BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2953_g1_i1 len=2030 path=[4847:0-135 2840:136-2029]

Length=2030
                                                                      Score     E

ref|XP_010324219.1|  PREDICTED: methyltransferase-like protein 25...    478   4e-159   
emb|CDP13614.1|  unnamed protein product                                478   2e-157   
ref|XP_004243992.1|  PREDICTED: methyltransferase-like protein 25...    476   5e-157   
ref|XP_009627581.1|  PREDICTED: methyltransferase-like protein 25...    474   4e-156   
ref|XP_006346051.1|  PREDICTED: protein RRNAD1-like isoform X1          470   1e-154   
ref|XP_009802713.1|  PREDICTED: protein RRNAD1 isoform X1               467   4e-153   
ref|XP_002269801.1|  PREDICTED: protein RRNAD1 isoform X1               445   1e-144   Vitis vinifera
ref|XP_006477996.1|  PREDICTED: protein RRNAD1-like                     437   2e-141   
ref|XP_006585432.1|  PREDICTED: protein RRNAD1-like isoform X3          434   8e-141   
gb|KHN26802.1|  Protein RRNAD1                                          434   1e-140   
ref|XP_006585431.1|  PREDICTED: protein RRNAD1-like isoform X2          434   2e-140   
ref|XP_004150777.1|  PREDICTED: methyltransferase-like protein 25...    424   8e-137   
ref|XP_010537776.1|  PREDICTED: methyltransferase-like protein 25...    414   5e-134   
ref|XP_010476778.1|  PREDICTED: methyltransferase-like protein 25       416   5e-134   
ref|XP_011095623.1|  PREDICTED: methyltransferase-like protein 25...    415   6e-134   
ref|XP_011095621.1|  PREDICTED: methyltransferase-like protein 25...    415   1e-133   
ref|XP_010537774.1|  PREDICTED: methyltransferase-like protein 25...    413   3e-133   
ref|XP_011095620.1|  PREDICTED: methyltransferase-like protein 25...    414   9e-133   
ref|XP_006416795.1|  hypothetical protein EUTSA_v10007372mg             413   1e-132   
ref|XP_010537773.1|  PREDICTED: methyltransferase-like protein 25...    413   1e-132   
gb|KFK43870.1|  uncharacterized protein AALP_AA1G184800                 412   3e-132   
ref|XP_007022294.1|  S-adenosyl-L-methionine-dependent methyltran...    412   4e-132   
ref|XP_010537772.1|  PREDICTED: methyltransferase-like protein 25...    412   6e-132   
ref|XP_002890179.1|  hypothetical protein ARALYDRAFT_889058             411   7e-132   
ref|XP_004488841.1|  PREDICTED: protein RRNAD1-like                     412   1e-131   
emb|CDY40042.1|  BnaC05g12730D                                          410   1e-131   
ref|XP_007149264.1|  hypothetical protein PHAVU_005G055600g             410   2e-131   
ref|XP_007149265.1|  hypothetical protein PHAVU_005G055600g             411   2e-131   
gb|EYU27530.1|  hypothetical protein MIMGU_mgv1a003870mg                410   5e-131   
ref|XP_008444278.1|  PREDICTED: protein RRNAD1 isoform X1               409   2e-130   
ref|XP_008226288.1|  PREDICTED: protein RRNAD1 isoform X2               405   5e-130   
ref|XP_010258678.1|  PREDICTED: methyltransferase-like protein 25...    404   7e-130   
gb|KEH38366.1|  methyltransferase-like protein                          405   7e-130   
ref|XP_010459205.1|  PREDICTED: methyltransferase-like protein 25       405   8e-130   
ref|XP_010258677.1|  PREDICTED: protein RRNAD1 isoform X2               407   8e-130   
gb|KHG07111.1|  Protein RRNAD1                                          407   9e-130   
emb|CDY35109.1|  BnaA06g11190D                                          405   9e-130   
ref|XP_010497984.1|  PREDICTED: methyltransferase-like protein 25       405   1e-129   
ref|XP_009149102.1|  PREDICTED: methyltransferase-like protein 25...    404   2e-129   
ref|XP_008226287.1|  PREDICTED: protein RRNAD1 isoform X1               405   3e-129   
ref|NP_173110.2|  S-adenosyl-L-methionine-dependent methyltransfe...    404   4e-129   Arabidopsis thaliana [mouse-ear cress]
gb|AES66222.2|  methyltransferase-like protein                          404   8e-129   
ref|XP_008372833.1|  PREDICTED: protein RRNAD1                          403   2e-128   
ref|XP_010258676.1|  PREDICTED: protein RRNAD1 isoform X1               404   3e-128   
ref|XP_004294193.1|  PREDICTED: methyltransferase-like protein 25...    402   3e-128   
ref|XP_010906764.1|  PREDICTED: protein RRNAD1 isoform X2               402   5e-128   
ref|XP_010906736.1|  PREDICTED: protein RRNAD1 isoform X1               402   1e-127   
ref|XP_009627585.1|  PREDICTED: protein RRNAD1 isoform X4               399   1e-127   
ref|XP_009361752.1|  PREDICTED: protein RRNAD1-like isoform X1          401   1e-127   
ref|XP_003595971.1|  hypothetical protein MTR_2g064450                  402   2e-127   
ref|XP_009627582.1|  PREDICTED: protein RRNAD1 isoform X2               398   5e-127   
ref|XP_009627583.1|  PREDICTED: protein RRNAD1 isoform X3               397   1e-126   
ref|XP_009627586.1|  PREDICTED: protein RRNAD1 isoform X5               395   1e-126   
ref|XP_009336670.1|  PREDICTED: protein RRNAD1-like                     397   5e-126   
ref|XP_008444280.1|  PREDICTED: methyltransferase-like protein 25...    396   8e-126   
ref|XP_009361759.1|  PREDICTED: protein RRNAD1-like isoform X3          395   1e-125   
ref|XP_009361758.1|  PREDICTED: protein RRNAD1-like isoform X2          390   1e-123   
gb|KDP37706.1|  hypothetical protein JCGZ_06847                         388   7e-123   
ref|XP_009388957.1|  PREDICTED: methyltransferase-like protein 25...    383   3e-122   
ref|XP_010645035.1|  PREDICTED: methyltransferase-like protein 25...    384   1e-121   
ref|XP_009388956.1|  PREDICTED: methyltransferase-like protein 25...    380   6e-120   
ref|XP_002442510.1|  hypothetical protein SORBIDRAFT_08g021070          378   1e-118   Sorghum bicolor [broomcorn]
ref|XP_011012779.1|  PREDICTED: protein RRNAD1 isoform X1               374   2e-117   
gb|ACN25385.1|  unknown                                                 373   5e-117   Zea mays [maize]
ref|XP_008672243.1|  PREDICTED: hypothetical protein isoform X2         373   6e-117   
ref|XP_004963148.1|  PREDICTED: methyltransferase-like protein 25...    372   1e-116   
ref|XP_010060832.1|  PREDICTED: methyltransferase-like protein 25...    372   1e-116   
ref|XP_002310689.1|  hypothetical protein POPTR_0007s08440g             370   6e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010060833.1|  PREDICTED: protein RRNAD1 isoform X3               367   2e-115   
ref|XP_004963147.1|  PREDICTED: methyltransferase-like protein 25...    369   2e-115   
ref|XP_010060831.1|  PREDICTED: methyltransferase-like protein 25...    367   9e-115   
gb|KCW67711.1|  hypothetical protein EUGRSUZ_F01450                     364   1e-113   
gb|EMT22192.1|  hypothetical protein F775_20178                         367   2e-113   
dbj|BAJ99456.1|  predicted protein                                      365   2e-113   
gb|EMS64937.1|  hypothetical protein TRIUR3_03597                       366   4e-112   
ref|XP_010237044.1|  PREDICTED: protein RRNAD1                          361   5e-112   
ref|XP_006346052.1|  PREDICTED: protein RRNAD1-like isoform X2          357   3e-111   
ref|XP_009627587.1|  PREDICTED: protein RRNAD1 isoform X6               354   3e-111   
ref|XP_006664734.1|  PREDICTED: protein RRNAD1-like                     356   1e-110   
ref|NP_001067247.1|  Os12g0610500                                       357   3e-110   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69659.1|  hypothetical protein OsI_39073                          359   3e-110   Oryza sativa Indica Group [Indian rice]
gb|EPS72956.1|  hypothetical protein M569_01800                         353   1e-109   
ref|XP_010666178.1|  PREDICTED: methyltransferase-like protein 25...    350   2e-109   
gb|EEE53589.1|  hypothetical protein OsJ_36831                          355   1e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666177.1|  PREDICTED: methyltransferase-like protein 25...    350   3e-108   
ref|XP_006836403.1|  hypothetical protein AMTR_s00092p00143460          347   2e-106   
ref|XP_002529955.1|  protein with unknown function                      343   1e-105   Ricinus communis
ref|XP_011012782.1|  PREDICTED: methyltransferase-like protein 25...    317   3e-96    
ref|XP_008444279.1|  PREDICTED: protein RRNAD1 isoform X2               316   4e-95    
ref|XP_008444283.1|  PREDICTED: protein RRNAD1 isoform X6               312   6e-95    
ref|XP_009802714.1|  PREDICTED: methyltransferase-like protein 25...    310   1e-94    
ref|XP_009149103.1|  PREDICTED: methyltransferase-like protein 25...    310   5e-94    
ref|XP_008444281.1|  PREDICTED: protein RRNAD1 isoform X4               312   9e-94    
gb|KDO53412.1|  hypothetical protein CISIN_1g022433mg                   302   4e-93    
ref|XP_007022295.1|  S-adenosyl-L-methionine-dependent methyltran...    302   3e-91    
ref|XP_010324218.1|  PREDICTED: protein RRNAD1 isoform X2               300   3e-90    
ref|XP_006307588.1|  hypothetical protein CARUB_v10009211mg             291   6e-87    
ref|NP_001136550.1|  hypothetical protein                               285   3e-84    Zea mays [maize]
ref|XP_007213759.1|  hypothetical protein PRUPE_ppa003763m1g            272   6e-82    
ref|XP_008444282.1|  PREDICTED: methyltransferase-like protein 25...    258   2e-74    
gb|AAG10818.1|AC011808_6  Hypothetical protein                          257   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974472.1|  hypothetical protein SELMODRAFT_101072             257   2e-73    
ref|XP_002990829.1|  hypothetical protein SELMODRAFT_132321             256   7e-73    
ref|XP_004167500.1|  PREDICTED: methyltransferase-like protein 25...    234   3e-68    
ref|XP_010666179.1|  PREDICTED: methyltransferase-like protein 25...    229   7e-64    
gb|KGN58120.1|  hypothetical protein Csa_3G523080                       219   4e-62    
ref|XP_001772442.1|  predicted protein                                  226   6e-62    
ref|XP_006441026.1|  hypothetical protein CICLE_v10022203mg             212   5e-60    
ref|XP_010087147.1|  hypothetical protein L484_007397                   219   2e-59    
ref|XP_001779393.1|  predicted protein                                  199   2e-52    
ref|XP_006441027.1|  hypothetical protein CICLE_v10021587mg             136   3e-32    
gb|ADN33749.1|  hypothetical protein                                    119   6e-27    
ref|XP_007213760.1|  hypothetical protein PRUPE_ppa003763m2g            119   2e-26    
gb|ERZ95423.1|  hypothetical protein GLOINDRAFT_311324                  122   7e-26    
gb|KGN58119.1|  hypothetical protein Csa_3G523070                       118   2e-25    
ref|XP_006992367.1|  PREDICTED: methyltransferase-like protein 25       114   6e-23    
gb|EPB87340.1|  hypothetical protein HMPREF1544_05865                   108   9e-22    
ref|XP_007901972.1|  PREDICTED: methyltransferase-like protein 25       107   5e-21    
emb|CDH60806.1|  cra-b-like protein                                     102   7e-20    
emb|CDH60805.1|  protein rrnad1                                         102   1e-19    
emb|CEG72862.1|  hypothetical protein RMATCC62417_08345               96.7    3e-18    
emb|CEI98264.1|  hypothetical protein RMCBS344292_12377               95.5    7e-18    
emb|CEI93124.1|  hypothetical protein RMCBS344292_07367               95.9    2e-17    
ref|XP_002005659.1|  GI20589                                          95.9    2e-17    Drosophila mojavensis
emb|CDS12570.1|  hypothetical protein LRAMOSA04764                    95.1    3e-17    
ref|XP_002066087.1|  GK22174                                          94.0    7e-17    Drosophila willistoni
gb|EIE75716.1|  hypothetical protein RO3G_00420                       92.0    7e-17    
ref|XP_007431353.1|  PREDICTED: methyltransferase-like protein 25...  94.0    1e-16    
ref|XP_002599929.1|  hypothetical protein BRAFLDRAFT_74053            94.0    1e-16    Branchiostoma floridae
ref|XP_006513594.1|  PREDICTED: methyltransferase like 25 isoform X1  92.4    3e-16    
emb|CDS10716.1|  hypothetical protein LRAMOSA11202                    91.3    5e-16    
gb|EPB87587.1|  hypothetical protein HMPREF1544_05569                 90.1    1e-15    
ref|XP_007808434.1|  hypothetical protein MAC_02094                   89.0    4e-15    
gb|EXM36406.1|  hypothetical protein FOTG_00577                       89.0    5e-15    
emb|CEI91742.1|  Putative Inositol oxygenase                          88.6    6e-15    
emb|CEG71773.1|  hypothetical protein RMATCC62417_07446               87.4    8e-15    
ref|NP_001082903.1|  protein RRNAD1                                   88.2    8e-15    Danio rerio [leopard danio]
ref|XP_004083212.1|  PREDICTED: methyltransferase-like protein 25...  87.8    9e-15    
gb|EMT65364.1|  hypothetical protein FOC4_g10011347                   87.4    1e-14    
gb|ENH64693.1|  hypothetical protein FOC1_g10013969                   87.4    1e-14    
gb|EWY98802.1|  hypothetical protein FOYG_03115                       87.4    1e-14    
gb|EGU81852.1|  hypothetical protein FOXB_07647                       87.4    1e-14    
emb|CDH52943.1|  cra-b-like protein                                   86.7    1e-14    
emb|CDH52942.1|  cra-b-like protein                                   86.7    1e-14    
ref|XP_006821789.1|  PREDICTED: methyltransferase-like protein 25...  87.0    1e-14    
gb|KID86848.1|  RNA small subunit methyltransferase                   87.4    1e-14    
gb|KID73454.1|  RNA small subunit methyltransferase                   87.4    1e-14    
gb|KFG85114.1|  hypothetical protein MANI_002150                      87.0    2e-14    
ref|XP_007817714.1|  hypothetical protein MAA_01525                   87.0    2e-14    
ref|XP_005374447.1|  PREDICTED: methyltransferase-like protein 25...  86.7    2e-14    
gb|EXA50152.1|  hypothetical protein FOVG_02983                       86.3    3e-14    
gb|EWZ44884.1|  hypothetical protein FOZG_05456                       86.3    3e-14    
gb|ERL89579.1|  hypothetical protein D910_06944                       85.5    3e-14    
gb|EWZ98235.1|  hypothetical protein FOWG_02427                       86.3    3e-14    
gb|ENN81253.1|  hypothetical protein YQE_02347                        85.1    4e-14    
gb|ELU10992.1|  hypothetical protein CAPTEDRAFT_157654                85.5    4e-14    
gb|KID98549.1|  RNA small subunit methyltransferase                   85.9    4e-14    
emb|CCE27765.1|  uncharacterized protein CPUR_01239                   85.9    5e-14    
gb|KDB18770.1|  hypothetical protein UV8b_161                         85.5    5e-14    
gb|EPY88647.1|  protein RRNAD1-like protein                           85.1    6e-14    
ref|XP_002015829.1|  GL10807                                          84.7    7e-14    Drosophila persimilis
ref|XP_008313882.1|  PREDICTED: methyltransferase-like protein 25     85.1    8e-14    
ref|XP_003050086.1|  predicted protein                                85.1    8e-14    
ref|XP_001959359.1|  GF12827                                          84.7    8e-14    Drosophila ananassae
gb|EKG18830.1|  hypothetical protein MPH_03846                        84.7    1e-13    
gb|EWG48384.1|  hypothetical protein FVEG_08175                       84.0    2e-13    
gb|KFH64852.1|  hypothetical protein MVEG_09581                       84.3    2e-13    
ref|NP_001033941.1|  CG33964                                          83.6    2e-13    Drosophila melanogaster
ref|XP_005451683.1|  PREDICTED: methyltransferase-like protein 25...  83.2    2e-13    
ref|XP_010780717.1|  PREDICTED: methyltransferase-like protein 25     82.8    2e-13    
emb|CCT65868.1|  uncharacterized protein FFUJ_02848                   83.2    3e-13    
ref|XP_010741455.1|  PREDICTED: methyltransferase-like protein 25     83.6    3e-13    
ref|XP_005451682.1|  PREDICTED: methyltransferase-like protein 25...  83.2    3e-13    
ref|XP_005451681.1|  PREDICTED: methyltransferase-like protein 25...  83.2    3e-13    
gb|ETN67646.1|  hypothetical protein AND_000532                       82.8    3e-13    
ref|XP_002091112.1|  GE12415                                          82.4    4e-13    Drosophila yakuba
gb|KEF51507.1|  hypothetical protein A1O9_12424                       82.4    5e-13    
emb|CEI92606.1|  Putative Inositol oxygenase                          81.6    5e-13    
ref|XP_001809803.1|  PREDICTED: methyltransferase-like protein 25     81.6    5e-13    Tribolium castaneum [rust-red flour beetle]
ref|XP_006633669.1|  PREDICTED: methyltransferase-like protein 25...  82.8    5e-13    
ref|XP_009859760.1|  PREDICTED: protein RRNAD1-like isoform X3        81.3    6e-13    
ref|XP_001360363.2|  GA17328                                          81.6    6e-13    Drosophila pseudoobscura pseudoobscura
ref|XP_001975969.1|  GG20255                                          81.6    7e-13    Drosophila erecta
gb|KFO72573.1|  Methyltransferase-like 25                             81.6    7e-13    
gb|KFA64840.1|  hypothetical protein S40285_08653                     81.6    8e-13    
ref|XP_004548337.1|  PREDICTED: methyltransferase-like protein 25...  81.6    9e-13    
ref|XP_005733519.1|  PREDICTED: methyltransferase-like protein 25...  81.6    9e-13    
ref|XP_005097520.1|  PREDICTED: protein RRNAD1-like                   81.6    1e-12    
ref|XP_002130567.1|  PREDICTED: protein RRNAD1-like isoform X2        80.9    1e-12    Ciona intestinalis [sea vase]
ref|XP_008568612.1|  PREDICTED: protein RRNAD1                        80.9    1e-12    
ref|XP_009859759.1|  PREDICTED: protein RRNAD1-like isoform X1        80.9    1e-12    
ref|XP_004948256.1|  PREDICTED: protein RRNAD1 isoform X3             81.3    1e-12    
ref|XP_005188726.1|  PREDICTED: methyltransferase-like protein 25...  80.5    2e-12    
ref|XP_008291047.1|  PREDICTED: methyltransferase-like protein 25     80.9    2e-12    
ref|XP_002080517.1|  GD10526                                          79.3    2e-12    Drosophila simulans
ref|XP_008109118.1|  PREDICTED: methyltransferase-like protein 25...  80.1    2e-12    
gb|KFO96116.1|  Methyltransferase-like 25                             80.1    2e-12    
ref|XP_007564094.1|  PREDICTED: methyltransferase-like protein 25     80.1    3e-12    
ref|XP_009254179.1|  hypothetical protein FPSE_02785                  80.1    3e-12    
ref|XP_005203782.1|  PREDICTED: protein RRNAD1 isoform X1             79.3    3e-12    
ref|XP_003221187.1|  PREDICTED: methyltransferase-like protein 25...  80.1    3e-12    
gb|ELQ38217.1|  hypothetical protein OOU_Y34scaffold00548g33          79.7    3e-12    
ref|XP_005203783.1|  PREDICTED: protein RRNAD1 isoform X2             79.0    3e-12    
ref|XP_309746.4|  AGAP010960-PA                                       79.7    3e-12    Anopheles gambiae str. PEST
ref|XP_005930335.1|  PREDICTED: methyltransferase-like protein 25...  79.7    3e-12    
ref|XP_006780801.1|  PREDICTED: methyltransferase-like protein 25...  79.7    3e-12    
ref|XP_003475444.1|  PREDICTED: protein RRNAD1 isoform X1             79.3    4e-12    
ref|XP_005930334.1|  PREDICTED: methyltransferase-like protein 25...  79.7    4e-12    
ref|XP_003712212.1|  hypothetical protein MGG_09528                   79.7    4e-12    
ref|XP_005245292.1|  PREDICTED: protein RRNAD1 isoform X2             78.6    4e-12    
emb|CCF32634.1|  hypothetical protein CH063_04982                     79.7    4e-12    
ref|XP_387182.1|  hypothetical protein FG07006.1                      79.3    4e-12    Fusarium graminearum PH-1
ref|XP_007974913.1|  PREDICTED: protein RRNAD1 isoform X3             79.0    4e-12    
ref|XP_007431352.1|  PREDICTED: methyltransferase-like protein 25...  79.7    4e-12    
ref|XP_002076314.1|  GD15405                                          79.0    4e-12    Drosophila simulans
ref|XP_005541468.1|  PREDICTED: protein RRNAD1 isoform X4             78.6    5e-12    
ref|XP_007974915.1|  PREDICTED: protein RRNAD1 isoform X4             78.6    5e-12    
gb|KEY73383.1|  hypothetical protein S7711_01496                      79.3    5e-12    
gb|ACE75363.1|  conserved hypothetical protein                        78.6    6e-12    Glyptapanteles indiensis
tpg|DAA31801.1|  TPA: hypothetical protein LOC532204                  78.6    6e-12    
ref|XP_005898808.1|  PREDICTED: protein RRNAD1                        78.6    6e-12    
gb|KFU98332.1|  Methyltransferase-like 25                             78.6    6e-12    
ref|NP_057081.3|  protein RRNAD1 isoform 1                            78.6    6e-12    Homo sapiens [man]
ref|XP_004436289.1|  PREDICTED: protein RRNAD1                        78.6    6e-12    
ref|XP_009432793.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRNAD1   78.6    6e-12    
ref|XP_008398852.1|  PREDICTED: methyltransferase-like protein 25     79.0    7e-12    
ref|XP_002049394.1|  GJ20770                                          78.2    8e-12    Drosophila virilis
ref|XP_002080519.1|  GD10527                                          78.2    8e-12    Drosophila simulans
ref|XP_001866633.1|  conserved hypothetical protein                   78.2    8e-12    Culex quinquefasciatus
gb|KFZ57621.1|  Methyltransferase-like 25                             78.2    8e-12    
ref|XP_009667902.1|  PREDICTED: methyltransferase-like protein 25     78.2    9e-12    
ref|XP_010353702.1|  PREDICTED: protein RRNAD1 isoform X1             78.2    9e-12    
ref|XP_003892886.1|  PREDICTED: protein RRNAD1 isoform X1             78.2    9e-12    
ref|XP_002032836.1|  GM20996                                          77.8    9e-12    Drosophila sechellia
ref|NP_001244410.1|  protein RRNAD1                                   78.2    9e-12    
ref|XP_008321156.1|  PREDICTED: protein RRNAD1 isoform X2             78.2    9e-12    
gb|KFV89525.1|  Methyltransferase-like 25                             78.2    9e-12    
gb|KFV78549.1|  Methyltransferase-like 25                             78.2    9e-12    
ref|XP_009585664.1|  PREDICTED: methyltransferase-like protein 25     78.2    9e-12    
ref|XP_005039553.1|  PREDICTED: methyltransferase-like protein 25...  77.8    1e-11    
gb|AAD34037.1|AF151800_1  CGI-41 protein                              77.8    1e-11    Homo sapiens [man]
gb|EAW52916.1|  chromosome 1 open reading frame 66, isoform CRA_b     77.8    1e-11    Homo sapiens [man]
gb|AAH11382.1|  Chromosome 1 open reading frame 66                    77.8    1e-11    Homo sapiens [man]
gb|EAW52915.1|  chromosome 1 open reading frame 66, isoform CRA_a     77.8    1e-11    
ref|XP_008262522.1|  PREDICTED: protein RRNAD1 isoform X2             77.8    1e-11    
