C K ++  ++  + VW+S
Sbjct  120  DIISLNSAVTTTN--DLNDLCYAVLAILRSRFAKMEGTISGLCFKGQSKPRMVCIHVWKS  177

Query  263  LQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNGV  84
            L  CYS+ILN D R  ++PYL+  S+++KYDIFRVVYVSG+N +DF+    H+ LE NG 
Sbjct  178  LHFCYSWILNSDQRKWMMPYLERFSIEMKYDIFRVVYVSGDNVVDFNCISTHQKLE-NGK  236

Query  83   HDS  75
              S
Sbjct  237  ESS  239



>ref|XP_004504546.1| PREDICTED: uncharacterized protein LOC101501830 [Cicer arietinum]
Length=242

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 170/236 (72%), Gaps = 3/236 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            + C I FN+++L++SFF+F+PTIVIVD L+  LK FSS  E LGCV S+IF+SIHG++II
Sbjct  2    VTCSIDFNNKDLEISFFVFKPTIVIVDHLIHELKQFSSRAENLGCVQSSIFKSIHGNMII  61

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYG W K+SSD ++D L+A L SML+ V+ M I++EQ F +A+AGE+RDGT   KF TGD
Sbjct  62   WYGTWKKRSSD-EKDKLTANLQSMLTNVTKMCILVEQNFLDAYAGESRDGTSTIKFSTGD  120

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +S+N++  + +  DLN   YA LAIFK RF + +G   G CLK + L  V  + VW+SL
Sbjct  121  IISINSVVTTMK--DLNDLCYAVLAIFKSRFAKNEGKNAGICLKGQKLPSVVCIHVWKSL  178

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLES  93
            Q CYS++LN D+R  ++PYL+   + +KYDIFRVVYVSGEN +D  +     LLE+
Sbjct  179  QFCYSWVLNPDHRKWMIPYLERFKIVMKYDIFRVVYVSGENIVDLAYKSSLMLLEN  234



>ref|XP_003531167.2| PREDICTED: uncharacterized protein LOC100804600 [Glycine max]
Length=247

 Score =   264 bits (674),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 174/236 (74%), Gaps = 4/236 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M C +  N+++LD+SF++F+PT+VIVD LV  L+ FS  T+ LGCV S+IFRSIHG+ II
Sbjct  2    MTCSVDLNNKDLDISFYVFKPTVVIVDHLVHGLQQFSLLTQNLGCVQSSIFRSIHGNTII  61

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLS-GVSSMAIILEQGFYEAFAGEARDGTPAAKFYTG  444
            WYGAW K+SSD ++D L+A L SML+  V+ MA+++E  F +A+AGE+RDG+ A KF TG
Sbjct  62   WYGAWQKRSSD-EKDKLTANLQSMLTNNVTRMAVLVEHNFLDAYAGESRDGSLAVKFSTG  120

Query  443  DTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRS  264
            D +SMN++  +T+  DLN   YA LAIF+ RF + +G   G C+K + L +V  + VW+S
Sbjct  121  DIISMNSVVTTTK--DLNDLCYAVLAIFRSRFPKTEGITSGLCMKGQCLPRVVCIHVWQS  178

Query  263  LQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLE  96
            LQ CYS+ILN D+R  ++PYL+  S ++K+DIFRVVYVS EN M+  +  PHR+LE
Sbjct  179  LQFCYSWILNSDHRKWMMPYLERFSTEMKHDIFRVVYVSDENVMNVPYDSPHRMLE  234



>ref|XP_007158737.1| hypothetical protein PHAVU_002G177900g [Phaseolus vulgaris]
 gb|ESW30731.1| hypothetical protein PHAVU_002G177900g [Phaseolus vulgaris]
Length=246

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = -1

Query  797  ACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLIIW  618
             C + FN+++LD+SFF+F+PT+VIV+ LV  L+HFS  T+ LGCV S+IFRSIHG++IIW
Sbjct  3    TCSVDFNNKDLDISFFVFKPTVVIVEHLVHGLQHFSLLTQNLGCVQSSIFRSIHGNMIIW  62

