BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29569_g1_i1 len=1351 path=[1329:0-1350]

Length=1351
                                                                      Score     E

ref|XP_004237537.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    365   2e-120   
ref|XP_009758973.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    360   4e-118   
ref|XP_009594014.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    358   4e-117   
ref|XP_004236813.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    343   1e-111   
ref|XP_006359345.1|  PREDICTED: cardiolipin synthase-like               341   1e-110   
ref|XP_009619577.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    335   2e-108   
emb|CDP04339.1|  unnamed protein product                                314   1e-101   
gb|EYU39573.1|  hypothetical protein MIMGU_mgv1a010238mg                305   2e-96    
ref|XP_011077013.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    299   5e-94    
gb|EYU39806.1|  hypothetical protein MIMGU_mgv1a009906mg                297   2e-93    
ref|XP_010937763.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    298   3e-93    
ref|XP_011084377.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    296   7e-93    
ref|XP_010101500.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    296   9e-93    
ref|XP_006411155.1|  hypothetical protein EUTSA_v10016968mg             291   2e-91    
gb|KHG03988.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    291   2e-91    
ref|XP_006294709.1|  hypothetical protein CARUB_v10023748mg             287   4e-90    
ref|XP_002879790.1|  predicted protein                                  287   5e-90    
ref|XP_007009648.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    288   8e-90    
emb|CDY24971.1|  BnaC03g22010D                                          286   3e-89    
gb|ACL53831.1|  unknown                                                 283   4e-89    Zea mays [maize]
ref|NP_181461.1|  phosphatidylglycerolphosphate synthase 1              285   4e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292231.1|  hypothetical protein CARUB_v10018438mg             282   6e-89    
ref|XP_010260128.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    285   7e-89    
ref|XP_011027060.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    286   8e-89    
ref|XP_008384323.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    286   1e-88    
gb|EEE58822.1|  hypothetical protein OsJ_10391                          281   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004163469.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    281   1e-88    
ref|XP_006436175.1|  hypothetical protein CICLE_v10031930mg             286   1e-88    
ref|XP_002316331.1|  hypothetical protein POPTR_0010s22200g             281   2e-88    Populus trichocarpa [western balsam poplar]
dbj|BAD43832.1|  putative CDP-diacylglycerol--glycerol-3- phospha...    283   2e-88    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA44780.1|  TPA: CDP-diacylglycerol--glycerol-3-phosphate 3-...    283   3e-88    
ref|XP_009357618.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    285   3e-88    
ref|NP_001147695.1|  LOC100281305                                       283   3e-88    Zea mays [maize]
emb|CDY07659.1|  BnaA03g18520D                                          283   3e-88    
ref|NP_001151070.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    283   6e-88    Zea mays [maize]
emb|CBI25325.3|  unnamed protein product                                279   9e-88    
ref|XP_002876283.1|  hypothetical protein ARALYDRAFT_906919             279   1e-87    
ref|XP_003558189.1|  PREDICTED: cardiolipin synthase, mitochondri...    282   1e-87    
ref|XP_006403499.1|  hypothetical protein EUTSA_v10010682mg             279   1e-87    
ref|XP_010516058.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    278   2e-87    
ref|XP_009133353.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    281   2e-87    
ref|XP_010509037.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    280   2e-87    
ref|NP_001240075.1|  uncharacterized protein LOC100779345               277   3e-87    
ref|XP_010504341.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    278   3e-87    
ref|XP_009144774.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    279   3e-87    
gb|KHN03200.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    277   4e-87    
gb|AFW88763.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    281   4e-87    
emb|CDX73415.1|  BnaC08g25880D                                          276   1e-86    
ref|NP_191063.1|  phosphatidylglycerolphosphate synthase 2              276   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517266.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    279   1e-86    
ref|XP_010427243.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    276   1e-86    
ref|XP_002281544.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    280   2e-86    Vitis vinifera
ref|XP_010556265.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    277   3e-86    
ref|XP_010505596.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    278   3e-86    
ref|XP_009139204.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    275   4e-86    
emb|CDY02903.1|  BnaC04g25830D                                          275   4e-86    
ref|XP_010032250.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    275   4e-86    
emb|CDX77586.1|  BnaA07g07240D                                          276   5e-86    
ref|XP_010253445.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    279   5e-86    
ref|XP_009420343.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    276   6e-86    
ref|XP_009103950.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    274   6e-86    
emb|CDX67621.1|  BnaA07g16610D                                          274   7e-86    
ref|XP_004143599.1|  PREDICTED: uncharacterized protein LOC101221229    279   7e-86    
ref|XP_008445828.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    278   2e-85    
ref|XP_002525055.1|  cdp-diacylglycerol--glycerol-3-phosphate 3-p...    276   5e-85    Ricinus communis
ref|XP_008233394.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    277   5e-85    
ref|XP_007218141.1|  hypothetical protein PRUPE_ppa007257mg             276   1e-84    
ref|XP_009116201.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    270   2e-84    
ref|XP_002311126.2|  hypothetical protein POPTR_0008s04650g             275   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_004307437.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    270   3e-84    
emb|CDY07505.1|  BnaC06g15590D                                          270   4e-84    
emb|CDY51439.1|  BnaA09g54840D                                          269   6e-84    
ref|XP_007139084.1|  hypothetical protein PHAVU_008G000300g             269   6e-84    
ref|XP_004497372.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    271   8e-84    
ref|XP_007139087.1|  hypothetical protein PHAVU_008G000300g             268   9e-84    
ref|XP_011012888.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    272   3e-83    
gb|ACZ51242.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phospha...    270   4e-83    
ref|XP_009412608.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    271   7e-83    
ref|XP_004984797.1|  PREDICTED: cardiolipin synthase-like               270   9e-83    
ref|XP_003592809.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-ph...    268   2e-82    
ref|XP_009410588.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    266   3e-82    
ref|XP_008369841.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    270   3e-82    
ref|XP_002875816.1|  hypothetical protein ARALYDRAFT_485066             267   3e-82    
ref|XP_006651264.1|  PREDICTED: uncharacterized protein LOC102712153    266   3e-82    
gb|KEH21444.1|  phosphatidylglycerolphosphate synthase                  264   4e-82    
gb|AES77193.2|  phosphatidylglycerolphosphate synthase                  264   5e-82    
ref|XP_010534442.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    269   5e-82    
gb|EEC74996.1|  hypothetical protein OsI_11056                          267   7e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001049756.1|  Os03g0283600                                       267   9e-82    Oryza sativa Japonica Group [Japonica rice]
gb|AFK45194.1|  unknown                                                 265   1e-81    
ref|XP_009410587.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    264   2e-81    
gb|KDP46136.1|  hypothetical protein JCGZ_06647                         266   5e-81    
ref|XP_007142655.1|  hypothetical protein PHAVU_007G005600g             261   3e-80    
gb|KHN37289.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    262   3e-80    
ref|XP_003536794.1|  PREDICTED: probable cardiolipin synthase           262   3e-80    
ref|XP_007142654.1|  hypothetical protein PHAVU_007G005600g             261   9e-80    
ref|XP_002465438.1|  hypothetical protein SORBIDRAFT_01g038850          261   1e-79    Sorghum bicolor [broomcorn]
ref|XP_010067242.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    262   1e-79    
ref|XP_004515576.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    258   3e-79    
ref|XP_004515577.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    257   4e-79    
ref|XP_008795292.1|  PREDICTED: cardiolipin synthase, mitochondri...    256   5e-79    
ref|XP_010693113.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    261   9e-79    
gb|ABA55724.1|  phosphatidylglycerolphosphate synthase                  257   2e-78    Vigna unguiculata
ref|XP_010922478.1|  PREDICTED: cardiolipin synthase, mitochondri...    258   2e-78    
gb|ABR17104.1|  unknown                                                 258   3e-78    Picea sitchensis
ref|XP_008783647.1|  PREDICTED: cardiolipin synthase, mitochondri...    254   9e-78    
ref|XP_006828262.1|  hypothetical protein AMTR_s00023p00206380          252   4e-76    
emb|CDY06996.1|  BnaA04g23190D                                          245   2e-74    
ref|XP_009142136.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    240   1e-72    
gb|EMT16898.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    238   1e-71    
gb|KHG18040.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    235   8e-71    
ref|XP_001763508.1|  predicted protein                                  230   1e-68    
gb|ABV57771.1|  phosphatidylglycerolphosphate synthase                  223   3e-67    Gossypium hirsutum [American cotton]
ref|XP_001752025.1|  predicted protein                                  220   2e-65    
ref|XP_010922479.1|  PREDICTED: cardiolipin synthase, mitochondri...    216   9e-63    
ref|XP_008783648.1|  PREDICTED: cardiolipin synthase, mitochondri...    211   2e-61    
emb|CDX93276.1|  BnaC04g46200D                                          205   2e-59    
ref|XP_008783649.1|  PREDICTED: cardiolipin synthase, mitochondri...    197   2e-56    
gb|KFK34751.1|  hypothetical protein AALP_AA5G188400                    194   5e-56    
ref|XP_002954076.1|  hypothetical protein VOLCADRAFT_44897              196   5e-56    
ref|XP_002980380.1|  hypothetical protein SELMODRAFT_112501             194   3e-55    
ref|XP_002962711.1|  hypothetical protein SELMODRAFT_78503              194   4e-55    
ref|XP_007009651.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    193   7e-54    
ref|XP_007009650.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    191   2e-53    
ref|XP_007139085.1|  hypothetical protein PHAVU_008G000300g             186   1e-52    
tpg|DAA44779.1|  TPA: hypothetical protein ZEAMMB73_859058              186   2e-51    
ref|XP_009776593.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    181   4e-50    
ref|XP_007512284.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    181   1e-49    
ref|XP_001420685.1|  predicted protein                                  176   6e-48    Ostreococcus lucimarinus CCE9901
ref|XP_008789016.1|  PREDICTED: cardiolipin synthase, mitochondri...    170   2e-46    
gb|AFK38258.1|  unknown                                                 167   4e-45    
ref|XP_006485967.1|  PREDICTED: uncharacterized protein LOC102607...    170   4e-45    
ref|XP_002507590.1|  cdp-alcohol phosphatidyltransferase                167   1e-44    Micromonas commoda
ref|WP_028836375.1|  hypothetical protein                               163   9e-44    
gb|EPS58151.1|  hypothetical protein M569_16665                         160   1e-43    
emb|CEF99950.1|  CDP-alcohol phosphatidyltransferase                    155   5e-40    
ref|WP_004582357.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    147   5e-38    
gb|KGU82702.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    146   9e-38    
emb|CDF94907.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosp...    146   1e-37    
ref|WP_010221879.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    145   2e-37    
ref|WP_015277053.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    146   2e-37    
ref|WP_009394220.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    145   2e-37    
ref|WP_038995609.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    145   2e-37    
ref|WP_038612268.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    145   3e-37    
ref|WP_003208929.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    145   3e-37    
ref|XP_009792385.1|  PREDICTED: CDP-diacylglycerol--glycerol-3-ph...    141   4e-37    
ref|WP_013982772.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    145   4e-37    
ref|WP_011913222.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    145   4e-37    
ref|WP_014820260.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   5e-37    
ref|WP_024781215.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   5e-37    
ref|WP_003300236.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    144   5e-37    
ref|WP_003284952.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   6e-37    
gb|AHL75612.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    144   7e-37    
ref|WP_025112503.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   7e-37    
dbj|BAP44729.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phosph...    144   7e-37    
ref|WP_028302328.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   7e-37    
gb|EXF92857.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    145   7e-37    
ref|WP_027603207.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   8e-37    
ref|WP_034119069.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   8e-37    
ref|WP_003182757.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   8e-37    
ref|WP_003232771.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    144   8e-37    
ref|WP_003225417.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    144   9e-37    
gb|AIS18150.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    144   9e-37    
ref|WP_038660282.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    144   1e-36    
ref|WP_003445025.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    144   1e-36    
ref|WP_003200282.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    144   1e-36    
ref|WP_008080159.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    143   1e-36    
gb|KGK84840.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    143   1e-36    
ref|WP_018608070.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    143   1e-36    
ref|WP_032892416.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    143   1e-36    
ref|WP_003190391.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    143   2e-36    
ref|WP_030141409.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    143   2e-36    
ref|WP_017847081.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    143   2e-36    
ref|WP_007965084.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    143   2e-36    
ref|WP_008567753.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   2e-36    
ref|WP_032886611.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   2e-36    
ref|WP_016968866.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   2e-36    
ref|WP_034135291.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   2e-36    
ref|WP_028622707.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   2e-36    
ref|WP_028946102.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   2e-36    
ref|WP_008066866.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   2e-36    
ref|WP_007933765.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   2e-36    
ref|WP_017339130.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_039768771.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_019410046.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_008029556.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   3e-36    
ref|WP_034097260.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_015045696.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_016984200.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_008150904.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   3e-36    
ref|WP_019826345.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   3e-36    
ref|WP_027923802.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   4e-36    
ref|WP_007943517.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   4e-36    
ref|WP_008066654.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   4e-36    
ref|WP_007950102.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   4e-36    
ref|WP_034873950.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   4e-36    
ref|WP_034103764.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   4e-36    
ref|WP_010566013.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   4e-36    
ref|WP_012723427.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   4e-36    
ref|WP_017530524.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   5e-36    
ref|WP_022962632.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    142   5e-36    
gb|AHZ67202.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    142   5e-36    
ref|WP_007896267.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    142   5e-36    
ref|WP_020295155.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   7e-36    
ref|WP_008015882.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   7e-36    
ref|WP_027620323.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   7e-36    
ref|WP_015094913.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   7e-36    
ref|WP_034147143.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   9e-36    
ref|WP_007958898.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    141   1e-35    
ref|WP_020798850.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    141   1e-35    
ref|WP_003291085.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   1e-35    
ref|WP_016781234.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   1e-35    
ref|WP_027979415.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   1e-35    
ref|WP_012970752.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    141   1e-35    
gb|KIH83025.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    140   1e-35    
ref|WP_026013470.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   1e-35    
ref|WP_007992985.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    140   1e-35    
ref|WP_029293776.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    140   1e-35    
ref|WP_008051977.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   1e-35    
ref|WP_034137766.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   2e-35    
ref|WP_007974720.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   2e-35    
ref|WP_036989959.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   2e-35    
ref|WP_022988958.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    140   2e-35    
ref|XP_003055406.1|  predicted protein                                  140   2e-35    
ref|WP_017904511.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   3e-35    
dbj|BAC55221.1|  CDP-diacylglycerol-glycerol-3-phosphate                139   4e-35    Pseudomonas stutzeri
gb|AJE15172.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    139   4e-35    
ref|WP_029653594.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   4e-35    
ref|WP_033699146.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   4e-35    
ref|WP_010211263.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    139   5e-35    
ref|WP_036207967.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   6e-35    
ref|WP_013973364.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    139   6e-35    
gb|EXJ14767.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    139   6e-35    
ref|WP_012273272.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   7e-35    
ref|WP_017639981.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   7e-35    
ref|WP_007161859.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    139   7e-35    
emb|CEA05136.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosp...    139   7e-35    
ref|WP_019361451.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   7e-35    
gb|AHI27936.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    138   7e-35    
ref|WP_037009848.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   7e-35    
gb|AHF67938.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    139   7e-35    
ref|WP_028692524.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    139   7e-35    
ref|WP_031320034.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   8e-35    
ref|WP_004417531.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   9e-35    
gb|EGH44803.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    138   9e-35    
ref|WP_038706385.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
ref|WP_003296391.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
ref|WP_005892534.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
ref|WP_003173108.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
ref|WP_016774513.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
ref|WP_003410850.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
ref|WP_024012763.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    138   1e-34    
gb|EKD72811.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phospha...    138   2e-34    
ref|WP_015271035.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
ref|WP_014421673.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
ref|WP_014852898.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
ref|WP_016711578.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    137   2e-34    
ref|WP_027592792.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
ref|WP_007152304.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
gb|EKD54121.1|  hypothetical protein ACD_60C00121G0005                  138   2e-34    
ref|WP_011784701.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    137   2e-34    
ref|WP_019339070.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
ref|WP_003393964.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   2e-34    
gb|AHD15448.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    137   2e-34    
ref|WP_011534581.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   3e-34    
ref|WP_028696043.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   3e-34    
dbj|BAP79602.1|  CDP-diacylglycerol--glycerol-3-phosphate3-phosph...    137   3e-34    
ref|WP_011588588.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   3e-34    
ref|WP_027898587.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   3e-34    
ref|WP_002553346.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    137   3e-34    
ref|WP_003400851.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   3e-34    
ref|WP_016498771.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   3e-34    
ref|WP_019530248.1|  hypothetical protein                               137   4e-34    
ref|WP_011268070.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    137   4e-34    
ref|WP_021206792.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   4e-34    
ref|WP_039576696.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   4e-34    
ref|WP_011104334.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   4e-34    
ref|WP_017938990.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   4e-34    
ref|WP_017704883.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   4e-34    
ref|WP_010446526.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   4e-34    
ref|WP_008369686.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   5e-34    
ref|WP_005737927.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    136   5e-34    
ref|WP_007040756.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   5e-34    
ref|WP_032679936.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   5e-34    
ref|WP_007924430.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    136   5e-34    
ref|WP_003383314.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   5e-34    
ref|WP_009049612.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   5e-34    
gb|KCU97692.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    136   6e-34    
ref|WP_007249427.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    136   6e-34    
ref|WP_028632295.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   6e-34    
ref|WP_003240624.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   6e-34    
ref|WP_010440491.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   6e-34    
ref|WP_039613116.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    136   7e-34    
ref|WP_010954882.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   7e-34    
ref|WP_004879535.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   8e-34    
ref|WP_023534788.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    135   8e-34    
ref|WP_027831905.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   8e-34    
ref|WP_036191983.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   8e-34    
ref|WP_028626065.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   9e-34    
ref|WP_019470563.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    135   9e-34    
ref|WP_021700221.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_008098037.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_035458672.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_035015149.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_016956776.1|  hypothetical protein                               135   1e-33    
ref|WP_018974338.1|  hypothetical protein                               135   1e-33    
ref|WP_014149891.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_005756268.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_027966641.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_014576959.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_017842182.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_008174472.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   1e-33    
ref|WP_023496107.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   2e-33    
ref|WP_012315213.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   2e-33    
ref|WP_016488197.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   2e-33    
ref|WP_007350091.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   2e-33    
ref|WP_020505089.1|  hypothetical protein                               135   2e-33    
ref|WP_003251374.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   2e-33    
ref|WP_014871103.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   2e-33    
ref|WP_029511181.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   2e-33    
ref|WP_021821071.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   2e-33    
ref|WP_020407262.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    135   2e-33    
ref|WP_021783204.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    134   2e-33    
ref|WP_023381192.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    134   2e-33    
ref|WP_037023052.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   2e-33    
ref|WP_026258390.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   2e-33    
ref|WP_012441793.1|  phosphatidylglycerophosphate synthetase            134   3e-33    
ref|XP_003620975.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-ph...    138   3e-33    
ref|WP_007226875.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   3e-33    
ref|WP_012701082.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   3e-33    
ref|WP_023654689.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-ph...    134   3e-33    
gb|KGD65866.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    134   3e-33    
ref|WP_022956337.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   3e-33    
ref|WP_029885978.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    134   3e-33    
emb|CDF84630.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosp...    134   3e-33    
ref|WP_024688279.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   3e-33    
ref|WP_016391366.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   3e-33    
ref|WP_016914352.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   4e-33    
ref|WP_008938223.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   4e-33    
ref|XP_005848792.1|  hypothetical protein CHLNCDRAFT_51707              135   4e-33    
ref|WP_004169426.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   4e-33    
ref|WP_010130477.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   4e-33    
ref|WP_022996804.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    134   4e-33    
gb|EKD70001.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phospha...    134   4e-33    
ref|WP_007019615.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   5e-33    
ref|WP_039182535.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   5e-33    
ref|WP_020284686.1|  putative phosphatidylglycerophosphate synthase     133   5e-33    
ref|WP_012340218.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   5e-33    
ref|WP_002684813.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   5e-33    
ref|WP_020412939.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   5e-33    
ref|WP_012137354.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   6e-33    
ref|WP_009020604.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   6e-33    
ref|WP_024300026.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   6e-33    
ref|WP_027920568.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   6e-33    
ref|WP_014338708.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   7e-33    
ref|WP_007149445.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    134   7e-33    
ref|WP_011609308.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   7e-33    
ref|WP_010794641.1|  MULTISPECIES: CDP-diacylglycerol-glycerol-3-...    133   8e-33    
ref|WP_028236627.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   9e-33    
ref|WP_024951187.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   1e-32    
ref|WP_035231270.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   1e-32    
ref|WP_024967686.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   1e-32    
ref|WP_008295456.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   1e-32    
ref|WP_027958445.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    132   1e-32    
ref|WP_004157029.1|  phosphatidylglycerophosphate synthetase            132   1e-32    
ref|WP_019866658.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   1e-32    
ref|WP_022522907.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   1e-32    
ref|WP_027147036.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    132   1e-32    
ref|WP_039589536.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   1e-32    
emb|CDK14935.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phosph...    132   1e-32    
ref|WP_013201601.1|  phosphatidylglycerophosphate synthetase            132   2e-32    
ref|WP_039804014.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_036129174.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_009288005.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    133   2e-32    
dbj|BAN69027.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosp...    132   2e-32    
ref|WP_036860465.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_036304433.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_027336167.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_005370186.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_011507431.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    131   2e-32    
ref|WP_027591011.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    132   2e-32    
ref|WP_014994380.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_034843306.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_021218990.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    132   2e-32    
ref|WP_034913951.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    131   2e-32    
ref|WP_011061839.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    131   2e-32    
ref|WP_013791524.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    131   2e-32    
gb|KFM23026.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phospha...    140   2e-32    
ref|WP_025129801.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   3e-32    
ref|WP_005320074.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   3e-32    
ref|WP_006717782.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   3e-32    
ref|WP_030070301.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   3e-32    
ref|WP_007113222.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   3e-32    
ref|WP_018152237.1|  hypothetical protein                               131   3e-32    
ref|WP_012800881.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   3e-32    
ref|WP_016189584.1|  phosphatidylglycerophosphate synthetase            131   4e-32    
ref|WP_033789425.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    131   4e-32    
ref|WP_035583895.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   4e-32    
ref|WP_011200136.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   4e-32    
ref|WP_028023396.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   5e-32    
ref|WP_013817959.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   5e-32    
gb|KGA03364.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    130   5e-32    
ref|WP_006889935.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   5e-32    
ref|WP_034939012.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   6e-32    
ref|WP_023006769.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   6e-32    
ref|WP_014780553.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   6e-32    
ref|WP_027150528.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   6e-32    
ref|WP_005761200.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   6e-32    
ref|WP_027706058.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   6e-32    
gb|KFC87382.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    130   6e-32    
ref|WP_013692726.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   7e-32    
ref|WP_038086611.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   7e-32    
gb|KGL51127.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    130   8e-32    
gb|KFN19295.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    130   8e-32    
gb|KER62229.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    130   8e-32    
ref|WP_034891923.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    130   8e-32    
ref|WP_036774609.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_006118776.1|  MULTISPECIES: phosphatidylglycerophosphate s...    129   1e-31    
ref|WP_039468565.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_028722380.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_009722719.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_010675229.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_007912285.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   1e-31    
ref|WP_035476596.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_020482416.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_026457115.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   1e-31    
ref|WP_005302692.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    129   2e-31    
gb|ERP92791.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    130   2e-31    
ref|WP_010633516.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    129   2e-31    
gb|EHB90767.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-phospha...    130   2e-31    
ref|WP_004421762.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
gb|AHE50098.1|  pgsA product                                            129   2e-31    
ref|WP_005704109.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_017786221.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_033157381.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    129   2e-31    
ref|WP_020290071.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_004094793.1|  MULTISPECIES: phosphatidylglycerophosphate s...    129   2e-31    
ref|WP_031376084.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_013263488.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_024522237.1|  hypothetical protein                               129   2e-31    
ref|WP_026458878.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_038482886.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_033131193.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_007194571.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_011706577.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_026601278.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_028684256.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
emb|CDQ36413.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosp...    129   2e-31    
ref|WP_021182674.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_004723140.1|  phosphatidylglycerophosphate synthetase            129   2e-31    
ref|XP_001701223.1|  phosphatidylglycerophosphate synthase              131   2e-31    
ref|WP_007017749.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_033751087.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_024460117.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_038193901.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_007637313.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    129   2e-31    
ref|WP_012989089.1|  phosphatidylglycerophosphate synthetase            128   3e-31    
gb|AHX61492.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    128   3e-31    
ref|WP_005287119.1|  phosphatidylglycerophosphate synthetase            128   3e-31    
ref|WP_027856453.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_034025971.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_038626895.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_033412268.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_004392860.1|  phosphatidylglycerophosphate synthetase            128   3e-31    
ref|WP_012487407.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_035540894.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_027961440.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   3e-31    
ref|WP_005160174.1|  phosphatidylglycerophosphate synthetase            128   4e-31    
ref|WP_005555649.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   4e-31    
ref|WP_023085315.1|  CDP-diacylglycerol-glycerol-3-phosphate 3-ph...    128   4e-31    
ref|WP_034045969.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   4e-31    
ref|WP_003090349.1|  MULTISPECIES: CDP-diacylglycerol--glycerol-3...    128   4e-31    
ref|WP_021615318.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   4e-31    
ref|WP_024025249.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   4e-31    
ref|WP_027350819.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   4e-31    
ref|WP_015834703.1|  phosphatidylglycerophosphate synthetase            128   4e-31    
ref|WP_024496417.1|  hypothetical protein                               128   5e-31    
ref|WP_013795518.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   5e-31    
ref|WP_008911606.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   5e-31    
ref|WP_015871573.1|  phosphatidylglycerophosphate synthetase            127   5e-31    
ref|WP_008284346.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   5e-31    
ref|WP_017026161.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   5e-31    
ref|WP_012848878.1|  MULTISPECIES: phosphatidylglycerophosphate s...    127   6e-31    
ref|WP_017349781.1|  phosphatidylglycerophosphate synthetase            127   6e-31    
ref|WP_031433195.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   6e-31    
ref|WP_009619678.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   6e-31    
gb|EXJ11384.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-phosph...    127   6e-31    
ref|WP_036510322.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   7e-31    
ref|WP_008842816.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   7e-31    
ref|WP_012668493.1|  phosphatidylglycerophosphate synthetase            127   7e-31    
ref|WP_005577611.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   8e-31    
ref|WP_014543945.1|  phosphatidylglycerophosphate synthetase            127   8e-31    
ref|WP_014539097.1|  phosphatidylglycerophosphate synthetase            127   8e-31    
ref|WP_028669982.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   8e-31    
ref|WP_019080796.1|  MULTISPECIES: phosphatidylglycerophosphate s...    127   8e-31    
ref|WP_015281472.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    128   8e-31    
ref|WP_028293551.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   8e-31    
ref|WP_038633627.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   9e-31    
ref|WP_017490470.1|  phosphatidylglycerophosphate synthetase            127   9e-31    
ref|WP_027696058.1|  CDP-diacylglycerol--glycerol-3-phosphate 3-p...    127   9e-31    



>ref|XP_004237537.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Solanum lycopersicum]
Length=307

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 238/312 (76%), Gaps = 18/312 (6%)
 Frame = +1

Query  73   GALKLHAVVTSIY---SQKPYTWARTISS---AAKSETLRGPAASTPRWRRRIPFPAPVR  234
            G LKL+  + SIY   S KPY W R+ +S      S +    AA+  R+   IP   P  
Sbjct  3    GTLKLNNALASIYYYNSHKPYNWLRSFTSLTGTGISNSSITVAAAHKRYSLYIP---PDG  59

Query  235  GVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDT-----VPSQSDKLLTL  399
              P+ +  LG      +    +RSISTTQMG  PD KE+ L        +PS+S+KLLTL
Sbjct  60   DSPSRRKFLGRLGHGYA----LRSISTTQMGPTPDHKEEDLRREKSSLPIPSKSEKLLTL  115

Query  400  PTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAF  579
            PTILTIGRVAAVPLLV+TFYVDSWWGP ATT IFIAAA+TDWLDGY+ARK  LGTAFGAF
Sbjct  116  PTILTIGRVAAVPLLVTTFYVDSWWGPNATTAIFIAAAVTDWLDGYLARKMNLGTAFGAF  175

Query  580  LDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGS  759
            LDPVADKLMVAATLVLLCT+PLE+  F  +PWLLTVPSIAIIGREITMSAVREWAASQG 
Sbjct  176  LDPVADKLMVAATLVLLCTKPLESGVFGQLPWLLTVPSIAIIGREITMSAVREWAASQGG  235

Query  760  KLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLF  939
            KLSEAVAVNNLGKWKTATQM ALTILL TRDSSL  A +LVGSGV LLYISAWLAVWSLF
Sbjct  236  KLSEAVAVNNLGKWKTATQMIALTILLLTRDSSLSGAASLVGSGVMLLYISAWLAVWSLF  295

Query  940  VYMRKIWKVLLV  975
            VYMRKIWKVLL+
Sbjct  296  VYMRKIWKVLLM  307



>ref|XP_009758973.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Nicotiana sylvestris]
Length=316

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 220/317 (69%), Positives = 240/317 (76%), Gaps = 19/317 (6%)
 Frame = +1