ref|XP_008321155.1|  PREDICTED: protein RRNAD1 isoform X1             78.2    1e-11    
ref|XP_005956008.1|  PREDICTED: protein RRNAD1                        77.8    1e-11    
ref|XP_005039552.1|  PREDICTED: methyltransferase-like protein 25...  77.8    1e-11    
ref|XP_005358159.1|  PREDICTED: methyltransferase-like protein 25...  78.2    1e-11    
gb|KFO64767.1|  Methyltransferase-like 25                             77.8    1e-11    
ref|XP_008639338.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  77.8    1e-11    
ref|XP_006052017.1|  PREDICTED: protein RRNAD1 isoform X2             77.0    1e-11    
ref|XP_002715413.1|  PREDICTED: protein RRNAD1 isoform X1             77.4    1e-11    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010412057.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  77.8    1e-11    
ref|XP_005419322.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  77.8    1e-11    
ref|XP_308265.4|  AGAP007607-PA                                       77.4    1e-11    Anopheles gambiae str. PEST
ref|XP_001640966.1|  predicted protein                                77.4    1e-11    Nematostella vectensis
gb|KFQ87740.1|  Methyltransferase-like 25                             77.4    1e-11    
ref|XP_009181981.1|  PREDICTED: protein RRNAD1 isoform X4             77.4    1e-11    
ref|XP_005039550.1|  PREDICTED: methyltransferase-like protein 25...  77.8    1e-11    
ref|XP_006513595.1|  PREDICTED: methyltransferase like 25 isoform X2  77.4    2e-11    
ref|XP_004480651.1|  PREDICTED: protein RRNAD1 isoform 5              77.4    2e-11    
ref|XP_009181975.1|  PREDICTED: protein RRNAD1 isoform X2             77.4    2e-11    
ref|XP_004480647.1|  PREDICTED: protein RRNAD1 isoform 1              77.4    2e-11    
ref|NP_001015641.1|  protein RRNAD1                                   77.4    2e-11    Bos taurus [bovine]
ref|XP_004480648.1|  PREDICTED: protein RRNAD1 isoform 2              77.4    2e-11    
ref|XP_002192209.1|  PREDICTED: methyltransferase-like protein 25     77.4    2e-11    Taeniopygia guttata
ref|XP_009084944.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  77.4    2e-11    
ref|XP_001970544.1|  GG23319                                          77.0    2e-11    Drosophila erecta
ref|XP_003743280.1|  PREDICTED: protein RRNAD1-like                   77.0    2e-11    
ref|XP_005480831.1|  PREDICTED: methyltransferase-like protein 25     77.4    2e-11    
ref|XP_005805971.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  77.8    2e-11    
ref|XP_002033497.1|  GM21342                                          77.0    2e-11    Drosophila sechellia
ref|XP_008923763.1|  PREDICTED: methyltransferase-like protein 25     75.9    2e-11    
ref|XP_010209444.1|  PREDICTED: methyltransferase-like protein 25     77.0    2e-11    
gb|KGL74827.1|  Methyltransferase-like 25                             77.0    2e-11    
ref|XP_003415208.1|  PREDICTED: protein RRNAD1 isoform X1             77.0    2e-11    
ref|XP_008552751.1|  PREDICTED: protein RRNAD1-like                   77.0    2e-11    
ref|XP_004480649.1|  PREDICTED: protein RRNAD1 isoform 3              77.0    2e-11    
ref|NP_001038522.1|  methyltransferase-like protein 25                77.4    2e-11    
ref|XP_006513596.1|  PREDICTED: methyltransferase like 25 isoform X3  76.6    2e-11    
gb|ETE64435.1|  putative protein C12orf26                             77.4    2e-11    
ref|XP_007535598.1|  PREDICTED: protein RRNAD1                        76.6    2e-11    
ref|XP_005242696.1|  PREDICTED: methyltransferase-like protein 25     77.0    2e-11    
gb|EFX89953.1|  hypothetical protein DAPPUDRAFT_309622                76.6    2e-11    
ref|XP_010715198.1|  PREDICTED: methyltransferase-like protein 25     77.0    2e-11    
gb|AAI15314.1|  Zgc:136889                                            77.0    2e-11    
gb|EDL21681.1|  cDNA sequence BC067068                                77.0    2e-11    
ref|XP_006775799.1|  PREDICTED: protein RRNAD1                        76.6    2e-11    
ref|NP_997405.2|  methyltransferase-like protein 25                   77.0    2e-11    
sp|Q6NXH8.1|MET25_MOUSE  RecName: Full=Methyltransferase-like pro...  77.0    2e-11    
gb|KFQ58143.1|  Methyltransferase-like 25                             76.6    2e-11    
ref|XP_416122.4|  PREDICTED: chromosome 1 open reading frame, hum...  77.0    2e-11    
gb|EPQ08624.1|  Protein RRNAD1                                        75.9    3e-11    
ref|XP_003228456.1|  PREDICTED: protein RRNAD1 isoform X2             76.6    3e-11    
ref|NP_001230253.1|  protein RRNAD1                                   76.6    3e-11    
ref|XP_004480650.1|  PREDICTED: protein RRNAD1 isoform 4              76.6    3e-11    
ref|XP_008850542.1|  PREDICTED: methyltransferase-like protein 25     77.0    3e-11    
ref|XP_006052016.1|  PREDICTED: protein RRNAD1 isoform X1             76.6    3e-11    
ref|XP_009491167.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  76.3    3e-11    
ref|XP_005514879.1|  PREDICTED: methyltransferase-like protein 25     76.6    3e-11    
ref|XP_007171905.1|  PREDICTED: protein RRNAD1 isoform X2             76.3    3e-11    
ref|XP_008120259.1|  PREDICTED: protein RRNAD1 isoform X1             77.0    3e-11    
ref|XP_009976554.1|  PREDICTED: methyltransferase-like protein 25     76.6    3e-11    
ref|XP_002089553.1|  GE19163                                          76.3    3e-11    
ref|XP_002431133.1|  conserved hypothetical protein                   76.6    3e-11    
ref|XP_005080163.1|  PREDICTED: protein RRNAD1 isoform X2             74.7    3e-11    
ref|XP_001944814.1|  PREDICTED: methyltransferase-like protein 25...  76.6    3e-11    
ref|XP_005331460.1|  PREDICTED: protein RRNAD1                        76.3    3e-11    
ref|XP_004522871.1|  PREDICTED: methyltransferase-like protein 25...  76.6    3e-11    
ref|XP_007380005.1|  hypothetical protein PUNSTDRAFT_97172            76.3    3e-11    
ref|XP_006923557.1|  PREDICTED: protein RRNAD1                        76.3    3e-11    
ref|XP_009283192.1|  PREDICTED: methyltransferase-like protein 25...  76.3    3e-11    
ref|XP_005358158.1|  PREDICTED: methyltransferase-like protein 25...  76.6    4e-11    
gb|KFQ95494.1|  Methyltransferase-like 25                             76.3    4e-11    
ref|XP_009325791.1|  PREDICTED: methyltransferase-like protein 25...  75.9    4e-11    
ref|XP_009283190.1|  PREDICTED: methyltransferase-like protein 25...  76.3    4e-11    
gb|KFO12081.1|  Methyltransferase-like 25                             76.3    4e-11    
ref|XP_007739768.1|  hypothetical protein A1O5_00959                  76.3    4e-11    
ref|XP_009283191.1|  PREDICTED: methyltransferase-like protein 25...  75.9    4e-11    
ref|XP_009461434.1|  PREDICTED: methyltransferase-like protein 25     76.3    4e-11    
gb|KFV50808.1|  Methyltransferase-like 25                             75.9    4e-11    
gb|KFM11354.1|  Methyltransferase-like 25                             75.9    4e-11    
ref|XP_009325790.1|  PREDICTED: methyltransferase-like protein 25...  75.9    4e-11    
ref|XP_010303285.1|  PREDICTED: methyltransferase-like protein 25     75.9    4e-11    
ref|XP_005519456.1|  PREDICTED: methyltransferase-like protein 25     76.3    5e-11    
gb|KFW69551.1|  Methyltransferase-like 25                             75.9    5e-11    
ref|XP_009325789.1|  PREDICTED: methyltransferase-like protein 25...  75.9    5e-11    
gb|KFP22127.1|  Methyltransferase-like 25                             75.9    5e-11    
ref|XP_009644589.1|  PREDICTED: methyltransferase-like protein 25     75.9    5e-11    
ref|XP_009079812.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  75.9    5e-11    
ref|XP_008047983.1|  PREDICTED: protein RRNAD1                        75.9    5e-11    
ref|XP_001500508.1|  PREDICTED: protein RRNAD1 isoform X1             75.5    5e-11    
ref|XP_009806573.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  75.5    5e-11    
ref|XP_006097846.1|  PREDICTED: protein RRNAD1                        75.5    5e-11    
gb|KFP87427.1|  Methyltransferase-like 25                             75.9    5e-11    
ref|XP_003972911.1|  PREDICTED: uncharacterized protein C12orf26 ...  75.9    6e-11    
ref|XP_005867662.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal RN...  75.5    6e-11    
ref|XP_004027030.1|  PREDICTED: protein RRNAD1 isoform 1              75.5    6e-11    
ref|XP_005356962.1|  PREDICTED: protein RRNAD1                        75.5    6e-11    
ref|XP_004388525.1|  PREDICTED: protein RRNAD1                        75.5    6e-11    
ref|XP_009554349.1|  PREDICTED: methyltransferase-like protein 25     75.5    7e-11    
gb|KID93297.1|  CRA-b-like protein                                    75.1    7e-11    
gb|KFZ64273.1|  Methyltransferase-like 25                             75.5    7e-11    
ref|XP_005840177.1|  hypothetical protein GUITHDRAFT_100907           73.9    8e-11    
ref|XP_005080162.1|  PREDICTED: protein RRNAD1 isoform X1             74.3    8e-11    
ref|XP_010172407.1|  PREDICTED: methyltransferase-like protein 25     75.1    8e-11    
ref|XP_009937397.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  75.1    8e-11    
gb|KFU85440.1|  Uncharacterized protein C12orf26                      75.1    8e-11    
ref|XP_004871293.1|  PREDICTED: protein RRNAD1 isoform X1             75.1    9e-11    
ref|XP_001995139.1|  GH22793                                          75.1    9e-11    
emb|CEJ94890.1|  hypothetical protein VHEMI10397                      74.7    9e-11    
gb|KHJ34428.1|  hypothetical protein EV44_g6085                       75.5    9e-11    
ref|XP_010006351.1|  PREDICTED: methyltransferase-like protein 25     75.1    1e-10    
ref|XP_009181982.1|  PREDICTED: protein RRNAD1 isoform X5             74.3    1e-10    
ref|XP_009048794.1|  hypothetical protein LOTGIDRAFT_157965           71.2    1e-10    
gb|KFR14321.1|  Methyltransferase-like 25                             74.7    1e-10    
ref|XP_002005384.1|  GI20447                                          74.7    1e-10    
ref|XP_010181510.1|  PREDICTED: methyltransferase-like protein 25     74.7    1e-10    
gb|KFQ34453.1|  Methyltransferase-like 25                             74.7    1e-10    
ref|XP_009880966.1|  PREDICTED: methyltransferase-like protein 25     74.7    1e-10    
ref|XP_007641916.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  75.1    1e-10    
gb|KFV64648.1|  Methyltransferase-like 25                             74.7    1e-10    
ref|XP_010135498.1|  PREDICTED: methyltransferase-like protein 25     74.3    1e-10    
ref|XP_005541467.1|  PREDICTED: protein RRNAD1 isoform X3             74.3    1e-10    
ref|XP_006155268.1|  PREDICTED: protein RRNAD1 isoform X3             74.3    1e-10    
ref|XP_004629783.1|  PREDICTED: protein RRNAD1                        74.3    1e-10    
ref|XP_005182182.1|  PREDICTED: protein RRNAD1-like                   74.3    1e-10    
gb|KFO90381.1|  Methyltransferase-like 25                             73.9    1e-10    
ref|XP_010642085.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    1e-10    
ref|XP_007069668.1|  PREDICTED: methyltransferase-like protein 25     74.7    1e-10    
ref|XP_004623820.1|  PREDICTED: methyltransferase-like protein 25...  74.7    1e-10    
ref|XP_006895809.1|  PREDICTED: protein RRNAD1                        74.3    1e-10    
ref|XP_009895262.1|  PREDICTED: methyltransferase-like protein 25     74.7    1e-10    
gb|KGL91356.1|  Methyltransferase-like 25                             74.3    1e-10    
ref|XP_004623819.1|  PREDICTED: methyltransferase-like protein 25...  74.7    1e-10    
ref|XP_007171904.1|  PREDICTED: protein RRNAD1 isoform X1             74.3    1e-10    
ref|XP_005411754.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    1e-10    
ref|XP_002595725.1|  hypothetical protein BRAFLDRAFT_200329           74.3    1e-10    
ref|XP_005245291.1|  PREDICTED: protein RRNAD1 isoform X1             73.9    1e-10    
ref|XP_010885646.1|  PREDICTED: methyltransferase-like protein 25...  74.7    1e-10    
ref|XP_010885647.1|  PREDICTED: methyltransferase-like protein 25...  74.7    1e-10    
ref|XP_006024865.1|  PREDICTED: methyltransferase-like protein 25     74.3    2e-10    
ref|XP_002810054.1|  PREDICTED: protein RRNAD1 isoform X1             74.3    2e-10    
ref|XP_006155267.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    2e-10    
ref|XP_010353703.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    2e-10    
ref|XP_009181979.1|  PREDICTED: protein RRNAD1 isoform X3             73.9    2e-10    
ref|XP_007974912.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    2e-10    
ref|XP_008972759.1|  PREDICTED: protein RRNAD1 isoform X3             73.9    2e-10    
ref|XP_005148011.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  74.3    2e-10    
ref|XP_005541466.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    2e-10    
ref|XP_010885644.1|  PREDICTED: methyltransferase-like protein 25...  74.7    2e-10    
ref|XP_005279149.1|  PREDICTED: methyltransferase-like protein 25...  74.3    2e-10    
ref|XP_008164723.1|  PREDICTED: methyltransferase-like protein 25...  74.3    2e-10    
ref|XP_008972758.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    2e-10    
ref|XP_004879180.1|  PREDICTED: protein RRNAD1 isoform X1             73.9    2e-10    
ref|XP_007618668.1|  PREDICTED: methyltransferase-like protein 25...  74.3    2e-10    
ref|XP_006155266.1|  PREDICTED: protein RRNAD1 isoform X1             73.9    2e-10    
gb|EGD93140.1|  hypothetical protein TESG_00694                       74.3    2e-10    
ref|XP_010885645.1|  PREDICTED: methyltransferase-like protein 25...  74.3    2e-10    
gb|EKC32488.1|  UPF0431 protein C1orf66-like protein                  72.8    2e-10    
gb|KFP53734.1|  Methyltransferase-like 25                             73.6    2e-10    
ref|XP_010120869.1|  PREDICTED: methyltransferase-like protein 25     73.9    2e-10    
ref|XP_003821079.1|  PREDICTED: protein RRNAD1 isoform X1             73.9    2e-10    
ref|XP_005279148.1|  PREDICTED: methyltransferase-like protein 25...  74.3    2e-10    
gb|KFP42985.1|  Methyltransferase-like 25                             73.9    2e-10    
ref|XP_003014968.1|  conserved hypothetical protein                   74.3    2e-10    
gb|KFP56333.1|  Methyltransferase-like 25                             73.9    2e-10    
ref|XP_004619379.1|  PREDICTED: protein RRNAD1                        73.6    2e-10    
ref|XP_009708470.1|  PREDICTED: methyltransferase-like protein 25     73.9    2e-10    
ref|XP_005411753.1|  PREDICTED: protein RRNAD1 isoform X1             73.6    2e-10    
ref|XP_010642084.1|  PREDICTED: protein RRNAD1 isoform X1             73.6    2e-10    
ref|XP_010146794.1|  PREDICTED: methyltransferase-like protein 25     73.6    2e-10    
ref|XP_004948257.1|  PREDICTED: protein RRNAD1 isoform X4             73.9    2e-10    
gb|ACE75279.1|  conserved hypothetical protein                        73.6    3e-10    
gb|KFV92045.1|  Methyltransferase-like 25                             73.6    3e-10    
ref|NP_001097225.1|  CG2906, isoform D                                73.2    3e-10    
ref|XP_008496435.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  73.6    3e-10    
ref|NP_724630.3|  CG2906, isoform E                                   72.8    3e-10    
ref|XP_001364140.1|  PREDICTED: methyltransferase-like protein 25...  73.6    3e-10    
gb|KFW95088.1|  Methyltransferase-like 25                             73.2    3e-10    
ref|XP_004948255.1|  PREDICTED: protein RRNAD1 isoform X2             73.9    3e-10    
ref|XP_009510637.1|  PREDICTED: methyltransferase-like protein 25     73.6    3e-10    
ref|XP_004867586.1|  PREDICTED: methyltransferase-like protein 25...  73.6    3e-10    
ref|XP_004867585.1|  PREDICTED: methyltransferase-like protein 25...  73.6    3e-10    
ref|XP_001232148.3|  PREDICTED: protein RRNAD1 isoform X1             73.9    3e-10    
ref|XP_010346772.1|  PREDICTED: protein RRNAD1 isoform X2             72.8    3e-10    
ref|XP_003730668.1|  PREDICTED: uncharacterized protein C12orf26 ...  71.6    3e-10    
ref|XP_006821494.1|  PREDICTED: protein RRNAD1-like                   73.2    3e-10    
ref|XP_003795290.1|  PREDICTED: protein RRNAD1                        73.2    3e-10    
ref|XP_004867584.1|  PREDICTED: methyltransferase-like protein 25...  73.6    4e-10    
ref|XP_010203449.1|  PREDICTED: methyltransferase-like protein 25     73.2    4e-10    
gb|KFP28012.1|  Methyltransferase-like 25                             73.2    4e-10    
ref|XP_010952180.1|  PREDICTED: protein RRNAD1 isoform X2             72.8    4e-10    
ref|XP_003771013.1|  PREDICTED: uncharacterized protein C12orf26 ...  73.2    4e-10    
dbj|GAA57395.1|  hypothetical protein CLF_112661                      72.4    4e-10    
gb|ETN65498.1|  hypothetical protein AND_002724                       72.8    4e-10    
emb|CAG01909.1|  unnamed protein product                              73.2    4e-10    
gb|EZA46158.1|  hypothetical protein K425_365                         72.8    5e-10    
ref|XP_010608428.1|  PREDICTED: methyltransferase-like protein 25...  72.8    5e-10    
ref|XP_003382873.1|  PREDICTED: protein RRNAD1-like                   72.0    5e-10    
ref|XP_003204649.2|  PREDICTED: protein RRNAD1                        72.4    6e-10    
ref|XP_005991713.1|  PREDICTED: protein RRNAD1 isoform X1             72.8    6e-10    
ref|XP_005991714.1|  PREDICTED: protein RRNAD1 isoform X2             72.8    6e-10    
ref|XP_007641705.1|  PREDICTED: protein RRNAD1 isoform X5             71.6    6e-10    
ref|XP_010608441.1|  PREDICTED: methyltransferase-like protein 25...  72.4    7e-10    
ref|XP_007641701.1|  PREDICTED: protein RRNAD1 isoform X4             71.6    7e-10    
ref|XP_010836518.1|  PREDICTED: protein RRNAD1 isoform X3             71.6    7e-10    
ref|XP_003937900.1|  PREDICTED: protein RRNAD1 isoform X1             72.0    8e-10    
ref|XP_009924136.1|  PREDICTED: methyltransferase-like protein 25     71.6    8e-10    
ref|XP_006232751.1|  PREDICTED: protein RRNAD1 isoform X3             71.6    8e-10    
ref|XP_005109989.1|  PREDICTED: methyltransferase-like protein 25...  72.4    8e-10    
gb|EZF30188.1|  hypothetical protein H101_06164                       72.4    8e-10    
ref|XP_005039551.1|  PREDICTED: methyltransferase-like protein 25...  72.0    8e-10    
gb|KFQ09540.1|  Methyltransferase-like 25                             71.6    8e-10    
ref|XP_006232750.1|  PREDICTED: protein RRNAD1 isoform X2             71.6    9e-10    
ref|XP_004589101.1|  PREDICTED: protein RRNAD1                        71.6    9e-10    
ref|XP_004650208.1|  PREDICTED: methyltransferase-like protein 25     72.0    9e-10    
ref|XP_007635294.1|  PREDICTED: protein RRNAD1 isoform X3             71.6    9e-10    
gb|KFQ44587.1|  Methyltransferase-like 25                             72.0    9e-10    
ref|XP_004821711.1|  PREDICTED: protein RRNAD1 isoform X2             71.6    9e-10    
ref|XP_010836517.1|  PREDICTED: protein RRNAD1 isoform X2             71.2    9e-10    
gb|EPZ33667.1|  Methyltransferase domain-containing protein           71.2    9e-10    
ref|XP_004778536.1|  PREDICTED: protein RRNAD1 isoform X3             71.6    1e-09    
ref|XP_010017382.1|  PREDICTED: methyltransferase-like protein 25     71.6    1e-09    
gb|ERE87393.1|  protein RRNAD1                                        71.6    1e-09    
ref|XP_008154099.1|  PREDICTED: protein RRNAD1                        71.6    1e-09    
ref|XP_007641700.1|  PREDICTED: protein RRNAD1 isoform X2             71.6    1e-09    
ref|XP_004667345.1|  PREDICTED: protein RRNAD1                        71.6    1e-09    
ref|XP_003017851.1|  conserved hypothetical protein                   72.0    1e-09    
ref|XP_001360648.2|  GA15509                                          71.2    1e-09    
ref|XP_009954587.1|  PREDICTED: methyltransferase-like protein 25     71.6    1e-09    
ref|XP_009246344.1|  PREDICTED: methyltransferase-like protein 25...  71.6    1e-09    
ref|XP_003502950.1|  PREDICTED: protein RRNAD1 isoform X1             71.2    1e-09    
gb|EMC90096.1|  hypothetical protein A306_00818                       71.6    1e-09    
ref|XP_002016227.1|  GL11477                                          71.2    1e-09    
ref|XP_007252476.1|  PREDICTED: methyltransferase-like protein 25     71.6    1e-09    
ref|XP_010560135.1|  PREDICTED: methyltransferase-like protein 25     71.6    1e-09    
ref|XP_004778535.1|  PREDICTED: protein RRNAD1 isoform X2             71.2    1e-09    
gb|ERE87392.1|  protein RRNAD1                                        71.2    1e-09    
ref|XP_007946795.1|  PREDICTED: protein RRNAD1                        70.9    1e-09    
gb|KFQ14548.1|  Methyltransferase-like 25                             71.2    1e-09    
ref|XP_010836516.1|  PREDICTED: protein RRNAD1 isoform X1             71.2    1e-09    
ref|XP_006861667.1|  PREDICTED: protein RRNAD1                        71.2    1e-09    
ref|XP_005374454.1|  PREDICTED: methyltransferase-like protein 25...  71.6    1e-09    
ref|XP_004778534.1|  PREDICTED: protein RRNAD1 isoform X1             71.2    1e-09    
ref|XP_006214653.1|  PREDICTED: protein RRNAD1                        70.9    2e-09    
ref|XP_009019688.1|  hypothetical protein HELRODRAFT_65351            68.6    2e-09    
ref|XP_006118565.1|  PREDICTED: methyltransferase-like protein 25     71.2    2e-09    
ref|XP_004714773.1|  PREDICTED: protein RRNAD1                        70.9    2e-09    
ref|XP_008255073.1|  PREDICTED: methyltransferase-like protein 25...  70.9    2e-09    
ref|XP_004284590.1|  PREDICTED: protein RRNAD1                        70.9    2e-09    
ref|XP_006197931.1|  PREDICTED: methyltransferase-like protein 25     71.2    2e-09    
ref|XP_007249815.1|  PREDICTED: protein RRNAD1                        71.2    2e-09    
ref|XP_004928143.1|  PREDICTED: methyltransferase-like protein 25...  70.9    2e-09    
ref|XP_010997744.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRNAD1   70.9    2e-09    
ref|NP_001124890.1|  methyltransferase-like protein 25                70.9    2e-09    
ref|XP_006232748.1|  PREDICTED: protein RRNAD1 isoform X1             70.9    2e-09    
ref|XP_010952179.1|  PREDICTED: protein RRNAD1 isoform X1             70.9    2e-09    
ref|XP_006174606.1|  PREDICTED: protein RRNAD1                        70.9    2e-09    