Query  617  YGAWIKKSSDKDRDLLSATLLSMLS-GVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            YGAW K+ SD ++D L+  L SML+  V+ MA+++E  F EA+AGE+R+G+   K  TGD
Sbjct  63   YGAWHKRPSD-EKDKLTENLQSMLAINVTGMAVLVEHNFLEAYAGESRNGSLTVKLSTGD  121

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +SM+++   TR  DLN  SYA LAIF+ RF ++DG   G C+K + L  V  + VW+SL
Sbjct  122  IISMHSVVTVTR--DLNDLSYAALAIFRSRFSKIDGITSGLCMKGQCLPSVVCIHVWQSL  179

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLE  96
            Q CYS+IL+ D+R+ ++PYL+  S+ +KYDIFRVVYVS EN M+     PH LLE
Sbjct  180  QFCYSWILHPDHRNWMMPYLERFSIQMKYDIFRVVYVSAENVMNLPRVLPHTLLE  234



>ref|XP_003524872.2| PREDICTED: uncharacterized protein LOC100786682 [Glycine max]
 gb|KHN46051.1| hypothetical protein glysoja_030052 [Glycine soja]
Length=246

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 175/236 (74%), Gaps = 4/236 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M C + FN+++L++SF++F+PT+VIVD LV  L+ FS  T+ LGCV S+IFRSIHG++II
Sbjct  1    MTCSVDFNNKDLEISFYVFKPTVVIVDHLVHGLQQFSLLTQNLGCVQSSIFRSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSG-VSSMAIILEQGFYEAFAGEARDGTPAAKFYTG  444
            WYGAW K+SS+ ++D L+  L SML+  V+ MA+++E  F +A+AGE+RDG+ + KF TG
Sbjct  61   WYGAWQKRSSE-EKDKLTENLQSMLTNTVTRMAVLVEHNFLDAYAGESRDGSLSVKFSTG  119

Query  443  DTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRS  264
            D +SMN++  +T+  DLN   YA LAIF+ RF + +G   G C+K + L +V  + VW+S
Sbjct  120  DIISMNSVITTTK--DLNDLCYAVLAIFRSRFPKTEGITAGLCMKGQCLPRVVCIHVWQS  177

Query  263  LQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLE  96
            LQ CYS+ILN D+R  ++PYL+  S ++KYDIFRVVYVSG+N ++  +   +R+LE
Sbjct  178  LQFCYSWILNSDHRKWMMPYLERFSTEMKYDIFRVVYVSGDNVVNLPYGSHNRMLE  233



>ref|XP_006364879.1| PREDICTED: uncharacterized protein LOC102587686 [Solanum tuberosum]
Length=193

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 157/195 (81%), Gaps = 8/195 (4%)
 Frame = -1

Query  626  IIWYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYT  447
            ++WYGAWIK+S++ ++D L+ATLLSML+ VSSMAI+LE GF++A+AGE++D +PAAKFYT
Sbjct  1    MVWYGAWIKRSTE-NKDSLAATLLSMLTSVSSMAILLEHGFFDAYAGESKDHSPAAKFYT  59

Query  446  GDTVSMNALSFSTREV-DLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVW  270
            GD VSMN+ SFS  ++  +  F+Y CLAIFKDRF  M+GA  G C KS+ LSKV AVFVW
Sbjct  60   GDIVSMNSASFSHHDIMPIEDFTYTCLAIFKDRFQNMNGAVSGVCFKSQQLSKVAAVFVW  119

Query  269  RSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLES-  93
            +SLQ CYSYILN D R SVLPY DG SLD+KYD+F+VVYVSG++A++FH FPPH++LE  
Sbjct  120  KSLQCCYSYILNQDSR-SVLPYFDGFSLDLKYDVFKVVYVSGDSALNFHIFPPHKMLEGK  178

Query  92   ----NGVHDSNKVAD  60
                N  H+ N++++
Sbjct  179  QGLHNVAHELNRISE  193



>emb|CBI30947.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 166/223 (74%), Gaps = 3/223 (1%)
 Frame = -1

Query  734  IVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLIIWYGAWIKKSSDKDRDLLSATLL  555
            +V+VD L+D LK FSSSTE++GCVHS+IFRSIHG++IIWYGAW+K+SS+ +++ L A  L
Sbjct  2    VVVVDDLIDALKLFSSSTESMGCVHSSIFRSIHGNMIIWYGAWMKRSSE-NKEFLHAAFL  60