Query  73   GALKLHAVVTSIYSQKPYTWARTISSAAKSETLRGPA-------ASTPR--WRRRIPFPA  225
            G LKL+AV TSIYS+KPY + R+ +S   + +    A         T R  W   I  PA
Sbjct  3    GGLKLNAV-TSIYSRKPYNFFRSFTSVTGTSSSAAAAAAAVSVSTHTRRCWWGTSISIPA  61

Query  226  PVRGVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQL-------PDTVPSQSD  384
                  + Q  LGF  +  +   P+RSISTTQM   PD KE+ L       P   PS+S+
Sbjct  62   S-GDFRHRQKLLGFLGKGYANF-PLRSISTTQMCPAPDHKEEDLRREKASPPPPPPSKSE  119

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGP ATT IFIAAAITDWLDGY+ARK  LGT
Sbjct  120  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPTATTAIFIAAAITDWLDGYLARKMNLGT  179

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCTRPLE+S F  +PWLLTVPSIAIIGREITMSAVREWA
Sbjct  180  AFGAFLDPVADKLMVAATLILLCTRPLESSVFGQLPWLLTVPSIAIIGREITMSAVREWA  239

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQG KLSEAVAVNNLGKWKTATQM+ALTILL  RDSSL   G LVGSGV LLYISAWLA
Sbjct  240  ASQGGKLSEAVAVNNLGKWKTATQMTALTILLLARDSSLSGVGTLVGSGVILLYISAWLA  299

Query  925  VWSLFVYMRKIWKVLLV  975
            VWSL VYMRKIWKVLL+
Sbjct  300  VWSLVVYMRKIWKVLLM  316



>ref|XP_009594014.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Nicotiana tomentosiformis]
Length=315

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 238/315 (76%), Gaps = 16/315 (5%)
 Frame = +1

Query  73   GALKLHAVVTSIYSQKPYTWARTISSA-AKSETLRGPAASTPRWRRRI------PFPAPV  231
            G LKL+ VV SIYS KPY + R+ +S    S +    A S P + RR           P 
Sbjct  3    GGLKLN-VVASIYSHKPYNFFRSFTSVTGTSNSATATAVSVPTYTRRCWWGSSISISIPA  61

Query  232  RG-VPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQL------PDTVPSQSDKL  390
             G   + Q  LGF ++  +   P+RSISTTQMG  PD KE  L      P   PS+S+KL
Sbjct  62   SGDFRHRQKLLGFLDKGYANF-PLRSISTTQMGPAPDHKEDDLRREKASPPPPPSKSEKL  120

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            LTLPTILTIGRVAAVPLLVSTFYVDSWWGP ATT IFIAAAITDWLDGY+ARK  LGTAF
Sbjct  121  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPTATTAIFIAAAITDWLDGYLARKMNLGTAF  180

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVAATLVLLCTRPLE+  F  +PWLLTVPSIAIIGREITMSAVREWAAS
Sbjct  181  GAFLDPVADKLMVAATLVLLCTRPLESGVFGQLPWLLTVPSIAIIGREITMSAVREWAAS  240

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
            QG KLSEAVAVNNLGKWKTATQM+ALTILL  RDSSL   G LVGSGV LLYISAWLAVW
Sbjct  241  QGGKLSEAVAVNNLGKWKTATQMTALTILLLARDSSLSGVGTLVGSGVILLYISAWLAVW  300

Query  931  SLFVYMRKIWKVLLV  975
            SL  YMRKIWKVLL+
Sbjct  301  SLVAYMRKIWKVLLM  315



>ref|XP_004236813.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Solanum lycopersicum]
Length=309

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 211/310 (68%), Positives = 230/310 (74%), Gaps = 14/310 (5%)
 Frame = +1

Query  76   ALKLHAVVTSIYSQKPYTWARTISSAAKSETLRGPAASTPRWR-RRIPFPAPVRGVPNYQ  252
             LKL AV  SIY   PY + RT SS A + T   P   T  +R RRI  PAP     +  
Sbjct  4    GLKLKAVA-SIYGHMPYNFYRTFSSTA-APTTNLPVVPTHIYRSRRISTPAPAFSKVSIF  61

Query  253  ISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPD---------TVPSQSDKLLTLPT  405
               G    + +P   VR+ISTT MG  P  KE    +         + PS+S KLLTLPT
Sbjct  62   SCQG-EKEEYAPF-SVRNISTTGMGYTPGNKEDHHREKTLRSSPSSSAPSKSAKLLTLPT  119

Query  406  ILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLD  585
            ILTIGRVAA+P+LV+TFYVDSWWGP ATT IFIAAAITDWLDGY+ARK  LGTAFGAFLD
Sbjct  120  ILTIGRVAAIPVLVTTFYVDSWWGPTATTCIFIAAAITDWLDGYLARKMNLGTAFGAFLD  179

Query  586  PVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKL  765
            PVADKLMVAATL+LLCT+PLEAS F   PWLLTVPSIAIIGREITMSAVREWAASQG KL
Sbjct  180  PVADKLMVAATLILLCTKPLEASLFGQFPWLLTVPSIAIIGREITMSAVREWAASQGGKL  239

Query  766  SEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVY  945
            SEAVAVNNLGKWKTATQM+ALTILL TRDSSL  AG  V SGV LLY+SAWLAVWSL VY
Sbjct  240  SEAVAVNNLGKWKTATQMTALTILLLTRDSSLSGAGTFVASGVILLYVSAWLAVWSLVVY  299

Query  946  MRKIWKVLLV  975
            MRKI KVLL+
Sbjct  300  MRKISKVLLM  309



>ref|XP_006359345.1| PREDICTED: cardiolipin synthase-like [Solanum tuberosum]
Length=309

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 235/312 (75%), Gaps = 18/312 (6%)
 Frame = +1

Query  76   ALKLHAVVTSIYSQKPYTWARTISSAAKSETLRGPAASTPRWR-RRIPFPAPVRGVPNYQ  252
             LKL A V SIY   PY + RT SS A + T   P   T  +R RRI  P P       +
Sbjct  4    GLKLKAAV-SIYGHMPYNFYRTFSSTA-APTTNFPVVPTHIYRCRRISTPVPAF----LK  57

Query  253  ISLGFHNRDCSPLLP--VRSISTTQMGSDP-DKKEQQLPDTV--------PSQSDKLLTL  399
            +S+    ++     P  VR+ISTT MG  P +KK+     T+        PS+S KLLTL
Sbjct  58   VSVFSCQKEKEEYAPFSVRNISTTGMGYTPGNKKDHHREKTLRSSSSSSAPSKSAKLLTL  117

Query  400  PTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAF  579
            PTILTIGRVAA+P+LV+TFYVDSWWGP ATTGIFIAAAITDWLDGY+ARK  LGTAFGAF
Sbjct  118  PTILTIGRVAAIPVLVTTFYVDSWWGPTATTGIFIAAAITDWLDGYLARKMNLGTAFGAF  177

Query  580  LDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGS  759
            LDPVADKLMVAATL+LLCT+PLEAS F  +PWLLTVPSIAIIGREITMSAVREWAASQG 
Sbjct  178  LDPVADKLMVAATLILLCTKPLEASLFGQLPWLLTVPSIAIIGREITMSAVREWAASQGG  237

Query  760  KLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLF  939
            KLSEAVAVNNLGKWKTATQM+ALTILL TRDSSL  AG  V SGV LLY+SAWLA+WSL 
Sbjct  238  KLSEAVAVNNLGKWKTATQMTALTILLLTRDSSLSGAGTFVASGVILLYVSAWLALWSLV  297

Query  940  VYMRKIWKVLLV  975
            VYMRKI KVLL+
Sbjct  298  VYMRKISKVLLM  309



>ref|XP_009619577.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Nicotiana tomentosiformis]
Length=297

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 226/314 (72%), Gaps = 29/314 (9%)
 Frame = +1

Query  52   FLRTMAGGALKLHAVVTSIYSQKPYTWARTISSAAKS-----ETLRGPAASTPRWR-RRI  213
             L TM  G LKL A   SIY QKPYT+  T +S   S      T       T  +R RRI
Sbjct  7    ILHTMLVG-LKLTANFASIYGQKPYTFFPTFTSTTTSTSTAVNTNHQAVPPTLIYRCRRI  65

Query  214  PFPAPVRGVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLL  393
              PAP    P     LGF              S   MGS         P + PS+S KLL
Sbjct  66   ATPAPAYPFPAKV--LGF--------------SCLSMGSAFR------PSSAPSKSAKLL  103

Query  394  TLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFG  573
            TLPTILTIGRVAA+P+LV+TFYVDSWWGP ATTGIFIAAAITDWLDGY+ARK  LGTAFG
Sbjct  104  TLPTILTIGRVAAIPILVTTFYVDSWWGPTATTGIFIAAAITDWLDGYLARKMNLGTAFG  163

Query  574  AFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQ  753
            AFLDPVADKLMVAATL+LLCTRPLEAS F  +PWLLTVPSIAIIGREITMSAVREWAASQ
Sbjct  164  AFLDPVADKLMVAATLILLCTRPLEASVFGPLPWLLTVPSIAIIGREITMSAVREWAASQ  223

Query  754  GSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWS  933
            G KLSEAVAVNNLGKWKTATQM ALTILL TRDSSL  AG  V SGV LLY+SAWLAVWS
Sbjct  224  GGKLSEAVAVNNLGKWKTATQMIALTILLVTRDSSLSGAGTFVASGVILLYVSAWLAVWS  283

Query  934  LFVYMRKIWKVLLV  975
            L VYMRKIWKVLL+
Sbjct  284  LVVYMRKIWKVLLM  297



>emb|CDP04339.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 188/220 (85%), Gaps = 3/220 (1%)
 Frame = +1

Query  316  TQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattg  495
            T  G D D K+   P    + S KLLTLPTILTIGRVAAVPLLV+TFY D+WWGP A TG
Sbjct  4    TPYGHDDDGKKPLPPS---ANSAKLLTLPTILTIGRVAAVPLLVATFYSDNWWGPNAATG  60

Query  496  ifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPW  675
            IFIAAA+TDWLDGY+ARK K GTAFGAFLDPVADKLMVAATLVLLC++PLEA  F    W
Sbjct  61   IFIAAAVTDWLDGYLARKMKQGTAFGAFLDPVADKLMVAATLVLLCSKPLEAGIFGQASW  120

Query  676  LLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDS  855
            LLTVP+IAIIGREITMSAVREWAASQ  KLSEAVAVNNLGKWKTATQM+ALTILLATRDS
Sbjct  121  LLTVPAIAIIGREITMSAVREWAASQDGKLSEAVAVNNLGKWKTATQMTALTILLATRDS  180

Query  856  SLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLLV  975
            SL+ AG LV SGV LLYISAWL+VWSL VYMRKIWKVLL+
Sbjct  181  SLIGAGTLVASGVVLLYISAWLSVWSLVVYMRKIWKVLLM  220



>gb|EYU39573.1| hypothetical protein MIMGU_mgv1a010238mg [Erythranthe guttata]
Length=318

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 215/322 (67%), Gaps = 26/322 (8%)
 Frame = +1

Query  64   MAGGALKLHAVVTSIYSQKPYTWARTISSAAKSETLRGPAASTPRWRRRIPFPAPVRGVP  243
            M  G++K     T ++  KPY   +++ +++   T+  P  S+  WR  IP     +   
Sbjct  3    MPVGSIKFTNF-TFLHPLKPY---KSLPNSSSPTTILRPNLSSVCWRSTIPRATAEQRPI  58

Query  244  NYQISLG-------------------FHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDT  366
             ++IS G                   F N        V   +  Q    P ++  + P  
Sbjct  59   TWRISGGQKSRPFSSGSVNGGLKGKLFCNSKTKMCATVNGKADNQSDVPPSRENHEKP--  116

Query  367  VPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIAR  546
             P++  +LLTLPT+LTIGRVAAVPLLV TFYV+SWWGPAATT IFIAAA TDWLDG++AR
Sbjct  117  -PAEQSQLLTLPTMLTIGRVAAVPLLVGTFYVESWWGPAATTVIFIAAAFTDWLDGFLAR  175

Query  547  KKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMS  726
            K  LGT FGAFLDPVADKLMVAATL+LLCTRP EA  F   PWLLTVP+IAIIGREITMS
Sbjct  176  KMNLGTPFGAFLDPVADKLMVAATLILLCTRPFEAGIFGQAPWLLTVPAIAIIGREITMS  235

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLY  906
            AVREWAASQ  KL EAVAVNNLGKWKTA QMSALTILLATRD SLV AG    SGV LLY
Sbjct  236  AVREWAASQDKKLLEAVAVNNLGKWKTAAQMSALTILLATRDGSLVGAGTFADSGVLLLY  295

Query  907  ISAWLAVWSLFVYMRKIWKVLL  972
            ISAWLA+WSL VY RKI KVLL
Sbjct  296  ISAWLALWSLVVYARKISKVLL  317



>ref|XP_011077013.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Sesamum indicum]
Length=326

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 175/213 (82%), Gaps = 5/213 (2%)
 Frame = +1

Query  334  PDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaa  513
            PD  E+      P    KLLTLPTILTIGRVAAVPLLV TFYV SWWGP ATT IFI+AA
Sbjct  118  PDYHEKS-----PLHPPKLLTLPTILTIGRVAAVPLLVGTFYVHSWWGPVATTSIFISAA  172

Query  514  itDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPS  693
             TDWLDGY+ARK  LGT FGAFLDPVADKLMVAATL+LL TRPLEA  F+  PWLL VP+
Sbjct  173  FTDWLDGYLARKMNLGTPFGAFLDPVADKLMVAATLILLSTRPLEAGMFLQTPWLLAVPA  232

Query  694  IAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAG  873
            IAIIGREITMSAVREWAASQ  KL EAVAVNNLGKWKTATQM ALTILLA RD SLV AG
Sbjct  233  IAIIGREITMSAVREWAASQDRKLLEAVAVNNLGKWKTATQMLALTILLAARDGSLVVAG  292

Query  874  ALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
             L  SGV LLYISAWLA+WSL VY+RKIWKVLL
Sbjct  293  TLAYSGVLLLYISAWLALWSLVVYVRKIWKVLL  325



>gb|EYU39806.1| hypothetical protein MIMGU_mgv1a009906mg [Erythranthe guttata]
Length=327

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 179/227 (79%), Gaps = 7/227 (3%)
 Frame = +1

Query  316  TQMGSDPDKKEQQLPDT-------VPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWW  474
            TQMG+  + K     D         P  S +LLTLPTILTIGRVAAVPLLVSTFYV+SWW
Sbjct  101  TQMGAGVNCKVDTASDVSPPHKTPPPPDSSRLLTLPTILTIGRVAAVPLLVSTFYVESWW  160

Query  475  GPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEAS  654
            GP AT GIFI AA TDWLDGY+ARK KLGT FGAFLDPVADKLMVAATL+LLCT+P EA 
Sbjct  161  GPPATVGIFIVAAATDWLDGYLARKMKLGTQFGAFLDPVADKLMVAATLILLCTKPFEAG  220

Query  655  AFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTI  834
             F   PWLLTVP+IAII REITMSAVREWAAS+  KL EAVAVNNLGKWKTATQM ALT 
Sbjct  221  MFGQAPWLLTVPAIAIISREITMSAVREWAASRNRKLLEAVAVNNLGKWKTATQMCALTA  280

Query  835  LLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLLV  975
            LLA RD SL  A  LV SGV LLY SAWL++WSL VYMRKIW+VLL+
Sbjct  281  LLAARDGSLAGAEILVSSGVVLLYFSAWLSLWSLVVYMRKIWRVLLL  327



>ref|XP_010937763.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Elaeis guineensis]
Length=357

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 185/223 (83%), Gaps = 5/223 (2%)
 Frame = +1

Query  304  SISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPa  483
             I   ++G+D   +++         S +LLTLPT+LTIGRVAAVPLLVSTFY++  W   
Sbjct  139  QIDGREVGTDGGYRQEG-----QQGSPRLLTLPTVLTIGRVAAVPLLVSTFYMNGSWATT  193

Query  484  attgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFV  663
            ATT IFIAAA+TDWLDGYIARK +LGTAFGAFLDPVADKLMVAATLVLLCTRPLE +AF 
Sbjct  194  ATTCIFIAAAVTDWLDGYIARKMRLGTAFGAFLDPVADKLMVAATLVLLCTRPLEVAAFG  253

Query  664  HMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLA  843
              PWLLTVPSIAIIGREITMSAVREWAASQ SK+ EAVAVNNLGKWKTATQM+ALTILLA
Sbjct  254  DAPWLLTVPSIAIIGREITMSAVREWAASQNSKVLEAVAVNNLGKWKTATQMTALTILLA  313

Query  844  TRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            TRDSSL   G LV SGV LLYISA LAVWSL VYMRKIW+VLL
Sbjct  314  TRDSSLTGPGVLVASGVVLLYISAGLAVWSLAVYMRKIWRVLL  356



>ref|XP_011084377.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Sesamum indicum]
Length=336

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 204/260 (78%), Gaps = 20/260 (8%)
 Frame = +1

Query  256  SLGFHNRDCSPLLPV----RSIST---TQMG-----------SDPD--KKEQQLPDTVPS  375
            +L F+  DC     V    RS +    TQMG           ++PD  +  Q+  +  P+
Sbjct  77   NLHFYTSDCRNKGQVVHLQRSTNGDFGTQMGATVNGRVDSQCNEPDVLQPPQKDGEKRPA  136

Query  376  QSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKK  555
            +  KLLTLPTILTIGRV AVPLLVSTFYV+SWWGPAATTGIFIAAAITDWLDGY+ARK K
Sbjct  137  EPSKLLTLPTILTIGRVVAVPLLVSTFYVESWWGPAATTGIFIAAAITDWLDGYLARKMK  196

Query  556  LGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVR  735
            LGT FGAFLDPVADKLMVAATL+LLCTRP EA  F   PWLLTVP+IAIIGREITMSAVR
Sbjct  197  LGTQFGAFLDPVADKLMVAATLILLCTRPFEAGMFGQAPWLLTVPAIAIIGREITMSAVR  256

Query  736  EWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISA  915
            EWAASQ  KL EAVAVNNLGKWKTATQM+ALT+LLA RD SLV +GALV SGV LLYIS+
Sbjct  257  EWAASQDRKLLEAVAVNNLGKWKTATQMTALTMLLAARDGSLVGSGALVSSGVVLLYISS  316

Query  916  WLAVWSLFVYMRKIWKVLLV  975
            WL++WSL VYMRKIWKVLL+
Sbjct  317  WLSLWSLLVYMRKIWKVLLL  336



>ref|XP_010101500.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Morus notabilis]
 gb|EXB88497.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Morus notabilis]
Length=365

 Score =   296 bits (759),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  298  VRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWG  477
            V  + +     D + KE        + S K LTLPT+LT+GRVAAVPLL+ TFYVDSWWG
Sbjct  140  VVDMGSENKHQDFNGKEVNQDLKQSASSSKFLTLPTVLTLGRVAAVPLLIGTFYVDSWWG  199

Query  478  PaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASA  657
            P ATT IFIAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVA TL+LLCTRP +   
Sbjct  200  PTATTSIFIAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAGTLILLCTRPFDVPG  259

Query  658  FVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTIL  837
            F  +PWLLTVP IAIIGREITMSAVREWAASQ +KL EAVAVNNLGKWKTATQM+ALTIL
Sbjct  260  FGQVPWLLTVPVIAIIGREITMSAVREWAASQNTKLLEAVAVNNLGKWKTATQMTALTIL  319

Query  838  LATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            LATRDSSL   G LV SGV LLY+SA LA WSL VYM KIW+VL+
Sbjct  320  LATRDSSLGAPGFLVASGVVLLYVSAGLAFWSLVVYMSKIWRVLM  364



>ref|XP_006411155.1| hypothetical protein EUTSA_v10016968mg [Eutrema salsugineum]
 gb|ESQ52608.1| hypothetical protein EUTSA_v10016968mg [Eutrema salsugineum]
Length=314

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 182/212 (86%), Gaps = 6/212 (3%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D ++   P   P  S K+LTLPT+LT+GRVAAVPLLV+TFYVDSWWG  ATTGIFIAAAI
Sbjct  108  DDEDNSSP---PQSSSKVLTLPTVLTLGRVAAVPLLVATFYVDSWWGTTATTGIFIAAAI  164

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSI  696
            TDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSI
Sbjct  165  TDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPIDVAVLGPVPWLLTVPSI  224

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA  876
            AIIGREITMSAVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDSS+   G 
Sbjct  225  AIIGREITMSAVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDSSV---GW  281

Query  877  LVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            LV SG  LLY+SA L+VWSL VYMRKIWKVLL
Sbjct  282  LVASGAGLLYVSAGLSVWSLVVYMRKIWKVLL  313



>gb|KHG03988.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Gossypium arboreum]
Length=323

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 180/224 (80%), Gaps = 10/224 (4%)
 Frame = +1

Query  331  DPDKKEQQLPDTVPSQSD----------KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGP  480
            DPD K   L +  P   D          K+LTLPT+LT+GRVAAVPLL+ TFYVDS WG 
Sbjct  99   DPDSKPSPLIEPQPQMRDPNFPSDNSSSKILTLPTVLTLGRVAAVPLLIFTFYVDSCWGR  158

Query  481  aattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAF  660
             ATT IF+AAAITDWLDGYIARK KL + FGAFLDPVADKLMVAATLVLLC+RPL  + F
Sbjct  159  TATTSIFVAAAITDWLDGYIARKMKLHSVFGAFLDPVADKLMVAATLVLLCSRPLNVANF  218

Query  661  VHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILL  840
              +PWLL VPSIAIIGREITMSAVREWAASQ SKL EAVAVNNLGKWKTATQM+ALTILL
Sbjct  219  GQVPWLLIVPSIAIIGREITMSAVREWAASQNSKLLEAVAVNNLGKWKTATQMAALTILL  278

Query  841  ATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            ATRDSSL +AG LV SGV LLYISA L+V SL VYM KIW+VLL
Sbjct  279  ATRDSSLGEAGILVASGVILLYISAGLSVMSLAVYMGKIWQVLL  322



>ref|XP_006294709.1| hypothetical protein CARUB_v10023748mg [Capsella rubella]
 gb|EOA27607.1| hypothetical protein CARUB_v10023748mg [Capsella rubella]
Length=296

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 178/205 (87%), Gaps = 4/205 (2%)
 Frame = +1

Query  361  DTVPSQSD-KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGY  537
            D  P QS  K+LTLPT+LT+GRVAAVPLLV+TFY DSWWG  ATT IFIAAAITDWLDGY
Sbjct  94   DNSPQQSSSKVLTLPTVLTLGRVAAVPLLVATFYCDSWWGTTATTSIFIAAAITDWLDGY  153

Query  538  IARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREI  717
            +ARK KLG+AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREI
Sbjct  154  LARKMKLGSAFGAFLDPVADKLMVAATLILLCTKPIDVAVLGPVPWLLTVPSIAIIGREI  213

Query  718  TMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVA  897
            TMSAVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS++   G LV SG  
Sbjct  214  TMSAVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDSNI---GWLVASGAG  270

Query  898  LLYISAWLAVWSLFVYMRKIWKVLL  972
            LLY+SA L+VWSL VYMRKIWKVL+
Sbjct  271  LLYVSAGLSVWSLVVYMRKIWKVLM  295



>ref|XP_002879790.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56049.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 194/262 (74%), Gaps = 4/262 (2%)
 Frame = +1

Query  190  TPRWRRRIPFPAPVR-GVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDT  366
            T R+  R     P+R  + N+++S    +       P  S   +  G      +      
Sbjct  37   TSRYSSRTALRFPIRISLHNHRLSYFSSSSSSEQGRPTSSSRNSFSGHGQLDGDDNSSPP  96

Query  367  VPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIAR  546
                S K+LTLPT+LT+GRVAAVPLLV+TFYVDSWWG  ATT IFIAAAITDWLDGY+AR
Sbjct  97   PSQSSSKVLTLPTVLTLGRVAAVPLLVATFYVDSWWGTTATTSIFIAAAITDWLDGYLAR  156

Query  547  KKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMS  726
            K +LG+AFGAFLDPVADKLMVAATL+LLCT+P+E +    +PWLLTVPSIAIIGREITMS
Sbjct  157  KMRLGSAFGAFLDPVADKLMVAATLILLCTKPIEVAELGPVPWLLTVPSIAIIGREITMS  216

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLY  906
            AVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY
Sbjct  217  AVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLY  273

Query  907  ISAWLAVWSLFVYMRKIWKVLL  972
            +SA L+VWSL VYMRKIWKVL+
Sbjct  274  VSAGLSVWSLAVYMRKIWKVLM  295



>ref|XP_007009648.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 1 [Theobroma cacao]
 ref|XP_007009649.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY18458.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY18459.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 1 [Theobroma cacao]
Length=319

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 179/224 (80%), Gaps = 10/224 (4%)
 Frame = +1

Query  331  DPDKKE----QQLPDTVPS------QSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGP  480
            D D K     QQ  D  P        S K+LTLPTILT+GRVAAVPLL+ TFYVDSWWG 
Sbjct  95   DSDSKTSPLMQQQQDHQPKLSSSNNSSSKILTLPTILTLGRVAAVPLLIFTFYVDSWWGR  154

Query  481  aattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAF  660
             ATT IFIAAAITDWLDGYIARK +L + FGAFLDPVADKLMVAATLVLLC+RPL  + F
Sbjct  155  TATTSIFIAAAITDWLDGYIARKMRLHSVFGAFLDPVADKLMVAATLVLLCSRPLNVAVF  214

Query  661  VHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILL  840
              +PWLL VPSIAIIGREITMSAVREWAASQ SKL EAVAVNNLGKWKTATQM+ALTILL
Sbjct  215  GQVPWLLIVPSIAIIGREITMSAVREWAASQNSKLLEAVAVNNLGKWKTATQMAALTILL  274

Query  841  ATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            ATRDSSL + G  V SGV LLYISA L+V SL VYM KIWKVL+
Sbjct  275  ATRDSSLGEPGIFVASGVILLYISAGLSVMSLGVYMGKIWKVLI  318



>emb|CDY24971.1| BnaC03g22010D [Brassica napus]
Length=310

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 175/281 (62%), Positives = 195/281 (69%), Gaps = 32/281 (11%)
 Frame = +1

Query  136  RTISSAAKSETLRGPAASTPRWRRRIPFPAPVRGVPNYQISLGFHNRDCSPLLPVRSIST  315
            R +SS +      GP++ST     R             Q S   HN D            
Sbjct  59   RRLSSFSSPSVKHGPSSST-----RSSLAGQDDAFTAAQNSFNGHNHD------------  101

Query  316  TQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattg  495
                   D  E   P   P  S K+LTLPT+LTI RVAAVPLLV+TFY DS WG  ATT 
Sbjct  102  -------DGNENSSP---PQPSSKVLTLPTVLTIARVAAVPLLVATFYADSSWGTTATTS  151

Query  496  ifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAF--VHM  669
            IFIAAAITDWLDGY+ARK KLG+AFGAFLDPVADKLMVAATL+LLCT+P+E +    V +
Sbjct  152  IFIAAAITDWLDGYLARKMKLGSAFGAFLDPVADKLMVAATLILLCTKPVEVAVLGPVPV  211

Query  670  PWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATR  849
            PWLLTVPSIAIIGREITMSAVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+R
Sbjct  212  PWLLTVPSIAIIGREITMSAVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASR  271

Query  850  DSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            DS++   G LV SG  LLY+SA L+VWSL VYMRKIWKVLL
Sbjct  272  DSNI---GWLVASGAGLLYVSAGLSVWSLVVYMRKIWKVLL  309



>gb|ACL53831.1| unknown [Zea mays]
Length=237

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT
Sbjct  41   RLLTLPTVLTIGRVAAVPLLISTFYMEGPWAAMATTGIFLAAAVTDWLDGYIARKMQLGT  100

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLCT+PLE+S     PWLLTVPSIAIIGREITMSAVREWA
Sbjct  101  PFGAFLDPVADKLMVAATLVLLCTKPLESSLLNDGPWLLTVPSIAIIGREITMSAVREWA  160

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ SK+ EAVAVNNLGKWKTATQM+ALT+LLA+RD SL   GALV  GVALLY+S  LA
Sbjct  161  ASQNSKVLEAVAVNNLGKWKTATQMTALTLLLASRDPSLPAQGALVAPGVALLYVSTGLA  220

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMRKIW++LL
Sbjct  221  VWSLVVYMRKIWRILL  236



>ref|NP_181461.1| phosphatidylglycerolphosphate synthase 1 [Arabidopsis thaliana]
 sp|O80952.1|PGPS1_ARATH RecName: Full=CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic; AltName: Full=Phosphatidylglycerophosphate 
synthase 1; Short=PGP synthase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC28995.1| putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Arabidopsis thaliana]
 dbj|BAB39133.1| phosphatidylglycerolphosphate synthase [Arabidopsis thaliana]
 dbj|BAB68508.1| phophoglycerolphosphate synthase [Arabidopsis thaliana]
 gb|ABD65588.1| At2g39290 [Arabidopsis thaliana]
 gb|AEC09655.1| phosphatidylglycerolphosphate synthase 1 [Arabidopsis thaliana]
Length=296

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 174/196 (89%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+GRVAAVPLLV+TFYVDSWWG  ATT IFIAAAITDWLDGY+ARK +LG+
Sbjct  103  KVLTLPTVLTLGRVAAVPLLVATFYVDSWWGTTATTSIFIAAAITDWLDGYLARKMRLGS  162