>ref|XP_010324219.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Solanum 
lycopersicum]
Length=435

 Score =   478 bits (1230),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 307/417 (74%), Gaps = 32/417 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RELSVPKTVT
Sbjct  49    GYLAQVLAFDYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNCSEPRELSVPKTVT  108

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLKALSN  +EK   G Q++   SS+ Q    +ED   PHS    DS+L++AG
Sbjct  109   CRVLSTDTLKALSNSLIEKDHAGNQHMGNRSSVSQPSRFAED--IPHSRSCSDSTLVIAG  166

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA  + DS CGFP+S+ VK+ G++
Sbjct  167   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEAICEADSCCGFPVSQGVKSAGVI  226

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L KSARDLACQSADRWRGLG+ AGLHNFELHAFRA FQ+ L R+Y  +L++SP IGRQGK
Sbjct  227   LAKSARDLACQSADRWRGLGENAGLHNFELHAFRAAFQIFLFRHYPSILLESPTIGRQGK  286

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ +QR LESNL          GGSS+     E R S+                  A
Sbjct  287   ALRRQQNQRILESNLH--------HGGSSES---GEPRESV------------------A  317

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H+ SS     N  +NAVD  SLF KFC+SGL RL +    +  YS IW+E++ + E+I
Sbjct  318   FLHEYSSI-QSSNSESNAVDRCSLFAKFCESGLGRLHLPHLADTAYSAIWRESESYAELI  376

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWSLRAALGPVLET+ILLDRLL LQE    +EA+L+PIF+PVLSPRNMAII RKI
Sbjct  377   GPYWSLRAALGPVLETLILLDRLLLLQEYGSDLEASLLPIFNPVLSPRNMAIIARKI  433



>emb|CDP13614.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   478 bits (1231),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/418 (59%), Positives = 306/418 (73%), Gaps = 4/418 (1%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF++GLS+ AIDA  HHG +TDARAER+RK+YA+K+RKS  E RELS+PKTVT
Sbjct  158   GYLAQVLSFQHGLSVYAIDACLHHGKVTDARAERVRKYYASKMRKSGLESRELSIPKTVT  217

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C+VLS   L  LSN  ++     K  ++      Q +   E  L   S +   SSLILAG
Sbjct  218   CQVLSANMLNNLSNSFIQGEHATKPNVVSGIMSEQRKGPHESELPSTSDVFCSSSLILAG  277

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLE ++VK+VIS+GCCYNLLSE+ + K  S CGFP+SK VK  G  
Sbjct  278   LHACGDLSVTMLRTFLESDQVKSVISIGCCYNLLSEDDSDKASSVCGFPMSKGVKFTGFA  337

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LG+SARDLACQSA+RW+ LG+ AGLHNFELHAFRA FQM+L +YY ++L++SP+IGRQGK
Sbjct  338   LGRSARDLACQSAERWKCLGEFAGLHNFELHAFRAAFQMVLSQYYPKLLMESPSIGRQGK  397

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK--GVTCDD  1032
              LRRQ HQ+ LESNL  ++ PK  S  SS   S++ +R + +     +  KK  G  CD 
Sbjct  398   ALRRQQHQKILESNLSYEE-PKFFSASSSTNISKEGSRFAFACTESRDTEKKVAGSCCDI  456

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
             D L  + S   S  NE T + D FSLF++FC SGL RLG++   +I+   +W+ET+PF+ 
Sbjct  457   DGLSCE-SFVESSMNEETRSFDRFSLFLEFCHSGLNRLGLHYLSDIELHTVWEETEPFSV  515

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             +IGPYWSLRAALGPVLETIILLDRLLFLQE    VEA ++PIFDPVLSPRN+A+I +K
Sbjct  516   LIGPYWSLRAALGPVLETIILLDRLLFLQEQGSIVEAVMLPIFDPVLSPRNVALIAKK  573



>ref|XP_004243992.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324215.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324216.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324217.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Solanum 
lycopersicum]
Length=540

 Score =   476 bits (1226),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 307/417 (74%), Gaps = 32/417 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RELSVPKTVT
Sbjct  154   GYLAQVLAFDYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNCSEPRELSVPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLKALSN  +EK   G Q++   SS+ Q    +ED   PHS    DS+L++AG
Sbjct  214   CRVLSTDTLKALSNSLIEKDHAGNQHMGNRSSVSQPSRFAED--IPHSRSCSDSTLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA  + DS CGFP+S+ VK+ G++
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEAICEADSCCGFPVSQGVKSAGVI  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L KSARDLACQSADRWRGLG+ AGLHNFELHAFRA FQ+ L R+Y  +L++SP IGRQGK
Sbjct  332   LAKSARDLACQSADRWRGLGENAGLHNFELHAFRAAFQIFLFRHYPSILLESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ +QR LESNL          GGSS+     E R S+                  A
Sbjct  392   ALRRQQNQRILESNLH--------HGGSSES---GEPRESV------------------A  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H+ SS     N  +NAVD  SLF KFC+SGL RL +    +  YS IW+E++ + E+I
Sbjct  423   FLHEYSSI-QSSNSESNAVDRCSLFAKFCESGLGRLHLPHLADTAYSAIWRESESYAELI  481

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWSLRAALGPVLET+ILLDRLL LQE    +EA+L+PIF+PVLSPRNMAII RKI
Sbjct  482   GPYWSLRAALGPVLETLILLDRLLLLQEYGSDLEASLLPIFNPVLSPRNMAIIARKI  538



>ref|XP_009627581.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Nicotiana 
tomentosiformis]
Length=541

 Score =   474 bits (1220),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 309/417 (74%), Gaps = 31/417 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FEY LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154   GYLAQVLAFEYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLK LSN   E  D   Q+L  + S  Q    +E+ L   SY   DSSL++AG
Sbjct  214   CRVLSSDTLKTLSNFLEENDDAANQHLSQKCSGSQLSRLAENILPSLSY--SDSSLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ HQR LESNL  +        G S+                  + +K V     A
Sbjct  392   ALRRQQHQRILESNLHYR--------GPSEY----------------GEPRKNV-----A  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
              FH+ SS ++ K+  ++ VD +SLF+KFC+SGL RL +   ++IDYS +W+E++ + E+I
Sbjct  423   FFHEYSSIQNSKSRESSTVDRYSLFVKFCESGLGRLHLPCLEDIDYSAVWRESESYAELI  482