Query  554  SMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSYA  375
             ML+ VSSMAI+ +  F++A+AGE++DG PAAKF TG  +S+   + ++  +D    S+A
Sbjct  61   QMLTNVSSMAILADHSFFDAYAGESKDGFPAAKFSTGGIISIGTAALASDNLD--ELSHA  118

Query  374  CLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDG  195
             LA+FK  F +M+GA  G CL+     +V  +FVW+SL +CYS+ILN DYR++VLPYL+ 
Sbjct  119  NLALFKAYFQKMEGAISGVCLRCEMSPRVACLFVWKSLHACYSWILNTDYRATVLPYLNR  178

Query  194  MSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNGVHDSNKV  66
            ++ DIK+DIFRV+YVS +N   F + PP ++LE+ G    +KV
Sbjct  179  LTPDIKFDIFRVLYVSDDNVPSFQYLPPQQMLENGGGSKQDKV  221



>ref|XP_009767389.1| PREDICTED: uncharacterized protein LOC104218562 [Nicotiana sylvestris]
Length=194

 Score =   246 bits (627),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 157/197 (80%), Gaps = 11/197 (6%)
 Frame = -1

Query  626  IIWYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYT  447
            ++WYGAWIK+SS+ ++DLL A LLSML+ VSSMAI++E GFY+A+AGE++D +PAAKFYT
Sbjct  1    MVWYGAWIKRSSE-NKDLLDA-LLSMLTNVSSMAILMEHGFYDAYAGESKDHSPAAKFYT  58

Query  446  GDTVSMNALSFSTREVDL--NRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFV  273
            GD VSMN+ + S+   D+    FSY CLAIFKDRF +MDGA  G CLK + + KV A+FV
Sbjct  59   GDIVSMNSAASSSHHHDMPIEHFSYTCLAIFKDRFQKMDGAVAGVCLKCQTIPKVAAIFV  118

Query  272  WRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLE-  96
            W+SLQ CY+YILN D R SVLPY DG SLD+KYD+F+VVYVSG+ A++FHF+PPH++LE 
Sbjct  119  WKSLQCCYNYILNQDSR-SVLPYFDGFSLDLKYDVFKVVYVSGDGALNFHFYPPHKMLEG  177

Query  95   SNGVHDS-----NKVAD  60
              G+H++     N+VA+
Sbjct  178  KEGLHNNVTQELNRVAE  194



>gb|KEH20520.1| hypothetical protein MTR_8g079475 [Medicago truncatula]
Length=248

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 173/238 (73%), Gaps = 5/238 (2%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            + C I F++++L++SFF+F+PT+VIVD+L+  +K FSS  E LGCV S+I +SIHG++II
Sbjct  2    VTCCIDFSNKDLEISFFVFKPTVVIVDRLIHEIKQFSSRAENLGCVQSSILKSIHGNMII  61

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            W+GAW K+S D ++D L+A LLS+L  V+ MA+++E  F  A+AGE+RDG+    F TGD
Sbjct  62   WFGAWQKRSYD-EKDKLTADLLSILIHVTRMAVLVEHYFLNAYAGESRDGSSTINFSTGD  120

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
             +SMN++  + +  DLN   YA LAIF+ RF ++ G   G CLK + L  V  + VW+SL
Sbjct  121  IISMNSILTNIK--DLNDLCYAILAIFRSRFSQIQGKNSGLCLKGQKLPNVVCIHVWKSL  178

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLD-IKYDIFRVVYVSGENAMDFHF-FPPHRLLES  93
            Q CYS+ILN DYR+ ++PYL+  S++ +KYDIFRVVYVSG+N ++  + +  H +LE+
Sbjct  179  QFCYSWILNPDYRNWMIPYLERFSINMMKYDIFRVVYVSGDNIVNLPYDYNVHEMLEN  236



>ref|XP_007214788.1| hypothetical protein PRUPE_ppa015981mg, partial [Prunus persica]
 gb|EMJ15987.1| hypothetical protein PRUPE_ppa015981mg, partial [Prunus persica]
Length=286