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREITMSAVREWA
Sbjct  163  AFGAFLDPVADKLMVAATLILLCTKPIQVAELGPLPWLLTVPSIAIIGREITMSAVREWA  222

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY+SA L+
Sbjct  223  ASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLYVSAGLS  279

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMRKIWKVL+
Sbjct  280  VWSLAVYMRKIWKVLM  295



>ref|XP_006292231.1| hypothetical protein CARUB_v10018438mg [Capsella rubella]
 gb|EOA25129.1| hypothetical protein CARUB_v10018438mg [Capsella rubella]
Length=235

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 184/236 (78%), Gaps = 25/236 (11%)
 Frame = +1

Query  265  FHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLL  444
              NR  SPL P               + QQL       S K+LTLPT+LT+GRVAAVP+L
Sbjct  23   LRNRHSSPLPP---------------RPQQL-------SSKVLTLPTVLTLGRVAAVPIL  60

Query  445  VSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLV  624
            V+TFYVD WWG  ATT IFIAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+
Sbjct  61   VATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLI  120

Query  625  LLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWK  804
            LLCT+P+ A  F  +PWL+TVPSIAIIGREITMSAVREWAASQ  KLSEAVAVN+LGKWK
Sbjct  121  LLCTKPMNAVVFGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWK  180

Query  805  TATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            TATQM ALTILLA+RDSS      L+ SG+ LLY+SA L++WSL VYMRKIW+VLL
Sbjct  181  TATQMIALTILLASRDSSF---ERLLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLL  233



>ref|XP_010260128.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Nelumbo nucifera]
Length=327

 Score =   285 bits (730),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +1

Query  376  QSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKK  555
            Q  + LTLPTILT+GRV AVPLL+ TFY++ WWG  ATT IFI AAITDWLDGYIARK +
Sbjct  128  QPSRWLTLPTILTLGRVVAVPLLICTFYMNGWWGTTATTSIFIVAAITDWLDGYIARKMR  187

Query  556  LGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVR  735
            LGTAFGAFLDPVADKLMVAATLVLLC RPL  + F  +PWLLTVPSI IIGREITMSAVR
Sbjct  188  LGTAFGAFLDPVADKLMVAATLVLLCNRPLGVAVFGDLPWLLTVPSIVIIGREITMSAVR  247

Query  736  EWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISA  915
            EWAASQ +++ EAVAVNNLGKWKTATQM+ALTILLATRDSSL  +G LV SG+ LLY+SA
Sbjct  248  EWAASQNNRVLEAVAVNNLGKWKTATQMTALTILLATRDSSLSGSGILVSSGIVLLYVSA  307

Query  916  WLAVWSLFVYMRKIWKVLL  972
             L +WSL VYM KIW++LL
Sbjct  308  GLTIWSLVVYMSKIWRILL  326



>ref|XP_011027060.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Populus euphratica]
Length=364

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 187/246 (76%), Gaps = 13/246 (5%)
 Frame = +1

Query  235  GVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILT  414
            G  N    +G++N D S   P+ +  + Q+       +QQ       Q  K LTLPT+LT
Sbjct  131  GSENKIDDVGWYNHD-SQDQPLSASPSMQI-----HNQQQ-------QHSKFLTLPTVLT  177

Query  415  IGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVA  594
            +GRVAAVPLLV+TFY DSWWG  ATT IFI AAITDWLDGY+ARK KLGTAFGAFLDPVA
Sbjct  178  LGRVAAVPLLVATFYADSWWGRTATTSIFIVAAITDWLDGYLARKMKLGTAFGAFLDPVA  237

Query  595  DKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEA  774
            DKLMVAA L+LLC+RPLE +    +PWL TVP+ AIIGREITMSAVREWAAS+ SKL EA
Sbjct  238  DKLMVAAALILLCSRPLEDAMSGELPWLFTVPTTAIIGREITMSAVREWAASRNSKLLEA  297

Query  775  VAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRK  954
            VAVNNLGKWKTATQM +LTILLA RDSSL   G LV SGV LLYISA L+VWSL VYM K
Sbjct  298  VAVNNLGKWKTATQMISLTILLAARDSSLEGPGILVPSGVILLYISAGLSVWSLAVYMSK  357

Query  955  IWKVLL  972
            IWKVLL
Sbjct  358  IWKVLL  363



>ref|XP_008384323.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Malus domestica]
Length=374

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = +1

Query  388  LLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTA  567
             LTLPTILT+GRVAAVP+L+STFY+DSWWG  ATT IFIAAAITDWLDGYIARK KLG+A
Sbjct  179  FLTLPTILTLGRVAAVPVLISTFYIDSWWGTTATTSIFIAAAITDWLDGYIARKMKLGSA  238

Query  568  FGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAA  747
            FGAFLDPVADKLMVAATLVLLC+RPL+ + F  +PWL  VPSIAIIGREITMSAVREWAA
Sbjct  239  FGAFLDPVADKLMVAATLVLLCSRPLDVAMFGQVPWLFVVPSIAIIGREITMSAVREWAA  298

Query  748  SQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAV  927
            SQ +KL EAVAVNNLGKWKTATQM ALTILLATRD+S      +V SGV LLY+SA LAV
Sbjct  299  SQNTKLLEAVAVNNLGKWKTATQMIALTILLATRDNSFGRPDVIVASGVFLLYVSAGLAV  358

Query  928  WSLFVYMRKIWKVLL  972
            WSL +YM KIWKVLL
Sbjct  359  WSLIMYMSKIWKVLL  373



>gb|EEE58822.1| hypothetical protein OsJ_10391 [Oryza sativa Japonica Group]
Length=228

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            KLLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT
Sbjct  32   KLLTLPTVLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWLDGYIARKMQLGT  91

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLCT+PLE S     PWLLTVP+IAIIGREITMSAVREWA
Sbjct  92   PFGAFLDPVADKLMVAATLVLLCTKPLEISLLRDGPWLLTVPAIAIIGREITMSAVREWA  151

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ +K+ EAVAVNNLGKWKTATQM+ALTILLA+RD SL    ALV SG+ALLY+SA LA
Sbjct  152  ASQNTKVLEAVAVNNLGKWKTATQMTALTILLASRDKSLPAQDALVTSGIALLYVSAGLA  211

Query  925  VWSLFVYMRKIWKVLL  972
            +WSL VYMRKIW++LL
Sbjct  212  IWSLVVYMRKIWRILL  227



>ref|XP_004163469.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase-like 
[Cucumis sativus]
Length=231

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 185/236 (78%), Gaps = 22/236 (9%)
 Frame = +1

Query  265  FHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLL  444
            FHN+  SPL+                  Q  P     Q  KLLTLPTILT+ RV AVP+ 
Sbjct  17   FHNQTPSPLM-----------------HQHEP-----QHSKLLTLPTILTLARVVAVPIF  54

Query  445  VSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLV  624
            V TFYVD+WWG  ATT IFIAAA+TDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+
Sbjct  55   VCTFYVDNWWGTTATTSIFIAAAVTDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLI  114

Query  625  LLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWK  804
            LLCT+PLE S F H+PWLLT+PSIAIIGREITMSAVREWAASQ SKL EAVAVNNLGKWK
Sbjct  115  LLCTQPLEVSVFGHIPWLLTLPSIAIIGREITMSAVREWAASQNSKLLEAVAVNNLGKWK  174

Query  805  TATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            TATQM ALT LLA+RDSSL  +G +V +GV LLYISAWLAVWSLFVY RKI KVLL
Sbjct  175  TATQMIALTTLLASRDSSLGGSGIVVATGVVLLYISAWLAVWSLFVYSRKISKVLL  230



>ref|XP_006436175.1| hypothetical protein CICLE_v10031930mg [Citrus clementina]
 ref|XP_006485966.1| PREDICTED: uncharacterized protein LOC102607269 isoform X1 [Citrus 
sinensis]
 gb|ESR49415.1| hypothetical protein CICLE_v10031930mg [Citrus clementina]
 gb|KDO67866.1| hypothetical protein CISIN_1g018312mg [Citrus sinensis]
Length=358

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            S+K+LTLPTILT+GRVAAVPLL+ TFYVDSWWG  ATT IFIAAA+TDWLDGYIARK +L
Sbjct  160  SNKILTLPTILTLGRVAAVPLLICTFYVDSWWGRTATTSIFIAAAVTDWLDGYIARKMRL  219

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVRE  738
            G+ FGAFLDPVADKLMVAATLVLLCT+PLE   F  +PWLLTVP+IAIIGREITMSAVRE
Sbjct  220  GSTFGAFLDPVADKLMVAATLVLLCTKPLELPVFGQVPWLLTVPAIAIIGREITMSAVRE  279

Query  739  WAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAW  918
            WAASQ ++L EAVAVNNLGKWKTATQM ALTILL TRDSS+     LV SGV LLYISA 
Sbjct  280  WAASQNTRLLEAVAVNNLGKWKTATQMIALTILLTTRDSSIGGPWILVCSGVVLLYISAG  339

Query  919  LAVWSLFVYMRKIWKVLL  972
            L+VWSL VYM KI KVLL
Sbjct  340  LSVWSLVVYMGKISKVLL  357



>ref|XP_002316331.1| hypothetical protein POPTR_0010s22200g [Populus trichocarpa]
 gb|EEF02502.1| hypothetical protein POPTR_0010s22200g [Populus trichocarpa]
Length=238

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 187/246 (76%), Gaps = 13/246 (5%)
 Frame = +1

Query  235  GVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILT  414
            G  N    +G++N D S   P+ +  + Q+       +QQ       Q  K LTLPT+LT
Sbjct  5    GSENKIDDVGWYNHD-SQDQPLSTSPSMQI-----HNQQQ-------QHSKFLTLPTVLT  51

Query  415  IGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVA  594
            +GRVAAVPLLV+TFY DSWWG  ATT IFI AAITDWLDGY+ARK KLGTAFGAFLDPVA
Sbjct  52   LGRVAAVPLLVATFYADSWWGRTATTSIFIVAAITDWLDGYLARKMKLGTAFGAFLDPVA  111

Query  595  DKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEA  774
            DKLMVAA L+LLC+RPLE +    +PWL TVP+ +IIGREITMSAVREWAAS+ SKL EA
Sbjct  112  DKLMVAAALILLCSRPLEVALSGEVPWLFTVPATSIIGREITMSAVREWAASRNSKLLEA  171

Query  775  VAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRK  954
            VAVNNLGKWKTATQM +LTILLA RDSSL   G LV SGV LLYISA L++WSL VY+ K
Sbjct  172  VAVNNLGKWKTATQMISLTILLAARDSSLEGPGILVPSGVILLYISAGLSIWSLAVYVSK  231

Query  955  IWKVLL  972
            IWKVLL
Sbjct  232  IWKVLL  237



>dbj|BAD43832.1| putative CDP-diacylglycerol--glycerol-3- phosphate 3-phosphatidyltransferase 
[Arabidopsis thaliana]
Length=296

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 173/196 (88%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+GRVAAVPLLV+TFYVDSWWG  ATT IFIAAAITDWLDGY+ARK +LG+
Sbjct  103  KVLTLPTVLTLGRVAAVPLLVATFYVDSWWGTTATTSIFIAAAITDWLDGYLARKMRLGS  162

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREITMSAVREWA
Sbjct  163  AFGAFLDPVADKLMVAATLILLCTKPIQVAELGPLPWLLTVPSIAIIGREITMSAVREWA  222

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY+S  L+
Sbjct  223  ASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLYVSVGLS  279

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMRKIWKVL+
Sbjct  280  VWSLAVYMRKIWKVLM  295



>tpg|DAA44780.1| TPA: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Zea mays]
Length=318

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT
Sbjct  122  RLLTLPTVLTIGRVAAVPLLISTFYMEGPWAAMATTGIFLAAAVTDWLDGYIARKMQLGT  181

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLCT+PLE+S     PWLLTVPSIAIIGREITMSAVREWA
Sbjct  182  PFGAFLDPVADKLMVAATLVLLCTKPLESSLLNDGPWLLTVPSIAIIGREITMSAVREWA  241

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ SK+ EAVAVNNLGKWKTATQM+ALT+LLA+RD SL   GALV  GVALLY+S  LA
Sbjct  242  ASQNSKVLEAVAVNNLGKWKTATQMTALTLLLASRDPSLPAQGALVAPGVALLYVSTGLA  301

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMRKIW++LL
Sbjct  302  VWSLVVYMRKIWRILL  317



>ref|XP_009357618.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Pyrus x bretschneideri]
Length=370

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = +1

Query  388  LLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTA  567
             LTLPTILT+GRVAAVP+L+STFY+DSWWG   TT IFIAAAITDWLDGYIARK KLG+A
Sbjct  175  FLTLPTILTLGRVAAVPVLISTFYIDSWWGTTTTTSIFIAAAITDWLDGYIARKMKLGSA  234

Query  568  FGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAA  747
            FGAFLDPVADKLMVAATLVLLC+RPL+ + F  +PWL  VPSIAIIGREITMSAVREWAA
Sbjct  235  FGAFLDPVADKLMVAATLVLLCSRPLDVAMFGQVPWLFVVPSIAIIGREITMSAVREWAA  294

Query  748  SQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAV  927
            SQ +KL EAVAV+NLGKWKTATQM ALTILLATRD+SL     +V SGV LLY+SA LAV
Sbjct  295  SQNTKLLEAVAVSNLGKWKTATQMIALTILLATRDNSLGRPDVIVASGVFLLYVSAGLAV  354

Query  928  WSLFVYMRKIWKVLL  972
            WSL VYM KIWKVLL
Sbjct  355  WSLIVYMSKIWKVLL  369



>ref|NP_001147695.1| LOC100281305 [Zea mays]
 gb|ACG28402.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Zea mays]
Length=318

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT
Sbjct  122  RLLTLPTVLTIGRVAAVPLLISTFYMEGPWAAMATTGIFLAAAVTDWLDGYIARKMQLGT  181

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLCT+PLE+S     PWLLTVPSIAIIGREITMSAVREWA
Sbjct  182  PFGAFLDPVADKLMVAATLVLLCTKPLESSLLNDGPWLLTVPSIAIIGREITMSAVREWA  241

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ SK+ EAVAVNNLGKWKTATQM+ALT+LLA+RD SL   GALV  GVALLY+S  LA
Sbjct  242  ASQNSKVLEAVAVNNLGKWKTATQMTALTLLLASRDPSLPAQGALVAPGVALLYVSTGLA  301

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMRKIW++LL
Sbjct  302  VWSLVVYMRKIWRILL  317



>emb|CDY07659.1| BnaA03g18520D [Brassica napus]
Length=302

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +1

Query  376  QSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKK  555
             S K+LTLPT+LT+ RVAAVPLLV+TFY DS WG  ATT IFIAAAITDWLDGY+ARK K
Sbjct  106  NSSKVLTLPTVLTVARVAAVPLLVATFYADSSWGTTATTSIFIAAAITDWLDGYLARKMK  165

Query  556  LGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVR  735
            LG+AFGAFLDPVADKLMVAATL+LLCT+P++      +PWLLTVPSIAIIGREITMSAVR
Sbjct  166  LGSAFGAFLDPVADKLMVAATLILLCTKPMDVGVLGPLPWLLTVPSIAIIGREITMSAVR  225

Query  736  EWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISA  915
            EWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY+SA
Sbjct  226  EWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLYVSA  282

Query  916  WLAVWSLFVYMRKIWKVLL  972
             L+VWSL VYMRKIWKVLL
Sbjct  283  GLSVWSLVVYMRKIWKVLL  301



>ref|NP_001151070.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Zea mays]
 gb|ACG41510.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Zea mays]
Length=321

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 178/214 (83%), Gaps = 1/214 (0%)
 Frame = +1

Query  334  PDKKEQQLPDTVPSQSD-KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaa  510
            P      +P   P+ +  +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AA
Sbjct  107  PPVNGMMMPKEEPATAPPRLLTLPTVLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAA  166

Query  511  aitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVP  690
            A+TDWLDGYIARK +LGT FGAFLDPVADKLMVAATLVLLCT+PLE S     PWLLTVP
Sbjct  167  AVTDWLDGYIARKMQLGTPFGAFLDPVADKLMVAATLVLLCTKPLETSLLNDGPWLLTVP  226

Query  691  SIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDA  870
            SIAIIGREITMSAVREWAASQ S+  EAVAVNNLGKWKTATQM+ALT+LLA+RD S+   
Sbjct  227  SIAIIGREITMSAVREWAASQNSEALEAVAVNNLGKWKTATQMTALTLLLASRDPSVPAQ  286

Query  871  GALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            GALV  GVALLYISA LA+WSL VYMRKIW++LL
Sbjct  287  GALVAPGVALLYISAGLAIWSLVVYMRKIWRILL  320



>emb|CBI25325.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLL+ TFYVDSWWG   TT IFIAAAITDWLDGY+ARK +LGT FGAFLDPVAD
Sbjct  45   GRVAAVPLLIGTFYVDSWWGTTTTTTIFIAAAITDWLDGYLARKMRLGTTFGAFLDPVAD  104

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLC+RPLE   F  +PWLLTVPSIAIIGREITMSAVREWAASQ ++L EAV
Sbjct  105  KLMVAATLVLLCSRPLEVGMFGPVPWLLTVPSIAIIGREITMSAVREWAASQNTELLEAV  164

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM++LT+LLA RDSSL  AG LV SGV LLYISA LAVWSL VYMRKI
Sbjct  165  AVNNLGKWKTATQMTSLTVLLAARDSSLTAAGGLVASGVVLLYISAGLAVWSLVVYMRKI  224

Query  958  WKVLL  972
            WKVL+
Sbjct  225  WKVLI  229



>ref|XP_002876283.1| hypothetical protein ARALYDRAFT_906919 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52542.1| hypothetical protein ARALYDRAFT_906919 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 183/227 (81%), Gaps = 7/227 (3%)
 Frame = +1

Query  304  SISTTQMGSDPD---KKEQQLPDTVPSQ-SDKLLTLPTILTIGRVAAVPLLVSTFYVDSW  471
            ++     G   D   +K    P   P+Q S K++TLPT+LT+GRVAAVP+LV+TFYVD W
Sbjct  8    TVDQNSFGGGKDSLLRKRHSAPLPSPTQLSSKVITLPTVLTLGRVAAVPILVATFYVDCW  67

Query  472  WGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEA  651
            WG  ATT IFIAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P+ A
Sbjct  68   WGKTATTSIFIAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMVA  127

Query  652  SAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALT  831
                 +PWL+TVPSIAIIGREITMSAVREWAASQ  KLSEAVAVN+LGKWKTATQM ALT
Sbjct  128  VVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALT  187

Query  832  ILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            +LLA+RDSS      L+ SG+ LLY+SA L++WSL VYMRKIW+VLL
Sbjct  188  LLLASRDSSF---ERLLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLL  231



>ref|XP_003558189.1| PREDICTED: cardiolipin synthase, mitochondrial-like [Brachypodium 
distachyon]
Length=314

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 184/228 (81%), Gaps = 12/228 (5%)
 Frame = +1

Query  322  MGSDPDKKEQQL-----------PDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDS  468
            MGSD  ++ +++           P  VP    +LLTLPT+LTIGRVAAVP L+STFY+D 
Sbjct  87   MGSDGAERRRRVAAVNGVSKEGAPQPVPVP-PRLLTLPTVLTIGRVAAVPFLISTFYMDG  145

Query  469  WWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLE  648
             W   ATTGIF+AAAITDWLDGYIARK +LGT FGAFLDPVADKLMVAATLVLLCT+PLE
Sbjct  146  PWAATATTGIFLAAAITDWLDGYIARKMQLGTPFGAFLDPVADKLMVAATLVLLCTKPLE  205

Query  649  ASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSAL  828
             S     PWL+TVPSIAIIGREITMSAVREWAASQ S++ EAVAVNNLGKWKTATQM+AL
Sbjct  206  TSLLSDGPWLMTVPSIAIIGREITMSAVREWAASQNSQVLEAVAVNNLGKWKTATQMTAL  265

Query  829  TILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            T+LLA+RD SL   GALV  GVALLY+SA LA+WSL VY+RKIW++LL
Sbjct  266  TLLLASRDPSLPVQGALVTPGVALLYVSAGLAIWSLVVYIRKIWRILL  313



>ref|XP_006403499.1| hypothetical protein EUTSA_v10010682mg [Eutrema salsugineum]
 gb|ESQ44952.1| hypothetical protein EUTSA_v10010682mg [Eutrema salsugineum]
Length=234

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 180/218 (83%), Gaps = 5/218 (2%)
 Frame = +1

Query  325  GSDPDKKEQQLPDTVPSQ--SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgi  498
            G D   + +      P Q  S K++TLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT I
Sbjct  17   GEDSLLRHRHSSPLTPPQHLSSKVITLPTVLTLGRVAAVPILVATFYVDCWWGKTATTSI  76

Query  499  fiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWL  678
            FIAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A     +PWL
Sbjct  77   FIAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAIILGPVPWL  136

Query  679  LTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSS  858
            +TVPSIAIIGREITMSAVREWAASQ  KLSEAVAVN+LGKWKTATQM ALTILLA+RDSS
Sbjct  137  VTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALTILLASRDSS  196

Query  859  LVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
                  L+ SG+ LLY+SA L+VWSL VYMRKIW+VLL
Sbjct  197  F---ERLLPSGIVLLYVSAGLSVWSLVVYMRKIWRVLL  231



>ref|XP_010516058.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Camelina sativa]
Length=235

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 173/196 (88%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IFIAAAITDWLDGYIARK +LG+
Sbjct  41   KVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGS  100

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCT+PL+A     +PWL+TVPSIAIIGREITMSAVREWA
Sbjct  101  AFGAFLDPVADKLMVAATLILLCTKPLDAVILGPVPWLVTVPSIAIIGREITMSAVREWA  160

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KLSEAVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY+SA L+
Sbjct  161  ASQNGKLSEAVAVNSLGKWKTATQMIALTILLASRDSSF---ARLLPSGIGLLYVSAGLS  217

Query  925  VWSLFVYMRKIWKVLL  972
            +WSL VYMRKIW+VLL
Sbjct  218  IWSLVVYMRKIWRVLL  233



>ref|XP_009133353.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic [Brassica rapa]
Length=301

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 170/201 (85%), Gaps = 3/201 (1%)
 Frame = +1

Query  370  PSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARK  549
            P  S K+LT+PTILTI RVAAVPLLV+TFY DS WG  ATT I IAAAITDWL GY+ARK
Sbjct  103  PQPSSKVLTIPTILTIARVAAVPLLVATFYADSSWGTTATTSICIAAAITDWLVGYLARK  162

Query  550  KKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSA  729
             KLG+AFGAFLDPVADKLMVAATL+LLCT+P++      +PWLLTVPSIAIIGREITMSA
Sbjct  163  MKLGSAFGAFLDPVADKLMVAATLILLCTKPMDVGVLGPLPWLLTVPSIAIIGREITMSA  222

Query  730  VREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYI  909
            VREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY+
Sbjct  223  VREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLYV  279

Query  910  SAWLAVWSLFVYMRKIWKVLL  972
            SA L+VWSL VYMRKIWKVLL
Sbjct  280  SAGLSVWSLVVYMRKIWKVLL  300



>ref|XP_010509037.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic-like [Camelina sativa]
Length=301

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 181/227 (80%), Gaps = 9/227 (4%)
 Frame = +1

Query  295  PVRSISTTQMGSDPDKKEQQLPDTVPSQSD-KLLTLPTILTIGRVAAVPLLVSTFYVDSW  471
            P  S +      D D  E       P QS  K+LTLPT+LT+GRVAAVP+LV+TFY DSW
Sbjct  82   PRNSFTGHGQLDDGDDDENS-----PHQSSSKVLTLPTVLTLGRVAAVPILVATFYCDSW  136

Query  472  WGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEA  651
            WG  ATT IFIAAAITDWLDGY+ARK KLG+AFGAFLDPVADKLMVAATL+LLCT+P++ 
Sbjct  137  WGTTATTSIFIAAAITDWLDGYLARKMKLGSAFGAFLDPVADKLMVAATLILLCTKPIDV  196

Query  652  SAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALT  831
            +    +PWLLTVPSIAIIGREITMSAVREWAASQ  KL EAVAVNNLGKWKTATQM+ALT
Sbjct  197  AVLGPVPWLLTVPSIAIIGREITMSAVREWAASQNGKLLEAVAVNNLGKWKTATQMTALT  256

Query  832  ILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            ILLA+RDS   + G LV SG  LLY+SA L+V SL VY+RKIWKVLL
Sbjct  257  ILLASRDS---NVGWLVASGAGLLYVSAGLSVLSLVVYIRKIWKVLL  300



>ref|NP_001240075.1| uncharacterized protein LOC100779345 [Glycine max]
 gb|ACU19422.1| unknown [Glycine max]
Length=220

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  361  DTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYI  540
            D   + + K LTLPTILT+GRVAAVPLLV+TFY+D W G   TT IF AAA+TDWLDGYI
Sbjct  16   DRTSNSNSKFLTLPTILTLGRVAAVPLLVATFYMDGWRGTVVTTSIFTAAAVTDWLDGYI  75

Query  541  ARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREIT  720
            ARK K+ + FGAFLDPVADKLMV+ATLVLLCTRPLE + F  +PWLL +PSI IIGREIT
Sbjct  76   ARKMKMKSTFGAFLDPVADKLMVSATLVLLCTRPLEVAVFRQVPWLLIIPSITIIGREIT  135

Query  721  MSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVAL  900
            MSA+REWAASQGSKL E VAVNNLGKWKTA+QM AL ILLATRD S      LVGSGV L
Sbjct  136  MSALREWAASQGSKLLEVVAVNNLGKWKTASQMVALIILLATRDCSRGGPAILVGSGVVL  195

Query  901  LYISAWLAVWSLFVYMRKIWKVL  969
            LYISA LA+WS  VYMR+I KVL
Sbjct  196  LYISAGLALWSFVVYMREICKVL  218



>ref|XP_010504341.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Camelina sativa]
Length=235

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 173/196 (88%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IFIAAAITDWLDGYIARK +LG+
Sbjct  41   KVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGS  100

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCT+P++A     +PWL+TVPSIAIIGREITMSAVREWA
Sbjct  101  AFGAFLDPVADKLMVAATLILLCTKPMDAVLLGPVPWLVTVPSIAIIGREITMSAVREWA  160

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KLSEAVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY+SA L+
Sbjct  161  ASQNGKLSEAVAVNSLGKWKTATQMIALTILLASRDSSF---ARLLPSGIGLLYVSAGLS  217

Query  925  VWSLFVYMRKIWKVLL  972
            +WSL VYMRKIW+VLL
Sbjct  218  IWSLVVYMRKIWRVLL  233



>ref|XP_009144774.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic-like [Brassica rapa]
Length=270

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 171/196 (87%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+ RVAAVPLLV+TFYVD WWG  ATT IF+AAA+TDWLDGY+ARK KLG+
Sbjct  77   KVLTLPTVLTLCRVAAVPLLVATFYVDGWWGATATTSIFVAAAVTDWLDGYLARKMKLGS  136

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREITMSAVREWA
Sbjct  137  AFGAFLDPVADKLMVAATLILLCTKPIDVAVLGPVPWLLTVPSIAIIGREITMSAVREWA  196

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RD S+   G LV SG  LLY+SA L+
Sbjct  197  ASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDRSV---GWLVASGAGLLYVSAGLS  253

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMR IWKVLL
Sbjct  254  VWSLLVYMRMIWKVLL  269



>gb|KHN03200.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Glycine soja]
Length=216

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  361  DTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYI  540
            D   + + K LTLPTILT+GRVAAVPLLV+TFY+D W G   TT IF AAA+TDWLDGYI
Sbjct  12   DRTSNSNSKFLTLPTILTLGRVAAVPLLVATFYMDGWRGTVVTTSIFTAAAVTDWLDGYI  71

Query  541  ARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREIT  720
            ARK K+ + FGAFLDPVADKLMV+ATLVLLCTRPLE + F  +PWLL +PSI IIGREIT
Sbjct  72   ARKMKMKSTFGAFLDPVADKLMVSATLVLLCTRPLEVAVFRQVPWLLIIPSITIIGREIT  131

Query  721  MSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVAL  900
            MSA+REWAASQGSKL E VAVNNLGKWKTA+QM AL ILLATRD S      LVGSGV L
Sbjct  132  MSALREWAASQGSKLLEVVAVNNLGKWKTASQMVALIILLATRDCSRGGPAILVGSGVVL  191

Query  901  LYISAWLAVWSLFVYMRKIWKVL  969
            LYISA LA+WS  VYMR+I KVL
Sbjct  192  LYISAGLALWSFVVYMREICKVL  214



>gb|AFW88763.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Zea mays]
Length=347

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = +1

Query  349  QQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWL  528
            ++ P T P    +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWL
Sbjct  142  KEEPATAPP---RLLTLPTVLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWL  198

Query  529  DGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIG  708
            DGYIARK +LGT FGAFLDPVADKLMVAATLVLLCT+PLE S     PWLLTVPSIAIIG
Sbjct  199  DGYIARKMQLGTPFGAFLDPVADKLMVAATLVLLCTKPLETSLLNDGPWLLTVPSIAIIG  258