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWSLRAALGPVLET++LLDRLL LQE  + +EA+L+P+F PVLSPRNMAII +KI
Sbjct  483   GPYWSLRAALGPVLETLVLLDRLLLLQEYGNDLEASLLPVFSPVLSPRNMAIIAKKI  539



>ref|XP_006346051.1| PREDICTED: protein RRNAD1-like isoform X1 [Solanum tuberosum]
Length=541

 Score =   470 bits (1210),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 306/417 (73%), Gaps = 31/417 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE SVPKTVT
Sbjct  154   GYLAQVLAFDYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNCSEQREFSVPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TL ALSN  +E    G Q+L  + S+ Q    +ED L   SY   DS+L++AG
Sbjct  214   CRVLSSDTLSALSNSPVENDHAGNQHLSQKCSVSQPSRLAEDILPSRSY--SDSTLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA    DS CGFP+S+ VK+ G++
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEAIDIADSCCGFPVSQGVKSAGVM  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHA RA FQ++L R+Y  +L++SPAIGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHALRAAFQIVLFRHYPNILLESPAIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ +QR LESNL          GG S+     E R S+S                  
Sbjct  392   ALRRQQNQRILESNLH--------HGGPSES---GEPRESVS------------------  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H+ SS +S KN  + AVD +SLF+KFC+SGL RL +   ++  YS +W+E++ + E+I
Sbjct  423   FLHEYSSIQSSKNCKSRAVDGYSLFVKFCESGLGRLHLPHLEDTAYSAVWRESESYFELI  482

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWSLRAALG VLET+ILLDRLL LQE    +EA+L+PIF+PVLSPRNMAII +KI
Sbjct  483   GPYWSLRAALGSVLETLILLDRLLLLQEYDSDLEASLLPIFNPVLSPRNMAIIAKKI  539



>ref|XP_009802713.1| PREDICTED: protein RRNAD1 isoform X1 [Nicotiana sylvestris]
Length=562

 Score =   467 bits (1202),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 307/438 (70%), Gaps = 52/438 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSFEY LS++AIDA SHHG ITDAR ERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154   GYLAQVLSFEYQLSVIAIDACSHHGKITDARVERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLK LSN   E  D   QYL  +SS  Q    +E+ L   SY   DSSL++AG
Sbjct  214   CRVLSSDTLKTLSNFREENDDAANQYLSRKSSGSQPSRLTENILPSLSY--SDSSLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC+  KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272   LHACGDLSVTMLRTFLECDNAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ HQR LESNL  +        G S+                      G   ++ A
Sbjct  392   ALRRQQHQRILESNLHYR--------GPSES---------------------GKPWENVA  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT---  1209
              FH+ SS ++ K+  ++ VD +SLF+KFC+SGL RL +   ++IDYS +W+E++ +    
Sbjct  423   FFHEYSSIQNSKSRESSTVDRYSLFVKFCESGLGRLHLPCLEDIDYSAVWRESESYAIGE  482

Query  1210  ------------------EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVP  1335
                               E+IGPYWSLRAALGPVLET++LLDRLL LQE  + +EA+L+P
Sbjct  483   HAYLLYLYRTHYKHNSLLELIGPYWSLRAALGPVLETLVLLDRLLLLQEYGNDLEASLLP  542

Query  1336  IFDPVLSPRNMAIIGRKI  1389
             IF PVLSPRNMAII +KI
Sbjct  543   IFSPVLSPRNMAIIAKKI  560



>ref|XP_002269801.1| PREDICTED: protein RRNAD1 isoform X1 [Vitis vinifera]
 emb|CBI21807.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   445 bits (1144),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 240/418 (57%), Positives = 294/418 (70%), Gaps = 32/418 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y LS++AID+ SHHGN+T+ARAERI+KHYAA++RKS S  R L+VPKTVT
Sbjct  157   GYLAQVLSFQYQLSVVAIDSCSHHGNVTNARAERIKKHYAAQMRKSGSGSRSLNVPKTVT  216

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSED--RLTPHSYMVGDSSLIL  492
             CRV+S + LKA+++  L + DV     IG+S I Q      D  RL     +  +SS +L
Sbjct  217   CRVMSADMLKAVNDMLLSEDDVQCPQQIGQS-ISQPSHPGLDKRRLPSLCDVHNESSFVL  275

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTMLRTFLEC EVKAV+S+GCCYNLLSEE      S CGFP+S  +K+ G
Sbjct  276   AGLHACGDLSVTMLRTFLECKEVKAVVSIGCCYNLLSEEVCESSSSQCGFPMSNVIKSAG  335

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKS+RDLACQSA+RWR +G+ AGL NFELHAFRA FQM+L RYY EVL+ SPAIGRQ
Sbjct  336   LSLGKSSRDLACQSAERWRVMGKDAGLQNFELHAFRAAFQMVLYRYYPEVLITSPAIGRQ  395

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             GK LRRQ  +R LES+LQ +                              D K     + 
Sbjct  396   GKALRRQQQRRNLESSLQPE-----------------------------KDDKAAFAMEK  426

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
             D+LF  ISS  +  ++  N+VD +SLF KFC SGL RLG+    ++++  +W+E  PF E
Sbjct  427   DSLFQGISSDETTISDAINSVDKYSLFEKFCKSGLCRLGLKPLPDVNFKEVWEEAAPFAE  486

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              IGPYWSLRAALGP+LET+ILLDRLLFLQE    VEA ++PIFDPVLSPRN+AII +K
Sbjct  487   FIGPYWSLRAALGPLLETLILLDRLLFLQEQGSSVEAVMLPIFDPVLSPRNVAIIAKK  544



>ref|XP_006477996.1| PREDICTED: protein RRNAD1-like [Citrus sinensis]
Length=560

 Score =   437 bits (1124),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 230/423 (54%), Positives = 288/423 (68%), Gaps = 27/423 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDASSHHG +T+ARAERI+K+YAA++RK  S ++  +VPKT+T
Sbjct  155   GYLAQVLSFQYQHSVVAIDASSHHGKVTNARAERIKKYYAAQLRKKGSGNKNPNVPKTIT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRV+S +TLKALSN SL   DV +  L+      Q  +  E R    S     +SL+LAG
Sbjct  215   CRVMSIDTLKALSNMSLHSDDVEQSKLVE-----QNHQECEGRKLRSSC----NSLVLAG  265

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF+EC EVKAV+S+GCCYNLLSEE      S  GFP+S  VK++G  
Sbjct  266   LHACGDLSVTMLKTFVECKEVKAVVSIGCCYNLLSEEGIDLAGSPSGFPISHGVKSLGFT  325

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L   AG+ NFELHAFRA FQM+L +YY EV+V SP++GRQGK
Sbjct  326   LGKSSRDLACQSAERWRSLEMDAGVRNFELHAFRAAFQMVLCKYYPEVIVTSPSVGRQGK  385

Query  859   TLRRQHHQRALESNLQCQD--CPKNSSGGSSQKRSEDETRCS-----MSDLGCGNDGKKG  1017
              LRRQ  +R LES L  +D  CP           S D+  C      ++      D K  
Sbjct  386   ALRRQQQRRILESRLHIEDHTCP-----------SFDQKHCGIAYSFLNPKESKMDDKSV  434

Query  1018  VTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKET  1197
                D  AL H  S  RS + E+T + D + LF K+C SGL RL +     ++   +W E 
Sbjct  435   SMLDTAALSHGNSFNRSTRCEHTVSDDKYLLFEKYCLSGLCRLDLKPLDNLNLHRLWDEA  494

Query  1198  QPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAII  1377
             +PF ++IGPYWSLRAAL PVLET ILLDRLLFLQE    +EA ++P+FDPVLSPRN+AII
Sbjct  495   EPFADIIGPYWSLRAALAPVLETYILLDRLLFLQEQGSSLEAVMLPVFDPVLSPRNVAII  554

Query  1378  GRK  1386
              +K
Sbjct  555   AKK  557



>ref|XP_006585432.1| PREDICTED: protein RRNAD1-like isoform X3 [Glycine max]
Length=527

 Score =   434 bits (1116),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 226/427 (53%), Positives = 289/427 (68%), Gaps = 36/427 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+K+Y +++ KSES  R L+VPKT+T
Sbjct  118   GYLAQVLAFQYQHPVIAIDACSHHGRVTDARAERIKKYYTSQMIKSESGMRSLNVPKTIT  177

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEH--SEDRLTPHSYMVGDSSLIL  492
             CRVLS +TLK L   SL   DV +  L  E+   Q + H  S+    P        S++L
Sbjct  178   CRVLSIDTLKTLVETSLIGDDVEQSMLKVENQEDQGKLHWLSDANKKP--------SIVL  229

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TF+EC +VKAV+S+GCCYNLLSEE     +S  GFP+S +V+++G
Sbjct  230   AGLHACGDLSVTMLKTFVECKDVKAVVSLGCCYNLLSEEMIKDGESQFGFPMSHAVRSIG  289

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY E+++ +P+IGR+
Sbjct  290   LSLGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEIVMSTPSIGRK  349

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKR--------SEDETRCSMSDLGCGNDG  1008
             GK LRR+H +R+ ES L  +       G +   R        SE ET           DG
Sbjct  350   GKALRRRHQRRSAESQLHLK-------GSTCHMRHNFPSVVPSESET-----------DG  391

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
               G   +   L  +I S      E   + D  S F  FC SGL+ LGI  SQ+I+  GIW
Sbjct  392   ILGSMSEIQTLPGEIPSNERAGCEVIKSDDKLSHFENFCQSGLSHLGIKHSQDINLQGIW  451

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             KE +PF +++GPYWSLRAALGP+LET+I+LDRLLFLQE    +EA L+PIFDP +SPRN+
Sbjct  452   KEAEPFADLVGPYWSLRAALGPLLETLIILDRLLFLQEQGSALEACLLPIFDPKISPRNV  511

Query  1369  AIIGRKI  1389
             AII +KI
Sbjct  512   AIIAKKI  518



>gb|KHN26802.1| Protein RRNAD1 [Glycine soja]
Length=536

 Score =   434 bits (1116),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 288/420 (69%), Gaps = 22/420 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+K+Y +++ KSES  R L+VPKT+T
Sbjct  127   GYLAQVLAFQYQHPVIAIDACSHHGRVTDARAERIKKYYTSQMIKSESGMRSLNVPKTIT  186

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEH--SEDRLTPHSYMVGDSSLIL  492
             CRVLS +TLK L   SL   DV +  L  E+   Q + H  S+    P        S++L
Sbjct  187   CRVLSIDTLKTLVETSLIGDDVEQSMLKVENQEDQGKLHWLSDANKKP--------SIVL  238

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TF+EC +VKAV+S+GCCYNLLSEE     +S  GFP+S +V+++G
Sbjct  239   AGLHACGDLSVTMLKTFVECKDVKAVVSLGCCYNLLSEEMIKDGESQFGFPMSHAVRSIG  298

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY E+++ +P+IGR+
Sbjct  299   LSLGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEIVMSTPSIGRK  358

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGG-SSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             GK LRR+H +R+ ES L  +    +      S   SE ET           DG  G   +
Sbjct  359   GKALRRRHQRRSAESQLHLKGSTCHMRHNFPSVVPSESET-----------DGILGSMSE  407

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
                L  +I S      E   + D  S F  FC SGL+ LGI  SQ+I+  GIWKE +PF 
Sbjct  408   IQTLPGEIPSNERAGCEVIKSDDKLSHFENFCQSGLSHLGIKHSQDINLQGIWKEAEPFA  467

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             +++GPYWSLRAALGP+LET+I+LDRLLFLQE    +EA L+PIFDP +SPRN+AII +KI
Sbjct  468   DLVGPYWSLRAALGPLLETLIILDRLLFLQEQGSALEACLLPIFDPKISPRNVAIIAKKI  527



>ref|XP_006585431.1| PREDICTED: protein RRNAD1-like isoform X2 [Glycine max]
 ref|XP_003532944.2| PREDICTED: protein RRNAD1-like isoform X1 [Glycine max]
Length=564

 Score =   434 bits (1116),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 288/420 (69%), Gaps = 22/420 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+K+Y +++ KSES  R L+VPKT+T
Sbjct  155   GYLAQVLAFQYQHPVIAIDACSHHGRVTDARAERIKKYYTSQMIKSESGMRSLNVPKTIT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEH--SEDRLTPHSYMVGDSSLIL  492
             CRVLS +TLK L   SL   DV +  L  E+   Q + H  S+    P        S++L
Sbjct  215   CRVLSIDTLKTLVETSLIGDDVEQSMLKVENQEDQGKLHWLSDANKKP--------SIVL  266

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TF+EC +VKAV+S+GCCYNLLSEE     +S  GFP+S +V+++G
Sbjct  267   AGLHACGDLSVTMLKTFVECKDVKAVVSLGCCYNLLSEEMIKDGESQFGFPMSHAVRSIG  326

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY E+++ +P+IGR+
Sbjct  327   LSLGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEIVMSTPSIGRK  386

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGG-SSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             GK LRR+H +R+ ES L  +    +      S   SE ET           DG  G   +
Sbjct  387   GKALRRRHQRRSAESQLHLKGSTCHMRHNFPSVVPSESET-----------DGILGSMSE  435

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
                L  +I S      E   + D  S F  FC SGL+ LGI  SQ+I+  GIWKE +PF 
Sbjct  436   IQTLPGEIPSNERAGCEVIKSDDKLSHFENFCQSGLSHLGIKHSQDINLQGIWKEAEPFA  495

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             +++GPYWSLRAALGP+LET+I+LDRLLFLQE    +EA L+PIFDP +SPRN+AII +KI
Sbjct  496   DLVGPYWSLRAALGPLLETLIILDRLLFLQEQGSALEACLLPIFDPKISPRNVAIIAKKI  555



>ref|XP_004150777.1| PREDICTED: methyltransferase-like protein 25-like [Cucumis sativus]
Length=521

 Score =   424 bits (1089),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 286/434 (66%), Gaps = 24/434 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y ++IRK+  E + L +PK +T
Sbjct  112   GYLAQALSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLSQIRKAGLEAKNLRLPKAMT  171

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
               VLS + LK+L+N SLE   V K  + G+      Q+ S+     +S    + SL+LAG
Sbjct  172   FHVLSVDALKSLANMSLEDDHVEKTSMTGDDQKKINQQDSKCLTLCNSD--EEPSLVLAG  229

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV +LRTF+EC EVKAVI++GCCYNLL+E  +  +    GFP+S  VK+ GL 
Sbjct  230   LHACGDLSVIILRTFVECKEVKAVINIGCCYNLLTEYGSNNEGVQNGFPMSFGVKSSGLS  289

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS R LACQSA+RWR L    GLHNFELHAFRA FQM+L +YY +V+   P++GRQGK
Sbjct  290   LGKSGRGLACQSAERWRNLENEGGLHNFELHAFRAAFQMVLYKYYPDVVATCPSVGRQGK  349

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ  +R    + QC                ED+   S SDL        G+  + +A
Sbjct  350   ALRRQ-KKREDSVSSQCH---------------EDKLEASQSDL------IGGLPVNVNA  387

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H +S   S   E + +VD + LF KFC SGL RLGI  SQ++D  GIW +T PFTE+I
Sbjct  388   FSHTVSDHGSTPCEQSKSVDKYPLFEKFCHSGLNRLGIQSSQDMDCYGIWMDTDPFTELI  447

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI*SL  1398
             GPYWSLRAALGPVLET ILLDRLLFLQE    VEA L+PIFDP LSPRN+AII RK+ + 
Sbjct  448   GPYWSLRAALGPVLETCILLDRLLFLQEQGGSVEAILLPIFDPSLSPRNVAIIARKVGTT  507

Query  1399  HELVS*SVDAKLEK  1440
               L+  S+  + E+
Sbjct  508   EGLLEESLPNRNER  521



>ref|XP_010537776.1| PREDICTED: methyltransferase-like protein 25 isoform X4 [Tarenaya 
hassleriana]
Length=438

 Score =   414 bits (1063),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 274/417 (66%), Gaps = 39/417 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y   ++AIDA SHHGN+TDARA RI+KH+AA++RKS S ++  +VP TVT
Sbjct  47    GYLAQVLSFQYKHLVIAIDACSHHGNVTDARAMRIKKHFAAQMRKSGSGNKCPNVPVTVT  106

Query  319   CRVLSPETLKALSNGSL-EKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILA  495
             CRVLS E LK+L++    E+ D+    L G     Q    S              SL+LA
Sbjct  107   CRVLSTEALKSLNDVPRNEEVDLNVTELDGNQRRSQDSNRS-------------CSLVLA  153

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC EVKAV+SVGCCYNL+SEE      S CGFP+S  +K+ G 
Sbjct  154   GLHACGDLSVTMLRTFVECKEVKAVVSVGCCYNLISEERIENSGSQCGFPMSSCLKSSGF  213

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK++RDLACQSA+RW  LG+ AGL NFELHAFRA FQM+L +YY EV+  SP+IGRQG
Sbjct  214   SLGKNSRDLACQSAERWSSLGEDAGLQNFELHAFRAAFQMVLSKYYPEVMATSPSIGRQG  273

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             KTLRRQ  ++ LES          + G SS  R                D   G + D D
Sbjct  274   KTLRRQQQRKVLESR-------SKADGVSSATR---------------KDPVSGSSFDID  311

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
                   SS R   +++  +  SF     FC S  +RL +   ++ID   +WKE + FTE+
Sbjct  312   EPSWTGSSARETISDSDRSSSSFE---NFCMSAFSRLNLERPRDIDLQEVWKEAEAFTEL  368

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             IGPYWS+RAALGPVLET+ILLDRL+FLQE  D +EA ++PIFDP +SPRN+AII +K
Sbjct  369   IGPYWSIRAALGPVLETLILLDRLMFLQEQDDSIEAVMLPIFDPTISPRNVAIIAKK  425



>ref|XP_010476778.1| PREDICTED: methyltransferase-like protein 25 [Camelina sativa]
Length=520