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = -1

Query  755  FFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLIIWYGAWIKKSSDKDRD  576
             F  +PT+V+VD L++ LK FS  TE+LGCV S+I +SIHG++IIW+GAW+K+S + ++D
Sbjct  82   IFSSKPTVVLVDDLLNALKQFSLCTESLGCVQSSILQSIHGNMIIWFGAWLKRSCE-NKD  140

Query  575  LLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVD  396
             L+A+LLSML+ +SSMAI+LE  F++A+AGE+RDG+ AAKF  GDTVSM+    +    D
Sbjct  141  SLTASLLSMLTNMSSMAILLEHSFFDAYAGESRDGSCAAKFCRGDTVSMSTAVVNGG--D  198

Query  395  LNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSS  216
            +N  SYACLA+FK  F +M+G   G CLK +   ++ ++FVW+SLQ CYS+ILN D R +
Sbjct  199  MNNVSYACLAMFKSGFQKMEGVAAGVCLKCQTKPRIASLFVWKSLQCCYSWILNSDQRKA  258

Query  215  VLPYLDGMSLDIKYDIFRVVYVSGEN  138
            +LPYL+ +S++IKYDIFRVVYVSG+N
Sbjct  259  MLPYLESVSIEIKYDIFRVVYVSGDN  284



>ref|XP_009385193.1| PREDICTED: uncharacterized protein LOC103972565 [Musa acuminata 
subsp. malaccensis]
Length=237

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/238 (45%), Positives = 166/238 (70%), Gaps = 3/238 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M CF+PF+++ LD+SFF FRPT V  D+L+D +K+FS   E LGCV+S++ RSIHG++I+
Sbjct  1    MPCFVPFDNKKLDVSFFAFRPTGVFADELIDAVKYFSFHAEDLGCVYSSVLRSIHGNMIV  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW+++S D +R +L+  LLS+L  VS+M ++L  GF+EAF GE++DG+  AKF +GD
Sbjct  61   WYGAWLRRSPD-NRKMLNDALLSVLEEVSTMGVLLHHGFFEAFFGESKDGSSLAKFSSGD  119

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            T+ ++A++ + R  D+   SYACLA+ K  F + DG      L+      V A+ VW+SL
Sbjct  120  TIFLSAMASTPR--DVADLSYACLALHKTFFAKTDGLSADVHLRCNDQPVVAALMVWKSL  177

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLESNG  87
             +CYS++L  DYR+++LPY   +S D ++D+F+VVYV+ +  ++   FPP  +   +G
Sbjct  178  HACYSWLLRSDYRNTILPYFSHLSQDAQFDVFKVVYVNRDEILNVSPFPPRTIGGGDG  235



>gb|AES64118.2| hypothetical protein MTR_2g018670 [Medicago truncatula]
Length=191

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = -1

Query  629  LIIWYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFY  450
            LIIWYGAW +K S K+++LL+ TL SML+ VS+MA ++E  F EA+AGE+RDG+  AKF 
Sbjct  3    LIIWYGAW-QKQSTKEKELLTLTLKSMLTKVSTMAKLIEHSFLEAYAGESRDGSSTAKFS  61

Query  449  TGDTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVW  270
            TGD +S+N+   ++R+ DLN  SYA LA+F+ RF +M+G   G CLK ++   V  + VW
Sbjct  62   TGDILSINSAGTNSRD-DLNDLSYAVLALFRSRFAKMEGMTSGLCLKGQSRPIVVCIHVW  120

Query  269  RSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLES  93
            +SL  CYS+ILN D+R  ++PYL+  ++D+KYDIF+VVYVSG+N +D ++   H++LE+
Sbjct  121  KSLHFCYSWILNSDHRKWMMPYLEKFAIDMKYDIFKVVYVSGDNVVDVNYISHHQMLEN  179



>gb|KGN65879.1| hypothetical protein Csa_1G536320 [Cucumis sativus]
Length=242

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 149/222 (67%), Gaps = 4/222 (2%)
 Frame = -1

Query  788  IPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLIIWYGA  609
            + FND+ + +SF +F+P +++VD  V+ LK FS ST  LGC+ + + +SIHG++IIW G 
Sbjct  5    VGFNDKEIYVSFVVFKPMVLVVDDFVEALKQFSFSTNNLGCIQNCVLKSIHGNMIIWCGI  64