Query  709  REITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGS  888
            REITMSAVREWAASQ S+  EAVAVNNLGKWKTATQM+ALT+LLA+RD S+   GALV  
Sbjct  259  REITMSAVREWAASQNSEALEAVAVNNLGKWKTATQMTALTLLLASRDPSVPAQGALVAP  318

Query  889  GVALLYISAWLAVWSLFVYMRKIWKVLL  972
            GVALLYISA LA+WSL VYMRKIW+ LL
Sbjct  319  GVALLYISAGLAIWSLVVYMRKIWRTLL  346



>emb|CDX73415.1| BnaC08g25880D [Brassica napus]
Length=219

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 182/220 (83%), Gaps = 6/220 (3%)
 Frame = +1

Query  322  MGSDPDKK--EQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattg  495
            MG + D    +Q   D   S S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT 
Sbjct  1    MGEEEDSVTVDQNSCDGADSSSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTS  60

Query  496  ifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVH-MP  672
            +FIAAAITDWLDGY+ARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A   +  +P
Sbjct  61   LFIAAAITDWLDGYLARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAVVVLGPIP  120

Query  673  WLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRD  852
            WL+TVPSIAIIGREITMSAVREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RD
Sbjct  121  WLVTVPSIAIIGREITMSAVREWAASQNGKLSKAVAVNSLGKWKTATQMIALTILLASRD  180

Query  853  SSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            SS      L+ SG+ LLY+SA L++WSL VYMR+I +VLL
Sbjct  181  SSF---ERLLPSGIGLLYVSAGLSIWSLVVYMRQIMRVLL  217



>ref|NP_191063.1| phosphatidylglycerolphosphate synthase 2 [Arabidopsis thaliana]
 sp|Q9M2W3.1|PGPS2_ARATH RecName: Full=CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2; AltName: Full=Phosphatidylglycerophosphate 
synthase 2; Short=PGP synthase 2 [Arabidopsis thaliana]
 gb|AAK44001.1|AF370186_1 putative phosphatidylglycerophosphate synthase [Arabidopsis thaliana]
 emb|CAB82698.1| phosphatidylglycerophosphate synthase-like protein [Arabidopsis 
thaliana]
 gb|AAL15250.1| putative phosphatidylglycerophosphate synthase [Arabidopsis thaliana]
 gb|AEE79330.1| phosphatidylglycerolphosphate synthase 2 [Arabidopsis thaliana]
Length=233

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 181/227 (80%), Gaps = 7/227 (3%)
 Frame = +1

Query  304  SISTTQMGSDPD---KKEQQLPDTVPSQ-SDKLLTLPTILTIGRVAAVPLLVSTFYVDSW  471
            ++     G   D   +     P   P+Q S K++TLPT+LT+GRVAAVP+LV+TFYVD W
Sbjct  8    TVDQNSFGGGKDSLLRNRHSSPLPSPTQLSSKVITLPTVLTLGRVAAVPILVATFYVDCW  67

Query  472  WGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEA  651
            WG  ATT IFIAAAITDWLDGYIARK +LG+ FGAFLDPVADKLMVAATL+LLCT+P+ A
Sbjct  68   WGRTATTSIFIAAAITDWLDGYIARKMRLGSEFGAFLDPVADKLMVAATLILLCTKPMVA  127

Query  652  SAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALT  831
                 +PWL+TVPSIAIIGREITMSAVREWAASQ  KLSEAVAVN+LGKWKTATQM ALT
Sbjct  128  VVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALT  187

Query  832  ILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            ILLA+RDSS      L+ SG+ LLY+SA L++WSL VYMRKIW+VLL
Sbjct  188  ILLASRDSSF---ERLLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLL  231



>ref|XP_010517266.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic-like [Camelina sativa]
Length=304

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 175/202 (87%), Gaps = 4/202 (2%)
 Frame = +1

Query  370  PSQSD-KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIAR  546
            P QS  K+LTLPT+LT+GRVAAVP+LV+TFY DSWWG  ATT IFIAAAITDWLDGY+AR
Sbjct  105  PHQSSSKVLTLPTVLTLGRVAAVPILVATFYCDSWWGTTATTSIFIAAAITDWLDGYLAR  164

Query  547  KKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMS  726
            K KLG+AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREITMS
Sbjct  165  KMKLGSAFGAFLDPVADKLMVAATLILLCTKPIDVAVLGPVPWLLTVPSIAIIGREITMS  224

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLY  906
            AVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY
Sbjct  225  AVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLY  281

Query  907  ISAWLAVWSLFVYMRKIWKVLL  972
            +SA L+V SL VY+RKIWKVLL
Sbjct  282  VSAGLSVLSLVVYIRKIWKVLL  303



>ref|XP_010427243.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Camelina sativa]
Length=235

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 172/196 (88%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IFIAAAITDWLDGYIARK +LG+
Sbjct  41   KVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGS  100

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+LLCT+P++      +PWL+TVPSIAIIGREITMSAVREWA
Sbjct  101  AFGAFLDPVADKLMVAATLILLCTKPMDYVVLGPVPWLVTVPSIAIIGREITMSAVREWA  160

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KLSEAVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY+SA L+
Sbjct  161  ASQNGKLSEAVAVNSLGKWKTATQMIALTILLASRDSSF---ARLLPSGIGLLYVSAGLS  217

Query  925  VWSLFVYMRKIWKVLL  972
            +WSL VYMRKIW+VLL
Sbjct  218  IWSLVVYMRKIWRVLL  233



>ref|XP_002281544.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Vitis vinifera]
Length=348

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLL+ TFYVDSWWG   TT IFIAAAITDWLDGY+ARK +LGT FGAFLDPVAD
Sbjct  163  GRVAAVPLLIGTFYVDSWWGTTTTTTIFIAAAITDWLDGYLARKMRLGTTFGAFLDPVAD  222

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLC+RPLE   F  +PWLLTVPSIAIIGREITMSAVREWAASQ ++L EAV
Sbjct  223  KLMVAATLVLLCSRPLEVGMFGPVPWLLTVPSIAIIGREITMSAVREWAASQNTELLEAV  282

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM++LT+LLA RDSSL  AG LV SGV LLYISA LAVWSL VYMRKI
Sbjct  283  AVNNLGKWKTATQMTSLTVLLAARDSSLTAAGGLVASGVVLLYISAGLAVWSLVVYMRKI  342

Query  958  WKVLL  972
            WKVL+
Sbjct  343  WKVLI  347



>ref|XP_010556265.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Tarenaya hassleriana]
 ref|XP_010556332.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Tarenaya hassleriana]
Length=273

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 173/196 (88%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K LTLPT+LT+GRVAAVP+L++TFYVD W    ATT  FIA AITDWLDGYIARK +L +
Sbjct  80   KFLTLPTVLTLGRVAAVPILIATFYVDRWGATTATTSFFIAPAITDWLDGYIARKMRLDS  139

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKL+VAATL+LLCT P++ +AF  +PWL+TVPSIAIIGREITMSAVREWA
Sbjct  140  AFGAFLDPVADKLIVAATLILLCTSPMDIAAFGPVPWLMTVPSIAIIGREITMSAVREWA  199

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ ++LSEAVAVN+LGKWKTATQM+ALTILLATRDSS+   G LV SGVALLY+SA L+
Sbjct  200  ASQNNQLSEAVAVNSLGKWKTATQMTALTILLATRDSSV---GGLVASGVALLYVSAGLS  256

Query  925  VWSLFVYMRKIWKVLL  972
            +WSL VYMRKIW+VLL
Sbjct  257  MWSLVVYMRKIWRVLL  272



>ref|XP_010505596.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic-like [Camelina sativa]
Length=301

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 175/202 (87%), Gaps = 4/202 (2%)
 Frame = +1

Query  370  PSQSD-KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIAR  546
            P QS  K+LTLPT+LT+GRVAAVP+LV+TFY DSWWG  ATT IFIAAAITDWLDGY+AR
Sbjct  102  PHQSSSKVLTLPTMLTLGRVAAVPILVATFYCDSWWGTTATTSIFIAAAITDWLDGYLAR  161

Query  547  KKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMS  726
            K KLG+AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREITMS
Sbjct  162  KMKLGSAFGAFLDPVADKLMVAATLILLCTKPIDVAVLGPVPWLLTVPSIAIIGREITMS  221

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLY  906
            AVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  LLY
Sbjct  222  AVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAGLLY  278

Query  907  ISAWLAVWSLFVYMRKIWKVLL  972
            +SA L+V SL VY+RKIWK+LL
Sbjct  279  VSAGLSVLSLVVYIRKIWKLLL  300



>ref|XP_009139204.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Brassica rapa]
 emb|CDX76125.1| BnaA04g03890D [Brassica napus]
Length=234

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 174/201 (87%), Gaps = 3/201 (1%)
 Frame = +1

Query  370  PSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARK  549
            P  S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IFIAAAITDWLDGYIARK
Sbjct  34   PHLSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARK  93

Query  550  KKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSA  729
             +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A     +PWL+TVPSIAIIGREITMSA
Sbjct  94   MRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAIVLGPVPWLVTVPSIAIIGREITMSA  153

Query  730  VREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYI  909
            VREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY+
Sbjct  154  VREWAASQNGKLSQAVAVNSLGKWKTATQMIALTILLASRDSSF---ERLLPSGIGLLYV  210

Query  910  SAWLAVWSLFVYMRKIWKVLL  972
            SA L+VWSL VYMR+I +VLL
Sbjct  211  SAGLSVWSLVVYMRQIMRVLL  231



>emb|CDY02903.1| BnaC04g25830D [Brassica napus]
Length=234

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 174/201 (87%), Gaps = 3/201 (1%)
 Frame = +1

Query  370  PSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARK  549
            P  S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IFIAAAITDWLDGYIARK
Sbjct  34   PHLSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARK  93

Query  550  KKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSA  729
             +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A     +PWL+TVPSIAIIGREITMSA
Sbjct  94   MRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAIVLGPVPWLVTVPSIAIIGREITMSA  153

Query  730  VREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYI  909
            VREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY+
Sbjct  154  VREWAASQNGKLSQAVAVNSLGKWKTATQMIALTILLASRDSSF---ERLLPSGIGLLYV  210

Query  910  SAWLAVWSLFVYMRKIWKVLL  972
            SA L+VWSL VYMR+I +VLL
Sbjct  211  SAGLSVWSLVVYMRQIMRVLL  231



>ref|XP_010032250.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic [Eucalyptus grandis]
 gb|KCW51656.1| hypothetical protein EUGRSUZ_J01141 [Eucalyptus grandis]
Length=239

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            +DKLLTLPT+LT+GRVAAVPL VSTFYVDSWWG  ATT IFIAAAITDWLDGY+ARK +L
Sbjct  41   ADKLLTLPTVLTLGRVAAVPLFVSTFYVDSWWGTTATTSIFIAAAITDWLDGYLARKMRL  100

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVRE  738
            G+ FGAFLDPVADKLMVAA LVLLCTRPL+   F   PWL+TVPSIAIIGREITMSAVRE
Sbjct  101  GSVFGAFLDPVADKLMVAAALVLLCTRPLDVDMFEQAPWLMTVPSIAIIGREITMSAVRE  160

Query  739  WAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAW  918
            WAASQ SK+ EAVAVNNLGKWKTA QM+ALTILLATRDSSL  +  L+ SGVALLYISA 
Sbjct  161  WAASQNSKILEAVAVNNLGKWKTAMQMTALTILLATRDSSLGGSDTLIASGVALLYISAG  220

Query  919  LAVWSLFVYMRKIWKVLL  972
            LA+WSL VY+ KIWKVL+
Sbjct  221  LAIWSLIVYVGKIWKVLI  238



>emb|CDX77586.1| BnaA07g07240D [Brassica napus]
Length=270

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 170/196 (87%), Gaps = 3/196 (2%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+ RVAAVPLLV+TFYVD WWG  ATT IF+AAA+TDWLDGY+ARK KLG+
Sbjct  77   KVLTLPTVLTLCRVAAVPLLVATFYVDGWWGATATTSIFVAAAVTDWLDGYLARKMKLGS  136

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
            AFGAFLDPVADKLMVAATL+ LCT+P++ +    +PWLLTVPSIAIIGREITMSAVREWA
Sbjct  137  AFGAFLDPVADKLMVAATLISLCTKPIDVAVLGPVPWLLTVPSIAIIGREITMSAVREWA  196

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RD S+   G LV SG  LLY+SA L+
Sbjct  197  ASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDLSV---GWLVASGAGLLYVSAGLS  253

Query  925  VWSLFVYMRKIWKVLL  972
            VWSL VYMR IWKVLL
Sbjct  254  VWSLLVYMRMIWKVLL  269



>ref|XP_010253445.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Nelumbo nucifera]
Length=348

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLVSTFY+++WWG  ATT IFIAAA+TDWLDGYIARK +LGT FGAFLDPVAD
Sbjct  163  GRVAAVPLLVSTFYMNNWWGTTATTSIFIAAAVTDWLDGYIARKMRLGTTFGAFLDPVAD  222

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRP EA+ F  +PWLLTVPSI IIGREITMSAVREWAASQ SK+ EAV
Sbjct  223  KLMVAATLVLLCTRPSEAAIFGDVPWLLTVPSIVIIGREITMSAVREWAASQNSKVLEAV  282

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM+ALTILL TRDSSL   G LV SGV LLYISA LAVWSL VYMRKI
Sbjct  283  AVNNLGKWKTATQMTALTILLVTRDSSLSGLGTLVASGVVLLYISAGLAVWSLAVYMRKI  342

Query  958  WKVLL  972
            W++LL
Sbjct  343  WRILL  347



>ref|XP_009420343.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Musa acuminata subsp. malaccensis]
Length=275

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 173/218 (79%), Gaps = 0/218 (0%)
 Frame = +1

Query  319  QMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgi  498
            +M      K+   P    S + KLLTLPT+LTIGRVAAVPLLVSTFYVD WW   ATTGI
Sbjct  57   EMNGSGSVKQSPPPLLQQSGTPKLLTLPTVLTIGRVAAVPLLVSTFYVDGWWATTATTGI  116

Query  499  fiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWL  678
            F+ AA+TDWLDGYIARK +LGTAFGAFLDPVADKLMV+ATLVLLCT+PL+ + F  +PWL
Sbjct  117  FLLAALTDWLDGYIARKMRLGTAFGAFLDPVADKLMVSATLVLLCTKPLKCAVFWDVPWL  176

Query  679  LTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSS  858
            L  PSI IIGREITMS+VREWAASQ  +  EAVAVN+ GKWKTATQM ALT+LLA+RD  
Sbjct  177  LAAPSITIIGREITMSSVREWAASQNGRALEAVAVNSFGKWKTATQMIALTVLLASRDPR  236

Query  859  LVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            L     LV +GV LLYISA LAVWSL VYM+KIW++LL
Sbjct  237  LAAMTGLVAAGVVLLYISAGLAVWSLVVYMKKIWRLLL  274



>ref|XP_009103950.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Brassica rapa]
Length=217

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 178/217 (82%), Gaps = 3/217 (1%)
 Frame = +1

Query  322  MGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgif  501
            MG +   +  Q        S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IF
Sbjct  1    MGEEDTAELDQNSYNGGEDSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIF  60

Query  502  iaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLL  681
            IAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A  F  +PWL+
Sbjct  61   IAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAVVFGPVPWLV  120

Query  682  TVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSL  861
            TVPSIAIIGREITMSAVREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSS 
Sbjct  121  TVPSIAIIGREITMSAVREWAASQNGKLSKAVAVNSLGKWKTATQMIALTILLASRDSSF  180

Query  862  VDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
                 L+  G+ LLY+SA L++WSL VYMR+I +VLL
Sbjct  181  ---ERLLPPGIGLLYVSAGLSIWSLVVYMRQIVRVLL  214



>emb|CDX67621.1| BnaA07g16610D [Brassica napus]
Length=217

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 178/217 (82%), Gaps = 3/217 (1%)
 Frame = +1

Query  322  MGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgif  501
            MG +   +  Q        S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT IF
Sbjct  1    MGEEDAAELDQNSYNGGEDSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIF  60

Query  502  iaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLL  681
            IAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A  F  +PWL+
Sbjct  61   IAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAVVFGPVPWLV  120

Query  682  TVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSL  861
            TVPSIAIIGREITMSAVREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSS 
Sbjct  121  TVPSIAIIGREITMSAVREWAASQNGKLSKAVAVNSLGKWKTATQMIALTILLASRDSSF  180

Query  862  VDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
                 L+  G+ LLY+SA L++WSL VYMR+I +VLL
Sbjct  181  ---ERLLPPGIGLLYVSAGLSIWSLVVYMRQIVRVLL  214



>ref|XP_004143599.1| PREDICTED: uncharacterized protein LOC101221229 [Cucumis sativus]
 gb|KGN50484.1| hypothetical protein Csa_5G177040 [Cucumis sativus]
Length=371

 Score =   279 bits (714),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 185/236 (78%), Gaps = 22/236 (9%)
 Frame = +1

Query  265  FHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLL  444
            FHN+  SPL+                  Q  P     Q  KLLTLPTILT+ RV AVP+ 
Sbjct  157  FHNQTPSPLM-----------------HQHEP-----QHSKLLTLPTILTLARVVAVPIF  194

Query  445  VSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLV  624
            V TFYVD+WWG  ATT IFIAAA+TDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+
Sbjct  195  VCTFYVDNWWGTTATTSIFIAAAVTDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLI  254

Query  625  LLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWK  804
            LLCT+PLE S F H+PWLLT+PSIAIIGREITMSAVREWAASQ SKL EAVAVNNLGKWK
Sbjct  255  LLCTQPLEVSVFGHIPWLLTLPSIAIIGREITMSAVREWAASQNSKLLEAVAVNNLGKWK  314

Query  805  TATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            TATQM ALT LLA+RDSSL  +G +V +GV LLYISAWLAVWSLFVY RKI KVLL
Sbjct  315  TATQMIALTTLLASRDSSLGGSGIVVATGVVLLYISAWLAVWSLFVYSRKISKVLL  370



>ref|XP_008445828.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Cucumis melo]
Length=371

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 184/236 (78%), Gaps = 22/236 (9%)
 Frame = +1

Query  265  FHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLL  444
            FHN+  SPL                   Q  P     Q  KLLTLPTILT+ RV AVP+ 
Sbjct  157  FHNQTPSPL-----------------THQHEP-----QRSKLLTLPTILTLARVVAVPIF  194

Query  445  VSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLV  624
            V TFYVD+WWG  ATT IFIAAA+TDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+
Sbjct  195  VCTFYVDNWWGTTATTSIFIAAAVTDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLI  254

Query  625  LLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWK  804
            LLCT+PLE S F H+PWLLT+PSIAIIGREITMSAVREWAASQ SKL EAVAVNNLGKWK
Sbjct  255  LLCTQPLEVSVFGHIPWLLTLPSIAIIGREITMSAVREWAASQNSKLLEAVAVNNLGKWK  314

Query  805  TATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            TATQM ALT LLA+RDSSL  +G +V +GV LLYISAWLAVWSLFVY RKI KVLL
Sbjct  315  TATQMIALTTLLASRDSSLGGSGIVVATGVVLLYISAWLAVWSLFVYSRKISKVLL  370



>ref|XP_002525055.1| cdp-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, 
putative [Ricinus communis]
 gb|EEF37302.1| cdp-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, 
putative [Ricinus communis]
Length=359

 Score =   276 bits (707),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLVSTFYVDSWWG  ATT IFIAAA+TDWLDGY+ARK +LG+AFGAFLDPVAD
Sbjct  174  GRVAAVPLLVSTFYVDSWWGRTATTSIFIAAAVTDWLDGYLARKMRLGSAFGAFLDPVAD  233

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATL+LLCT+P E + F  +PWLLTVPSIAIIGREITMSAVREWAASQ +KL EAV
Sbjct  234  KLMVAATLILLCTKPPEVAIFGQVPWLLTVPSIAIIGREITMSAVREWAASQNAKLLEAV  293

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM ALTILLATR+S+L   G LV SGV LLYISA L+VWSL VYM KI
Sbjct  294  AVNNLGKWKTATQMIALTILLATRESTLGGPGVLVASGVVLLYISAGLSVWSLVVYMSKI  353

Query  958  WKVLL  972
            W+VLL
Sbjct  354  WRVLL  358



>ref|XP_008233394.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Prunus mume]
Length=377

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVA+VP+L+STFYVDS WG  ATT IFIAAAITDWLDGYIARK +LG+AFGAFLDPVAD
Sbjct  192  GRVASVPILISTFYVDSRWGTTATTSIFIAAAITDWLDGYIARKMRLGSAFGAFLDPVAD  251

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLC+RPL+ + F  +PWLL VPSIAIIGREITMSAVREWAASQ SKL EAV
Sbjct  252  KLMVAATLVLLCSRPLDVAMFGQVPWLLVVPSIAIIGREITMSAVREWAASQNSKLLEAV  311

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM ALT+LLATRDSSL    ALV SGVALLYISA LAVWSL VYM KI
Sbjct  312  AVNNLGKWKTATQMIALTVLLATRDSSLGRPEALVASGVALLYISAGLAVWSLVVYMSKI  371

Query  958  WKVLL  972
            WKVLL
Sbjct  372  WKVLL  376



>ref|XP_007218141.1| hypothetical protein PRUPE_ppa007257mg [Prunus persica]
 gb|EMJ19340.1| hypothetical protein PRUPE_ppa007257mg [Prunus persica]
Length=376

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVA+VP+L+STFYVDS WG  ATT IFIAAAITDWLDGYIARK +LG+AFGAFLDPVAD
Sbjct  191  GRVASVPILISTFYVDSRWGTTATTSIFIAAAITDWLDGYIARKMRLGSAFGAFLDPVAD  250

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLC+RPL+ + F  +PWLL VPSIAIIGREITMSAVREWAASQ SKL EAV
Sbjct  251  KLMVAATLVLLCSRPLDVAMFGQVPWLLVVPSIAIIGREITMSAVREWAASQNSKLLEAV  310

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM ALT+LLATRDSSL    ALV SGVALLYISA LAVWSL VYM KI
Sbjct  311  AVNNLGKWKTATQMIALTVLLATRDSSLGRPEALVASGVALLYISAGLAVWSLVVYMSKI  370

Query  958  WKVLL  972
            WKVLL
Sbjct  371  WKVLL  375



>ref|XP_009116201.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Brassica rapa]
Length=227

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 175/202 (87%), Gaps = 4/202 (2%)
 Frame = +1

Query  370  PSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARK  549
            P  S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT +FIAAAITDWLDGY+ARK
Sbjct  27   PQLSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSLFIAAAITDWLDGYLARK  86

Query  550  KKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVH-MPWLLTVPSIAIIGREITMS  726
             +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A   +  +PWL+TVPSIAIIGREITMS
Sbjct  87   MRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAVVVLGPVPWLVTVPSIAIIGREITMS  146

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLY  906
            AVREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY
Sbjct  147  AVREWAASQNGKLSKAVAVNSLGKWKTATQMIALTILLASRDSSF---ERLLPSGIGLLY  203

Query  907  ISAWLAVWSLFVYMRKIWKVLL  972
            +SA L++WSL VYMR+I +VLL
Sbjct  204  VSAGLSIWSLVVYMRQIMRVLL  225



>ref|XP_002311126.2| hypothetical protein POPTR_0008s04650g [Populus trichocarpa]
 gb|EEE88493.2| hypothetical protein POPTR_0008s04650g [Populus trichocarpa]
Length=360

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 180/215 (84%), Gaps = 3/215 (1%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSD---KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifia  507
            + ++ Q P   PS  +   KLLTLPTILT+GRVAAVPLLV+TFYVDSWW   ATT IF+A
Sbjct  145  NDRQNQPPSVSPSMQNHDSKLLTLPTILTLGRVAAVPLLVATFYVDSWWARTATTSIFVA  204

Query  508  aaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTV  687
            AAITDWLDGY+ARK KLGT FGAFLDPVADKLMVAA L+LLC+RPLE + F  +PWL TV
Sbjct  205  AAITDWLDGYLARKMKLGTVFGAFLDPVADKLMVAAALILLCSRPLEVAMFREVPWLFTV  264

Query  688  PSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVD  867
            P+IAIIGREITMSAVREWAASQ ++L EAVAVNNLGKWKTATQM +LTILLATRDSSL  
Sbjct  265  PAIAIIGREITMSAVREWAASQNTRLLEAVAVNNLGKWKTATQMISLTILLATRDSSLGG  324

Query  868  AGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
             G LV SGV LLYISA L+VWSL +YM KIWKVLL
Sbjct  325  PGILVPSGVLLLYISAGLSVWSLAIYMSKIWKVLL  359



>ref|XP_004307437.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=234

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = +1

Query  334  PDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaa  513
            PD    +     P QS KLLTLPTILT+GRVAAVPLL+STFYVDSW G  ATT IFIAAA
Sbjct  21   PDHHHDRSQPPPPHQSTKLLTLPTILTLGRVAAVPLLISTFYVDSWLGKTATTSIFIAAA  80

Query  514  itDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPS  693
            ITDWLDGY+ARK +LG+AFGAFLDPVADKLMVAATLVLLC+RP + +AF  + WLL VPS
Sbjct  81   ITDWLDGYLARKMRLGSAFGAFLDPVADKLMVAATLVLLCSRPQDVAAFGQVQWLLVVPS  140

Query  694  IAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAG  873
            IAIIGREITMSAVREWAASQ +KL EAVAVNNLGKWKTA QM ALTILLATRDSSL  + 
Sbjct  141  IAIIGREITMSAVREWAASQNTKLLEAVAVNNLGKWKTAAQMIALTILLATRDSSLGGSE  200

Query  874  ALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
             +V SGV LLYISA LAVWSL VYM KIWKVLL
Sbjct  201  FVVASGVVLLYISAGLAVWSLVVYMSKIWKVLL  233



>emb|CDY07505.1| BnaC06g15590D [Brassica napus]
Length=227

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 176/210 (84%), Gaps = 3/210 (1%)
 Frame = +1

Query  343  KEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitD  522
            ++  L +  P  S K+LTLPT+LT+GRVAAVP+LV++FYVD WWG  ATT IFIAAA TD
Sbjct  18   EDSSLHNPTPQLSSKVLTLPTVLTLGRVAAVPILVASFYVDCWWGRTATTSIFIAAAFTD  77

Query  523  WLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAI  702
            WLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A     +PWL+TVPSIAI
Sbjct  78   WLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDALVLGPVPWLVTVPSIAI  137

Query  703  IGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALV  882
            IGREITMSAVREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSSL     L+
Sbjct  138  IGREITMSAVREWAASQNGKLSKAVAVNSLGKWKTATQMIALTILLASRDSSL---ERLL  194

Query  883  GSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
              G+ LLY+SA L++ SL VYMR+I +VLL
Sbjct  195  PPGIGLLYVSAGLSILSLVVYMRQIVRVLL  224



>emb|CDY51439.1| BnaA09g54840D [Brassica napus]
Length=227

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 175/202 (87%), Gaps = 4/202 (2%)
 Frame = +1

Query  370  PSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARK  549
            P  S K+LTLPT+LT+GRVAAVP+LV+TFYVD WWG  ATT +FIAAAITDWLDGY+ARK
Sbjct  27   PQLSSKVLTLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSLFIAAAITDWLDGYLARK  86

Query  550  KKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVH-MPWLLTVPSIAIIGREITMS  726
             +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A   +  +PWL+TVPSIAIIGREITMS
Sbjct  87   LRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAVVVLGPVPWLVTVPSIAIIGREITMS  146

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLY  906
            AVREWAASQ  KLS+AVAVN+LGKWKTATQM ALTILLA+RDSS      L+ SG+ LLY
Sbjct  147  AVREWAASQNGKLSKAVAVNSLGKWKTATQMIALTILLASRDSSF---ERLLPSGIGLLY  203

Query  907  ISAWLAVWSLFVYMRKIWKVLL  972
            +SA L++WSL VYMR+I +VLL
Sbjct  204  VSAGLSIWSLVVYMRQIMRVLL  225



>ref|XP_007139084.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
 gb|ESW11078.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
Length=225

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            + K LTLPTILT+GRVA++PLLV+TF++D W G  ATTGIF AAA+TDWLDGYIARK K+
Sbjct  25   NSKFLTLPTILTLGRVASIPLLVATFFMDGWRGTVATTGIFTAAAVTDWLDGYIARKMKM  84

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVRE  738
             + FGAFLDPVADKLMV+ATLVLLCTRPLE + F   PWLL +PSI IIGREITMSA+RE
Sbjct  85   KSTFGAFLDPVADKLMVSATLVLLCTRPLEVAVFGQFPWLLIIPSITIIGREITMSALRE  144

Query  739  WAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAW  918
            WAASQGSKL E VAVNNLGKWKTATQM AL ILLATRD S      LVGSGV LLYISA 
Sbjct  145  WAASQGSKLLEVVAVNNLGKWKTATQMVALIILLATRDCSRGGPAILVGSGVVLLYISAG  204

Query  919  LAVWSLFVYMRKIWKVL  969
            L++WS  VY R+I KVL
Sbjct  205  LSLWSFVVYTREICKVL  221



>ref|XP_004497372.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase-like 
[Cicer arietinum]
Length=290

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IFIAA++TDWLDGYIARK KL ++FGAFLDPVAD
Sbjct  105  GRVAAVPLLVATFYMDGWRGTAATTTIFIAASVTDWLDGYIARKMKLKSSFGAFLDPVAD  164