 Score =   416 bits (1070),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 214/417 (51%), Positives = 279/417 (67%), Gaps = 50/417 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG +TDARA RIRKH+AA++RKS S ++   VP T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIRKHFAAQMRKSGSGNKCPDVPMTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LKAL++  LEK D+        S++ +    S+   +P+   +   SL+LAG
Sbjct  214   CRVLSTEMLKALTDVPLEKNDLDS----NASALNEGPRRSQ---SPND-AIRSCSLVLAG  265

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+++    S CGFP+S  +K +   
Sbjct  266   LHACGDLSVTMLRTFMECEEVKAVVSIGCCYNLLSEKSSENSCSKCGFPMSAGLKFLNFS  325

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  326   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  385

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+                   + D+TR         ND K         
Sbjct  386   AFRRQQQRKALET-----------------PAAVDKTRKD-------NDNKN--------  413

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                       +K  ++N+ D+FS F KFC S  + L +   Q++D +  W E   FTE+I
Sbjct  414   ---------PLKQTSSNS-DTFSSFEKFCLSAFSSLNLEHPQDLDLNATWNEADAFTELI  463

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  D +E  ++PIFDP +SPRN+AII R++
Sbjct  464   GPYWSIRAALGPVLETLILLDRLMFLQEQGDSIEVMMLPIFDPSISPRNVAIIARRL  520



>ref|XP_011095623.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Sesamum 
indicum]
Length=490

 Score =   415 bits (1067),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 289/419 (69%), Gaps = 32/419 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSFE+ LS++AIDASSHHG+ITDARA+RI K+YAAK  KS S      +PKTVT
Sbjct  102   GYLAQVLSFEHELSVIAIDASSHHGSITDARAKRIEKYYAAKKCKSRSG---FCIPKTVT  158

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGD-SSLILA  495
             CRVLSP  LK +S+   +  ++    +  +++  +          P+S    D S+++LA
Sbjct  159   CRVLSPAMLKDISSSLRQVDEMENPTIFRDNTDSKPLAGDLASECPYSSKADDKSTMVLA  218

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC+EVKAVIS+GCCYNLLSEE   + D   GFP+S+  K+  L
Sbjct  219   GLHACGDLSVTMLRTFMECDEVKAVISIGCCYNLLSEEGIKEGDCQFGFPVSRGAKSANL  278

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK+ARDLACQSA+RWRGLG+AAGLHNFELH FRA FQM+L + Y E++ +SPAIGRQG
Sbjct  279   QLGKNARDLACQSAERWRGLGEAAGLHNFELHTFRAAFQMVLFQCYPEIITRSPAIGRQG  338

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             K  RRQHH+R LE N             +   ++  +  CS              T   D
Sbjct  339   KAFRRQHHRRILECN-------------ADMAQTFSQNCCS--------------TYAKD  371

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             AL ++ SS     N+  N+ D +S+F+KFC SGL RLG+   Q+I++S +W+E + F+ +
Sbjct  372   ALLNEHSSYPKSANKEANSADRYSMFVKFCKSGLGRLGLCVPQDIEFSRLWEEAEEFSGL  431

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSD-WVEAALVPIFDPVLSPRNMAIIGRKI  1389
             +GPYW+LRAALGPVLETI+LLDRLLFLQE  +  ++  L+PIFDPVLSPRN+A+I  K 
Sbjct  432   VGPYWTLRAALGPVLETILLLDRLLFLQEQGNVLIQTVLLPIFDPVLSPRNVALIAEKF  490



>ref|XP_011095621.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Sesamum 
indicum]
Length=508

 Score =   415 bits (1066),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 289/419 (69%), Gaps = 32/419 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSFE+ LS++AIDASSHHG+ITDARA+RI K+YAAK  KS S      +PKTVT
Sbjct  120   GYLAQVLSFEHELSVIAIDASSHHGSITDARAKRIEKYYAAKKCKSRSG---FCIPKTVT  176

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGD-SSLILA  495
             CRVLSP  LK +S+   +  ++    +  +++  +          P+S    D S+++LA
Sbjct  177   CRVLSPAMLKDISSSLRQVDEMENPTIFRDNTDSKPLAGDLASECPYSSKADDKSTMVLA  236

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC+EVKAVIS+GCCYNLLSEE   + D   GFP+S+  K+  L
Sbjct  237   GLHACGDLSVTMLRTFMECDEVKAVISIGCCYNLLSEEGIKEGDCQFGFPVSRGAKSANL  296

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK+ARDLACQSA+RWRGLG+AAGLHNFELH FRA FQM+L + Y E++ +SPAIGRQG
Sbjct  297   QLGKNARDLACQSAERWRGLGEAAGLHNFELHTFRAAFQMVLFQCYPEIITRSPAIGRQG  356

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             K  RRQHH+R LE N             +   ++  +  CS              T   D
Sbjct  357   KAFRRQHHRRILECN-------------ADMAQTFSQNCCS--------------TYAKD  389

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             AL ++ SS     N+  N+ D +S+F+KFC SGL RLG+   Q+I++S +W+E + F+ +
Sbjct  390   ALLNEHSSYPKSANKEANSADRYSMFVKFCKSGLGRLGLCVPQDIEFSRLWEEAEEFSGL  449

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSD-WVEAALVPIFDPVLSPRNMAIIGRKI  1389
             +GPYW+LRAALGPVLETI+LLDRLLFLQE  +  ++  L+PIFDPVLSPRN+A+I  K 
Sbjct  450   VGPYWTLRAALGPVLETILLLDRLLFLQEQGNVLIQTVLLPIFDPVLSPRNVALIAEKF  508



>ref|XP_010537774.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Tarenaya 
hassleriana]
Length=478

 Score =   413 bits (1061),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 274/417 (66%), Gaps = 39/417 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y   ++AIDA SHHGN+TDARA RI+KH+AA++RKS S ++  +VP TVT
Sbjct  87    GYLAQVLSFQYKHLVIAIDACSHHGNVTDARAMRIKKHFAAQMRKSGSGNKCPNVPVTVT  146

Query  319   CRVLSPETLKALSNGSL-EKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILA  495
             CRVLS E LK+L++    E+ D+    L G     Q    S              SL+LA
Sbjct  147   CRVLSTEALKSLNDVPRNEEVDLNVTELDGNQRRSQDSNRS-------------CSLVLA  193

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC EVKAV+SVGCCYNL+SEE      S CGFP+S  +K+ G 
Sbjct  194   GLHACGDLSVTMLRTFVECKEVKAVVSVGCCYNLISEERIENSGSQCGFPMSSCLKSSGF  253

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK++RDLACQSA+RW  LG+ AGL NFELHAFRA FQM+L +YY EV+  SP+IGRQG
Sbjct  254   SLGKNSRDLACQSAERWSSLGEDAGLQNFELHAFRAAFQMVLSKYYPEVMATSPSIGRQG  313

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             KTLRRQ  ++ LES          + G SS  R                D   G + D D
Sbjct  314   KTLRRQQQRKVLESR-------SKADGVSSATR---------------KDPVSGSSFDID  351

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
                   SS R   +++  +  SF     FC S  +RL +   ++ID   +WKE + FTE+
Sbjct  352   EPSWTGSSARETISDSDRSSSSFE---NFCMSAFSRLNLERPRDIDLQEVWKEAEAFTEL  408

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             IGPYWS+RAALGPVLET+ILLDRL+FLQE  D +EA ++PIFDP +SPRN+AII +K
Sbjct  409   IGPYWSIRAALGPVLETLILLDRLMFLQEQDDSIEAVMLPIFDPTISPRNVAIIAKK  465



>ref|XP_011095620.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Sesamum 
indicum]
Length=546

 Score =   414 bits (1064),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 289/419 (69%), Gaps = 32/419 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSFE+ LS++AIDASSHHG+ITDARA+RI K+YAAK  KS S      +PKTVT
Sbjct  158   GYLAQVLSFEHELSVIAIDASSHHGSITDARAKRIEKYYAAKKCKSRSG---FCIPKTVT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGD-SSLILA  495
             CRVLSP  LK +S+   +  ++    +  +++  +          P+S    D S+++LA
Sbjct  215   CRVLSPAMLKDISSSLRQVDEMENPTIFRDNTDSKPLAGDLASECPYSSKADDKSTMVLA  274

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC+EVKAVIS+GCCYNLLSEE   + D   GFP+S+  K+  L
Sbjct  275   GLHACGDLSVTMLRTFMECDEVKAVISIGCCYNLLSEEGIKEGDCQFGFPVSRGAKSANL  334

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK+ARDLACQSA+RWRGLG+AAGLHNFELH FRA FQM+L + Y E++ +SPAIGRQG
Sbjct  335   QLGKNARDLACQSAERWRGLGEAAGLHNFELHTFRAAFQMVLFQCYPEIITRSPAIGRQG  394

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             K  RRQHH+R LE N             +   ++  +  CS              T   D
Sbjct  395   KAFRRQHHRRILECN-------------ADMAQTFSQNCCS--------------TYAKD  427

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             AL ++ SS     N+  N+ D +S+F+KFC SGL RLG+   Q+I++S +W+E + F+ +
Sbjct  428   ALLNEHSSYPKSANKEANSADRYSMFVKFCKSGLGRLGLCVPQDIEFSRLWEEAEEFSGL  487

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSD-WVEAALVPIFDPVLSPRNMAIIGRKI  1389
             +GPYW+LRAALGPVLETI+LLDRLLFLQE  +  ++  L+PIFDPVLSPRN+A+I  K 
Sbjct  488   VGPYWTLRAALGPVLETILLLDRLLFLQEQGNVLIQTVLLPIFDPVLSPRNVALIAEKF  546



>ref|XP_006416795.1| hypothetical protein EUTSA_v10007372mg [Eutrema salsugineum]
 gb|ESQ35148.1| hypothetical protein EUTSA_v10007372mg [Eutrema salsugineum]
Length=520

 Score =   413 bits (1061),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 212/417 (51%), Positives = 276/417 (66%), Gaps = 50/417 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG ITDARA RIRKH+AA++RKS S ++   VP T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGKITDARASRIRKHFAAQMRKSGSGNKCPDVPVTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LK L+N SLEK D+        S + +    S+  L+P +   G  SL+LAG
Sbjct  214   CRVLSTEMLKTLTNVSLEKNDLDS----NASVLNEGPRRSQ--LSPDANRSG--SLVLAG  265

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+++    S CGFP+S  +K+VG  
Sbjct  266   LHACGDLSVTMLRTFMECEEVKAVVSIGCCYNLLSEKSSENSCSKCGFPMSAGLKSVGFS  325

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  326   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  385

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+        K++                                 DD 
Sbjct  386   AFRRQQQRKALETPATVATTRKDT---------------------------------DDK  412

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                + +S++S         D  S F KFC+S  + L +   +++D    W E+  FTE+I
Sbjct  413   KPMRQTSSKS---------DICSSFEKFCESAFSSLNLEHPEDLDLRATWNESVEFTELI  463

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE    ++  ++PIFDP +SPRN+AII +++
Sbjct  464   GPYWSIRAALGPVLETLILLDRLMFLQEQGASIKVVMLPIFDPTISPRNVAIIAKRL  520



>ref|XP_010537773.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Tarenaya 
hassleriana]
Length=517

 Score =   413 bits (1061),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 274/417 (66%), Gaps = 39/417 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y   ++AIDA SHHGN+TDARA RI+KH+AA++RKS S ++  +VP TVT
Sbjct  126   GYLAQVLSFQYKHLVIAIDACSHHGNVTDARAMRIKKHFAAQMRKSGSGNKCPNVPVTVT  185

Query  319   CRVLSPETLKALSNGSL-EKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILA  495
             CRVLS E LK+L++    E+ D+    L G     Q    S              SL+LA
Sbjct  186   CRVLSTEALKSLNDVPRNEEVDLNVTELDGNQRRSQDSNRS-------------CSLVLA  232

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC EVKAV+SVGCCYNL+SEE      S CGFP+S  +K+ G 
Sbjct  233   GLHACGDLSVTMLRTFVECKEVKAVVSVGCCYNLISEERIENSGSQCGFPMSSCLKSSGF  292

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK++RDLACQSA+RW  LG+ AGL NFELHAFRA FQM+L +YY EV+  SP+IGRQG
Sbjct  293   SLGKNSRDLACQSAERWSSLGEDAGLQNFELHAFRAAFQMVLSKYYPEVMATSPSIGRQG  352

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             KTLRRQ  ++ LES          + G SS  R                D   G + D D
Sbjct  353   KTLRRQQQRKVLESR-------SKADGVSSATR---------------KDPVSGSSFDID  390

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
                   SS R   +++  +  SF     FC S  +RL +   ++ID   +WKE + FTE+
Sbjct  391   EPSWTGSSARETISDSDRSSSSFE---NFCMSAFSRLNLERPRDIDLQEVWKEAEAFTEL  447

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             IGPYWS+RAALGPVLET+ILLDRL+FLQE  D +EA ++PIFDP +SPRN+AII +K
Sbjct  448   IGPYWSIRAALGPVLETLILLDRLMFLQEQDDSIEAVMLPIFDPTISPRNVAIIAKK  504



>gb|KFK43870.1| uncharacterized protein AALP_AA1G184800 [Arabis alpina]
Length=511

 Score =   412 bits (1058),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 271/417 (65%), Gaps = 52/417 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG +TDARA RIRKH+AA++RKS S ++   VP T+T
Sbjct  147   GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIRKHFAAQMRKSGSGNKCPDVPMTIT  206

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LKAL++  LEK D+       E   G  +  S D   P        SL+LAG
Sbjct  207   CRVLSTEMLKALTDVPLEKNDLELNACALE---GPRRSQSTDANRP-------CSLVLAG  256

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLL+E+++    SH GFP+S  +K++   
Sbjct  257   LHACGDLSVTMLRTFMECKEVKAVVSIGCCYNLLTEKSSENSCSHSGFPMSTGLKSLRFS  316

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP IGRQGK
Sbjct  317   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPTIGRQGK  376

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  +++LE                        TR ++       D KK +      
Sbjct  377   AFRRQQQRKSLE------------------------TRATVDSTRKDTDEKKPI------  406

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                          + ++  D+ S F KFC S  +RL +   Q++D    W E + FTE+I
Sbjct  407   ------------KQTSSKFDTCSSFTKFCLSAFSRLNLEHPQDLDLLATWNEAEAFTELI  454

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  D +E  ++PIFDP +SPRN+AII +++
Sbjct  455   GPYWSIRAALGPVLETLILLDRLMFLQEQGDPIEVVMIPIFDPTISPRNVAIIAKRL  511



>ref|XP_007022294.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein, putative isoform 1 [Theobroma cacao]
 gb|EOY13819.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein, putative isoform 1 [Theobroma cacao]
Length=539

 Score =   412 bits (1059),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 268/391 (69%), Gaps = 19/391 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FEY  S++AIDA SHHG +TDARA+RI+KHY A++ K+ S +++L+VP+T+T
Sbjct  155   GYLAQVLAFEYHHSVVAIDACSHHGKVTDARAKRIKKHYTAQMWKNGSGNKKLNVPQTIT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CR++S ETLKAL+     K DV               E  E  L         SSL+LAG
Sbjct  215   CRIMSLETLKALTTLLPHKGDV---------------EQIEQDLEKFGLTGNKSSLVLAG  259

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+T LEC EV+AVIS+GCCYNLLSEE         GFP+S  VK V   
Sbjct  260   LHACGDLSVTMLKTLLECEEVRAVISIGCCYNLLSEEGFENAGIQYGFPMSCGVKTVSFS  319

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RW+GLG+ AGLHNFELHAFRA FQM+L +YY EV++ SP+IGRQGK
Sbjct  320   LGKSSRDLACQSAERWKGLGKDAGLHNFELHAFRAAFQMVLHKYYPEVVIASPSIGRQGK  379

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLG-CGNDGKKGVTCDDD  1035
              LRR+  +R +ES L  ++   +S     Q+ S     CS+   G  G     G+  D D
Sbjct  380   ALRRKQQRRRMESELHDEESTYSS---PPQRPSNMGEACSIKQSGESGAVDSSGIRLDVD  436

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             ALF+K+    S + E T   D +SLF KFC SGL RLG+  S +I++ GIWKE +P+ ++
Sbjct  437   ALFNKMYLHTSSRCEETIPDDKYSLFEKFCQSGLCRLGLKPSDDINFRGIWKEVEPYVDL  496

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESS  1308
             IG YWSLRAA GP+LET ILLDRLLFLQE +
Sbjct  497   IGVYWSLRAAFGPLLETFILLDRLLFLQEQA  527



>ref|XP_010537772.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Tarenaya 
hassleriana]
Length=545

 Score =   412 bits (1058),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 219/417 (53%), Positives = 274/417 (66%), Gaps = 39/417 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y   ++AIDA SHHGN+TDARA RI+KH+AA++RKS S ++  +VP TVT
Sbjct  154   GYLAQVLSFQYKHLVIAIDACSHHGNVTDARAMRIKKHFAAQMRKSGSGNKCPNVPVTVT  213

Query  319   CRVLSPETLKALSNGSL-EKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILA  495
             CRVLS E LK+L++    E+ D+    L G     Q    S              SL+LA
Sbjct  214   CRVLSTEALKSLNDVPRNEEVDLNVTELDGNQRRSQDSNRS-------------CSLVLA  260

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF+EC EVKAV+SVGCCYNL+SEE      S CGFP+S  +K+ G 
Sbjct  261   GLHACGDLSVTMLRTFVECKEVKAVVSVGCCYNLISEERIENSGSQCGFPMSSCLKSSGF  320

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK++RDLACQSA+RW  LG+ AGL NFELHAFRA FQM+L +YY EV+  SP+IGRQG
Sbjct  321   SLGKNSRDLACQSAERWSSLGEDAGLQNFELHAFRAAFQMVLSKYYPEVMATSPSIGRQG  380

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             KTLRRQ  ++ LES          + G SS  R                D   G + D D
Sbjct  381   KTLRRQQQRKVLESR-------SKADGVSSATR---------------KDPVSGSSFDID  418

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
                   SS R   +++  +  SF     FC S  +RL +   ++ID   +WKE + FTE+
Sbjct  419   EPSWTGSSARETISDSDRSSSSFE---NFCMSAFSRLNLERPRDIDLQEVWKEAEAFTEL  475

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             IGPYWS+RAALGPVLET+ILLDRL+FLQE  D +EA ++PIFDP +SPRN+AII +K
Sbjct  476   IGPYWSIRAALGPVLETLILLDRLMFLQEQDDSIEAVMLPIFDPTISPRNVAIIAKK  532