Query  608  WIKKSSDKDRDLLSATLL-SMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDTVS  432
            W KK   ++  LLS TLL +M+S  S+MA +L+  F+EA+ GE+ DG+  AKF +     
Sbjct  65   WTKKLI-QNPQLLSETLLQTMISKTSNMATLLDLSFFEAYGGESMDGSCVAKFTS--KSI  121

Query  431  MNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSC  252
            ++ +S + +  D+N  SYACLAIFK RF +++G   G CLKS+    V ++ VW S   C
Sbjct  122  ISMISIAAKCGDINDLSYACLAIFKSRFRKIEGVNSGICLKSQNRPTVVSLHVWNSPFYC  181

Query  251  YSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDF  126
            YS+ILN D+ +S+LPYLD  SL IKYDI++VV +S  N  +F
Sbjct  182  YSWILNSDHLNSMLPYLDHFSLCIKYDIYQVVNISDANVPNF  223



>ref|XP_006597508.1| PREDICTED: uncharacterized protein LOC100795398 isoform X2 [Glycine 
max]
Length=208

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 133/190 (70%), Gaps = 4/190 (2%)
 Frame = -1

Query  638  HGSLIIWYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAA  459
            H S+IIWYGAW ++SS K+++ L++TL SML+ +SSMA+++E  F EA+ GE+RDG+  A
Sbjct  17   HCSMIIWYGAWQRRSS-KEKEELTSTLKSMLTSISSMAVLIEHSFLEAYGGESRDGSSTA  75

Query  458  KFYTGDTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAV  279
            KF TGD +S+N+   +T   DLN   YA LAI + RF +M+G   G C K ++  +V  +
Sbjct  76   KFSTGDIISLNSAVTTTN--DLNDLCYAVLAILRSRFAKMEGITAGLCFKGQSKPRVVCI  133

Query  278  FVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLL  99
             VW+SL  CY +ILN D+R  ++PYL+  S+D+KYDIFRVVYVSG+N +D +    H++L
Sbjct  134  HVWKSLHFCYCWILNSDHRKWMMPYLERFSIDMKYDIFRVVYVSGDNVVDLNCISTHQML  193

Query  98   ESNGVHDSNK  69
            E NG   S +
Sbjct  194  E-NGNESSRQ  202



>ref|XP_008444703.1| PREDICTED: uncharacterized protein LOC103487959 [Cucumis melo]
Length=237

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 145/222 (65%), Gaps = 2/222 (1%)
 Frame = -1

Query  788  IPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLIIWYGA  609
            + FND+ + +SF +F+P +++VD  V+ LK FS ST  LGC+ + + +SIHG++IIW G 
Sbjct  5    VGFNDKEIYVSFVVFKPMVLVVDDFVEALKQFSFSTNNLGCIQNCVLKSIHGNMIIWCGI  64

Query  608  WIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSM  429
            W K+S    + L    L +++S  S+MA +L+  F+EA+ GE+ DG+  AKF +     +
Sbjct  65   WAKRSIQSPQLLSERLLQTVISKTSNMATLLDLSFFEAYGGESMDGSCVAKFTS--RSII  122

Query  428  NALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCY  249
            + +S + +  D+N  SYACLAIFK RF +++G   G CLKS+    V +++VW S   CY
Sbjct  123  SMISIAAKCGDINDLSYACLAIFKSRFRKIEGINSGICLKSQNRPTVVSLYVWNSPFYCY  182

Query  248  SYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFH  123
            S+ILN D+ +S+LPYLD  SL IKYDI++VV VS  N   F 
Sbjct  183  SWILNSDHLNSMLPYLDRFSLCIKYDIYQVVNVSDANVSKFK  224



>ref|XP_003542956.1| PREDICTED: uncharacterized protein LOC100800652 isoform 2 [Glycine 
max]
Length=208

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 133/190 (70%), Gaps = 4/190 (2%)
 Frame = -1

Query  638  HGSLIIWYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAA  459
            H  +IIWYGAW ++SS K+++ L++TL SMLS +SSMA+++E  F EA+ GE+RDG+  A
Sbjct  17   HCFMIIWYGAWQRRSS-KEKEELTSTLKSMLSNISSMAVLIEHSFLEAYGGESRDGSSTA  75