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+A  F   PWLL +PSI IIGREITMSAVREWAASQ SKL EAV
Sbjct  165  KLMVAATLVLLCTRPLDAGVFGQAPWLLPIPSILIIGREITMSAVREWAASQDSKLLEAV  224

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM+AL ILLATRD S  +   ++GSGVALLY SA LA+WSLFVYMRKI
Sbjct  225  AVNNLGKWKTATQMTALAILLATRDLSHGEGALVIGSGVALLYTSAGLALWSLFVYMRKI  284

Query  958  WKVLL  972
            WKVLL
Sbjct  285  WKVLL  289



>ref|XP_007139087.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
 gb|ESW11081.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
Length=223

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            + K LTLPTILT+GRVA++PLLV+TF++D W G  ATTGIF AAA+TDWLDGYIARK K+
Sbjct  25   NSKFLTLPTILTLGRVASIPLLVATFFMDGWRGTVATTGIFTAAAVTDWLDGYIARKMKM  84

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVRE  738
             + FGAFLDPVADKLMV+ATLVLLCTRPLE + F   PWLL +PSI IIGREITMSA+RE
Sbjct  85   KSTFGAFLDPVADKLMVSATLVLLCTRPLEVAVFGQFPWLLIIPSITIIGREITMSALRE  144

Query  739  WAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAW  918
            WAASQGSKL E VAVNNLGKWKTATQM AL ILLATRD S      LVGSGV LLYISA 
Sbjct  145  WAASQGSKLLEVVAVNNLGKWKTATQMVALIILLATRDCSRGGPAILVGSGVVLLYISAG  204

Query  919  LAVWSLFVYMRKIWKVL  969
            L++WS  VY R+I KVL
Sbjct  205  LSLWSFVVYTREICKVL  221



>ref|XP_011012888.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2 [Populus euphratica]
Length=361

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 180/215 (84%), Gaps = 3/215 (1%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSD---KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifia  507
            + ++ Q P   PS  +   KLLTLPTILT+GRVAAVPLLV+TFYVDSWW   ATT IF+A
Sbjct  146  NDRQIQPPSMSPSMQNHDSKLLTLPTILTLGRVAAVPLLVATFYVDSWWARTATTSIFVA  205

Query  508  aaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTV  687
            AAITDWLDGY+ARK KLGT FGAFLDPVADKLMVAATL+LLC+RPLE + F  +PWL TV
Sbjct  206  AAITDWLDGYLARKMKLGTVFGAFLDPVADKLMVAATLILLCSRPLELAMFREVPWLFTV  265

Query  688  PSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVD  867
            P+IAIIGREITMSAVREWAASQ ++L EAVAVNNLGKWKTATQM +LTILLATRDSSL  
Sbjct  266  PAIAIIGREITMSAVREWAASQNTRLLEAVAVNNLGKWKTATQMISLTILLATRDSSLGG  325

Query  868  AGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
             G LV  GV LLYISA L+VWSL +YM KIWKVLL
Sbjct  326  PGILVPLGVLLLYISAGLSVWSLAIYMSKIWKVLL  360



>gb|ACZ51242.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase 
[Arachis hypogaea]
Length=311

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 196/252 (78%), Gaps = 8/252 (3%)
 Frame = +1

Query  226  PVRGVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDT-VPSQSD--KLLT  396
            P +G     ++   HN +       R IS+     DPD +        +PS S+  KLLT
Sbjct  64   PSQGSTRKSVTFAPHNNNSFS----RCISS-DTAKDPDTRGPGPGPGPLPSHSEPSKLLT  118

Query  397  LPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGA  576
            LPT+LT+GRVA+VP+LV+TFYVD+ WGPAATT IFIAAA+TDWLDGY+ARK KL ++FGA
Sbjct  119  LPTMLTLGRVASVPVLVATFYVDAPWGPAATTSIFIAAAVTDWLDGYLARKMKLKSSFGA  178

Query  577  FLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQG  756
            FLDPVADKLMVAATL+LLC++PL+ +AF   PWLLTVPSIAIIGREITMSAVREWAASQ 
Sbjct  179  FLDPVADKLMVAATLLLLCSKPLDVAAFSQAPWLLTVPSIAIIGREITMSAVREWAASQD  238

Query  757  SKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSL  936
            +KL EAVAVNNLGKWKTATQM+ALTILLATR  S   A  +VGSGV LLY SA LAVWSL
Sbjct  239  TKLLEAVAVNNLGKWKTATQMTALTILLATRGWSDGGAALVVGSGVGLLYTSAGLAVWSL  298

Query  937  FVYMRKIWKVLL  972
             VYMRKIWKVL+
Sbjct  299  VVYMRKIWKVLM  310



>ref|XP_009412608.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Musa acuminata subsp. malaccensis]
Length=356

 Score =   271 bits (692),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 186/239 (78%), Gaps = 4/239 (2%)
 Frame = +1

Query  262  GFHNRDCSPLL-PVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVP  438
            G   RD   ++ P  S      GS P +++Q+      S    LLTLPT+LT+GRVAAVP
Sbjct  121  GAGERDAVQVVGPAESGEMEINGSHPPRQQQEQRS---SDPPTLLTLPTVLTLGRVAAVP  177

Query  439  LLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAAT  618
            LLV T+Y++ WW   ATT IFIAAAITDWLDGYIARKK LGTAFGAFLDPVADKLMVAAT
Sbjct  178  LLVCTYYMNGWWATTATTSIFIAAAITDWLDGYIARKKHLGTAFGAFLDPVADKLMVAAT  237

Query  619  LVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGK  798
            LVLLCTRPLE   F  +PWLLT+PSIAIIGREITMSAVREWAASQ SK+ EAVAVN LGK
Sbjct  238  LVLLCTRPLEVGTFGEVPWLLTIPSIAIIGREITMSAVREWAASQNSKVLEAVAVNKLGK  297

Query  799  WKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLLV  975
            WKTA QM ALTILLATRDS+L     +V SGVALLY+SA LAVWSL VYMR IW+++L+
Sbjct  298  WKTAMQMIALTILLATRDSNLTGIDMVVASGVALLYVSASLAVWSLVVYMRNIWRLMLM  356



>ref|XP_004984797.1| PREDICTED: cardiolipin synthase-like [Setaria italica]
Length=328

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +1

Query  403  TILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFL  582
            T+LTIGRVAAVPLL+STFY++  W   ATTGIFIAAAITDWLDGY+ARK +LGT FGAFL
Sbjct  138  TVLTIGRVAAVPLLISTFYMEGPWAATATTGIFIAAAITDWLDGYLARKMQLGTPFGAFL  197

Query  583  DPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSK  762
            DPVADKLMVAATLVLLCT+PLE S     PWLLTVPSIAIIGREITMSAVREWAASQ SK
Sbjct  198  DPVADKLMVAATLVLLCTKPLEGSLLRDGPWLLTVPSIAIIGREITMSAVREWAASQNSK  257

Query  763  LSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFV  942
            + EAVAVNNLGKWKTATQM+ALT+LLA+RD SL   GALV  GV LLY+SA LA+WSL V
Sbjct  258  VLEAVAVNNLGKWKTATQMTALTLLLASRDPSLPAQGALVTPGVVLLYVSAGLAIWSLVV  317

Query  943  YMRKIWKVLL  972
            YMRKIW++LL
Sbjct  318  YMRKIWRILL  327



>ref|XP_003592809.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase 
[Medicago truncatula]
 gb|AES63060.1| phosphatidylglycerolphosphate synthase [Medicago truncatula]
Length=284

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IF+AA++TDWLDGYIARK  L + FGAFLDPVAD
Sbjct  99   GRVAAVPLLVATFYMDGWRGTAATTTIFVAASVTDWLDGYIARKMNLKSQFGAFLDPVAD  158

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+   F  +PWLL +P+IAIIGREITMSAVREWAASQ SKL EAV
Sbjct  159  KLMVAATLVLLCTRPLDVGVFAQLPWLLPIPAIAIIGREITMSAVREWAASQDSKLLEAV  218

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM+AL +LLATRDSS   A  +VGSGVALLY SA LA+WSL VYMRKI
Sbjct  219  AVNNLGKWKTATQMTALALLLATRDSSHGGAAFVVGSGVALLYTSAGLALWSLAVYMRKI  278

Query  958  WKVLL  972
            WKVLL
Sbjct  279  WKVLL  283



>ref|XP_009410588.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 171/221 (77%), Gaps = 4/221 (2%)
 Frame = +1

Query  319  QMGSDPDKKEQQLPDTVPSQSD---KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaat  489
            ++G     ++Q  P T P   +   +L TLPT+LTIGRVAA+PL VSTFY+D WWG  AT
Sbjct  35   KVGMQMSGRKQSPPSTPPMPQNGPGRLFTLPTVLTIGRVAAIPLFVSTFYMDGWWGATAT  94

Query  490  tgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHM  669
            T IF+ AAITDWLDGYIARK +L TAFGAFLDPVADKLMVAATLVLLCT+P E + F  +
Sbjct  95   TSIFLLAAITDWLDGYIARKMRLETAFGAFLDPVADKLMVAATLVLLCTKPFECAIFGDV  154

Query  670  PWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATR  849
            PWLLT PSI IIGREITMSAVREWAASQ S   EAVAVN LGKWK ATQM+ALT LLA+R
Sbjct  155  PWLLTAPSITIIGREITMSAVREWAASQNSLALEAVAVNKLGKWKAATQMTALTALLASR  214

Query  850  DSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            D S+    +++ SG+ LLY+SA LAVWSL VY RKIW V L
Sbjct  215  DPSMA-VPSVLASGIGLLYVSAGLAVWSLVVYTRKIWTVSL  254



>ref|XP_008369841.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Malus domestica]
Length=385

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 170/225 (76%), Gaps = 29/225 (13%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVST-----------------------------FYVDSWWG  477
            K LTLPTILT+GRVA+VP+L S+                             FYVDSWWG
Sbjct  160  KFLTLPTILTLGRVASVPVLXSSMISIEFFISLQIALTAIANLXFFPFIVLAFYVDSWWG  219

Query  478  PaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASA  657
              ATT IFIAAAITDWLDGYIARK + G+AFGAFLDPVADKLMVAATLVLLC+RPL+ + 
Sbjct  220  TTATTSIFIAAAITDWLDGYIARKMRSGSAFGAFLDPVADKLMVAATLVLLCSRPLDVAM  279

Query  658  FVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTIL  837
            F  +PWL  VPSIAIIGREITMSAVREWAASQ +KL EAVAVNNLGKWKTATQM ALTIL
Sbjct  280  FGQVPWLFVVPSIAIIGREITMSAVREWAASQNAKLLEAVAVNNLGKWKTATQMIALTIL  339

Query  838  LATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            LATRD+SL     LV SGV LLY+SA LAVWSL VYM KIWKVLL
Sbjct  340  LATRDNSLGRPEVLVASGVVLLYVSAGLAVWSLVVYMSKIWKVLL  384



>ref|XP_002875816.1| hypothetical protein ARALYDRAFT_485066 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52075.1| hypothetical protein ARALYDRAFT_485066 [Arabidopsis lyrata subsp. 
lyrata]
Length=301

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 12/205 (6%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPT+LT+GRVAAVPLLV+TFYVDSWWG  ATT IFIAAAITDWLDGY+ARK +LG+
Sbjct  99   KVLTLPTVLTLGRVAAVPLLVATFYVDSWWGTTATTSIFIAAAITDWLDGYLARKMRLGS  158

Query  565  AFGAFLDPVADKLMV---------AATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREI  717
            AFGAFLDPVADK++           +TL+LLCT+P++ +    +PWLLTVPSIAIIGREI
Sbjct  159  AFGAFLDPVADKVLSFIYYSGKRDLSTLILLCTKPIDIAELGPVPWLLTVPSIAIIGREI  218

Query  718  TMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVA  897
            TMSAVREWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDS   + G LV SG  
Sbjct  219  TMSAVREWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDS---NVGWLVASGAG  275

Query  898  LLYISAWLAVWSLFVYMRKIWKVLL  972
            LLY+SA L+VWSL VYMRKIWKVL+
Sbjct  276  LLYVSAGLSVWSLAVYMRKIWKVLM  300



>ref|XP_006651264.1| PREDICTED: uncharacterized protein LOC102712153 [Oryza brachyantha]
Length=283

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  406  ILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLD  585
            +LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT FGAFLD
Sbjct  94   VLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWLDGYIARKMQLGTPFGAFLD  153

Query  586  PVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKL  765
            PVADKLMVAATLVLLCT+PLE S   + PWLLTVP+IAIIGREITMSAVREWAASQ +K+
Sbjct  154  PVADKLMVAATLVLLCTKPLEISLLRYGPWLLTVPAIAIIGREITMSAVREWAASQNTKV  213

Query  766  SEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVY  945
             EAVAVN LGKWKTATQM+ALT+LLA+RD SL    ALV SGVALLY+SA LA+WSL VY
Sbjct  214  LEAVAVNKLGKWKTATQMTALTLLLASRDPSLPAQDALVTSGVALLYVSAGLAIWSLVVY  273

Query  946  MRKIWKVLL  972
            MRKIW++LL
Sbjct  274  MRKIWRILL  282



>gb|KEH21444.1| phosphatidylglycerolphosphate synthase [Medicago truncatula]
Length=224

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D K      ++PS   KLLTLPTILT+ RVA++P LV+TFY+D W G A TT IF AAAI
Sbjct  9    DLKNDHRASSMPSSHSKLLTLPTILTLARVASIPFLVATFYMDGWQGTAVTTCIFTAAAI  68

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSI  696
            TDWLDGYIARK KL ++FGAFLDPVADKLMVAATL+LLCTRPL+ +A    PWLL +PSI
Sbjct  69   TDWLDGYIARKMKLKSSFGAFLDPVADKLMVAATLILLCTRPLKVAALAQAPWLLIIPSI  128

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA  876
             IIGREITMSA+REWAASQGSK+ EAVAVNNLGKWKTATQM+ALTILLATRD S      
Sbjct  129  TIIGREITMSALREWAASQGSKVLEAVAVNNLGKWKTATQMTALTILLATRDCSHGGPAI  188

Query  877  LVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            L GSGV LLYI+A LA+WS  VYMRK+WKVLL
Sbjct  189  LAGSGVFLLYIAAGLAIWSFVVYMRKMWKVLL  220



>gb|AES77193.2| phosphatidylglycerolphosphate synthase [Medicago truncatula]
Length=221

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D K      ++PS   KLLTLPTILT+ RVA++P LV+TFY+D W G A TT IF AAAI
Sbjct  9    DLKNDHRASSMPSSHSKLLTLPTILTLARVASIPFLVATFYMDGWQGTAVTTCIFTAAAI  68

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSI  696
            TDWLDGYIARK KL ++FGAFLDPVADKLMVAATL+LLCTRPL+ +A    PWLL +PSI
Sbjct  69   TDWLDGYIARKMKLKSSFGAFLDPVADKLMVAATLILLCTRPLKVAALAQAPWLLIIPSI  128

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA  876
             IIGREITMSA+REWAASQGSK+ EAVAVNNLGKWKTATQM+ALTILLATRD S      
Sbjct  129  TIIGREITMSALREWAASQGSKVLEAVAVNNLGKWKTATQMTALTILLATRDCSHGGPAI  188

Query  877  LVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            L GSGV LLYI+A LA+WS  VYMRK+WKVLL
Sbjct  189  LAGSGVFLLYIAAGLAIWSFVVYMRKMWKVLL  220



>ref|XP_010534442.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Tarenaya hassleriana]
Length=376

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 182/218 (83%), Gaps = 5/218 (2%)
 Frame = +1

Query  325  GSDPDKKEQQLPDTVPS--QSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgi  498
            G D   ++   P   P    S KLLTLPT+LT+GRVAAVPLLV+TFYVDS  G  ATT I
Sbjct  161  GDDSLLRQSHSPSHQPPTPSSSKLLTLPTVLTLGRVAAVPLLVATFYVDSCLGRTATTSI  220

Query  499  fiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWL  678
            FIAAAITDWLDGYIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++ +A   +PWL
Sbjct  221  FIAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDIAASGPVPWL  280

Query  679  LTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSS  858
            +TVPSIAIIGREITMSAVREWAASQ  K+SEAVAVNNLGKWKTATQM+ALTILLATRDSS
Sbjct  281  MTVPSIAIIGREITMSAVREWAASQNGKVSEAVAVNNLGKWKTATQMTALTILLATRDSS  340

Query  859  LVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
                G LV SGVALLY+SA L+VWSL VYM KIWKVLL
Sbjct  341  F---GGLVASGVALLYVSAGLSVWSLVVYMSKIWKVLL  375



>gb|EEC74996.1| hypothetical protein OsI_11056 [Oryza sativa Indica Group]
Length=329

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  406  ILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLD  585
            +LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT FGAFLD
Sbjct  140  VLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWLDGYIARKMQLGTPFGAFLD  199

Query  586  PVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKL  765
            PVADKLMVAATLVLLCT+PLE S     PWLLTVP+IAIIGREITMSAVREWAASQ +K+
Sbjct  200  PVADKLMVAATLVLLCTKPLEISLLRDGPWLLTVPAIAIIGREITMSAVREWAASQNTKV  259

Query  766  SEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVY  945
             EAVAVNNLGKWKTATQM+ALTILLA+RD SL    ALV SGVALLY+SA LA+WSL VY
Sbjct  260  LEAVAVNNLGKWKTATQMTALTILLASRDKSLPAQDALVTSGVALLYVSAGLAIWSLVVY  319

Query  946  MRKIWKVLL  972
            MRKIW++LL
Sbjct  320  MRKIWRILL  328



>ref|NP_001049756.1| Os03g0283600 [Oryza sativa Japonica Group]
 sp|Q8H8U0.1|CLS_ORYSJ RecName: Full=Cardiolipin synthase, mitochondrial; Short=CLS; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAN64500.1| putative phosphatidylglycerolphosphate synthase [Oryza sativa 
Japonica Group]
 gb|ABF95333.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase 
family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF11670.1| Os03g0283600 [Oryza sativa Japonica Group]
 dbj|BAG91767.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  406  ILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLD  585
            +LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT FGAFLD
Sbjct  140  VLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWLDGYIARKMQLGTPFGAFLD  199

Query  586  PVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKL  765
            PVADKLMVAATLVLLCT+PLE S     PWLLTVP+IAIIGREITMSAVREWAASQ +K+
Sbjct  200  PVADKLMVAATLVLLCTKPLEISLLRDGPWLLTVPAIAIIGREITMSAVREWAASQNTKV  259

Query  766  SEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVY  945
             EAVAVNNLGKWKTATQM+ALTILLA+RD SL    ALV SG+ALLY+SA LA+WSL VY
Sbjct  260  LEAVAVNNLGKWKTATQMTALTILLASRDKSLPAQDALVTSGIALLYVSAGLAIWSLVVY  319

Query  946  MRKIWKVLL  972
            MRKIW++LL
Sbjct  320  MRKIWRILL  328



>gb|AFK45194.1| unknown [Medicago truncatula]
Length=284

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IF+AA++TDWLDGYIARK  L + FGAFLDPVAD
Sbjct  99   GRVAAVPLLVATFYMDGWRGTAATTTIFVAASVTDWLDGYIARKMNLKSQFGAFLDPVAD  158

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+   F  +PWLL +P+IAIIGREITMSAVREWAASQ SKL EAV
Sbjct  159  KLMVAATLVLLCTRPLDVGVFAQLPWLLPIPAIAIIGREITMSAVREWAASQDSKLLEAV  218

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM+AL +LLATRDSS   A  +VGSGVALLY  A LA+WSL VYMRKI
Sbjct  219  AVNNLGKWKTATQMTALALLLATRDSSHGGAAFVVGSGVALLYTFAGLALWSLAVYMRKI  278

Query  958  WKVLL  972
            WKVLL
Sbjct  279  WKVLL  283



>ref|XP_009410587.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=256

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 172/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  319  QMGSDPDKKEQQLPDTVPSQSD---KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaat  489
            ++G     ++Q  P T P   +   +L TLPT+LTIGRVAA+PL VSTFY+D WWG  AT
Sbjct  35   KVGMQMSGRKQSPPSTPPMPQNGPGRLFTLPTVLTIGRVAAIPLFVSTFYMDGWWGATAT  94

Query  490  tgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHM  669
            T IF+ AAITDWLDGYIARK +L TAFGAFLDPVADKLMVAATLVLLCT+P E + F  +
Sbjct  95   TSIFLLAAITDWLDGYIARKMRLETAFGAFLDPVADKLMVAATLVLLCTKPFECAIFGDV  154

Query  670  PWLLTVPSIAIIGREITMSAVREWAASQGS-KLSEAVAVNNLGKWKTATQMSALTILLAT  846
            PWLLT PSI IIGREITMSAVREWAASQ S  L +AVAVN LGKWK ATQM+ALT LLA+
Sbjct  155  PWLLTAPSITIIGREITMSAVREWAASQNSLALEQAVAVNKLGKWKAATQMTALTALLAS  214

Query  847  RDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            RD S+    +++ SG+ LLY+SA LAVWSL VY RKIW V L
Sbjct  215  RDPSMA-VPSVLASGIGLLYVSAGLAVWSLVVYTRKIWTVSL  255



>gb|KDP46136.1| hypothetical protein JCGZ_06647 [Jatropha curcas]
Length=365

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLVSTFY+DSWWG  ATT IFIAAA+TDWLDGY+ARK +LG+AFGAFLDPVAD
Sbjct  181  GRVAAVPLLVSTFYLDSWWGRTATTSIFIAAAVTDWLDGYLARKMRLGSAFGAFLDPVAD  240

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRP E + F  +PWLLTVPSI IIGREITMSAVREWAASQ SKL EAV
Sbjct  241  KLMVAATLVLLCTRPPEVAIFGQVPWLLTVPSILIIGREITMSAVREWAASQNSKLLEAV  300

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTATQM+ALTILLATRDSSL   G  V S V LLYISA L+VWSL +YM KI
Sbjct  301  AVNNLGKWKTATQMTALTILLATRDSSLGGPGISVAS-VVLLYISAGLSVWSLAMYMSKI  359

Query  958  WKVLL  972
            W+VLL
Sbjct  360  WRVLL  364



>ref|XP_007142655.1| hypothetical protein PHAVU_007G005600g [Phaseolus vulgaris]
 gb|ESW14649.1| hypothetical protein PHAVU_007G005600g [Phaseolus vulgaris]
Length=274

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IF+AA+ITDWLDGY+ARK KL ++FGAFLDPVAD
Sbjct  88   GRVAAVPLLVATFYMDGWRGTAATTSIFVAASITDWLDGYLARKMKLNSSFGAFLDPVAD  147

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+   F   PWLLT+P+IAIIGREITMSAVREWAASQ SKL EAV
Sbjct  148  KLMVAATLVLLCTRPLDVGVFGQAPWLLTIPAIAIIGREITMSAVREWAASQDSKLLEAV  207

Query  778  AVNNLGKWKTATQMSALTILLATRD-SSLVDAGALVGSGVALLYISAWLAVWSLFVYMRK  954
            AVNNLGKWKTA+QM+ALTILLATRD S+   A  +VGSGV LLY SA LA+WSL VYM+K
Sbjct  208  AVNNLGKWKTASQMTALTILLATRDLSNGGGAAIIVGSGVVLLYTSAGLAIWSLVVYMKK  267

Query  955  IWKVLL  972
            IW+VLL
Sbjct  268  IWRVLL  273



>gb|KHN37289.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Glycine soja]
Length=291

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IF+AA+ITDWLDGY+ARK KL ++FGAFLDPVAD
Sbjct  105  GRVAAVPLLVATFYMDGWRGTAATTSIFVAASITDWLDGYLARKMKLKSSFGAFLDPVAD  164

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+   F   PWLLT+P+IAIIGREITMSAVREWAASQ SKL EAV
Sbjct  165  KLMVAATLVLLCTRPLDGGVFGQAPWLLTIPAIAIIGREITMSAVREWAASQDSKLLEAV  224

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGAL-VGSGVALLYISAWLAVWSLFVYMRK  954
            AVNNLGKWKTATQM+ALTILLATRD S     A+ VGSGVALLY SA LA+WSL VYM+K
Sbjct  225  AVNNLGKWKTATQMTALTILLATRDWSHGGGAAIVVGSGVALLYTSAGLALWSLVVYMKK  284

Query  955  IWKVLL  972
            IW+VLL
Sbjct  285  IWRVLL  290



>ref|XP_003536794.1| PREDICTED: probable cardiolipin synthase [Glycine max]
Length=293

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IF+AA+ITDWLDGY+ARK KL ++FGAFLDPVAD
Sbjct  107  GRVAAVPLLVATFYMDGWRGTAATTSIFVAASITDWLDGYLARKMKLKSSFGAFLDPVAD  166

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+   F   PWLLT+P+IAIIGREITMSAVREWAASQ SKL EAV
Sbjct  167  KLMVAATLVLLCTRPLDGGVFGQAPWLLTIPAIAIIGREITMSAVREWAASQDSKLLEAV  226

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGAL-VGSGVALLYISAWLAVWSLFVYMRK  954
            AVNNLGKWKTATQM+ALTILLATRD S     A+ VGSGVALLY SA LA+WSL VYM+K
Sbjct  227  AVNNLGKWKTATQMTALTILLATRDWSHGGGAAIVVGSGVALLYTSAGLALWSLVVYMKK  286

Query  955  IWKVLL  972
            IW+VLL
Sbjct  287  IWRVLL  292



>ref|XP_007142654.1| hypothetical protein PHAVU_007G005600g [Phaseolus vulgaris]
 gb|ESW14648.1| hypothetical protein PHAVU_007G005600g [Phaseolus vulgaris]
Length=300

 Score =   261 bits (667),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IF+AA+ITDWLDGY+ARK KL ++FGAFLDPVAD
Sbjct  114  GRVAAVPLLVATFYMDGWRGTAATTSIFVAASITDWLDGYLARKMKLNSSFGAFLDPVAD  173

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCTRPL+   F   PWLLT+P+IAIIGREITMSAVREWAASQ SKL EAV
Sbjct  174  KLMVAATLVLLCTRPLDVGVFGQAPWLLTIPAIAIIGREITMSAVREWAASQDSKLLEAV  233

Query  778  AVNNLGKWKTATQMSALTILLATRD-SSLVDAGALVGSGVALLYISAWLAVWSLFVYMRK  954
            AVNNLGKWKTA+QM+ALTILLATRD S+   A  +VGSGV LLY SA LA+WSL VYM+K
Sbjct  234  AVNNLGKWKTASQMTALTILLATRDLSNGGGAAIIVGSGVVLLYTSAGLAIWSLVVYMKK  293

Query  955  IWKVLL  972
            IW+VLL
Sbjct  294  IWRVLL  299



>ref|XP_002465438.1| hypothetical protein SORBIDRAFT_01g038850 [Sorghum bicolor]
 gb|EER92436.1| hypothetical protein SORBIDRAFT_01g038850 [Sorghum bicolor]
Length=309

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 169/208 (81%), Gaps = 11/208 (5%)
 Frame = +1

Query  349  QQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWL  528
            ++ P T P    +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWL
Sbjct  112  KEEPATAP---PRLLTLPTVLTIGRVAAVPLLISTFYMEGPWAATATTGIFLAAAVTDWL  168

Query  529  DGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIG  708
            DGYIARK +LGT FGAFLDPVADKLMVAATLVLLCT+PLE S     PWLLTVPSIAIIG
Sbjct  169  DGYIARKMQLGTPFGAFLDPVADKLMVAATLVLLCTKPLETSLLNDGPWLLTVPSIAIIG  228

Query  709  REITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGS  888
                    REWAASQ SK+ EAVAVNNLGKWKTATQM+ALT+LLA+RD SL   GAL   
Sbjct  229  --------REWAASQNSKVLEAVAVNNLGKWKTATQMTALTLLLASRDPSLPAQGALAAP  280

Query  889  GVALLYISAWLAVWSLFVYMRKIWKVLL  972
            GVALLY+SA LA+WSL VYMRKIW++LL
Sbjct  281  GVALLYVSAGLAIWSLVVYMRKIWRILL  308



>ref|XP_010067242.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Eucalyptus grandis]
 gb|KCW65342.1| hypothetical protein EUGRSUZ_G02785 [Eucalyptus grandis]
 gb|KCW65343.1| hypothetical protein EUGRSUZ_G02785 [Eucalyptus grandis]
Length=343

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +1

Query  376  QSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKK  555
            ++D+LLTLPTILT+ RVAAVPLLVSTFYVD+ WG  ATTGIFIAAAITDWLDGY+ARK  
Sbjct  144  KADQLLTLPTILTLARVAAVPLLVSTFYVDTRWGTTATTGIFIAAAITDWLDGYLARKMG  203

Query  556  LGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVR  735
             G+AFGAFLDPVADKLMVAA L+LLC+RP E S F  +PWL+T P+IAIIGREITMSAVR
Sbjct  204  SGSAFGAFLDPVADKLMVAAILILLCSRPSEISVFGQLPWLITAPAIAIIGREITMSAVR  263

Query  736  EWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISA  915
            EWAASQ SKL EAVAVN LGKWKTA QM+ALTILLATRDSSL  A +LV SGV LLY SA
Sbjct  264  EWAASQDSKLLEAVAVNKLGKWKTAAQMTALTILLATRDSSLRGAESLVASGVVLLYTSA  323

