BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29541_g1_i1 len=421 path=[399:0-420]

Length=421
                                                                      Score     E

ref|XP_011099963.1|  PREDICTED: probable 1-deoxy-D-xylulose-5-pho...  53.9    1e-05   
gb|KDP29794.1|  hypothetical protein JCGZ_18729                       50.8    1e-04   
dbj|BAF98289.1|  1-deoxy-D-xylulose 5-phosphate synthase              50.1    2e-04   Hevea brasiliensis [jebe]
gb|ABF18929.1|  putative 1-deoxy-D-xylulose 5-phosphate synthase      50.1    2e-04   Hevea brasiliensis [jebe]



>ref|XP_011099963.1| PREDICTED: probable 1-deoxy-D-xylulose-5-phosphate synthase 2, 
chloroplastic [Sesamum indicum]
Length=712

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 2/33 (6%)
 Frame = -2

Query  93  QFCIRACDGGQEGK--KMMIRKEKDGWEIDFSG  1
           QFC++AC G  +G+  KM+IRKEKDGW+IDFSG
Sbjct  30  QFCVKACAGTSDGEEGKMVIRKEKDGWKIDFSG  62



>gb|KDP29794.1| hypothetical protein JCGZ_18729 [Jatropha curcas]
Length=709

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = -2

Query  93  QFCIRACDGGQEGKKMMIRKEKDGWEIDFSG  1
           QFC+RA    +EGK MMIRKE+DGW+IDFSG
Sbjct  30  QFCLRASADDKEGK-MMIRKEQDGWKIDFSG  59



>dbj|BAF98289.1| 1-deoxy-D-xylulose 5-phosphate synthase [Hevea brasiliensis]
Length=711

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 3/33 (9%)
 Frame = -2

Query  93  QFCIRACDG--GQEGKKMMIRKEKDGWEIDFSG  1
           QFC+RA  G   +EGK MMIRKEKDGW+IDFSG
Sbjct  30  QFCLRASAGHPDEEGK-MMIRKEKDGWKIDFSG  61



>gb|ABF18929.1| putative 1-deoxy-D-xylulose 5-phosphate synthase [Hevea brasiliensis]
Length=711

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 3/33 (9%)
 Frame = -2

Query  93  QFCIRACDG--GQEGKKMMIRKEKDGWEIDFSG  1
           QFC+RA  G   +EGK MMIRKEKDGW+IDFSG
Sbjct  30  QFCLRASAGHPDEEGK-MMIRKEKDGWKIDFSG  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513297653190