Query  458  KFYTGDTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAV  279
            KF TGD +S+N+   +T   DLN   YA LAI + RF +M+G   G C K ++  +V  +
Sbjct  76   KFSTGDIISLNSAVTTTN--DLNDLCYAVLAILRSRFAKMEGITAGLCFKGQSKPRVVCI  133

Query  278  FVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLL  99
             VW+SL  CYS+ILN D+R+ ++PYL+  S+++KYDIFRVVYV G+N +D +    H++L
Sbjct  134  HVWKSLHFCYSWILNSDHRNWMMPYLERFSINMKYDIFRVVYVRGDNVVDLNCISTHQML  193

Query  98   ESNGVHDSNK  69
            E NG   S +
Sbjct  194  E-NGKESSRQ  202



>ref|XP_006836353.1| hypothetical protein AMTR_s00092p00107280 [Amborella trichopoda]
 gb|ERM99206.1| hypothetical protein AMTR_s00092p00107280 [Amborella trichopoda]
Length=238

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 148/234 (63%), Gaps = 3/234 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            M CFIPF++ NL ++FF F+P      +LVD LK FS  +E LGC ++A+F+SIHG+L++
Sbjct  1    MPCFIPFSNNNLQITFFAFKPHGGCGAELVDSLKRFSFWSEALGCAYAAVFKSIHGNLVV  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSMLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGD  441
            WYGAW K+S+D+        + ++L   S  A IL+ G ++   GE++DG PA+KF +GD
Sbjct  61   WYGAWTKRSADQGEIANIPLVQALLRSASHQATILDTGLFQVCFGESKDGIPASKFSSGD  120

Query  440  TVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSL  261
            TVS++ L F+  + +L   +Y C+A+ K  F  ++G    +CL S    KV  + VW+SL
Sbjct  121  TVSIHML-FTGLD-NLYNLTYGCMALAKSYFSNVEGVSSASCLSSLDNPKVLCLHVWKSL  178

Query  260  QSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLL  99
              CYS++L  D  +++ P +  +  DIKYD+F+VVYV G+  M  + +P   LL
Sbjct  179  DMCYSWLLGLDGGTTMRPLISHLVKDIKYDVFKVVYVMGDEIMCLN-YPSGPLL  231



>ref|XP_007159378.1| hypothetical protein PHAVU_002G233300g [Phaseolus vulgaris]
 gb|ESW31372.1| hypothetical protein PHAVU_002G233300g [Phaseolus vulgaris]
Length=209

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 130/189 (69%), Gaps = 5/189 (3%)
 Frame = -1

Query  638  HGSLIIWYGAWIKKSSDKDRDLLSATLLSMLSG-VSSMAIILEQGFYEAFAGEARDGTPA  462
            H  +IIWYGAW ++SS K+++ L++TL +ML+  +S+M ++++  F EA+ GE+RDG+  
Sbjct  17   HCFMIIWYGAWPRQSS-KEKEELTSTLKTMLTNSISTMGVLIDHSFLEAYGGESRDGSST  75

Query  461  AKFYTGDTVSMNALSFSTREVDLNRFSYACLAIFKDRFLRMDGAKGGACLKSRALSKVCA  282
            AKF TGD +S+N+   +T   DLN   YA LAI + RF +M+G   G C K ++  ++  
Sbjct  76   AKFSTGDIISLNSAVTTTN--DLNDLCYAVLAILRSRFAKMEGTISGLCFKGQSKPRMVC  133

Query  281  VFVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFRVVYVSGENAMDFHFFPPHRL  102
            + VW+SL  CYS+ILN D R  ++PYL+  S+++KYDIFRVVYVSG+N +DF+    H+ 
Sbjct  134  IHVWKSLHFCYSWILNSDQRKWMMPYLERFSIEMKYDIFRVVYVSGDNVVDFNCISTHQK  193

Query  101  LESNGVHDS  75
            LE NG   S
Sbjct  194  LE-NGKESS  201



>gb|KEH36684.1| hypothetical protein MTR_2g018670 [Medicago truncatula]
Length=164