Query  916  WLAVWSLFVYMRKIWKVLL  972
             LA+WSL VYM+KIWKVLL
Sbjct  324  GLALWSLVVYMKKIWKVLL  342



>ref|XP_004515576.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase-like 
isoform X1 [Cicer arietinum]
Length=242

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  421  RVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADK  600
            RVA++PLLV+TFY+D W G A TT IF AAA+TDWLDGYIARK KL + FGAFLDPVADK
Sbjct  57   RVASIPLLVATFYMDGWQGTAVTTIIFTAAAVTDWLDGYIARKMKLKSTFGAFLDPVADK  116

Query  601  LMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVA  780
            LMVAATL+LLCTRPL+  A    PWLL +PSI IIGREITMSA+REWAASQGSK+ EAVA
Sbjct  117  LMVAATLILLCTRPLKVVALARAPWLLIIPSITIIGREITMSALREWAASQGSKVLEAVA  176

Query  781  VNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIW  960
            VNNLGKWKTATQM+ALTILLATRD S      L GSGV LLYI+A LA+WS  VYMRKIW
Sbjct  177  VNNLGKWKTATQMTALTILLATRDCSRGGPAILAGSGVFLLYIAAGLAIWSFVVYMRKIW  236

Query  961  KVLL  972
            K LL
Sbjct  237  KALL  240



>ref|XP_004515577.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase-like 
isoform X2 [Cicer arietinum]
Length=241

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  421  RVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADK  600
            RVA++PLLV+TFY+D W G A TT IF AAA+TDWLDGYIARK KL + FGAFLDPVADK
Sbjct  57   RVASIPLLVATFYMDGWQGTAVTTIIFTAAAVTDWLDGYIARKMKLKSTFGAFLDPVADK  116

Query  601  LMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVA  780
            LMVAATL+LLCTRPL+  A    PWLL +PSI IIGREITMSA+REWAASQGSK+ EAVA
Sbjct  117  LMVAATLILLCTRPLKVVALARAPWLLIIPSITIIGREITMSALREWAASQGSKVLEAVA  176

Query  781  VNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIW  960
            VNNLGKWKTATQM+ALTILLATRD S      L GSGV LLYI+A LA+WS  VYMRKIW
Sbjct  177  VNNLGKWKTATQMTALTILLATRDCSRGGPAILAGSGVFLLYIAAGLAIWSFVVYMRKIW  236

Query  961  KVLL  972
            K LL
Sbjct  237  KALL  240



>ref|XP_008795292.1| PREDICTED: cardiolipin synthase, mitochondrial-like [Phoenix 
dactylifera]
Length=215

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 168/212 (79%), Gaps = 8/212 (4%)
 Frame = +1

Query  340  KKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaait  519
            ++EQQ        S +LLTLPT+LTIGRVAAVPLLVSTFY++ WW   ATT IFIAAA+T
Sbjct  10   REEQQ-------GSPRLLTLPTVLTIGRVAAVPLLVSTFYMNGWWATTATTSIFIAAAVT  62

Query  520  DWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLL-CTRPLEASAFVHMPWLLTVPSI  696
            DWLDGYIARK  LGT FGAFLD VADK++    ++LL CTRPL+ +AF  +PWLLTVPSI
Sbjct  63   DWLDGYIARKMWLGTTFGAFLDDVADKVLPFLLIILLSCTRPLKVAAFRVVPWLLTVPSI  122

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA  876
            AII REI MSAVREWAASQ SK+ +AVAVNN  KWKT T M+ALTILLATRDSSL   G 
Sbjct  123  AIICREINMSAVREWAASQNSKVLKAVAVNNRRKWKTTTHMTALTILLATRDSSLTGLGV  182

Query  877  LVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            LV SGV LLY+SA LA+WS   YMRKIW+VLL
Sbjct  183  LVTSGVVLLYVSAGLAIWSFAGYMRKIWRVLL  214



>ref|XP_010693113.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like [Beta vulgaris subsp. vulgaris]
Length=370

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = +1

Query  355  LPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDG  534
            L D    Q  KLLTLPT+LT+ RVAA+P+ ++TFY +SWWG AATT IF+AAAITDWLDG
Sbjct  164  LKDQKDQQCSKLLTLPTVLTLARVAAIPVFIATFYANSWWGAAATTSIFVAAAITDWLDG  223

Query  535  YIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGRE  714
            Y+ARK +LGTAFGAFLDPVADKLMVAATLVLLC+RP EA+ F  +PWL  VP+I IIGRE
Sbjct  224  YLARKMRLGTAFGAFLDPVADKLMVAATLVLLCSRPPEAAMFGDIPWLYPVPAIVIIGRE  283

Query  715  ITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGV  894
            ITMSAVREWAASQ +KL +AVAVNNLGKWKTATQM+ALT +LATRD S+   GAL  SGV
Sbjct  284  ITMSAVREWAASQDAKLLQAVAVNNLGKWKTATQMTALTFILATRDGSVSSQGALAASGV  343

Query  895  ALLYISAWLAVWSLFVYMRKIWKVLL  972
             LLYISA LA WSL VYMRKI KVL+
Sbjct  344  VLLYISAGLAAWSLVVYMRKIGKVLM  369



>gb|ABA55724.1| phosphatidylglycerolphosphate synthase [Vigna unguiculata]
Length=300

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 178/206 (86%), Gaps = 3/206 (1%)
 Frame = +1

Query  358  PDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGY  537
            P+  P +S KLLTLPTILT+GRVAAVPLLV+TFY+D W G AATT IF+AA+ITDWLDGY
Sbjct  96   PEPEP-ESSKLLTLPTILTLGRVAAVPLLVATFYMDGWPGTAATTSIFVAASITDWLDGY  154

Query  538  IARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREI  717
            +ARK KL ++FGAFLDPVADKLMV+ATLVLLCTRPLE + F  +PWLL +PSI IIGREI
Sbjct  155  LARKMKLKSSFGAFLDPVADKLMVSATLVLLCTRPLEVAVFGQLPWLLIIPSITIIGREI  214

Query  718  TMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA-LVGSGV  894
            TMSA+REWAASQGSKL E VAVNNLGKWKTA+QM+ALTILLATRD S     A LVGSGV
Sbjct  215  TMSALREWAASQGSKLLE-VAVNNLGKWKTASQMTALTILLATRDLSHGGGAAILVGSGV  273

Query  895  ALLYISAWLAVWSLFVYMRKIWKVLL  972
            ALLY SA LA+WSL VYM+KIW+VLL
Sbjct  274  ALLYTSAGLALWSLVVYMKKIWRVLL  299



>ref|XP_010922478.1| PREDICTED: cardiolipin synthase, mitochondrial-like isoform X1 
[Elaeis guineensis]
Length=307

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRV AVP+LVST++++ WW   ATT IF+AAA TDWLDGYIARK +LGTAFGAFLDPVAD
Sbjct  122  GRVVAVPVLVSTYHMNGWWATTATTIIFLAAAFTDWLDGYIARKMRLGTAFGAFLDPVAD  181

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCT+P++ + FV +PWLLTVPSIAIIGREITMSAVREWAASQGS+  E+V
Sbjct  182  KLMVAATLVLLCTKPVDIALFVDVPWLLTVPSIAIIGREITMSAVREWAASQGSRALESV  241

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AV+NLGKWKTA QM+AL+ILLATRD SL  +  +V SGV LLYISA L+VWSL +YM KI
Sbjct  242  AVSNLGKWKTAAQMTALSILLATRDPSLTGSDVIVSSGVLLLYISAALSVWSLIMYMSKI  301

Query  958  WKVLL  972
            W++LL
Sbjct  302  WRILL  306



>gb|ABR17104.1| unknown [Picea sitchensis]
Length=322

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 169/225 (75%), Gaps = 1/225 (0%)
 Frame = +1

Query  301  RSISTTQMGSDPDKKEQQLPDTVP-SQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWG  477
            + +    M S+  K E+      P S + K LTLP +LT+GRVAAVPLL++ FY++ WW 
Sbjct  97   KRVIVADMESEKPKAEENGDKCNPISSAPKFLTLPNMLTLGRVAAVPLLIAVFYLNGWWV  156

Query  478  PaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASA  657
              ATT IF+AAA TDWLDGYIAR+   G+AFGAFLDPVADKL+VA +LVLLCTRP E + 
Sbjct  157  TMATTSIFVAAAATDWLDGYIARRMGSGSAFGAFLDPVADKLIVATSLVLLCTRPPEIAW  216

Query  658  FVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTIL  837
            F   PWLL VP+IAII REITMSAVREWAASQG  L EAVAVNNLGKWKTA QM +LTIL
Sbjct  217  FGEAPWLLPVPAIAIISREITMSAVREWAASQGGDLREAVAVNNLGKWKTAFQMVSLTIL  276

Query  838  LATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            LATRDSS   A  L   GVA+LY++A L +WSL VYM+ +W++LL
Sbjct  277  LATRDSSQNGAAGLAACGVAILYVAAGLGMWSLAVYMKGVWRILL  321



>ref|XP_008783647.1| PREDICTED: cardiolipin synthase, mitochondrial-like isoform X1 
[Phoenix dactylifera]
Length=265

 Score =   254 bits (650),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 173/212 (82%), Gaps = 7/212 (3%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D  +QQ P        KLLTLPT+LT+GRVAAVPLLVST++++  W P ATT IF+ AA 
Sbjct  60   DYNQQQSPP-------KLLTLPTVLTLGRVAAVPLLVSTYHMNGCWAPTATTSIFLVAAF  112

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSI  696
            TDWLDGYIARK +LGTAFGAFLDPVADKLMVAATLVLLCT P +   FV +PWLLTVPSI
Sbjct  113  TDWLDGYIARKMRLGTAFGAFLDPVADKLMVAATLVLLCTEPADIVLFVDVPWLLTVPSI  172

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA  876
            AII REITMSAVREWAASQGS+  ++VAV+NLGKWKTA QM+AL+ILLATRD SL  +  
Sbjct  173  AIICREITMSAVREWAASQGSRALQSVAVSNLGKWKTAAQMTALSILLATRDPSLTGSDV  232

Query  877  LVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            +V SGV LLYISA L+VWSL +YM KIW+VLL
Sbjct  233  IVSSGVLLLYISAALSVWSLIMYMSKIWRVLL  264



>ref|XP_006828262.1| hypothetical protein AMTR_s00023p00206380 [Amborella trichopoda]
 gb|ERM95678.1| hypothetical protein AMTR_s00023p00206380 [Amborella trichopoda]
Length=309

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY++SWW   A+T IF+ AA+TDWLDGY+ARK K GT FGAFLDPVAD
Sbjct  125  GRVAAVPLLVTTFYMNSWWSATASTSIFVVAAVTDWLDGYLARKMKSGTVFGAFLDPVAD  184

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCT+P++ S F  +PWLLTVPSIAIIGREITMSAVREWAASQG+ + EAV
Sbjct  185  KLMVAATLVLLCTKPVD-SMFGQVPWLLTVPSIAIIGREITMSAVREWAASQGASVLEAV  243

Query  778  AVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKI  957
            AVNNLGKWKTA+QM ALT+LLATRD S      L   G+ LLY+SA LA+WSL VY R I
Sbjct  244  AVNNLGKWKTASQMIALTVLLATRDMSQTGPSILATCGIVLLYMSAGLAIWSLVVYTRGI  303

Query  958  WKVLL  972
            W++LL
Sbjct  304  WRILL  308



>emb|CDY06996.1| BnaA04g23190D [Brassica napus]
Length=251

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 161/199 (81%), Gaps = 13/199 (7%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAV---PLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKK  555
            K+LTLPT+LT+ RVA++    LL+  FYVD WWG  ATT IF+AAA+TDWLDGY+ARK K
Sbjct  62   KVLTLPTVLTLCRVASIFTFVLLLVAFYVDGWWGATATTSIFVAAAVTDWLDGYLARKMK  121

Query  556  LGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVR  735
                   FLDPVADKLMVAATL+LLCT+P+  S    +PWLLTVPSIAIIGREITMSAVR
Sbjct  122  -------FLDPVADKLMVAATLILLCTKPIHVSVLGPVPWLLTVPSIAIIGREITMSAVR  174

Query  736  EWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISA  915
            EWAASQ  KL EAVAVNNLGKWKTATQM+ALTILLA+RDSS+   G LV SG  LLY+SA
Sbjct  175  EWAASQNGKLLEAVAVNNLGKWKTATQMTALTILLASRDSSV---GWLVASGAGLLYVSA  231

Query  916  WLAVWSLFVYMRKIWKVLL  972
             L+VWSL VYMRKI KVLL
Sbjct  232  GLSVWSLVVYMRKISKVLL  250



>ref|XP_009142136.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
1, chloroplastic-like [Brassica rapa]
Length=222

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = +1

Query  448  STFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVL  627
            STFYVD W G  ATT IF+AAA+TDWLDGY+ARK KLG+AFGAF DPVADKLMVAATL+L
Sbjct  50   STFYVDGWTGATATTSIFVAAAVTDWLDGYLARKMKLGSAFGAFWDPVADKLMVAATLIL  109

Query  628  LCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKT  807
            LCT+P+  S    +PWLLTVPSIAIIGREITMSAVREWAASQ  KL EAVAVNNLGKWKT
Sbjct  110  LCTKPIHVSVLGPVPWLLTVPSIAIIGREITMSAVREWAASQNGKLLEAVAVNNLGKWKT  169

Query  808  ATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            ATQM+ALTILLA+RDSS+   G LV SG  LLY+SA L+VWSL VYMRKI KVLL
Sbjct  170  ATQMTALTILLASRDSSV---GWLVASGAGLLYVSAGLSVWSLVVYMRKISKVLL  221



>gb|EMT16898.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Aegilops tauschii]
Length=260

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +1

Query  448  STFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVL  627
            + FY++  W   ATTGIF+AAAITDWLDGYIARK  LGT FGAFLDPVADKLMVAATLVL
Sbjct  85   NAFYMEGPWAATATTGIFLAAAITDWLDGYIARKMHLGTPFGAFLDPVADKLMVAATLVL  144

Query  628  LCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKT  807
            LCT+PLE S   + PWLLTVPSIAIIGREITMSAVREWAASQ +++ EAVAVNNLGKWKT
Sbjct  145  LCTKPLETSLLTNGPWLLTVPSIAIIGREITMSAVREWAASQNTQVLEAVAVNNLGKWKT  204

Query  808  ATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
            ATQM+ALT+LLA+RD SL   GALV  GVALLY SA LA+WSL VY+R IW++LL
Sbjct  205  ATQMTALTLLLASRDPSLHVQGALVPPGVALLYASAGLAIWSLVVYIRNIWRILL  259



>gb|KHG18040.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Gossypium arboreum]
Length=233

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 148/183 (81%), Gaps = 4/183 (2%)
 Frame = +1

Query  322  MGSDPDKKEQ----QLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaat  489
            M S+P  ++Q    Q        S K+LTLPT+LT+GRVAAVPLL+ TF VDSWWG  AT
Sbjct  1    MDSEPLLQQQLDHHQSLAYSNHSSSKILTLPTVLTLGRVAAVPLLIFTFSVDSWWGRTAT  60

Query  490  tgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHM  669
            T IF+AAAITDWLDGYIAR+ +L +AFGA LDPVADKLMVAATLVLLC+RPL  + F  +
Sbjct  61   TSIFMAAAITDWLDGYIARRMRLCSAFGALLDPVADKLMVAATLVLLCSRPLNIAVFGQV  120

Query  670  PWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATR  849
            PWLL VPSIAIIGREITMSAVREWAASQ  KL  AVAVN LGKWKTATQM+ALTILLATR
Sbjct  121  PWLLNVPSIAIIGREITMSAVREWAASQNGKLLAAVAVNKLGKWKTATQMAALTILLATR  180

Query  850  DSS  858
            DSS
Sbjct  181  DSS  183



>ref|XP_001763508.1| predicted protein [Physcomitrella patens]
 gb|EDQ71697.1| predicted protein [Physcomitrella patens]
Length=243

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 161/228 (71%), Gaps = 9/228 (4%)
 Frame = +1

Query  298  VRSISTTQMGSDPDKKEQQLPDT----VPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVD  465
            VR + T  +GS+  + + +   +    V S   K LTLPTILT+ RVAAVP L++ FY +
Sbjct  19   VRDLCTRCVGSEECEGDGEKAGSGDGYVGSSEKKFLTLPTILTLARVAAVPALLAVFYCE  78

Query  466  SWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPL  645
              W   A   IF+ AA+TDWLDGY+ARK    + FGAFLDPVADKLMVA TLVLLCTRP 
Sbjct  79   EKWATTAGATIFVVAAVTDWLDGYLARKMGSSSEFGAFLDPVADKLMVATTLVLLCTRPP  138

Query  646  EASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSA  825
             A+     PWLL VP+I IIGREITMSA+REWAASQG  + +AVAVN+LGKWKTA QM A
Sbjct  139  VAALAKVGPWLLPVPAITIIGREITMSALREWAASQGGDVRQAVAVNSLGKWKTAAQMVA  198

Query  826  LTILLATRDSSLVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVL  969
            LT+LLA R     D G ++ +GV+LLY+SA LAVWSL VY+R +W  L
Sbjct  199  LTLLLAGR-----DGGYVMSAGVSLLYVSAGLAVWSLVVYIRSMWNRL  241



>gb|ABV57771.1| phosphatidylglycerolphosphate synthase [Gossypium hirsutum]
Length=154

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  520  DWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIA  699
            DWLDGYIAR+ +L +AFGA LDPVADKLMVAATLVLLC+RPL  + F  +PWLL VPSIA
Sbjct  5    DWLDGYIARRMRLCSAFGALLDPVADKLMVAATLVLLCSRPLNIAEFGQVPWLLNVPSIA  64

Query  700  IIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGAL  879
            IIGREITMSAVREWAASQ  KL  AVAVN LGKWKTATQM+ALTILLATRDSSL + G L
Sbjct  65   IIGREITMSAVREWAASQNGKLLAAVAVNKLGKWKTATQMAALTILLATRDSSLGETGIL  124

Query  880  VGSGVALLYISAWLAVWSLFVYMRKIWKVL  969
            V SGV  LY+SA L+V SL VYM KI KVL
Sbjct  125  VASGVIFLYLSAGLSVMSLVVYMEKIRKVL  154



>ref|XP_001752025.1| predicted protein [Physcomitrella patens]
 gb|EDQ83460.1| predicted protein [Physcomitrella patens]
Length=193

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 148/193 (77%), Gaps = 0/193 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K LTLPTILT+ RVAAVP+L++ FY    W   AT  IF+ AA+TDWLDGY+ARK    +
Sbjct  1    KFLTLPTILTLSRVAAVPVLLAAFYSQETWATTATATIFVLAAVTDWLDGYLARKMGSSS  60

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVA TLVLLCTRP  A+     PWLL +P+IAIIGREITMSA+REWA
Sbjct  61   EFGAFLDPVADKLMVATTLVLLCTRPPLAALAKFGPWLLPLPAIAIIGREITMSALREWA  120

Query  745  ASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLA  924
            ASQG  + +AVAVN LGKWKTA QM ALT+LLA RD   V   AL  +GV+LLY+SA LA
Sbjct  121  ASQGKDVRKAVAVNGLGKWKTAAQMMALTLLLAGRDGGYVGGVALGVTGVSLLYVSAGLA  180

Query  925  VWSLFVYMRKIWK  963
            +WSL VY+R +WK
Sbjct  181  LWSLVVYIRSLWK  193



>ref|XP_010922479.1| PREDICTED: cardiolipin synthase, mitochondrial-like isoform X2 
[Elaeis guineensis]
Length=276

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRV AVP+LVST++++ WW   ATT IF+AAA TDWLDGYIARK +LGTAFGAFLDPVAD
Sbjct  122  GRVVAVPVLVSTYHMNGWWATTATTIIFLAAAFTDWLDGYIARKMRLGTAFGAFLDPVAD  181

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAV  777
            KLMVAATLVLLCT+P++ + FV +PWLLTVPSIAIIGREITMSAVREWAASQGS+  E+V
Sbjct  182  KLMVAATLVLLCTKPVDIALFVDVPWLLTVPSIAIIGREITMSAVREWAASQGSRALESV  241

Query  778  AVNNLGKWKTATQMSALTILLATRDSS  858
            AV+NLGKWKTA QM+AL+ILLATRD S
Sbjct  242  AVSNLGKWKTAAQMTALSILLATRDPS  268



>ref|XP_008783648.1| PREDICTED: cardiolipin synthase, mitochondrial-like isoform X2 
[Phoenix dactylifera]
Length=226

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 143/172 (83%), Gaps = 7/172 (4%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D  +QQ P        KLLTLPT+LT+GRVAAVPLLVST++++  W P ATT IF+ AA 
Sbjct  60   DYNQQQSPP-------KLLTLPTVLTLGRVAAVPLLVSTYHMNGCWAPTATTSIFLVAAF  112

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSI  696
            TDWLDGYIARK +LGTAFGAFLDPVADKLMVAATLVLLCT P +   FV +PWLLTVPSI
Sbjct  113  TDWLDGYIARKMRLGTAFGAFLDPVADKLMVAATLVLLCTEPADIVLFVDVPWLLTVPSI  172

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRD  852
            AII REITMSAVREWAASQGS+  ++VAV+NLGKWKTA QM+AL+ILLATRD
Sbjct  173  AIICREITMSAVREWAASQGSRALQSVAVSNLGKWKTAAQMTALSILLATRD  224



>emb|CDX93276.1| BnaC04g46200D [Brassica napus]
Length=211

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 139/185 (75%), Gaps = 24/185 (13%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAV---PLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKK  555
            K+LTLPT+LT+ RVA++    LL+  FYVD WWG  ATT IF                  
Sbjct  41   KVLTLPTVLTLCRVASIFTFVLLLVAFYVDGWWGATATTSIF------------------  82

Query  556  LGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVR  735
            LG+AFGAFLDPVADKLMVAATL+LLCT+P++ +    +PWLLTVPSIAIIGREITMSAVR
Sbjct  83   LGSAFGAFLDPVADKLMVAATLILLCTKPIDVAVLGPLPWLLTVPSIAIIGREITMSAVR  142

Query  736  EWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISA  915
            EWAASQ  KL EAVAVNNLGKWKT TQM+ALTILLA+RDSS+   G LV SG  L+Y+SA
Sbjct  143  EWAASQNGKLLEAVAVNNLGKWKTTTQMTALTILLASRDSSV---GWLVASGAGLVYVSA  199

Query  916  WLAVW  930
             L+V+
Sbjct  200  GLSVY  204



>ref|XP_008783649.1| PREDICTED: cardiolipin synthase, mitochondrial-like isoform X3 
[Phoenix dactylifera]
Length=217

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 135/164 (82%), Gaps = 7/164 (4%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D  +QQ P        KLLTLPT+LT+GRVAAVPLLVST++++  W P ATT IF+ AA 
Sbjct  60   DYNQQQSPP-------KLLTLPTVLTLGRVAAVPLLVSTYHMNGCWAPTATTSIFLVAAF  112

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSI  696
            TDWLDGYIARK +LGTAFGAFLDPVADKLMVAATLVLLCT P +   FV +PWLLTVPSI
Sbjct  113  TDWLDGYIARKMRLGTAFGAFLDPVADKLMVAATLVLLCTEPADIVLFVDVPWLLTVPSI  172

Query  697  AIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSAL  828
            AII REITMSAVREWAASQGS+  ++VAV+NLGKWKTA QM+AL
Sbjct  173  AIICREITMSAVREWAASQGSRALQSVAVSNLGKWKTAAQMTAL  216



>gb|KFK34751.1| hypothetical protein AALP_AA5G188400 [Arabis alpina]
Length=169

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +1

Query  358  PDTVPSQ-SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDG  534
            P   P+Q S K+LTLPT+LT+GRVAAVP+LV+TFY+D WWG  ATT IFIAAAITDWLDG
Sbjct  30   PLPTPTQLSSKVLTLPTVLTLGRVAAVPILVATFYIDCWWGRTATTSIFIAAAITDWLDG  89

Query  535  YIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGRE  714
            YIARK +LG+AFGAFLDPVADKLMVAATL+LLCT+P++A     +PWL+TVPSIAIIGRE
Sbjct  90   YIARKMRLGSAFGAFLDPVADKLMVAATLILLCTKPMDAIMLGPVPWLVTVPSIAIIGRE  149

Query  715  ITMSAVREWAASQGSKLSE  771
            ITMSAVREWAASQ  KLSE
Sbjct  150  ITMSAVREWAASQNGKLSE  168



>ref|XP_002954076.1| hypothetical protein VOLCADRAFT_44897 [Volvox carteri f. nagariensis]
 gb|EFJ44793.1| hypothetical protein VOLCADRAFT_44897 [Volvox carteri f. nagariensis]
Length=195

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 151/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  388  LLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTA  567
            ++TLPT+LT+GRVAA+P+L++ +Y +S +  AA+T +F  A++TDWLDGY+ARK K  + 
Sbjct  1    VITLPTMLTLGRVAAIPVLIAAWYWNSPYSAAASTTVFALASLTDWLDGYLARKMKAFSP  60

Query  568  FGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAA  747
            FGAFLDPVADKLMVAA LVLLCTRP+   +     WLL V ++AIIGREITMSA+REWAA
Sbjct  61   FGAFLDPVADKLMVAAVLVLLCTRPIAVGSLAGNDWLLPVCTLAIIGREITMSALREWAA  120

Query  748  SQGSKLSEAVAVNNLGKWKTATQMSALTILLATRD---SSLVDAGALVGSGVALLYISAW  918
            + G +  +AVAVN+ GKWKTA+QM++LT+LL  +D    S ++A A   +GV LL +++W
Sbjct  121  TAGPEARQAVAVNSWGKWKTASQMASLTLLLLCKDGGSGSWLEAAA--TAGVGLLLVASW  178

Query  919  LAVWSLFVYMRKIWKVL  969
            L V SL +YMR +W+ +
Sbjct  179  LTVQSLAIYMRGLWRFM  195



>ref|XP_002980380.1| hypothetical protein SELMODRAFT_112501 [Selaginella moellendorffii]
 gb|EFJ18640.1| hypothetical protein SELMODRAFT_112501 [Selaginella moellendorffii]
Length=226

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 154/219 (70%), Gaps = 5/219 (2%)
 Frame = +1

Query  310  STTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaat  489
            S+   G +  K E++  +T  S +  L+T+PT+LT  RV AVP L+  F+ +  W   A+
Sbjct  3    SSHAAGQNGRKVEEE--ETHASATKDLITVPTMLTGARVVAVPALIFVFFSNQEWASVAS  60

Query  490  tgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHM  669
            +GIF+ AA+TDWLDGY+ARK KL +AFGAFLDPVADKLMVA  L+LLCTRPL A+ FV +
Sbjct  61   SGIFVGAALTDWLDGYLARKMKLDSAFGAFLDPVADKLMVATALILLCTRPLAAAWFVDI  120

Query  670  PWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATR  849
            PWL+ +P+  +I REI +SAVREWAA QG  L++ VAV+ LGK KTATQM +LT LLA  
Sbjct  121  PWLIPLPAALMISREIIISAVREWAALQG--LNKVVAVDKLGKLKTATQMVSLTFLLAFG  178

Query  850  DSSLVDAGALV-GSGVALLYISAWLAVWSLFVYMRKIWK  963
            D+       +  G GV LLY+S  L++ SL  YMRK+W+
Sbjct  179  DARYSKTTPMKPGFGVGLLYLSTGLSLVSLSGYMRKLWR  217



>ref|XP_002962711.1| hypothetical protein SELMODRAFT_78503 [Selaginella moellendorffii]
 gb|EFJ36174.1| hypothetical protein SELMODRAFT_78503 [Selaginella moellendorffii]
Length=226

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 154/219 (70%), Gaps = 5/219 (2%)
 Frame = +1

Query  310  STTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaat  489
            S+   G +  K E++  +T  S +  L+T+PT+LT  RV AVP L+  F+ +  W   A+
Sbjct  3    SSHAAGQNGRKVEEE--ETHGSTTKDLITVPTMLTGARVVAVPALIFVFFSNQEWASVAS  60

Query  490  tgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHM  669
            TGIF+ AA+TDWLDGY+ARK KL +AFGAFLDPVADKLMVA  L+LLCTRPL A+ FV +
Sbjct  61   TGIFVGAALTDWLDGYLARKMKLDSAFGAFLDPVADKLMVATALILLCTRPLAAAWFVDI  120

Query  670  PWLLTVPSIAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATR  849
            PWL+ +P+  +I REI +SAVREWAA QG  L++ VAV+ LGK KTATQM +LT LLA  
Sbjct  121  PWLIPLPAALMISREIIISAVREWAALQG--LNKVVAVDKLGKLKTATQMVSLTFLLAFG  178

Query  850  DSSLVDAGALV-GSGVALLYISAWLAVWSLFVYMRKIWK  963
            D+       +  G GV LLY+S  L++ SL  YMRK+W+
Sbjct  179  DARYSKTTPMKPGFGVGLLYLSTGLSLVSLSGYMRKLWR  217



>ref|XP_007009651.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 4 [Theobroma cacao]
 gb|EOY18461.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 4 [Theobroma cacao]
Length=285

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPTILT+GRVAAVPLL+ TFYVDSWWG  ATT IFIAAAITDWLDGYIARK +L +
Sbjct  123  KILTLPTILTLGRVAAVPLLIFTFYVDSWWGRTATTSIFIAAAITDWLDGYIARKMRLHS  182