>ref|XP_002890179.1| hypothetical protein ARALYDRAFT_889058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66438.1| hypothetical protein ARALYDRAFT_889058 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   411 bits (1056),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 208/417 (50%), Positives = 281/417 (67%), Gaps = 50/417 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG +TDARA RIRKH+AA++RKS S ++   VP T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGTVTDARAARIRKHFAAQMRKSGSGNKCPDVPMTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LKAL+N  LEK D         S++ + Q  S+     +       SL+LAG
Sbjct  214   CRVLSSEMLKALTNVPLEKSDTD----FNGSALNEGQSRSQSASDANRL----CSLVLAG  265

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+SVGCCYNLLSE+++    S CG+P+S  +K++G  
Sbjct  266   LHACGDLSVTMLRTFMECEEVKAVVSVGCCYNLLSEKSSDDSCSKCGYPMSAGLKSLGFS  325

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW GLG+ AGL NF+LH+FRA FQM+L ++Y EVLV SP+IGRQGK
Sbjct  326   LGKNARDLACQSAERWSGLGEDAGLQNFQLHSFRAAFQMVLSKHYPEVLVTSPSIGRQGK  385

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  +++LE+          ++  +++K ++D+                        
Sbjct  386   AFRRQQQRKSLET---------PAAVDTTRKDTDDK------------------------  412

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                     + ++  ++N+ D  S F KFC S  +RL +    ++D +  WKE   FTE+I
Sbjct  413   --------KPMRQTSSNS-DMCSSFEKFCLSAFSRLNLEHPLDLDLNATWKEADAFTELI  463

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALG VLET+ILLDRL+FLQE  D ++  ++PIFDP +SPRN+AII +++
Sbjct  464   GPYWSIRAALGAVLETLILLDRLMFLQEQGDSIKVVMLPIFDPTISPRNVAIIAKRL  520



>ref|XP_004488841.1| PREDICTED: protein RRNAD1-like [Cicer arietinum]
Length=559

 Score =   412 bits (1058),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 287/417 (69%), Gaps = 16/417 (4%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+KHY +K+ KS S  + L+VPKT+T
Sbjct  156   GYLAQVLAFQYQHPVIAIDACSHHGMVTDARAERIKKHYTSKMVKSGSGMQNLNVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E+LK L   S+   D+ +  L GE+   + ++H        S     S  +LAG
Sbjct  216   CRVLSIESLKTLVETSVPGDDLEQSMLKGENQEDKGKQHCP------SDTNNRSPTVLAG  269

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV ML+ FL+C +VKAV+S+GCCYNLLSEE+   D+S CGFP+S++V++ GL 
Sbjct  270   LHACGDLSVIMLKAFLDCRDVKAVVSIGCCYNLLSEESLKDDESQCGFPMSRAVRSTGLS  329

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY EV+  +P+IGR+GK
Sbjct  330   LGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAVFQMVLSKYYPEVVRSTPSIGRKGK  389

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRR++ +R+ ES L  +       G +   R   +   ++       +G  G   D   
Sbjct  390   ALRRRNQRRSAESELHLK-------GSTCHMR---QNFPAVVPAESKTEGTFGSASDSQT  439

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
             L  +ISS  S   E     + FS F KFC SGL+ LGI  S +++   IWKE +PF ++I
Sbjct  440   LPGEISSNESSGCEGIKINNKFSNFEKFCQSGLSHLGIEHSDDVNLQCIWKEAEPFADLI  499

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWSLRAALGP+LET+ILLDRLLFLQE    +EA L+PIFDP +SPRN+A+I +KI
Sbjct  500   GPYWSLRAALGPLLETLILLDRLLFLQEQGGALEAYLLPIFDPNISPRNVAVIAKKI  556



>emb|CDY40042.1| BnaC05g12730D [Brassica napus]
Length=515

 Score =   410 bits (1053),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 274/417 (66%), Gaps = 57/417 (14%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHGN+TDARA RIRKH+A+++RKS S ++    P T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGNVTDARAARIRKHFASQMRKSGSGNKCPDAPTTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LK+L+N  LE+ D+     +  +++ +  + S+      S      SL+LAG
Sbjct  214   CRVLSTEMLKSLTNVPLEENDLD----LDAAALNEGPKSSQSS----SDANRPCSLVLAG  265

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+A+    S CGFP+S  +K++G  
Sbjct  266   LHACGDLSVTMLRTFMECEEVKAVVSIGCCYNLLSEKASESSCSKCGFPMSAGLKSLGFS  325

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  326   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  385

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+  + +   K++                                D  +
Sbjct  386   AFRRQKQRKALETPSKLETSRKDT--------------------------------DKKS  413

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
             + H  SS                 F KFC S  +RL +   Q++D S  W E   FTE+I
Sbjct  414   MTHTSSS-----------------FEKFCLSAFSRLNLERPQDLDLSATWNEAHAFTELI  456

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  D ++  ++PIFDP +SPRN+A+I +++
Sbjct  457   GPYWSIRAALGPVLETLILLDRLMFLQEQGDSIQVTMLPIFDPTISPRNVAVIAKRL  513



>ref|XP_007149264.1| hypothetical protein PHAVU_005G055600g [Phaseolus vulgaris]
 gb|ESW21258.1| hypothetical protein PHAVU_005G055600g [Phaseolus vulgaris]
Length=536

 Score =   410 bits (1054),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 288/419 (69%), Gaps = 20/419 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GY+AQVL+F+Y   ++AIDA SHHG +TDARAE+I+K+Y +++ KS S  R L+VPKT+T
Sbjct  129   GYVAQVLAFQYQHPVIAIDACSHHGRVTDARAEKIKKYYTSQMIKSGSGMRSLNVPKTIT  188

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPH--SYMVGDSSLIL  492
             CR+LS ++LK L   SL   DV +  L          E+ +D   PH  S     SS++L
Sbjct  189   CRILSTDSLKTLVEISLTGDDVEQSRL--------KAENQQDLGKPHWLSNANKKSSIVL  240

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TFLEC +VKAV+S+GCCYNLLSEE     +S CGFP+S +V++  
Sbjct  241   AGLHACGDLSVTMLKTFLECKDVKAVVSLGCCYNLLSEERIEDGESQCGFPMSHAVRSTS  300

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGK ARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY E++  +P+IGR+
Sbjct  301   LSLGKRARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEIVTSTPSIGRK  360

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             GK LRR+H +R+ ES L      K S+  S QK   +    S +D   G+        + 
Sbjct  361   GKALRRRHQRRSAESQLHL----KGSTCHSRQKCPPEVPSVSETDWTLGS------ISEI  410

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
               L  +I  +     E T + D+F  F  FC SGL+ LGI  SQ+I+  GIWKE +PF +
Sbjct  411   QTLPSEIPYSERAGYEGTKSDDTFLHFENFCRSGLSHLGIKHSQDINLQGIWKEAEPFAD  470

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             ++GPYWSLRAALGP+LET+ILLDRLLFLQE    +EA L+PIFDP +SPRN+AII +KI
Sbjct  471   LVGPYWSLRAALGPLLETLILLDRLLFLQEQGSALEACLLPIFDPNISPRNVAIIAKKI  529



>ref|XP_007149265.1| hypothetical protein PHAVU_005G055600g [Phaseolus vulgaris]
 gb|ESW21259.1| hypothetical protein PHAVU_005G055600g [Phaseolus vulgaris]
Length=561

 Score =   411 bits (1056),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 288/419 (69%), Gaps = 20/419 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GY+AQVL+F+Y   ++AIDA SHHG +TDARAE+I+K+Y +++ KS S  R L+VPKT+T
Sbjct  154   GYVAQVLAFQYQHPVIAIDACSHHGRVTDARAEKIKKYYTSQMIKSGSGMRSLNVPKTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPH--SYMVGDSSLIL  492
             CR+LS ++LK L   SL   DV +  L          E+ +D   PH  S     SS++L
Sbjct  214   CRILSTDSLKTLVEISLTGDDVEQSRL--------KAENQQDLGKPHWLSNANKKSSIVL  265

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TFLEC +VKAV+S+GCCYNLLSEE     +S CGFP+S +V++  
Sbjct  266   AGLHACGDLSVTMLKTFLECKDVKAVVSLGCCYNLLSEERIEDGESQCGFPMSHAVRSTS  325

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGK ARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY E++  +P+IGR+
Sbjct  326   LSLGKRARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEIVTSTPSIGRK  385

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             GK LRR+H +R+ ES L      K S+  S QK   +    S +D   G+        + 
Sbjct  386   GKALRRRHQRRSAESQLHL----KGSTCHSRQKCPPEVPSVSETDWTLGS------ISEI  435

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
               L  +I  +     E T + D+F  F  FC SGL+ LGI  SQ+I+  GIWKE +PF +
Sbjct  436   QTLPSEIPYSERAGYEGTKSDDTFLHFENFCRSGLSHLGIKHSQDINLQGIWKEAEPFAD  495

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             ++GPYWSLRAALGP+LET+ILLDRLLFLQE    +EA L+PIFDP +SPRN+AII +KI
Sbjct  496   LVGPYWSLRAALGPLLETLILLDRLLFLQEQGSALEACLLPIFDPNISPRNVAIIAKKI  554



>gb|EYU27530.1| hypothetical protein MIMGU_mgv1a003870mg [Erythranthe guttata]
Length=558

 Score =   410 bits (1053),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 293/418 (70%), Gaps = 23/418 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSFEY LS++A+DASSHHG+IT+ARA+RI KHYAAKIRKS SE++  S+PK VT
Sbjct  161   GYLAQVLSFEYELSVIAVDASSHHGSITEARAKRIEKHYAAKIRKSSSENKVFSIPKAVT  220

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQE-HSEDRLTPHSYMVGDSSLILA  495
             C+VLSP  L+ +S+  L+  D+    +  E++     E H  +   P S     SSL+LA
Sbjct  221   CQVLSPTMLEDVSSSLLQANDLENPTISRENNDDTPPEGHRSESPFP-SKANEKSSLVLA  279

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLR+FLEC+ VKAV+S+GCCYNLLSE+   + D+ CGFPLS   K+  L
Sbjct  280   GLHACGDLSVTMLRSFLECDAVKAVVSIGCCYNLLSEDGNKEADNQCGFPLSAGAKSASL  339

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK+ARDLACQSA+RWR LG+A GL NFELH FRA FQM+L +YY EV+ +   IGRQG
Sbjct  340   YLGKNARDLACQSAERWRNLGEADGLQNFELHIFRAAFQMVLCQYYPEVITRGTTIGRQG  399

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             K LRR+HH+R LESN                     + + ++S        + G T   +
Sbjct  400   KALRRKHHRRILESN--------------------GDIKSAISGTEFAQGVESGSTWAIN  439

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
              L +  S+     N  +++VD +S+F+ +C +GL RLG+++SQ+I+   +WKE + ++++
Sbjct  440   PLLNDPSTYPKSLNGKSSSVDRYSVFVNYCKAGLGRLGLHDSQDIELFSLWKEAEEYSDL  499

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSD-WVEAALVPIFDPVLSPRNMAIIGRK  1386
             +GPYW+LRA LGPVLET++LLDRLLFLQE  +  +EA ++P+FDP+LSPRNMA+I  K
Sbjct  500   VGPYWALRAGLGPVLETLLLLDRLLFLQEHGNVLIEAVMLPLFDPLLSPRNMALIAEK  557



>ref|XP_008444278.1| PREDICTED: protein RRNAD1 isoform X1 [Cucumis melo]
Length=561

 Score =   409 bits (1050),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 227/420 (54%), Positives = 275/420 (65%), Gaps = 27/420 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS---ESEDRELSVPK  309
             GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+     E   L +PK
Sbjct  163   GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGFYRLEAENLRLPK  222

Query  310   TVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
              +T  VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+
Sbjct  223   AMTFHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLV  280

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLRTF+EC EVKAVI++GCCYNLL+E  +       GFP+S  VK+ 
Sbjct  281   LAGLHACGDLSVIMLRTFVECKEVKAVINIGCCYNLLTEYGSNNKGIQNGFPMSFGVKSS  340

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              L LGKS RDLACQSA+RWR L +  GLHNFELHAFRA FQM+L +YY +V+   P+IGR
Sbjct  341   SLSLGKSGRDLACQSAERWRNLEKEGGLHNFELHAFRAAFQMVLYKYYPDVVATCPSIGR  400

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ                K   G  S +  ED+   S SDL        G   +
Sbjct  401   QGKALRRQ----------------KKREGSVSSQCREDKLEASQSDL------IGGFQVN  438

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
              +A  H IS   S   E + +VD + LF KFC SGL RLG+  SQ+ D  GIW +T+PFT
Sbjct  439   ANAFSHTISDHGSTPCEQSKSVDKYPLFEKFCHSGLIRLGLQSSQDTDCYGIWTDTEPFT  498

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E+IGPYWSLRAALGPVLET ILLDRLLFLQE    +EA L+PIFDP LSPRN+AII RK+
Sbjct  499   ELIGPYWSLRAALGPVLETCILLDRLLFLQEQGGSLEAILLPIFDPDLSPRNVAIIARKV  558



>ref|XP_008226288.1| PREDICTED: protein RRNAD1 isoform X2 [Prunus mume]
 ref|XP_008226290.1| PREDICTED: protein RRNAD1 isoform X2 [Prunus mume]
Length=507

 Score =   405 bits (1042),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 290/431 (67%), Gaps = 51/431 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  +++AIDA SHHG +TD RAE+I+K+YAA++RKS S +R L+VPKTVT
Sbjct  111   GYLAQVLSFHYQHAVVAIDACSHHGRVTDTRAEQIKKYYAAQMRKSVSGNRSLTVPKTVT  170

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S + LKAL++  L   +V         S+ Q+  ++++R          SSL+LAG
Sbjct  171   CNVMSIDMLKALADTPLHNDNV---------SLLQSSCNADNR----------SSLVLAG  211

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSEE      S CGFP+S  VK+ G+ 
Sbjct  212   LHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEEGFNHAGSQCGFPMSCGVKSAGIS  271

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RW+ L   AGLHNFELHAFRA FQM+L  YY EV+  SP+IGRQGK
Sbjct  272   LGKSSRDLACQSAERWKCLENDAGLHNFELHAFRAAFQMVLRVYYPEVMSTSPSIGRQGK  331

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG----KKGVTC  1026
              LRR+  QR ++++L                    E +CS+S++     G    KK    
Sbjct  332   ALRRR-QQRVVQNSL----------------LHHKENKCSLSEINSHMTGSCSHKKSTEL  374

Query  1027  DDDALFHKISSTRSVKNENTN----------AVDSFSLFMKFCDSGLARLGINESQEIDY  1176
             + D  F  + +T S+ NEN++           + ++ LF K+C SGL RLG+   +E D 
Sbjct  375   ETDDSFDVLETT-SITNENSSNKATKCERSEIIGNYPLFQKYCLSGLCRLGLEPLKETDI  433

Query  1177  SGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLS  1356
              GIWK+ + F E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA ++PIF+P LS
Sbjct  434   HGIWKQVESFAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAVMLPIFNPALS  493

Query  1357  PRNMAIIGRKI  1389
             PRN+AII +K+
Sbjct  494   PRNVAIIAKKL  504



>ref|XP_010258678.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Nelumbo 
nucifera]
Length=479

 Score =   404 bits (1039),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 242/434 (56%), Positives = 303/434 (70%), Gaps = 25/434 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y LS++AIDASSHHG +T ARAERI+KHYAAK + +      L+VP+TVT
Sbjct  54    GYLAQVLSFQYNLSVVAIDASSHHGAVTSARAERIKKHYAAKTKNAH-----LNVPQTVT  108

Query  319   CRVLSPETLKALSNGSLEKYDVG----KQYLIGESSI-GQAQEHSEDRLTPHSYMVGDSS  483
             C V+S + LKA S+  L+K D      K+  +GE  + G   E  +  L  +S M    S
Sbjct  109   CCVMSSDALKAFSDALLQKNDFEPLEMKEIDLGEPYLEGLEVERKKPSLCSNSNM--GPS  166

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK  663
             L+LAGLHACGDLSVTMLRTF+EC E+KAV+S+GCCYNLLSEE +    S CGFP+S+  K
Sbjct  167   LVLAGLHACGDLSVTMLRTFIECKEIKAVVSIGCCYNLLSEEGSQNSGSQCGFPVSEGAK  226

Query  664   AVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAI  843
               GL LGKSARDLACQSA+RWR L + A L NFELHAFRA FQM+L RYY E+L  SP+I
Sbjct  227   LSGLSLGKSARDLACQSAERWRSLTKDAALQNFELHAFRAAFQMVLNRYYPEILTTSPSI  286

Query  844   GRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG-----  1008
             GRQGK LRRQ  +R L++NL   D   +    ++ ++ E E  C+ S+      G     
Sbjct  287   GRQGKALRRQQQRRVLQNNLHV-DKRTSLPLVATWEKCEMERSCTTSNYSEAYQGHTSEV  345

Query  1009  --KKGVTC---DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGI--NESQE  1167
               ++G TC   D   L  +ISS+ S   E   ++D +SLF KFC+SGL RLG+  N SQE
Sbjct  346   VLREGDTCSTLDRGGLSLQISSSYSSGCEGIWSLDRYSLFEKFCNSGLCRLGLLTNISQE  405

Query  1168  IDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDP  1347
             ID+ G+WKE QPF E+IGPYWSLRA LGPVLET++LLDRLLFLQE    V+A  +PIF+P
Sbjct  406   IDFLGLWKEAQPFCELIGPYWSLRAVLGPVLETLLLLDRLLFLQEQGSSVKAVALPIFNP  465

Query  1348  VLSPRNMAIIGRKI  1389
             +LSPRN+AII +KI
Sbjct  466   ILSPRNVAIIAQKI  479



>gb|KEH38366.1| methyltransferase-like protein [Medicago truncatula]
Length=501

 Score =   405 bits (1040),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 217/424 (51%), Positives = 287/424 (68%), Gaps = 28/424 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+KHY +K+ KS S  + L+VPKT+T
Sbjct  92    GYLAQVLAFQYQHPVIAIDACSHHGMVTDARAERIKKHYTSKMVKSGSGMQNLNVPKTIT  151

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E+LK L   S+   D  +  L GE+      +  + +L   +      S +LAG
Sbjct  152   CRVLSIESLKTLVETSVPSDDHEQSTLRGEN------QEDKGKLDCPNDANNRPSTVLAG  205