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = -1

Query  551  MLSGVSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSYAC  372
            ML+ VS+MA ++E  F EA+AGE+RDG+  AKF TGD +S+N+   ++R+ DLN  SYA 
Sbjct  1    MLTKVSTMAKLIEHSFLEAYAGESRDGSSTAKFSTGDILSINSAGTNSRD-DLNDLSYAV  59

Query  371  LAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDGM  192
            LA+F+ RF +M+G   G CLK ++   V  + VW+SL  CYS+ILN D+R  ++PYL+  
Sbjct  60   LALFRSRFAKMEGMTSGLCLKGQSRPIVVCIHVWKSLHFCYSWILNSDHRKWMMPYLEKF  119

Query  191  SLDIKYDIFRVVYVSGENAMDFHFFPPHRLLES  93
            ++D+KYDIF+VVYVSG+N +D ++   H++LE+
Sbjct  120  AIDMKYDIFKVVYVSGDNVVDVNYISHHQMLEN  152



>ref|XP_003593867.1| hypothetical protein MTR_2g018670 [Medicago truncatula]
Length=157

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 106/146 (73%), Gaps = 1/146 (1%)
 Frame = -1

Query  530  MAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSYACLAIFKDR  351
            MA ++E  F EA+AGE+RDG+  AKF TGD +S+N+   ++R+ DLN  SYA LA+F+ R
Sbjct  1    MAKLIEHSFLEAYAGESRDGSSTAKFSTGDILSINSAGTNSRD-DLNDLSYAVLALFRSR  59

Query  350  FLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYD  171
            F +M+G   G CLK ++   V  + VW+SL  CYS+ILN D+R  ++PYL+  ++D+KYD
Sbjct  60   FAKMEGMTSGLCLKGQSRPIVVCIHVWKSLHFCYSWILNSDHRKWMMPYLEKFAIDMKYD  119

Query  170  IFRVVYVSGENAMDFHFFPPHRLLES  93
            IF+VVYVSG+N +D ++   H++LE+
Sbjct  120  IFKVVYVSGDNVVDVNYISHHQMLEN  145



>emb|CAN78178.1| hypothetical protein VITISV_006271 [Vitis vinifera]
Length=164

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -1

Query  530  MAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSYACLAIFKDR  351
            MAI+ +  F++A+AGE++DG PAAKF TG  +S+   + ++  +D    S+A LA+FK  
Sbjct  1    MAILADHSFFDAYAGESKDGFPAAKFSTGGIISIGTAALASNNLD--ELSHANLALFKAY  58

Query  350  FLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYD  171
            F +M+GA  G CL+     +V  +FVW+SL +CYS+ILN DYR++VLPYL+ ++ DIK+D
Sbjct  59   FQKMEGAISGVCLRYEMSPRVACLFVWKSLHACYSWILNTDYRATVLPYLNRLTPDIKFD  118

Query  170  IFRVVYVSGENAMDFHFFPPHRLLESNGVHDSNKV  66
            IFRV+YVS +N   F + PP ++LE+ G    +KV
Sbjct  119  IFRVLYVSDDNVPSFQYLPPQQMLENGGGSKQDKV  153



>gb|KHN12432.1| NIPA-like protein [Glycine soja]
Length=1191

 Score =   160 bits (406),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -1

Query  554   SMLSG-VSSMAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSY  378
             SML+  V+ MA+++E  F +A+AGE+RDG+ A KF TGD +SMN++  +T+  DLN   Y
Sbjct  1027  SMLTNTVTRMAVLVEHNFLDAYAGESRDGSLAVKFSTGDIISMNSVVTTTK--DLNDLCY  1084

Query  377   ACLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLD  198
             A LAIF+ RF + +G   G C+K + L +V  + VW+SLQ CYS+ILN D+R  ++PYL+
Sbjct  1085  AVLAIFRSRFPKTEGITSGLCMKGQCLPRVVCIHVWQSLQFCYSWILNSDHRKWMMPYLE  1144

Query  197   GMSLDIKYDIFRVVYVSGENAMDFHFFPPHRLLE  96
               S ++K+DIFRVVYVS EN M+  +  PHR+LE
Sbjct  1145  RFSTEMKHDIFRVVYVSDENVMNVPYDSPHRMLE  1178