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLC+RPL  + F  +PWLL VPSIAIIGREITMSAVREWA
Sbjct  183  VFGAFLDPVADKLMVAATLVLLCSRPLNVAVFGQVPWLLIVPSIAIIGREITMSAVREWA  242

Query  745  ASQGSKLSEA  774
            ASQ SKL  A
Sbjct  243  ASQNSKLFAA  252



>ref|XP_007009650.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 3 [Theobroma cacao]
 gb|EOY18460.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
isoform 3 [Theobroma cacao]
Length=251

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            K+LTLPTILT+GRVAAVPLL+ TFYVDSWWG  ATT IFIAAAITDWLDGYIARK +L +
Sbjct  123  KILTLPTILTLGRVAAVPLLIFTFYVDSWWGRTATTSIFIAAAITDWLDGYIARKMRLHS  182

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLC+RPL  + F  +PWLL VPSIAIIGREITMSAVREWA
Sbjct  183  VFGAFLDPVADKLMVAATLVLLCSRPLNVAVFGQVPWLLIVPSIAIIGREITMSAVREWA  242

Query  745  ASQGSKLSE  771
            ASQ S  S+
Sbjct  243  ASQNSCCSK  251



>ref|XP_007139085.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
 ref|XP_007139086.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
 gb|ESW11079.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
 gb|ESW11080.1| hypothetical protein PHAVU_008G000300g [Phaseolus vulgaris]
Length=170

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            + K LTLPTILT+GRVA++PLLV+TF++D W G  ATTGIF AAA+TDWLDGYIARK K+
Sbjct  25   NSKFLTLPTILTLGRVASIPLLVATFFMDGWRGTVATTGIFTAAAVTDWLDGYIARKMKM  84

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVRE  738
             + FGAFLDPVADKLMV+ATLVLLCTRPLE + F   PWLL +PSI IIGREITMSA+RE
Sbjct  85   KSTFGAFLDPVADKLMVSATLVLLCTRPLEVAVFGQFPWLLIIPSITIIGREITMSALRE  144

Query  739  WAASQGSKLSEAVAVNN  789
            WAASQGSKL E +   N
Sbjct  145  WAASQGSKLLELIIWGN  161



>tpg|DAA44779.1| TPA: hypothetical protein ZEAMMB73_859058 [Zea mays]
Length=256

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  385  KLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGT  564
            +LLTLPT+LTIGRVAAVPLL+STFY++  W   ATTGIF+AAA+TDWLDGYIARK +LGT
Sbjct  122  RLLTLPTVLTIGRVAAVPLLISTFYMEGPWAAMATTGIFLAAAVTDWLDGYIARKMQLGT  181

Query  565  AFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWA  744
             FGAFLDPVADKLMVAATLVLLCT+PLE+S     PWLLTVPSIAIIGREITMSAVREWA
Sbjct  182  PFGAFLDPVADKLMVAATLVLLCTKPLESSLLNDGPWLLTVPSIAIIGREITMSAVREWA  241

Query  745  ASQGSKLSE  771
            ASQ SK+ E
Sbjct  242  ASQNSKVLE  250



>ref|XP_009776593.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like isoform X1 [Nicotiana sylvestris]
Length=233

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 146/228 (64%), Gaps = 29/228 (13%)
 Frame = +1

Query  55   LRTMAGGALKLHAVVTSIYSQKPYTWARTISSAAKS-----ETLRGPAASTPRWR-RRIP  216
            L TM  G LKL A   SIY  KPYT+  T +S   S      T       T  +R RRI 
Sbjct  7    LHTMPVG-LKLTASFASIYGHKPYTFFPTFTSTTTSTSTAVNTNHQAVPPTLIYRCRRIA  65

Query  217  FPAPVRGVPNYQISLGFHNRDCSPLLPVRSISTTQMGSDPDKKEQQLPDTVPSQSDKLLT  396
             PAP    P                  V  +S   MGS              S+S KLLT
Sbjct  66   TPAPAYPFPA----------------KVLGVSCLSMGSAFRPSSSP------SKSAKLLT  103

Query  397  LPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGA  576
            LPTILTIGRVAA+P+LV+TFYVDSWWGP ATTGIFIAAAITDWLDGY+ARK  LGTAFGA
Sbjct  104  LPTILTIGRVAAIPILVTTFYVDSWWGPTATTGIFIAAAITDWLDGYLARKMNLGTAFGA  163

Query  577  FLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREIT  720
            FLDPVADKLMVAATL+LLCTRPLEAS F  +PWLLTVPSIAIIGRE++
Sbjct  164  FLDPVADKLMVAATLILLCTRPLEASVFGQLPWLLTVPSIAIIGREVS  211



>ref|XP_007512284.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Bathycoccus prasinos]
 emb|CCO66372.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Bathycoccus prasinos]
Length=279

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 140/219 (64%), Gaps = 12/219 (5%)
 Frame = +1

Query  343  KEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitD  522
            KE +      + S   LT+PT+LT+ RVAA+P     +Y  + W       +F+ AAITD
Sbjct  63   KEDEAARYGLTNSASGLTIPTMLTLARVAAIPAFAYMYYQTTAWSAPGCCFVFVLAAITD  122

Query  523  WLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAI  702
            WLDGY+ARK    +AFGAFLDPVADKLMVA  LVLLC+  LE     H P+L+ VPS  I
Sbjct  123  WLDGYLARKWNQSSAFGAFLDPVADKLMVACALVLLCS--LEPKGVSH-PYLVAVPSAII  179

Query  703  IGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSS--------  858
            IGREITMSA+REWA+++G    +AV VNNLGKWKTATQM A+++LL  RD +        
Sbjct  180  IGREITMSALREWASAKGGDAHKAVKVNNLGKWKTATQMVAISVLLLVRDGAPKAIESFL  239

Query  859  -LVDAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVLL  972
              + A  L   GV  L++SA LA  SL+VYM  + K +L
Sbjct  240  PKMLASELTNVGVVTLWVSAALAALSLYVYMAPVLKYML  278



>ref|XP_001420685.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98978.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=241

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 133/197 (68%), Gaps = 9/197 (5%)
 Frame = +1

Query  397  LPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGA  576
            LPT LT+ RVAAVPLL + +Y D          +FI AAITDWLDGY+AR+ K  +AFGA
Sbjct  45   LPTFLTLLRVAAVPLLAAVYYSDLANAAPIAGTMFIGAAITDWLDGYLARRLKASSAFGA  104

Query  577  FLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQG  756
            FLDPVADKLMVAA+L LLCT      A     W + VPSI IIGREITMSA+REW A++G
Sbjct  105  FLDPVADKLMVAASLCLLCTHAPRGVA----AWAVAVPSIVIIGREITMSALREWCAAKG  160

Query  757  SKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGA-----LVGSGVALLYISAWL  921
             +   AV VNNLGK+KTATQM AL++LL  RD S   A       LV  GV  L+ISA L
Sbjct  161  GEAHAAVKVNNLGKYKTATQMVALSVLLLVRDGSDFFANGAHDALLVRGGVWCLWISAAL  220

Query  922  AVWSLFVYMRKIWKVLL  972
            A+ SL+VYM  +  ++L
Sbjct  221  ALISLWVYMSGVIGIML  237



>ref|XP_008789016.1| PREDICTED: cardiolipin synthase, mitochondrial-like [Phoenix 
dactylifera]
Length=203

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +1

Query  307  ISTTQMGSDPDKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaa  486
            I   ++GS+   +++         S +LLTLPT+LTIGRVAAVPLLVSTFY++ WW   A
Sbjct  51   IDGREVGSNGGYRQEG-----QQGSPRLLTLPTVLTIGRVAAVPLLVSTFYMNGWWATTA  105

Query  487  ttgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVH  666
            TT IFIAAA+TDWLDGYIARK  LGT FGAFLDPVADKLMVAATLVLLCTRPLE +AF  
Sbjct  106  TTCIFIAAAVTDWLDGYIARKMHLGTPFGAFLDPVADKLMVAATLVLLCTRPLEVAAFGE  165

Query  667  MPWLLTVPSIAIIGREI  717
            +PWLLTVPSIAIIGRE+
Sbjct  166  VPWLLTVPSIAIIGREV  182



>gb|AFK38258.1| unknown [Lotus japonicus]
Length=216

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  418  GRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFGAFLDPVAD  597
            GRVAAVPLLV+TFY+D W G AATT IFIAA++TDWLDGYIARK KL ++FGAFLDPVAD
Sbjct  101  GRVAAVPLLVATFYMDGWRGTAATTSIFIAASVTDWLDGYIARKMKLESSFGAFLDPVAD  160

Query  598  KLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQ  753
            KLMVAATLVLLCTRPL    F   PWLLT+PSIAIIGREITMSAVREWAASQ
Sbjct  161  KLMVAATLVLLCTRPLAVDVFGQAPWLLTLPSIAIIGREITMSAVREWAASQ  212



>ref|XP_006485967.1| PREDICTED: uncharacterized protein LOC102607269 isoform X2 [Citrus 
sinensis]
Length=300

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            S+K+LTLPTILT+GRVAAVPLL+ TFYVDSWWG  ATT IFIAAA+TDWLDGYIARK +L
Sbjct  160  SNKILTLPTILTLGRVAAVPLLICTFYVDSWWGRTATTSIFIAAAVTDWLDGYIARKMRL  219

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREI  717
            G+ FGAFLDPVADKLMVAATLVLLCT+PLE   F  +PWLLTVP+IAIIGRE+
Sbjct  220  GSTFGAFLDPVADKLMVAATLVLLCTKPLELPVFGQVPWLLTVPAIAIIGREL  272



>ref|XP_002507590.1| cdp-alcohol phosphatidyltransferase [Micromonas sp. RCC299]
 gb|ACO68848.1| cdp-alcohol phosphatidyltransferase [Micromonas sp. RCC299]
Length=267

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 136/207 (66%), Gaps = 14/207 (7%)
 Frame = +1

Query  373  SQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKK  552
            S+    L +PT LT+ RVAAVPL+   F++   W   +   IFI AAITDW DG++ARK 
Sbjct  66   SRDGPTLNIPTALTLIRVAAVPLVTLIFFMRGAWVAPSCCTIFICAAITDWADGFLARKL  125

Query  553  KLGTAFGAFLDPVADKLMVAATLVLLCTR--PLEASAFVHMPWLLTVPSIAIIGREITMS  726
            +L ++FGAFLDPVADKLMVAA LVLLC    P    AF+       +P+  IIGREITMS
Sbjct  126  RLVSSFGAFLDPVADKLMVAAALVLLCVHAPPDVGGAFI------AIPATIIIGREITMS  179

Query  727  AVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSL-----VDAGALV-GS  888
            A+REWAAS G  + +AVAVN+ GKWKTATQ+ A++ILL  RD         DAG L+  +
Sbjct  180  ALREWAASAGGDVHDAVAVNSFGKWKTATQLVAISILLGARDGFAWLGLSKDAGMLLTKA  239

Query  889  GVALLYISAWLAVWSLFVYMRKIWKVL  969
            G   L+ISA LA+ S+ +YM  I K +
Sbjct  240  GSCCLWISAGLALLSMGIYMSGILKYM  266



>ref|WP_028836375.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-L05]
Length=196

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 137/195 (70%), Gaps = 10/195 (5%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LPT LT+ RVAAVP +   FY+   W   A + IFI AAITDW DG++ARK KL ++F
Sbjct  1    MNLPTTLTLLRVAAVPCITVLFYMQGVWVAPACSAIFILAAITDWADGFLARKLKLVSSF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA TLVL+CT+   A   V++  L+++P+  IIGREITMSA+REWAA+
Sbjct  61   GAFLDPVADKLMVATTLVLMCTK---APPSVNVS-LISIPATLIIGREITMSAIREWAAA  116

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSS----LVDAGA--LVGSGVALLYIS  912
             G K  +AVAVN+ GK KTATQ+ AL++LL  RD      L  A    L+ SG+  L++S
Sbjct  117  AGGKARDAVAVNSYGKLKTATQLVALSVLLGVRDGCGWVHLTGASEVWLINSGLICLWLS  176

Query  913  AWLAVWSLFVYMRKI  957
            A LA+ SL++YM  +
Sbjct  177  AGLALISLWIYMAGV  191



>gb|EPS58151.1| hypothetical protein M569_16665, partial [Genlisea aurea]
Length=113

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  379  SDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKL  558
            S KLLTLPTILTIGRVAAVPL+V  FY DSWWGP ATTGIFIAAAITDWLDGY+ARK K+
Sbjct  1    SAKLLTLPTILTIGRVAAVPLMVGAFYSDSWWGPTATTGIFIAAAITDWLDGYLARKMKV  60

Query  559  GTAFGAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREI  717
            GT FGAFLDPVADKLMVAATL+LLCT P +   F ++PWL+T P+IAIIGRE+
Sbjct  61   GTQFGAFLDPVADKLMVAATLILLCTVPYDVGFFGNIPWLMTAPTIAIIGREV  113



>emb|CEF99950.1| CDP-alcohol phosphatidyltransferase [Ostreococcus tauri]
Length=255

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 142/218 (65%), Gaps = 13/218 (6%)
 Frame = +1

Query  337  DKKEQQLPDTVPSQSDKLLTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaai  516
            D+K+ +       +  +L  LPT LT+ RVAAVP L   ++            +FIAAAI
Sbjct  40   DEKDARYGLANAERGTRLRWLPTALTLVRVAAVPALAVVYHSAMKNAAVICGVMFIAAAI  99

Query  517  tDWLDGYIARKKKLGTAFGAFLDPVADKLMVAATLVLLCTR-PLEASAFVHMPWLLTVPS  693
            TDWLDG++ARK K  +AFGAFLDPVADKLMVAA+L LLCTR P   S+       +++P+
Sbjct  100  TDWLDGFLARKLKASSAFGAFLDPVADKLMVAASLCLLCTRAPTGVSSLA-----VSLPA  154

Query  694  IAIIGREITMSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLV---  864
            I IIGREITMSA+REW A+ G +   AV VNNLGK+KTATQM AL++LL  RD S     
Sbjct  155  IVIIGREITMSALREWCAATGGEAHAAVKVNNLGKYKTATQMIALSVLLLVRDGSAFFMN  214

Query  865  ---DAGALVGSGVALLYISAWLAVWSLFVYMRKIWKVL  969
               DA A+V  GV  L+ SA LA+ SL+VYM+ +  ++
Sbjct  215  GAYDA-AIVKGGVWCLWASAVLALASLYVYMKPVIGIM  251



>ref|WP_004582357.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter nanhaiticus]
 gb|ENO14137.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter nanhaiticus D15-8W]
Length=185

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 118/190 (62%), Gaps = 15/190 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LP ILT+ R+A +P+ V  FY+   W    +  IF  AA TDWLDGY+AR+   GT F
Sbjct  1    MNLPNILTLSRIAMIPVFVIVFYLPFEWRFLVSAAIFALAAATDWLDGYLARRLNQGTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  L LL           H   +LTVP+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALTLLIEE--------HNSMILTVPATIIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G + S  VAV+ +GK KT  QM ++ +LLA     L   GA++G    LLY++A L +W
Sbjct  113  MGKRAS--VAVSYIGKIKTTAQMVSIIMLLA---FPLATPGAIIGE--ILLYVAAILTLW  165

Query  931  SLFVYMRKIW  960
            S+F+Y+R  W
Sbjct  166  SMFLYLRAAW  175



>gb|KGU82702.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas mediterranea CFBP 5447]
Length=186

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P +LT+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLLTVLRVLLIPIFILLFYLPYHWSYVASASVFAIAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113   LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLISAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR +V 
Sbjct  167   SMVQYLRAAWP------HLRTDVE  184



>emb|CDF94907.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. SHC52]
Length=186

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P +LT+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLLTVLRVLLIPIFILLFYLPYHWSYVASASVFAIAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113   LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLISAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR +V 
Sbjct  167   SMVQYLRAAWP------HLRTDVE  184



>ref|WP_010221879.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|KDN98588.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. P482]
Length=186

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 121/190 (64%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYIAASSVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA  +  ++    ++G   ALL ISA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLA--NPPVLTFWVILGY--ALLMISAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVHYLRAAW  176



>ref|WP_015277053.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 ref|YP_007240417.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri RCH2]
 gb|AGA86787.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri RCH2]
Length=204

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  20   MNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTVAALTDWLDGYLARRLEQSTPF  79

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  80   GAFLDPVADKLMVAVALVLLVEE--------HANLWLTLPAAIIIGREIVVSALREWMAE  131

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM+AL ILLA      +     VG G ALL ++A L +W
Sbjct  132  LGAR--AQVAVSNLGKWKTAAQMAALVILLANPPQPTI----WVGLGYALLIVAAGLTLW  185

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  186  SMINYLMAAW  195



>ref|WP_009394220.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida]
 gb|EKX87215.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida CSV86]
Length=186

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPYHWSYVAASSVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +      A V  G ALL I+A L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPPAF----TAWVVLGYALLMIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLHYLRAAW  176



>ref|WP_038995609.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida]
Length=186

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 120/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P  +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPFFILLFYVPYHWSYIAASSVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA  +  ++    ++G   ALL ISA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLA--NPPVLTFWVILGY--ALLMISAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVHYLRAAW  176



>ref|WP_038612268.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas alkylphenolia]
 gb|AIL62344.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas alkylphenolia]
Length=186

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 121/190 (64%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYIAASSVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA  +  ++    ++G   ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLA--NPPVLTFWVILGY--ALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVHYLRAAW  176



>ref|WP_003208929.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJF70396.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. Ag1]
 gb|ESW58969.1| CDP-diacylglycerol--glycerol-3-phosphate 3- phosphatidyltransferase 
[Pseudomonas fluorescens BBc6R8]
Length=186

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYMASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR EV 
Sbjct  167   SMLQYLRAAWP------HLRTEVE  184



>ref|XP_009792385.1| PREDICTED: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
2-like isoform X2 [Nicotiana sylvestris]
Length=85

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  721  MSAVREWAASQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVAL  900
            MSAVREWAASQG KLSEAVAVNNLGKWKTATQM ALTILL TRDSSL  AG  V SGV L
Sbjct  1    MSAVREWAASQGGKLSEAVAVNNLGKWKTATQMIALTILLVTRDSSLSGAGIFVASGVIL  60

Query  901  LYISAWLAVWSLFVYMRKIWKVLLV  975
            LY+SAWLAVWSL VYMRKIWKVLL+
Sbjct  61   LYVSAWLAVWSLVVYMRKIWKVLLM  85



>ref|WP_013982772.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 ref|YP_004714351.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri ATCC 17588 = LMG 11199]
 ref|YP_005938752.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri DSM 4166]
 gb|AEA84010.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri DSM 4166]
 gb|AEJ05262.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri ATCC 17588 = LMG 11199]
 gb|EPL63883.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri B1SMN1]
Length=185

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTIAALTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HSNLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA      +     VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPQPTI----WVGMGYALLIVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>ref|WP_011913222.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 ref|YP_001172597.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri A1501]
 gb|ABP79755.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri A1501]
Length=204

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  20   MNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTIAALTDWLDGYLARRLEQSTPF  79

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  80   GAFLDPVADKLMVAVALVLLVEE--------HSNLWLTLPAAIIIGREIVVSALREWMAE  131

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA      +     VG G ALL ++A L +W
Sbjct  132  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPQPTI----WVGMGYALLIVAAGLTLW  185

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  186  SMINYLMAAW  195



>ref|WP_014820260.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 ref|YP_006457722.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri CCUG 29243]
 gb|AFM33299.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri CCUG 29243]
Length=185

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFYWSYMAASAVFTVAALTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HSNLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA      +     VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPQPTI----WVGLGYALLIVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>ref|WP_024781215.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas corrugata]
Length=186

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P +LT+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLLTVLRVLLIPIFILLFYLPYNWSYMASASVFAVAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113   LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLISAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR +V 
Sbjct  167   SMVQYLRAAWP------HLRTDVE  184



>ref|WP_003300236.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri subgroup]
 gb|EME00348.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri NF13]
 gb|ESQ97616.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas chloritidismutans AW-1]
 emb|CEG51870.1| phosphatidylglycerophosphate synthetase [Pseudomonas xanthomarina]
Length=185

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTVAALTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HSNLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA      +     VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPQPTI----WVGLGYALLIVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>ref|WP_003284952.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 gb|EHY79217.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri ATCC 14405 = CCUG 16156]
Length=185

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTVAALTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HGNLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL +LLA      V     VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVVLLANPPQPTV----WVGMGYALLIVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>gb|AHL75612.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
Length=185

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 120/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ILT+ RV  +P++V  FY+   W   A++ +F  AA+TDWLDGY+ARK +  T F
Sbjct  1    MNIPNILTVLRVLLIPIIVLLFYLPFHWSYLASSAVFTVAALTDWLDGYLARKLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HSNLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV++LGKWKTA QM AL ILLA    + V     VG G ALL I+A L +W
Sbjct  113  LGAR--AHVAVSSLGKWKTAAQMVALVILLANPPLATV----WVGLGYALLIIAAALTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>ref|WP_025112503.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. H1h]
Length=186

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 118/191 (62%), Gaps = 16/191 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLAT-RDSSLVDAGALVGSGVALLYISAWLAV  927
             G++    VAV+NLGKWKTA QM AL ILLA  RD S       V  G ALL ISA L +
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPRDFSF-----WVFLGYALLLISAGLTL  165

Query  928  WSLFVYMRKIW  960
            WS+  Y+R  W
Sbjct  166  WSMVQYLRAAW  176



>dbj|BAP44729.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. StFLB209]
Length=186

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FYV   W  AA + +F  AA TDWLDGY+ARK +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYVPYHWSYAAASVVFAFAAATDWLDGYLARKLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LV+L           H  + LT+P++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVMLVQT--------HANFWLTLPAMVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA      V     V +G ALL ++A L +W
Sbjct  113  IGAR--AQVAVSNMGKWKTAAQMLALVILLANP----VQLSFWVVTGYALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y++  W
Sbjct  167  SMIQYLKAAW  176



>ref|WP_028302328.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Oceanospirillum beijerinckii]
Length=182

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 124/194 (64%), Gaps = 17/194 (9%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LP +LTI R+  +PL+V  FY+   +    +  +F  AA TDWLDGY+ARK    T F
Sbjct  1    MKLPNLLTILRICLIPLIVLFFYLPVEYNFYYSAALFALAAWTDWLDGYLARKWNQTTRF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  L LL    +EA    H  WL+TVP++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALGLL----IEA----HGSWLMTVPALVIIGREIIISALREWMAQ  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVG-SGVALLYISAWLAV  927
             G + +  VAV+++GKWKTA QM  + +LLA      V AG  +  +GVA+LY+S  L +
Sbjct  113  VGERTT--VAVSSVGKWKTAFQMLGIFVLLA------VPAGTTIAYAGVAVLYVSVILTI  164

Query  928  WSLFVYMRKIWKVL  969
            WS+ +Y+   W  L
Sbjct  165  WSMVLYLNAAWPAL  178



>gb|EXF92857.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens HK44]
Length=210

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 128/222 (58%), Gaps = 22/222 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNVWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113   LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLVGYTLLMVSAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVHLGSNF--QHSPDSAQFIK  1050
             S+  Y+R  W       HL+ +V     F  Q   ++++F K
Sbjct  167   SMVQYLRAAWP------HLKTDVEKNKTFLNQGVDETSKFYK  202



>ref|WP_027603207.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. LAMO17WK12:I2]
Length=186

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V +G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLTGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_034119069.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYVASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V +G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLTGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_003182757.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
 gb|EJL05053.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens Q2-87]
 gb|AHL34908.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas brassicacearum]
Length=186

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 121/203 (60%), Gaps = 20/203 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLISAGLTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLRFEV  999
            S+  Y+R  W       HLR +V
Sbjct  167  SMVQYLRAAWP------HLRTDV  183



>ref|WP_003232771.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 ref|YP_007396857.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas poae RE*1-1-14]
 gb|ELQ17992.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens BRIP34879]
 gb|AGE25361.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas poae RE*1-1-14]
 gb|ETK16517.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. FH1]
 gb|KGE64067.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens LMG 5329]
Length=186

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 123/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W  AA++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYAASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V +G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLTGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_003225417.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJZ58571.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens R124]
Length=186

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 118/191 (62%), Gaps = 16/191 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLAT-RDSSLVDAGALVGSGVALLYISAWLAV  927
             G++    VAV+NLGKWKTA QM AL ILLA  RD S       V  G ALL ISA L +
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPRDFSF-----WVLLGYALLMISAGLTL  165

Query  928  WSLFVYMRKIW  960
            WS+  Y+R  W
Sbjct  166  WSMVQYLRAAW  176



>gb|AIS18150.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas rhizosphaerae]
Length=186

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 120/200 (60%), Gaps = 20/200 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P  +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPFFILLFYLPYHWSYMAASTVFAIAAATDWLDGYLARRWEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HANFWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA   +    A   V  G ALL ++A L +W
Sbjct  113  IGAR--AQVAVSNMGKWKTAAQMVALVILLANPKA----ATFWVIVGYALLIVAAALTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLR  990
            S+  Y+R  W       HLR
Sbjct  167  SMLQYLRAAWP------HLR  180



>ref|WP_038660282.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 gb|AHY43067.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
Length=185

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+    T F
Sbjct  1    MNIPNLLTVLRVLLIPVFILLFYLPFYWSYLAASAVFTVAALTDWLDGYLARRLGQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA      +     VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPSQPTI----WVGLGYALLIVAAALTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>ref|WP_003445025.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EMI06003.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. Lz4W]
Length=185

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P  +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPFFILLFYLPYSWSYVASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  W LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQEH-------HNVW-LTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNMGKWKTAAQMLALIILLANPS----DFSFWVVVGYALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_003200282.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EIK64379.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens Q8r1-96]
Length=186

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYHWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113   LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLVSAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR +V 
Sbjct  167   SMVQYLRAAWP------HLRTDVE  184



>ref|WP_008080159.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM80]
 gb|EJN32850.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM80]
Length=186

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 118/191 (62%), Gaps = 16/191 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLAT-RDSSLVDAGALVGSGVALLYISAWLAV  927
             G++    VAV+NLGKWKTA QM AL ILLA  RD S       V  G ALL +SA L +
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPRDFSF-----WVVLGYALLMVSAGLTL  165

Query  928  WSLFVYMRKIW  960
            WS+  Y+R  W
Sbjct  166  WSMVQYLRAAW  176



>gb|KGK84840.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. HMP271]
Length=184

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+   W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFHWSYLAASAVFTIAAVTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVGE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +  +     VG G ALL I+A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPALTI----WVGLGYALLIIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLNAAW  176



>ref|WP_018608070.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EPJ86087.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CFII68]
Length=186

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYHWSYVASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113   LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLVSAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR +V 
Sbjct  167   SMVQYLRAAWP------HLRTDVE  184



>ref|WP_032892416.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. Eur1 9.41]
Length=186

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYIASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V +G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFTFWVLTGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_003190391.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 ref|YP_006323643.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens A506]
 gb|AFJ57947.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens A506]
 gb|EIK61219.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens SS101]
 gb|EIK69180.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas synxantha BG33R]
 gb|EPJ75657.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CFT9]
 gb|EPL05934.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CF150]
 gb|ETK39701.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens FH5]
 gb|AIB41556.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. WCS374]
 gb|KFF42933.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. BRG-100]
Length=186

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYVASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V +G ALL ++A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLTGYALLLVAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_030141409.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 121/203 (60%), Gaps = 20/203 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYVASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLVSAGLTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLRFEV  999
            S+  Y+R  W       HLR +V
Sbjct  167  SMVQYLRAAWP------HLRTDV  183



>ref|WP_017847081.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas veronii]
Length=186

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYMASSSVFAVAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_007965084.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM30]
 gb|EUB84943.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM30]
 gb|EZP32288.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. RIT288]
Length=186

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 118/191 (62%), Gaps = 16/191 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLAT-RDSSLVDAGALVGSGVALLYISAWLAV  927
             G++    VAV+NLGKWKTA QM AL ILLA  RD S       V  G +LL ISA L +
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPRDFSF-----WVLLGYSLLMISAGLTL  165

Query  928  WSLFVYMRKIW  960
            WS+  Y+R  W
Sbjct  166  WSMVQYLRAAW  176



>ref|WP_008567753.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. Chol1]
 gb|EKM96900.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. Chol1]
Length=184

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+   W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFHWSYLAASAVFTIAAVTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVGE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +  +     V  G ALL+I+A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPALTI----WVSLGYALLFIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLNAAW  176



>ref|WP_032886611.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. RIT357]
 gb|EZP66464.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. RIT357]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYEWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113  IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_016968866.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W  AA++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYAASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_034135291.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYVASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V +G ALL ++A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFTFWVLTGYALLLVAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_028622707.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. Ant30-3]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+NLGKWKTA QM AL ILLA   S        V  G ALL ISA L +W
Sbjct  113   LGAR--AHVAVSNLGKWKTAAQMLALVILLANPSSF----TFWVLLGYALLLISAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HL+ EV 
Sbjct  167   SMVQYLRAAWP------HLKTEVE  184



>ref|WP_028946102.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas vranovensis]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYMAASTVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LV+L           H    LT+P++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVMLVQD--------HANLWLTLPAVVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +        V  G  LL I+A L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPAT----LSFWVVVGYTLLMIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVHYLRAAW  176