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV ML+TFL C +V+AV+S+GCCYNLLSEE+ G  +S CGFP+S +V++ GL 
Sbjct  206   LHACGDLSVIMLKTFLGCRDVEAVVSIGCCYNLLSEESIGDGESQCGFPMSHAVRSTGLS  265

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY EV + +P+IGR+GK
Sbjct  266   LGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEVAISTPSIGRKGK  325

Query  859   TLRRQHHQRALESNLQ-------CQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKG  1017
              LRR++ +R+ ES+ +       C       +G  ++ ++E               G  G
Sbjct  326   ALRRRNQRRSAESDSKLHLKGSTCNTRQNFPAGVPAESKAE---------------GTFG  370

Query  1018  VTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKET  1197
                +   L  +ISS  S + E     + FS F  FC SGL+ LG+  S ++   G WKE 
Sbjct  371   SASETQTLSGEISSNESAEYEGIKIDNKFSNFENFCQSGLSHLGLKHSHDVSLQGTWKEV  430

Query  1198  QPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAII  1377
             +PF+++IGPYWSLRAALGP+LET+ILLDRLLFLQE  + +EA L+PIFDP +SPRN+AII
Sbjct  431   EPFSDLIGPYWSLRAALGPLLETLILLDRLLFLQEQGNALEAYLLPIFDPNISPRNVAII  490

Query  1378  GRKI  1389
              +KI
Sbjct  491   AKKI  494



>ref|XP_010459205.1| PREDICTED: methyltransferase-like protein 25 [Camelina sativa]
Length=517

 Score =   405 bits (1042),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 209/417 (50%), Positives = 270/417 (65%), Gaps = 53/417 (13%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG +TDARA RIRKH+AA++RKS S +    VP T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIRKHFAAQMRKSGSGNNCPDVPMTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LKAL++  LEKYD+        S++ +    S       S      SL+LAG
Sbjct  214   CRVLSTEMLKALTDVPLEKYDLDS----NASALNECPRRSLSLDANRS-----CSLVLAG  264

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+++    S CGFP+S  +K +   
Sbjct  265   LHACGDLSVTMLRTFMECEEVKAVVSIGCCYNLLSEKSSENSCSKCGFPMSAGLKFLNFS  324

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  325   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSQHYPEVLATSPSIGRQGK  384

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+                   + D TR    D                 
Sbjct  385   AFRRQQQRKALET-----------------PATVDNTRKDTDD-----------------  410

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                      S++  ++N+  SF    KFC S  +RL +   Q++D    W E   F+E+I
Sbjct  411   -------KNSMRQTSSNSCSSFE---KFCLSAFSRLNLEHPQDLDLDATWNEADAFSELI  460

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  + ++  ++PIFDP +SPRN+AII R++
Sbjct  461   GPYWSIRAALGPVLETLILLDRLMFLQEQGESIKVMMLPIFDPSISPRNVAIIARRL  517



>ref|XP_010258677.1| PREDICTED: protein RRNAD1 isoform X2 [Nelumbo nucifera]
Length=570

 Score =   407 bits (1046),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 240/424 (57%), Positives = 299/424 (71%), Gaps = 15/424 (4%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y LS++AIDASSHHG +T ARAERI+KHYAAK + +      L+VP+TVT
Sbjct  155   GYLAQVLSFQYNLSVVAIDASSHHGAVTSARAERIKKHYAAKTKNAH-----LNVPQTVT  209

Query  319   CRVLSPETLKALSNGSLEKYDVG----KQYLIGESSI-GQAQEHSEDRLTPHSYMVGDSS  483
             C V+S + LKA S+  L+K D      K+  +GE  + G   E  +  L  +S M    S
Sbjct  210   CCVMSSDALKAFSDALLQKNDFEPLEMKEIDLGEPYLEGLEVERKKPSLCSNSNM--GPS  267

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK  663
             L+LAGLHACGDLSVTMLRTF+EC E+KAV+S+GCCYNLLSEE +    S CGFP+S+  K
Sbjct  268   LVLAGLHACGDLSVTMLRTFIECKEIKAVVSIGCCYNLLSEEGSQNSGSQCGFPVSEGAK  327

Query  664   AVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAI  843
               GL LGKSARDLACQSA+RWR L + A L NFELHAFRA FQM+L RYY E+L  SP+I
Sbjct  328   LSGLSLGKSARDLACQSAERWRSLTKDAALQNFELHAFRAAFQMVLNRYYPEILTTSPSI  387

Query  844   GRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVT  1023
             GRQGK LRRQ  +R L++NL   D   +    ++ ++ E E  C+ S+      G    T
Sbjct  388   GRQGKALRRQQQRRVLQNNLHV-DKRTSLPLVATWEKCEMERSCTTSNYSEAYQGDTCST  446

Query  1024  CDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGI--NESQEIDYSGIWKET  1197
              D   L  +ISS+ S   E   ++D +SLF KFC+SGL RLG+  N SQEID+ G+WKE 
Sbjct  447   LDRGGLSLQISSSYSSGCEGIWSLDRYSLFEKFCNSGLCRLGLLTNISQEIDFLGLWKEA  506

Query  1198  QPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAII  1377
             QPF E+IGPYWSLRA LGPVLET++LLDRLLFLQE    V+A  +PIF+P+LSPRN+AII
Sbjct  507   QPFCELIGPYWSLRAVLGPVLETLLLLDRLLFLQEQGSSVKAVALPIFNPILSPRNVAII  566

Query  1378  GRKI  1389
              +KI
Sbjct  567   AQKI  570



>gb|KHG07111.1| Protein RRNAD1 [Gossypium arboreum]
 gb|KHG07112.1| Protein RRNAD1 [Gossypium arboreum]
Length=566

 Score =   407 bits (1046),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 221/418 (53%), Positives = 287/418 (69%), Gaps = 20/418 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FE+ LS++AIDA SHHG +T+ARAERI+KHY A++RK  S ++ L+VP+T+T
Sbjct  155   GYLAQVLAFEHQLSVVAIDACSHHGKVTNARAERIKKHYMAQMRKFGSGNQRLNVPQTIT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGES-SIGQAQEHSEDRLTPHSYMVGDSSLILA  495
             C ++S ETLK+L+  S  K DV +   I +   +G A                 SSL+LA
Sbjct  215   CNIMSLETLKSLTTMSSHKGDVEQPKPIEQDLELGLAGR--------------GSSLVLA  260

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTML+T LEC EV+AVIS+GCCYNLL+EE         GFP+S  VK+V L
Sbjct  261   GLHACGDLSVTMLKTLLECEEVRAVISIGCCYNLLTEEGFTNAQIQYGFPMSCGVKSVNL  320

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGKS+RDLACQSA+RW+ LG+ AGLHNFELHAFRA FQM+L +Y+ EV   SP+IGRQG
Sbjct  321   SLGKSSRDLACQSAERWKSLGKDAGLHNFELHAFRAAFQMVLHKYFPEVGT-SPSIGRQG  379

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGND-GKKGVTCDD  1032
             K LRR+  ++ +ES LQ ++   ++     Q     +  CS++  G        G+  D 
Sbjct  380   KALRRKQQRKIIESELQAEE---STYSDLPQMACNMDEACSVTHSGESEAVNTSGIRSDV  436

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
             DALF K+S       E T + D +SLF KFC SGL RLG+  S  I++ GIWK  +P+  
Sbjct  437   DALFTKMSLHTGSTCERTTSTDKYSLFEKFCQSGLCRLGLKPSDNINFHGIWKGVEPYVS  496

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             +IG YWSLRAA GP+LET+ILLDRLLFLQE  D +E+ ++PIFDP +SPRN+ II +K
Sbjct  497   LIGIYWSLRAAFGPLLETLILLDRLLFLQEQGDVLESVMLPIFDPAISPRNVTIIAKK  554



>emb|CDY35109.1| BnaA06g11190D [Brassica napus]
Length=504

 Score =   405 bits (1040),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 269/417 (65%), Gaps = 66/417 (16%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHGN+TDARA RIRKH+A+++RKS S ++    P T+T
Sbjct  154   GYLAQVLSFQYKHSVIAIDSSSHHGNVTDARAARIRKHFASQMRKSGSGNKCPDAPTTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LK+L+N  LE+ D+     +   ++ +  + S              SL+LAG
Sbjct  214   CRVLSTEMLKSLTNVPLEENDLD----LDAGALNEGPKRS-------------CSLVLAG  256

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+ +    S CGFP+S  +K++G  
Sbjct  257   LHACGDLSVTMLRTFIECEEVKAVVSIGCCYNLLSEKTSEDSCSKCGFPMSAGLKSLGFS  316

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  317   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  376

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+  + +   K+                                 D  +
Sbjct  377   AFRRQKQRKALETPSKLETSRKD--------------------------------IDKKS  404

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H  SS                 F KFC S  +RL +   Q++D +  W E   FTE+I
Sbjct  405   TTHTSSS-----------------FEKFCLSAFSRLNLEHPQDLDLTATWNEANAFTELI  447

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  D +E +++PIFDP LSPRN+AII +++
Sbjct  448   GPYWSIRAALGPVLETLILLDRLMFLQEQGDSLEVSMLPIFDPTLSPRNVAIIAKRL  504



>ref|XP_010497984.1| PREDICTED: methyltransferase-like protein 25 [Camelina sativa]
Length=513

 Score =   405 bits (1040),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 208/417 (50%), Positives = 270/417 (65%), Gaps = 57/417 (14%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG +TDARA RIRKH+AA++RKS S ++   VP T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIRKHFAAQMRKSGSGNKCPDVPMTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LKAL++  LEK D+       +S+ G  +  S +            SL+LAG
Sbjct  214   CRVLSTEMLKALTDVPLEKNDL-------DSNEGPRKSQSPNDAN------RSCSLVLAG  260

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDL VTMLRTF+EC EVKAV+S+GCCYNLLSE+++    S CGFP+S  +K +   
Sbjct  261   LHACGDLPVTMLRTFMECEEVKAVVSIGCCYNLLSEKSSENSCSKCGFPMSAGLKFLNFS  320

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  321   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSQHYPEVLATSPSIGRQGK  380

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+                   + D TR    D                 
Sbjct  381   AFRRQQQRKALET-----------------PATVDNTRKDTDD-----------------  406

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                      S++  ++N+  SF    KFC S  +RL +   Q++D +  W E   FTE+I
Sbjct  407   -------KNSMRQTSSNSCSSFE---KFCLSAFSRLNLEHPQDLDLNATWNEADAFTELI  456

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAA GPVLET+ILLDRL+FLQE  D ++  ++PIFDP +SPRN+AII R++
Sbjct  457   GPYWSIRAAFGPVLETLILLDRLMFLQEQGDSIKVMMLPIFDPNISPRNVAIIARRL  513



>ref|XP_009149102.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Brassica 
rapa]
Length=504

 Score =   404 bits (1038),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 269/417 (65%), Gaps = 66/417 (16%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHGN+TDARA RIRKH+A+++RKS S ++    P T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGNVTDARAARIRKHFASQMRKSGSGNKCPDAPTTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LK+L+N  LE+ D+     +  +++ +  + S              SL+LAG
Sbjct  214   CRVLSTEMLKSLTNVPLEENDLD----LDAAALNEGPKRS-------------CSLVLAG  256

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+ +      CGFP+S  +K++G  
Sbjct  257   LHACGDLSVTMLRTFMECEEVKAVVSIGCCYNLLSEKTSESSCYKCGFPMSAGLKSLGFS  316

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  317   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  376

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+  + +   K+                                 D  +
Sbjct  377   AFRRQKQRKALETPSKLETSRKD--------------------------------IDKKS  404

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H  SS                 F KFC S  +RL +   Q++D +  W E   FTE+I
Sbjct  405   TTHTSSS-----------------FEKFCLSAFSRLNLEHPQDLDLTATWNEANAFTELI  447

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  D +E +++PIFDP LSPRN+AII +++
Sbjct  448   GPYWSIRAALGPVLETLILLDRLMFLQEQGDSLEVSMLPIFDPTLSPRNVAIIAKRL  504



>ref|XP_008226287.1| PREDICTED: protein RRNAD1 isoform X1 [Prunus mume]
Length=553

 Score =   405 bits (1041),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 290/431 (67%), Gaps = 51/431 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  +++AIDA SHHG +TD RAE+I+K+YAA++RKS S +R L+VPKTVT
Sbjct  157   GYLAQVLSFHYQHAVVAIDACSHHGRVTDTRAEQIKKYYAAQMRKSVSGNRSLTVPKTVT  216

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S + LKAL++  L   +V         S+ Q+  ++++R          SSL+LAG
Sbjct  217   CNVMSIDMLKALADTPLHNDNV---------SLLQSSCNADNR----------SSLVLAG  257

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSEE      S CGFP+S  VK+ G+ 
Sbjct  258   LHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEEGFNHAGSQCGFPMSCGVKSAGIS  317

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RW+ L   AGLHNFELHAFRA FQM+L  YY EV+  SP+IGRQGK
Sbjct  318   LGKSSRDLACQSAERWKCLENDAGLHNFELHAFRAAFQMVLRVYYPEVMSTSPSIGRQGK  377

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG----KKGVTC  1026
              LRR+  QR ++++L                    E +CS+S++     G    KK    
Sbjct  378   ALRRR-QQRVVQNSL----------------LHHKENKCSLSEINSHMTGSCSHKKSTEL  420

Query  1027  DDDALFHKISSTRSVKNENTN----------AVDSFSLFMKFCDSGLARLGINESQEIDY  1176
             + D  F  + +T S+ NEN++           + ++ LF K+C SGL RLG+   +E D 
Sbjct  421   ETDDSFDVLETT-SITNENSSNKATKCERSEIIGNYPLFQKYCLSGLCRLGLEPLKETDI  479

Query  1177  SGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLS  1356
              GIWK+ + F E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA ++PIF+P LS
Sbjct  480   HGIWKQVESFAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAVMLPIFNPALS  539

Query  1357  PRNMAIIGRKI  1389
             PRN+AII +K+
Sbjct  540   PRNVAIIAKKL  550



>ref|NP_173110.2| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 gb|ACE62893.1| At1g16650 [Arabidopsis thaliana]
 gb|AEE29480.1| uncharacterized protein AT1G16650 [Arabidopsis thaliana]
Length=521

 Score =   404 bits (1037),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 273/417 (65%), Gaps = 49/417 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHG +TDARA RI+KH+AA++RKS S ++   VP T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIKKHFAAQMRKSGSGNKCPDVPMTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LKAL++  LEK +        +SS     E  + R    S      SL+LAG
Sbjct  214   CRVLSTEMLKALTDVHLEKDET-------DSSGSALNEEGQSRSQSSSDANRSCSLVLAG  266

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKA++S+GCCYNLLSE+++    S CG+P+S  ++++G  
Sbjct  267   LHACGDLSVTMLRTFMECEEVKALVSIGCCYNLLSEKSSEDSCSKCGYPMSAGLRSLGFS  326

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  327   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  386

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  +++LE+                   + D TR    D                 
Sbjct  387   AFRRQQQRKSLET-----------------PAAVDTTRKDTVD-----------------  412

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
                     + ++  + N+ D  S F KFC S  +RL +   +++D +  W E   FTE+I
Sbjct  413   -------KKPMRQTSLNS-DMCSSFEKFCLSAFSRLNLEHPRDLDLNATWNEADAFTELI  464

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWS+RAALGPVLET+ILLDRL+FLQE  D ++  ++PIFDP +SPRN+AII R++
Sbjct  465   GPYWSIRAALGPVLETLILLDRLMFLQEQGDSIKVVMLPIFDPTISPRNVAIIARRL  521



>gb|AES66222.2| methyltransferase-like protein [Medicago truncatula]
Length=565

 Score =   404 bits (1039),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 217/424 (51%), Positives = 287/424 (68%), Gaps = 28/424 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+KHY +K+ KS S  + L+VPKT+T
Sbjct  156   GYLAQVLAFQYQHPVIAIDACSHHGMVTDARAERIKKHYTSKMVKSGSGMQNLNVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E+LK L   S+   D  +  L GE+      +  + +L   +      S +LAG
Sbjct  216   CRVLSIESLKTLVETSVPSDDHEQSTLRGEN------QEDKGKLDCPNDANNRPSTVLAG  269

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV ML+TFL C +V+AV+S+GCCYNLLSEE+ G  +S CGFP+S +V++ GL 
Sbjct  270   LHACGDLSVIMLKTFLGCRDVEAVVSIGCCYNLLSEESIGDGESQCGFPMSHAVRSTGLS  329

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY EV + +P+IGR+GK
Sbjct  330   LGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEVAISTPSIGRKGK  389

Query  859   TLRRQHHQRALESNLQ-------CQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKG  1017
              LRR++ +R+ ES+ +       C       +G  ++ ++E               G  G
Sbjct  390   ALRRRNQRRSAESDSKLHLKGSTCNTRQNFPAGVPAESKAE---------------GTFG  434

Query  1018  VTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKET  1197
                +   L  +ISS  S + E     + FS F  FC SGL+ LG+  S ++   G WKE 
Sbjct  435   SASETQTLSGEISSNESAEYEGIKIDNKFSNFENFCQSGLSHLGLKHSHDVSLQGTWKEV  494

Query  1198  QPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAII  1377
             +PF+++IGPYWSLRAALGP+LET+ILLDRLLFLQE  + +EA L+PIFDP +SPRN+AII
Sbjct  495   EPFSDLIGPYWSLRAALGPLLETLILLDRLLFLQEQGNALEAYLLPIFDPNISPRNVAII  554

Query  1378  GRKI  1389
              +KI
Sbjct  555   AKKI  558



>ref|XP_008372833.1| PREDICTED: protein RRNAD1 [Malus domestica]
 ref|XP_008372834.1| PREDICTED: protein RRNAD1 [Malus domestica]
 ref|XP_008372835.1| PREDICTED: protein RRNAD1 [Malus domestica]
 ref|XP_008372836.1| PREDICTED: protein RRNAD1 [Malus domestica]
Length=554

 Score =   403 bits (1035),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 288/430 (67%), Gaps = 48/430 (11%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  ++ AIDA SHHG +TDARAE+I+K+YA++IRKS SE+R L+VPKT+T
Sbjct  156   GYLAQVLSFHYQHAVFAIDACSHHGRVTDARAEQIKKYYASQIRKSVSENRSLTVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDS--SLIL  492
             C V+S +TLKAL++  L+  +V        SS+  + +             GDS  SL+L
Sbjct  216   CNVMSIDTLKALADIPLDXDNV--------SSLQTSCK-------------GDSGTSLVL  254