>ref|XP_002317289.1| hypothetical protein POPTR_0011s02480g [Populus trichocarpa]
 gb|EEE97901.1| hypothetical protein POPTR_0011s02480g [Populus trichocarpa]
Length=151

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -1

Query  530  MAIILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSYACLAIFKDR  351
            MAI++E GF++A+AGE+RD + AA+  T DT+SM+ +  S +  D+N  SYA LA+FK +
Sbjct  1    MAILIEHGFFDAYAGESRDDSSAARLCTEDTISMSII-VSQKADDINDLSYANLALFKSQ  59

Query  350  FLRMDGAKGGACL--KSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIK  177
            FL+M+GA  G CL  KS    +V  ++VW+SL+ CYS+ILN DYR ++LPYL+  S  IK
Sbjct  60   FLKMEGANSGVCLTCKSVQQPRVACLYVWKSLRFCYSWILNSDYRRTILPYLERFSFVIK  119

Query  176  YDIFRVVYVSGENA  135
            YD+FR++  + E A
Sbjct  120  YDMFRIMLKNEEEA  133



>gb|KHN38159.1| hypothetical protein glysoja_007201 [Glycine soja]
Length=129

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = -1

Query  551  MLSGVSSMAI-ILEQGFYEAFAGEARDGTPAAKFYTGDTVSMNALSFSTREVDLNRFSYA  375
            + + V+ MA+ ++E  F +A+AGE+RDG+ A KF TGD +SMN++  +T+  DLN   YA
Sbjct  2    LTNNVTRMAVLVVEHNFLDAYAGESRDGSLAVKFSTGDIISMNSVVTTTK--DLNDQCYA  59

Query  374  CLAIFKDRFLRMDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDG  195
             LAIF+ RF + +G   G C+K + L +V  + VW+SLQ CYS+IL+ D+R  ++PYL+ 
Sbjct  60   VLAIFRSRFPKTEGITSGLCMKGQCLPRVVCIHVWQSLQFCYSWILSSDHRKWMMPYLER  119

Query  194  MSLDIKYDIF  165
             S ++K+DIF
Sbjct  120  FSTEMKHDIF  129



>ref|XP_006377239.1| hypothetical protein POPTR_0011s02500g [Populus trichocarpa]
 gb|ERP55036.1| hypothetical protein POPTR_0011s02500g [Populus trichocarpa]
Length=95

 Score =   122 bits (305),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLII  621
            MACF+PFN+RNL+ SFFIFRP + +VD+LV+ LKHFS+ TE+LGCV S+IF+SIHG++II
Sbjct  1    MACFVPFNNRNLETSFFIFRPIVALVDELVETLKHFSACTESLGCVQSSIFKSIHGNMII  60

Query  620  WYGAWIKKSSDKDRDLLSATLLSML  546
            WYGAW+KKS + ++++L+  L+S +
Sbjct  61   WYGAWMKKSCE-NKEVLTGELVSWI  84



>gb|ACU18132.1| unknown [Glycine max]
Length=69

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  800  MACFIPFNDRNLDLSFFIFRPTIVIVDQLVDYLKHFSSSTETLGCVHSAIFRSIHGSLI  624
            MAC +PFN++NLD+SFF+F+PTIVI+D LV  LKHFS +TE+LGCV S+IFRSIHG+++
Sbjct  1    MACSVPFNNKNLDISFFVFKPTIVIIDDLVHGLKHFSLTTESLGCVQSSIFRSIHGNMV  59



>gb|ACU20257.1| unknown [Glycine max]
Length=96

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/91 (45%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = -1

Query  341  MDGAKGGACLKSRALSKVCAVFVWRSLQSCYSYILNDDYRSSVLPYLDGMSLDIKYDIFR  162
            M+G   G C K ++  +V  + VW+SL  CYS+ILN D+R+ ++PYL+  S+++KYDIFR
Sbjct  1    MEGITAGLCFKGQSKPRVVCIHVWKSLHFCYSWILNSDHRNWMMPYLERFSINMKYDIFR  60

Query  161  VVYVSGENAMDFHFFPPHRLLESNGVHDSNK  69
            VVYV G+N +D +    H++LE NG   S +
Sbjct  61   VVYVRGDNVVDLNCISTHQMLE-NGKESSRQ  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2257883981626