>ref|WP_008066866.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM79]
 gb|EJN28908.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM79]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLMGYALLLVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_007933765.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJM21842.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM18]
Length=186

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLMGYALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_017339130.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
 gb|ERP41860.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens NCIMB 11764]
Length=186

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFTFWVLVGYALLLISAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_039768771.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
 gb|KIF60547.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +        V  G ALL ISA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPKAF----SFWVLIGYALLMISAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_019410046.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas psychrophila]
Length=185

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P  +  FY+   W  AA + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPFFILLFYLPYSWSYAAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HHNFWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLVGYALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_008029556.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJM82049.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM60]
 gb|EJM92501.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM67]
Length=185

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFTFWVLVGYALLMISAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_034097260.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFTFWVLLGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_015045696.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Simiduia agarivorans]
 ref|YP_006915253.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Simiduia agarivorans SA1 = DSM 21679]
 gb|AFU97523.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Simiduia agarivorans SA1 = DSM 21679]
Length=186

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 119/194 (61%), Gaps = 13/194 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            +TL   LT+ R+A +PL V  FY+   W   A   IF  AA+TDWLDGYIARK +  T F
Sbjct  1    MTLANQLTLARIALIPLFVVVFYLPYKWSYPAAALIFFFAALTDWLDGYIARKYQQSTQF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H   L+ + S  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVG--------AHKSALMALASAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G +   +VAV+ LGK KTA QM+AL  LLA    S   A     +G  LLY++A L +W
Sbjct  113  LGKR--SSVAVSFLGKVKTAAQMAALITLLAFEPESHPTAQL---AGYFLLYLAAGLTLW  167

Query  931  SLFVYMRKIWKVLL  972
            S+F+Y++  W +++
Sbjct  168  SMFLYLKAAWPLMM  181



>ref|WP_016984200.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVVLGYALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_008150904.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EUB74122.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM41(2012)]
 gb|KDD65690.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas mandelii PD30]
Length=186

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL ISA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFTFWVLLGYALLLISAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_019826345.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CF149]
 gb|EPJ93313.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CF149]
Length=185

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P  +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPFFILLFYVPYSWSYVAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  W LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQEH-------HNVW-LTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA  + S      LVG G  LL ++A L +W
Sbjct  113  LGAR--AQVAVSNMGKWKTAAQMLALVILLA--NPSDFSFWVLVGYG--LLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_027923802.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. URMO17WK12:I12]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYVASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLIGYALLLVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_007943517.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM21]
 gb|EJM23724.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM21]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLIGYALLLVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_008066654.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM78]
 gb|EJN16483.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM78]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVLLGYALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_007950102.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJM32793.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM24]
 gb|KHA70576.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas chlororaphis]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVILGYALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_034873950.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Endozoicomonas montiporae]
 gb|KEQ14194.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Endozoicomonas montiporae]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 120/191 (63%), Gaps = 15/191 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ILT  R+  VP LV  FY+   W   A+  IF  AA+TDW DGY+AR+    TAF
Sbjct  1    MNVPNILTSLRIVLVPFLVLVFYLPYEWRYLASASIFAVAAVTDWFDGYLARRWNQTTAF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAF DPVADK+MVA  L LL     E  AF    W +TVPS+ IIGREI +SA+REW A 
Sbjct  61   GAFFDPVADKIMVATALCLLIE---EFGAF----W-MTVPSMIIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGS-GVALLYISAWLAV  927
             G + S  VAVN +GK KTA QM A+T+LL T     V    ++G  G+ LLY SA L +
Sbjct  113  LGKRTS--VAVNRIGKLKTAAQMLAITLLLLTP----VPMAGIIGYIGLILLYASAVLTL  166

Query  928  WSLFVYMRKIW  960
            WS++VY+R  W
Sbjct  167  WSMYVYLRAAW  177



>ref|WP_034103764.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYVASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFTFWVLLGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_010566013.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas extremaustralis]
 gb|EZI26822.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas extremaustralis 14-3 substr. 14-3b]
Length=186

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVLLIPIFILLFYLPYEWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFTFWVLLGYALLLIAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  167   SMLQYLRAAWP------HLRTTVE  184



>ref|WP_012723427.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 ref|YP_002871806.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens SBW25]
 ref|YP_008931818.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. TKP]
 emb|CAY48429.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens SBW25]
 gb|AHC34808.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. TKP]
Length=186

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYEWSYMASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113  IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFTFWVLLGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_017530524.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYEWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL ++A L +W
Sbjct  113  IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLLGYALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_022962632.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas pelagia]
Length=189

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ILT+ RVA +P+ +  +Y+   W   A   +F  A++TDWLDGY+ARK +  T F
Sbjct  1    MNIPNILTLLRVALIPIFILFYYLPFHWCYLAAAIVFTVASVTDWLDGYLARKWEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + +T P++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQS--------HANFWVTAPAMVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G +    VAV+ LGK+KTA QM AL +LLA  +  L+    ++G    LL ISA L  W
Sbjct  113  LGKR--AHVAVSQLGKYKTAAQMVALIVLLA--NPPLISNWVVLGY--VLLMISAVLTFW  166

Query  931  SLFVYMRKIW  960
            S++VY+R  W
Sbjct  167  SMYVYLRAAW  176



>gb|AHZ67202.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas mandelii JR-1]
Length=188

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  3    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  62

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  63   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  114

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G ALL +SA L +W
Sbjct  115  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPS----DFTFWVLIGYALLLVSAGLTLW  168

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  169  SMVQYLRAAW  178



>ref|WP_007896267.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJM05998.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM102]
 gb|EJM70407.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM50]
Length=186

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   S        V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPSSF----SFWVLMGYALLLVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_020295155.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CF161]
 gb|EPL15611.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CF161]
Length=186

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYSWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL I+A L +W
Sbjct  113  LGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLVGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_008015882.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM55]
 gb|EJM78433.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM55]
Length=186

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANSK----DFSFWVLLGYTLLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_027620323.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. URHB0015]
Length=186

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYMPYHWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HANLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  IGAR--AQVAVSNLGKWKTAAQMLALVILLANPS----DFSFWVLVGYVLLMLSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVHYLRAAW  176



>ref|WP_015094913.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. UW4]
 ref|YP_007029391.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. UW4]
 gb|AFY19586.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. UW4]
Length=186

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HANLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVLLGYTLLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_034147143.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVLMGYVLLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_007958898.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 ref|YP_348794.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens Pf0-1]
 gb|ABA74803.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens Pf0-1]
 gb|EJM23875.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM25]
Length=186

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA            V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPKVF----SFWVVIGYALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_020798850.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EPA95327.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. G5(2012)]
 gb|KEX89452.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida]
Length=186

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILL        D    V  G ALL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLGNPS----DFSFWVLMGYALLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_003291085.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 gb|EIK51489.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri TS44]
Length=184

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+   W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFHWSYLAASAVFTIAALTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVGE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +  +     V  G ALL I+A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPALTI----WVSLGYALLIIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLNAAW  176



>ref|WP_016781234.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fragi]
Length=185

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P  +  FY+   W  AA + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPFFILLFYLPYSWSYAAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  W LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQEH-------HNVW-LTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA  + S      LVG G  LL ++A L +W
Sbjct  113  LGAR--AQVAVSNMGKWKTAAQMLALVILLA--NPSDFSFWVLVGYG--LLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_027979415.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[gamma proteobacterium L18]
Length=186

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P  +  FY+   W  AA + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPFFILLFYLPYEWSYAAASTVFAIAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  W LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQAH-------HNVW-LTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +        V  G ALL +SA L +W
Sbjct  113  IGAR--AHVAVSNLGKWKTAAQMLALVILLANPPA----ITFWVLLGYALLVVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMAHYLRAAW  176



>ref|WP_012970752.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Allochromatium vinosum]
 ref|YP_003443510.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase 
[Allochromatium vinosum DSM 180]
 gb|ADC62478.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase 
[Allochromatium vinosum DSM 180]
Length=194

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 123/189 (65%), Gaps = 13/189 (7%)
 Frame = +1

Query  394  TLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFG  573
             LP ILT+ R+A +P+ V  FY+DS W P A   +F AAA+TDWLDGY+ARK    +  G
Sbjct  3    NLPNILTLLRIALIPVFVVVFYLDSVWAPYAAAAVFGAAALTDWLDGYLARKWDQTSPLG  62

Query  574  AFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQ  753
            AFLDPVADKLMVA  LV+L    L+A   +    L+ +P I IIGREIT+SA+REW A  
Sbjct  63   AFLDPVADKLMVAVALVVL----LQADPRI----LIALPVIVIIGREITVSALREWMAEI  114

Query  754  GSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWS  933
            G++   AVAV+ LGK KT  QM ++ IL+  RDS  V      G GV LLY++A L +WS
Sbjct  115  GAR--AAVAVSALGKIKTTAQMISIVILI-LRDS--VFGPWTYGLGVVLLYVAALLTLWS  169

Query  934  LFVYMRKIW  960
            + +Y+   W
Sbjct  170  MVLYLVSAW  178



>gb|KIH83025.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas batumici]
Length=189

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVVLIPIFILLFYLPYQWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       D    V  G ALL  +A L +W
Sbjct  113  LGAR--AQVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLVGYALLMAAAVLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_026013470.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas agarici]
Length=189

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G +    VAV+N+GKWKTA QM AL ILLA       D    V  G +LL I+A L +W
Sbjct  113  LGER--AQVAVSNMGKWKTAAQMLALVILLANPS----DFSFWVLVGYSLLMIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_007992985.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EJM47197.1| phosphatidylglycerophosphate synthase [Pseudomonas sp. GM48]
 gb|EJM64588.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM49]
Length=186

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYLASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVLLGYTLLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_029293776.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens group]
 gb|ETK17291.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. FH4]
 gb|AIG01576.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYEWSYMASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA       +    V  G ALL I+A L +W
Sbjct  113  IGAR--AHVAVSNMGKWKTAAQMLALVILLANPS----NFTFWVLLGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_008051977.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM74]
 gb|EJM86754.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM74]
Length=186

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVLLGYTLLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_034137766.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYQWSYVASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA  + S      L+G   ALL I+A L +W
Sbjct  113  IGAR--AHVAVSNMGKWKTAAQMLALVILLA--NPSHFTFWVLLGY--ALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_007974720.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM33]
 gb|EJM42767.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. GM33]
Length=186

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSFVASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA       D    V  G  LL +SA L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPK----DFSFWVLLGYTLLMVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_036989959.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas bauzanensis]
 gb|EZQ20275.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas bauzanensis]
Length=190

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 120/200 (60%), Gaps = 19/200 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ILT+ RV  +P+ +  +Y+   W   A   IF  A+ITDWLDGY+ARK +  T F
Sbjct  1    MNIPNILTLMRVGLIPVFILLYYLPFHWSYLAAAVIFTLASITDWLDGYLARKWEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + +T P++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQS--------HSNFWVTAPAVVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGK+KT  QM AL +LLA   +  +   A V  G  LL ISA L +W
Sbjct  113  LGAR--SQVAVSNLGKYKTTAQMIALVVLLA---NPALPMTAWVVLGYVLLMISAALTLW  167

Query  931  SLFVYMRKIWKVLLV*EHLR  990
            S+  Y+R  W       HLR
Sbjct  168  SMVAYLRAAWP------HLR  181



>ref|WP_022988958.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter sp. ES-1]
 gb|ERP92697.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter sp. ES-1]
Length=182

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 117/190 (62%), Gaps = 15/190 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LP +LT+ R+  +P+ V  FY+   W    +  IF  A +TDWLDGY+ARK    T F
Sbjct  1    MNLPNLLTMSRIVMIPVFVVIFYLPVQWSYLVSAIIFALAGVTDWLDGYLARKLNQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  L +L     E SA      LLT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALAVLIE---EYSAV-----LLTIPATVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             GS+ S  VAV+ +GK KT  QM+A+  LLA     ++   A     + LLYI+A L +W
Sbjct  113  VGSRAS--VAVSYIGKVKTTAQMAAIVGLLAFPPGQMLSYVA-----IGLLYIAAGLTLW  165

Query  931  SLFVYMRKIW  960
            S+F+Y++  W
Sbjct  166  SMFLYLKAAW  175



>ref|XP_003055406.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60658.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=181

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 111/157 (71%), Gaps = 6/157 (4%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LPT LT+ RVAAVP++ + FY    W       IF+AAA+TDW DGY+ARK  L ++F
Sbjct  7    INLPTWLTLVRVAAVPVVTAIFYARGAWVCPTCCVIFVAAAVTDWADGYLARKLNLVSSF  66

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMP-WLLTVPSIAIIGREITMSAVREWAA  747
            GAFLDPVADKLMVAA LVLLCT P        +P W +  P+  IIGREITMSA+REWAA
Sbjct  67   GAFLDPVADKLMVAAALVLLCTIPPAG-----VPAWQVAAPATIIIGREITMSAIREWAA  121

Query  748  SQGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSS  858
            + G +   AVAVN+ GKWKTATQ+ A+++LL  RD +
Sbjct  122  AAGGEAHGAVAVNSYGKWKTATQLVAISVLLGVRDGT  158



>ref|WP_017904511.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fuscovaginae]
Length=186

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 121/208 (58%), Gaps = 23/208 (11%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1     MNIPNLITVLRVVLIPIFILLFYLPYQWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H  + LT P++ IIGREI +SA+REW A 
Sbjct  61    GAFLDPVADKLMVAVALVLLVQE--------HGNFWLTFPAVVIIGREIVVSALREWMAE  112

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+ +GKWKTA QM AL ILLA   +        V  G ALL ++A L +W
Sbjct  113   IGAR--AQVAVSKMGKWKTAAQMLALVILLANPST----LSFWVVVGYALLMVAAGLTLW  166

Query  931   SLFVYMRKIWKVLLV*EHLRFEVHLGSN  1014
             S+  Y+R  W       HLR     G N
Sbjct  167   SMVQYLRAAWP------HLRIH---GEN  185



>dbj|BAC55221.1| CDP-diacylglycerol-glycerol-3-phosphate [Pseudomonas stutzeri]
Length=184

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT  RV  +P+ +  FY+   W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTRVRVLLIPIFILLFYLPFHWSYLAASAVFTIAAVTDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVGE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +  +     VG G  LL I+A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMVALVILLANPPALTI----WVGLGYTLLIIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLNAAW  176



>gb|AJE15172.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas balearica DSM 6083]
Length=185

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P  +  FY+   W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPFFILLFYLPFHWSYLAASAVFTVAALTDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVGE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV++LGKWKTA QM AL ILLA   +  V     VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSSLGKWKTAAQMVALVILLANPPALTV----WVGLGYALLIVAAALTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMVNYLVAAW  176



>ref|WP_029653594.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter daepoensis]
Length=187

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 118/190 (62%), Gaps = 15/190 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LP ILT+ R+  +P+ V+ FY+   W    +  IF  A +TDWLDGY+AR+    T F
Sbjct  1    MNLPNILTMSRIVMIPVFVAVFYLPMQWSYLVSALIFALAGLTDWLDGYLARRLNQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  L +L     E SA      LLT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALAVLIE---EYSAV-----LLTIPATVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             GS+ S  VAV+ +GK KT  QM+A+  LLA       +  A V  G  LLYI+A L +W
Sbjct  113  IGSRAS--VAVSYIGKIKTTAQMAAIVGLLAFPPG---NVWAYVAIG--LLYIAAALTLW  165

Query  931  SLFVYMRKIW  960
            S+F+Y+R  W
Sbjct  166  SMFLYLRAAW  175



>ref|WP_033699146.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. WCS358]
 gb|KEY89421.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. WCS358]
 gb|KGI95001.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. H2]
Length=186

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYMAASSVFAVAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA      V    ++G G  LL ++A L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPPG--VTFWVILGYG--LLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMAHYLLAAW  176



>ref|WP_010211263.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|ERH47377.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens EGD-AQ6]
 gb|AIB36050.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas simiae]
Length=186

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W  AA++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYEWSYAASSSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA  + S      L+G   ALL ++A L +W
Sbjct  113  IGAR--AHVAVSNMGKWKTAAQMLALVILLA--NPSHFTFWVLLGY--ALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMLQYLRAAW  176



>ref|WP_036207967.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter sp. MCTG268]
Length=185

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 124/198 (63%), Gaps = 15/198 (8%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LP ILT+ R+  +P+ V  +Y+ + W    + G+F  AA TDWLDGY+ARK    T F
Sbjct  1    MNLPNILTLSRILMIPVFVIIYYLPAQWSYLVSAGLFALAAATDWLDGYLARKLNQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  L +L    +EA    H  ++LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALTVL----IEA----HASFILTIPATVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             GS+ S  VAV+ +GK KT  QM A+ +LLA     +V A A    G ALLY++A L  W
Sbjct  113  IGSRAS--VAVSYIGKIKTTAQMVAIIMLLA-FPPGVVWAQA----GTALLYVAAVLTFW  165

Query  931  SLFVYMRKIWKVLLV*EH  984
            S+ +Y++  W  L   +H
Sbjct  166  SMILYLKAAWPDLFPEKH  183



>ref|WP_013973364.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 ref|YP_004702921.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida S16]
 ref|YP_008955634.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas monteilii SB3078]
 ref|YP_008961002.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas monteilii SB3101]
 gb|AEJ14041.1| CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida S16]
 gb|ESW38015.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas taiwanensis SJ9]
 gb|AHC83511.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas monteilii SB3078]
 gb|AHC88887.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas monteilii SB3101]
 gb|AHZ78445.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida]
 gb|KGK26518.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas plecoglossicida]
Length=186

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYMAASSVFAVAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------THANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +        V  G ALL ++A L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPPA----VTFWVILGYALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMVHYLLAAW  176



>gb|EXJ14767.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Thiorhodococcus sp. AK35]
Length=197

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 126/192 (66%), Gaps = 13/192 (7%)
 Frame = +1

Query  394  TLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAFG  573
             LP ILT+ R+  +P+ V  FYV+  W P A   +F AAA+TDWLDGY+AR+ +  +  G
Sbjct  3    NLPNILTMLRIVLIPIFVVVFYVEEPWAPYAAAAVFGAAALTDWLDGYLARRWEQTSPLG  62

Query  574  AFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAASQ  753
            AFLDPVADKLMVA +L+++    L+A   +    LL +P I IIGREIT+SA+REW A  
Sbjct  63   AFLDPVADKLMVAVSLIVV----LQADPRI----LLALPVIVIIGREITVSALREWMAEL  114

Query  754  GSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVWS  933
            G++   AVAV+NLGK KT  QM ++ +LL  RDS  +    +   G+ L+Y++A L +WS
Sbjct  115  GAR--AAVAVSNLGKVKTTAQMISI-VLLILRDS--IFGPWVYDIGILLVYVAAILTLWS  169

Query  934  LFVYMRKIWKVL  969
            + +Y+R  W  L
Sbjct  170  MVLYLRAAWPCL  181



>ref|WP_012273272.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida]
 ref|YP_001669897.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida GB-1]
 gb|ABY99561.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas putida GB-1]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYQWSYMAASSVFAVAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------THANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +  V    ++G G  LL ++A L +W
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLANPPA--VTFWVILGYG--LLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMVHYLLAAW  176



>ref|WP_017639981.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. 313]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 118/194 (61%), Gaps = 14/194 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +PL V  FY+   W     + +F  A  TDWLDGY+AR+    T F
Sbjct  1    MNIPNLLTVLRVFLIPLFVILFYLPVHWSYWTASAVFAIACATDWLDGYLARRLGQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKL+VA  LVLL      A+A+      LT+P++ I+GREI +SA+REW A 
Sbjct  61   GAFLDPVADKLIVAVALVLLVQE--HANAW------LTLPAVIIVGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA            V SG ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMLALVILLANPP----QMTFWVISGYALLIVAAALTLW  166

Query  931  SLFVYMRKIWKVLL  972
            S+  Y+   W  L+
Sbjct  167  SMCTYLMAAWPHLM  180



>ref|WP_007161859.1| MULTISPECIES: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas]
 gb|EHK69910.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas psychrotolerans L19]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 118/194 (61%), Gaps = 14/194 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +PL V  FY+   W     + IF  A  TDWLDGY+AR+    T F
Sbjct  1    MNIPNLLTVLRVFLIPLFVILFYLPVHWSYWTASTIFAIACATDWLDGYLARRLGQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKL+VA  LVLL      A+A+      LT+P++ I+GREI +SA+REW A 
Sbjct  61   GAFLDPVADKLIVAVALVLLVQE--HANAW------LTLPAVIIVGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA            V SG ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMLALVILLANPP----QMTFWVISGYALLIVAAALTLW  166

Query  931  SLFVYMRKIWKVLL  972
            S+  Y+   W  L+
Sbjct  167  SMCTYLMAAWPHLM  180



>emb|CEA05136.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. 12M76_air]
 emb|CEF26969.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. 12M76_air]
Length=189

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 120/200 (60%), Gaps = 19/200 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ILT+ RV  +P+ +  +Y+   W   A   +F  A+ITDWLDGY+ARK +  T F
Sbjct  1    MNIPNILTLMRVFLIPVFILLYYLPFHWSYLAAAVVFTLASITDWLDGYLARKWEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + +T P++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQS--------HGNFWVTAPAVVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGK+KT  QM AL +LLA   +  +     V  G  LL +SA L +W
Sbjct  113  IGAR--SHVAVSNLGKYKTTAQMVALVVLLA---NPALPMSIWVILGYVLLMVSAVLTLW  167

Query  931  SLFVYMRKIWKVLLV*EHLR  990
            S+ VY+R  W       HLR
Sbjct  168  SMVVYLRAAWP------HLR  181



>ref|WP_019361451.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fuscovaginae]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 120/202 (59%), Gaps = 20/202 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVVLIPIFILLFYLPYHWSYIAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H  + LT P++ IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNFWLTFPAVVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G +    VAV+ +GKWKTA QM AL ILL   + S+     L+G   +LL +SA L +W
Sbjct  113  IGER--AQVAVSKMGKWKTAAQMLALVILLG--NPSVFSFWVLLGY--SLLMVSAGLTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLRFE  996
            S+  Y+R  W       HLR  
Sbjct  167  SMLQYLRAAWP------HLRIN  182



>gb|AHI27936.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Marinobacter similis]
Length=182

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 116/192 (60%), Gaps = 19/192 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + LP ILT+ R+  +P+ V  FY+   W    + GIF  A +TDWLDGY+ARK    T F
Sbjct  1    MNLPNILTLSRIIMIPVFVVIFYLPVEWSYLVSAGIFALAGVTDWLDGYLARKLDQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  L +L           H   LLT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALAVLIEE--------HAAILLTIPATVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSG--VALLYISAWLA  924
             GS+ S  VAV+ +GK KT  QM+A+  LLA     L       GS   +ALLYI+A L 
Sbjct  113  MGSRAS--VAVSYIGKIKTTAQMAAIVGLLAFPPGVL-------GSNIAIALLYIAAGLT  163

Query  925  VWSLFVYMRKIW  960
            +WS+ +Y++  W
Sbjct  164  LWSMGLYLKAAW  175



>ref|WP_037009848.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas lutea]
 gb|KGF64979.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas lutea]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 118/200 (59%), Gaps = 20/200 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYMAASSVFALAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------AHANLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +        V  G  LL ++A L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMLALVILLANPPAF----TFWVVLGYVLLMVAAGLTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLR  990
            S+  Y+R  W       HLR
Sbjct  167  SMVQYLRAAWP------HLR  180



>gb|AHF67938.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas cichorii JBC1]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYHWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------THANLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA   +        V  G ALL I+A L +W
Sbjct  113  IGAR--AQVAVSNMGKWKTAAQMLALVILLANPPA----VTFWVILGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_028692524.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas mosselii]
Length=186

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYMAASTVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA  +  L+    ++G G  LL ++A L + 
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLA--NPPLLTFWVVLGYG--LLLVAAGLTLI  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMVHYLLAAW  176



>ref|WP_031320034.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. CMAA1215]
Length=186

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYMPYSWSYMAASSVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HANLWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILLA  + S+     L+G   ALL ++A L +W
Sbjct  113  LGAR--AQVAVSNMGKWKTAAQMLALVILLA--NPSVFSFWVLLGY--ALLLVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMQQYLRAAW  176



>ref|WP_004417531.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas syringae]
 gb|ELS42679.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas syringae pv. syringae B64]
Length=186

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 119/200 (60%), Gaps = 20/200 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYMPYHWSYMAASAVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------AHANLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILL    +  V     V  G ALL I+A L +W
Sbjct  113  IGAR--AQVAVSNMGKWKTAAQMFALVILLGNPPAITV----WVILGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLR  990
            S+  Y+R  W       HLR
Sbjct  167  SMVQYLRAAWP------HLR  180



>gb|EGH44803.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas syringae pv. pisi str. 1704B]
Length=186

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 119/200 (60%), Gaps = 20/200 (10%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFIFLFYMPYHWSYMAASAVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------AHANLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILL    +  V     V  G ALL I+A L +W
Sbjct  113  IGAR--AQVAVSNMGKWKTAAQMLALVILLGNPPAITV----WVILGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIWKVLLV*EHLR  990
            S+  Y+R  W       HLR
Sbjct  167  SMVQYLRAAWP------HLR  180



>ref|WP_038706385.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas mosselii]
 gb|AIN59147.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas mosselii SJ10]
Length=186

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FYV   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYVPYHWSYMAASTVFAIAAATDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL          VH  + LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------VHANFWLTLPAAVIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA  +  L+    ++G G  LL ++A L + 
Sbjct  113  LGAR--AHVAVSNLGKWKTAAQMLALVILLA--NPPLLTFWVVLGYG--LLLVAAGLTLV  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMVHYLVAAW  176



>ref|WP_003296391.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri]
 gb|EWC39909.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas stutzeri KOS6]
Length=185

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P +LT+ RV  +P+ +  FY+  +W   A + +F  AA+TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFSVAALTDWLDGYLARRLQQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVEE--------HANLWLTLPAAIIIGREIVVSALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV++LGKWKT  QM AL ILLA            VG G ALL ++A L +W
Sbjct  113  LGAR--AQVAVSSLGKWKTTAQMVALVILLANPPQP----TMWVGLGYALLIVAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+   W
Sbjct  167  SMINYLMAAW  176



>ref|WP_005892534.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas syringae]
 gb|EGI03379.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas syringae pv. oryzae str. 1_6]
 gb|KGS12672.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas coronafaciens]
Length=186

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 116/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A + +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYMPYHWSYMAASAVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQ--------AHANLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+N+GKWKTA QM AL ILL    +  V     V  G ALL I+A L +W
Sbjct  113  IGAR--AQVAVSNMGKWKTAAQMLALVILLGNPPAVTV----WVILGYALLLIAAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



>ref|WP_003173108.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
 gb|EFQ64183.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens WH6]
Length=188

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = +1

Query  391   LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
             + +P ++T+ RV  +P+ +  FY+   W   A++ +F  AA TDWLDGY+AR+ +  T F
Sbjct  3     MNIPNLITVLRVLLIPIFILLFYLPYEWSYLASSSVFAFAAATDWLDGYLARRLEQSTPF  62

Query  571   GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
             GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  63    GAFLDPVADKLMVAVALVLLVQ--------AHGNLWLTLPAAVIIGREIVVSALREWMAE  114

Query  751   QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
              G++    VAV+N+GKWKTA QM AL ILLA   +        V  G ALL ++A L +W
Sbjct  115   IGAR--AHVAVSNMGKWKTAAQMLALVILLANPPAF----TFWVVLGYALLLVAAGLTLW  168

Query  931   SLFVYMRKIWKVLLV*EHLRFEVH  1002
             S+  Y+R  W       HLR  V 
Sbjct  169   SMLQYLRAAWP------HLRTTVE  186



>ref|WP_016774513.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas sp. R62]
 gb|KIF63304.1| CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 
[Pseudomonas fluorescens]
Length=186

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = +1

Query  391  LTLPTILTIGRVAAVPLLVSTFYVDSWWGPaattgifiaaaitDWLDGYIARKKKLGTAF  570
            + +P ++T+ RV  +P+ +  FY+   W   A+  +F  AA TDWLDGY+AR+ +  T F
Sbjct  1    MNIPNLITVLRVLLIPIFILLFYLPYEWSYMASASVFAFAAATDWLDGYLARRLEQSTPF  60

Query  571  GAFLDPVADKLMVAATLVLLCTRPLEASAFVHMPWLLTVPSIAIIGREITMSAVREWAAS  750
            GAFLDPVADKLMVA  LVLL           H    LT+P+  IIGREI +SA+REW A 
Sbjct  61   GAFLDPVADKLMVAVALVLLVQE--------HGNLWLTLPAAVIIGREIVISALREWMAE  112

Query  751  QGSKLSEAVAVNNLGKWKTATQMSALTILLATRDSSLVDAGALVGSGVALLYISAWLAVW  930
             G++    VAV+NLGKWKTA QM AL ILLA   +        V  G  LL +SA L +W
Sbjct  113  LGAR--AQVAVSNLGKWKTAAQMLALVILLAHPKAF----SFWVVLGYTLLIVSAGLTLW  166

Query  931  SLFVYMRKIW  960
            S+  Y+R  W
Sbjct  167  SMVQYLRAAW  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3560101069432