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSEE +    S CGFP+S  VK+ G
Sbjct  255   AGLHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEEGSNHVGSQCGFPMSHGVKSAG  314

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKS+RDLACQSA+RWR L   AG+HNFELHAFRA FQM+L  YY +V+  SP+IGRQ
Sbjct  315   LSLGKSSRDLACQSAERWRCLENDAGVHNFELHAFRAAFQMVLSVYYPKVMTTSPSIGRQ  374

Query  853   GKTLRRQHHQRALESNLQCQD--CPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTC  1026
             GK LRR+  + A +S+L  ++  C   S   SS K S    + ++ +             
Sbjct  375   GKALRRRQQRVAPDSSLHHKESTCSSLSQINSSMKGSWPHIKPTVQEA------------  422

Query  1027  DDDALFHKISSTRSVKNEN---------TNAVDSFSLFMKFCDSGLARLGINESQEIDYS  1179
               D  F  +  T ++ NEN         +  +  + LF K+C SGL+RLG+   +E+D  
Sbjct  423   --DGSFDTVLETXTITNENSFKATQCGRSKFIGKYPLFQKYCLSGLSRLGLEPLKEMDVH  480

Query  1180  GIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSP  1359
             GIWKE +   E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA + PIF+P LSP
Sbjct  481   GIWKEVESSAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAEMQPIFNPALSP  540

Query  1360  RNMAIIGRKI  1389
             RN+AII +K+
Sbjct  541   RNVAIIAKKL  550



>ref|XP_010258676.1| PREDICTED: protein RRNAD1 isoform X1 [Nelumbo nucifera]
Length=580

 Score =   404 bits (1037),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 242/434 (56%), Positives = 303/434 (70%), Gaps = 25/434 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y LS++AIDASSHHG +T ARAERI+KHYAAK + +      L+VP+TVT
Sbjct  155   GYLAQVLSFQYNLSVVAIDASSHHGAVTSARAERIKKHYAAKTKNAH-----LNVPQTVT  209

Query  319   CRVLSPETLKALSNGSLEKYDVG----KQYLIGESSI-GQAQEHSEDRLTPHSYMVGDSS  483
             C V+S + LKA S+  L+K D      K+  +GE  + G   E  +  L  +S M    S
Sbjct  210   CCVMSSDALKAFSDALLQKNDFEPLEMKEIDLGEPYLEGLEVERKKPSLCSNSNM--GPS  267

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK  663
             L+LAGLHACGDLSVTMLRTF+EC E+KAV+S+GCCYNLLSEE +    S CGFP+S+  K
Sbjct  268   LVLAGLHACGDLSVTMLRTFIECKEIKAVVSIGCCYNLLSEEGSQNSGSQCGFPVSEGAK  327

Query  664   AVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAI  843
               GL LGKSARDLACQSA+RWR L + A L NFELHAFRA FQM+L RYY E+L  SP+I
Sbjct  328   LSGLSLGKSARDLACQSAERWRSLTKDAALQNFELHAFRAAFQMVLNRYYPEILTTSPSI  387

Query  844   GRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG-----  1008
             GRQGK LRRQ  +R L++NL   D   +    ++ ++ E E  C+ S+      G     
Sbjct  388   GRQGKALRRQQQRRVLQNNLHV-DKRTSLPLVATWEKCEMERSCTTSNYSEAYQGHTSEV  446

Query  1009  --KKGVTC---DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGI--NESQE  1167
               ++G TC   D   L  +ISS+ S   E   ++D +SLF KFC+SGL RLG+  N SQE
Sbjct  447   VLREGDTCSTLDRGGLSLQISSSYSSGCEGIWSLDRYSLFEKFCNSGLCRLGLLTNISQE  506

Query  1168  IDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDP  1347
             ID+ G+WKE QPF E+IGPYWSLRA LGPVLET++LLDRLLFLQE    V+A  +PIF+P
Sbjct  507   IDFLGLWKEAQPFCELIGPYWSLRAVLGPVLETLLLLDRLLFLQEQGSSVKAVALPIFNP  566

Query  1348  VLSPRNMAIIGRKI  1389
             +LSPRN+AII +KI
Sbjct  567   ILSPRNVAIIAQKI  580



>ref|XP_004294193.1| PREDICTED: methyltransferase-like protein 25-like [Fragaria vesca 
subsp. vesca]
Length=548

 Score =   402 bits (1034),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 223/425 (52%), Positives = 289/425 (68%), Gaps = 39/425 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  S++AIDA SHHG +T+ARAE+I+KHYAA++RKS + +R L VPKT+T
Sbjct  153   GYLAQVLSFHYQHSVIAIDACSHHGRVTNARAEQIKKHYAAQMRKSVAGNRNLDVPKTIT  212

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S + LKAL++ SL K +         +S+ QA  H++          G++SL+LAG
Sbjct  213   CNVMSIDMLKALADISLHKDN---------ASLLQASCHAD----------GETSLVLAG  253

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF EC EVKAV+SVGCCYNLLSEE      S CGFP+S+ VK+  L 
Sbjct  254   LHACGDLSVTMLKTFTECEEVKAVVSVGCCYNLLSEEGFNHVGSQCGFPMSRGVKSADLS  313

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RW  L   AGLHNFELH FRA FQM+L RYY EV++ SP+IGRQGK
Sbjct  314   LGKSSRDLACQSAERWGCLENDAGLHNFELHTFRAAFQMVLSRYYPEVVITSPSIGRQGK  373

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ  +  ++S++       N   G+    S  +  C M   G G+  K      DD+
Sbjct  374   ALRRQQSRGTIDSSM-------NQKEGTCS--SLPQLPCDMK--GSGSHLKTTKIETDDS  422

Query  1039  LFHKI---------SSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWK  1191
                ++         SS+++ K   T  +  ++LF K+C SGL RLG+   +E D  GIWK
Sbjct  423   FEMELETTTKGSGHSSSKATKYMGTPLISKYTLFEKYCLSGLCRLGLEPLKETDLHGIWK  482

Query  1192  ETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMA  1371
             E QPF E++GPYW+LRAA GP+LET++LLDRLLFLQE    ++  ++PIFDP LSPRN+A
Sbjct  483   EVQPFAELVGPYWTLRAAFGPLLETLLLLDRLLFLQEQGSSIDVVMLPIFDPALSPRNVA  542

Query  1372  IIGRK  1386
             II +K
Sbjct  543   IIAKK  547



>ref|XP_010906764.1| PREDICTED: protein RRNAD1 isoform X2 [Elaeis guineensis]
Length=550

 Score =   402 bits (1032),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 213/429 (50%), Positives = 277/429 (65%), Gaps = 17/429 (4%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY LS+ AIDAS HH  +T+ARAE I+KHYAAKI +S+     L VP+TVT
Sbjct  118   GYLAQALSFEYQLSVTAIDASMHHATVTNARAETIKKHYAAKIAQSQ----HLKVPRTVT  173

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSS----L  486
             C VLS + L ALS  SL + +V +    G S      E+S+  +   SY+  + +    L
Sbjct  174   CHVLSSDILTALSTVSLHEDNVEQSTDTGNSLENAVLENSKSHIGQASYLYNNRNIRLPL  233

Query  487   ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             +LAGLHACGDLSV MLRTF++C +V A++ VGCCYNLLSE+ A K  + CGFP+S + K 
Sbjct  234   VLAGLHACGDLSVNMLRTFVDCKQVIALVGVGCCYNLLSEDQAEKTHTSCGFPMSNAAKL  293

Query  667   VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
               L LGK+ARDLACQSA+RWR L +   L NF++HAFRA FQM+L +Y+ +VL  SP+IG
Sbjct  294   SRLTLGKNARDLACQSAERWRSLTKDYALQNFDVHAFRAAFQMVLDKYFPDVLRSSPSIG  353

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMS------DLGC-GND  1005
             R+GK LRRQ  +  +ES L  + C       S Q+        +M       D GC  N 
Sbjct  354   RKGKALRRQRMRNIIESKLGAKGCATVPFFTSKQQCKSAACSLTMKNDELEVDDGCYSNM  413

Query  1006  GKKGVTCDDDALFHKISSTRSVKNENT--NAVDSFSLFMKFCDSGLARLGINESQEIDYS  1179
               +G  C       + SS+  ++   T     D++  F +F  SGL+RLG   S++I+  
Sbjct  414   TLRGDACTTSEELPQSSSSSDIRCLETPVEKTDNYLAFKEFSMSGLSRLGCGPSEDINLL  473

Query  1180  GIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSP  1359
              IWKE QPFTE +GP+WSLRAALGP++ET ILLDRLLFLQE  + VEA L P+FDP +SP
Sbjct  474   EIWKEAQPFTEFVGPFWSLRAALGPLVETYILLDRLLFLQEQGNSVEALLFPLFDPTISP  533

Query  1360  RNMAIIGRK  1386
             RN+ I+ RK
Sbjct  534   RNVVIVARK  542



>ref|XP_010906736.1| PREDICTED: protein RRNAD1 isoform X1 [Elaeis guineensis]
 ref|XP_010906744.1| PREDICTED: protein RRNAD1 isoform X1 [Elaeis guineensis]
 ref|XP_010906751.1| PREDICTED: protein RRNAD1 isoform X1 [Elaeis guineensis]
 ref|XP_010906756.1| PREDICTED: protein RRNAD1 isoform X1 [Elaeis guineensis]
Length=588

 Score =   402 bits (1033),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 213/429 (50%), Positives = 277/429 (65%), Gaps = 17/429 (4%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY LS+ AIDAS HH  +T+ARAE I+KHYAAKI +S+     L VP+TVT
Sbjct  156   GYLAQALSFEYQLSVTAIDASMHHATVTNARAETIKKHYAAKIAQSQ----HLKVPRTVT  211

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSS----L  486
             C VLS + L ALS  SL + +V +    G S      E+S+  +   SY+  + +    L
Sbjct  212   CHVLSSDILTALSTVSLHEDNVEQSTDTGNSLENAVLENSKSHIGQASYLYNNRNIRLPL  271

Query  487   ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             +LAGLHACGDLSV MLRTF++C +V A++ VGCCYNLLSE+ A K  + CGFP+S + K 
Sbjct  272   VLAGLHACGDLSVNMLRTFVDCKQVIALVGVGCCYNLLSEDQAEKTHTSCGFPMSNAAKL  331

Query  667   VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
               L LGK+ARDLACQSA+RWR L +   L NF++HAFRA FQM+L +Y+ +VL  SP+IG
Sbjct  332   SRLTLGKNARDLACQSAERWRSLTKDYALQNFDVHAFRAAFQMVLDKYFPDVLRSSPSIG  391

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMS------DLGC-GND  1005
             R+GK LRRQ  +  +ES L  + C       S Q+        +M       D GC  N 
Sbjct  392   RKGKALRRQRMRNIIESKLGAKGCATVPFFTSKQQCKSAACSLTMKNDELEVDDGCYSNM  451

Query  1006  GKKGVTCDDDALFHKISSTRSVKNENT--NAVDSFSLFMKFCDSGLARLGINESQEIDYS  1179
               +G  C       + SS+  ++   T     D++  F +F  SGL+RLG   S++I+  
Sbjct  452   TLRGDACTTSEELPQSSSSSDIRCLETPVEKTDNYLAFKEFSMSGLSRLGCGPSEDINLL  511

Query  1180  GIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSP  1359
              IWKE QPFTE +GP+WSLRAALGP++ET ILLDRLLFLQE  + VEA L P+FDP +SP
Sbjct  512   EIWKEAQPFTEFVGPFWSLRAALGPLVETYILLDRLLFLQEQGNSVEALLFPLFDPTISP  571

Query  1360  RNMAIIGRK  1386
             RN+ I+ RK
Sbjct  572   RNVVIVARK  580



>ref|XP_009627585.1| PREDICTED: protein RRNAD1 isoform X4 [Nicotiana tomentosiformis]
Length=483

 Score =   399 bits (1024),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 207/360 (58%), Positives = 258/360 (72%), Gaps = 31/360 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FEY LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154   GYLAQVLAFEYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLK LSN   E  D   Q+L  + S  Q    +E+ L   SY   DSSL++AG
Sbjct  214   CRVLSSDTLKTLSNFLEENDDAANQHLSQKCSGSQLSRLAENILPSLSY--SDSSLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ HQR LESNL  +        G S+                  + +K V     A
Sbjct  392   ALRRQQHQRILESNLHYR--------GPSEY----------------GEPRKNV-----A  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
              FH+ SS ++ K+  ++ VD +SLF+KFC+SGL RL +   ++IDYS +W+E++ + +++
Sbjct  423   FFHEYSSIQNSKSRESSTVDRYSLFVKFCESGLGRLHLPCLEDIDYSAVWRESESYADIV  482



>ref|XP_009361752.1| PREDICTED: protein RRNAD1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361753.1| PREDICTED: protein RRNAD1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361754.1| PREDICTED: protein RRNAD1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361755.1| PREDICTED: protein RRNAD1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361756.1| PREDICTED: protein RRNAD1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361757.1| PREDICTED: protein RRNAD1-like isoform X1 [Pyrus x bretschneideri]
Length=555

 Score =   401 bits (1030),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 220/426 (52%), Positives = 285/426 (67%), Gaps = 41/426 (10%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  ++ AIDA SHHG +TDARAE+I+K+YA++IRKS SE+R L+VPKT+T
Sbjct  156   GYLAQVLSFHYQHAVFAIDACSHHGRVTDARAEQIKKYYASQIRKSVSENRSLTVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S +TLKAL++  L+K +V     +  S  G +                 SSL+LAG
Sbjct  216   CNVMSIDTLKALADIPLDKDNVSS---LQTSCKGDS----------------GSSLVLAG  256

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSEE +    S CGFP+S  VK+ GL 
Sbjct  257   LHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEEGSKHVGSQCGFPMSHGVKSAGLS  316

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L   AG+HNFELHAFRA FQM+L  YY +V+  SP+IGRQGK
Sbjct  317   LGKSSRDLACQSAERWRCLENDAGVHNFELHAFRAAFQMVLSVYYPKVMTTSPSIGRQGK  376

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRR+  +   +S+L  ++     S  SS  +   + + S S +       K    + D 
Sbjct  377   ALRRRQQRVTPDSSLHHKE-----STISSLSQINSDMKGSWSHI-------KPTVQEADG  424

Query  1039  LFHKISSTRSVKNEN----------TNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              F  +  T ++ NEN          +  +  + LF K+C SGL+RLG+   +E+D  GIW
Sbjct  425   SFDTVLETTTITNENSFNKATQCGKSKFIGKYPLFQKYCLSGLSRLGLEPLKEMDVHGIW  484

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             K+ +   E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA + PIF+P LSPRN+
Sbjct  485   KDVESSAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAEMQPIFNPALSPRNV  544

Query  1369  AIIGRK  1386
             AII +K
Sbjct  545   AIIAKK  550



>ref|XP_003595971.1| hypothetical protein MTR_2g064450 [Medicago truncatula]
Length=589

 Score =   402 bits (1032),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 280/417 (67%), Gaps = 33/417 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y   ++AIDA SHHG +TDARAERI+KHY +K+ KS S  + L+VPKT+T
Sbjct  199   GYLAQVLAFQYQHPVIAIDACSHHGMVTDARAERIKKHYTSKMVKSGSGMQNLNVPKTIT  258

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E+LK L   S+   D  +  L GE+      +  + +L   +      S +LAG
Sbjct  259   CRVLSIESLKTLVETSVPSDDHEQSTLRGEN------QEDKGKLDCPNDANNRPSTVLAG  312

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV ML+TFL C +V+AV+S+GCCYNLLSEE+ G  +S CGFP+S +V++ GL 
Sbjct  313   LHACGDLSVIMLKTFLGCRDVEAVVSIGCCYNLLSEESIGDGESQCGFPMSHAVRSTGLS  372

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKSARDLACQSA+RWR L   AG+HNFELHAFRA FQM+L +YY EV + +P+IGR+GK
Sbjct  373   LGKSARDLACQSAERWRSLDMHAGIHNFELHAFRAAFQMVLSKYYPEVAISTPSIGRKGK  432

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRR++ +R+ ES+                           S L     G  G   +   
Sbjct  433   ALRRRNQRRSAESD---------------------------SKLHLKGKGTFGSASETQT  465

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
             L  +ISS  S + E     + FS F  FC SGL+ LG+  S ++   G WKE +PF+++I
Sbjct  466   LSGEISSNESAEYEGIKIDNKFSNFENFCQSGLSHLGLKHSHDVSLQGTWKEVEPFSDLI  525

Query  1219  GPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             GPYWSLRAALGP+LET+ILLDRLLFLQE  + +EA L+PIFDP +SPRN+AII +KI
Sbjct  526   GPYWSLRAALGPLLETLILLDRLLFLQEQGNALEAYLLPIFDPNISPRNVAIIAKKI  582



>ref|XP_009627582.1| PREDICTED: protein RRNAD1 isoform X2 [Nicotiana tomentosiformis]
Length=512

 Score =   398 bits (1022),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 216/394 (55%), Positives = 271/394 (69%), Gaps = 37/394 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FEY LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154   GYLAQVLAFEYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLK LSN   E  D   Q+L  + S  Q    +E+ L   SY   DSSL++AG
Sbjct  214   CRVLSSDTLKTLSNFLEENDDAANQHLSQKCSGSQLSRLAENILPSLSY--SDSSLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ HQR LESNL  +        G S+                  + +K V     A
Sbjct  392   ALRRQQHQRILESNLHYR--------GPSEY----------------GEPRKNV-----A  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
              FH+ SS ++ K+  ++ VD +SLF+KFC+SGL RL +   ++IDYS +W+E++ +   I
Sbjct  423   FFHEYSSIQNSKSRESSTVDRYSLFVKFCESGLGRLHLPCLEDIDYSAVWRESESYA--I  480

Query  1219  GPYWSLRAA-LGPVLETIILLDRLLFLQESSDWV  1317
             G +  L    +G ++ TI     L+   E  +W+
Sbjct  481   GEHAYLFCTFIGHIINTI---HYLILSLEDHNWM  511



>ref|XP_009627583.1| PREDICTED: protein RRNAD1 isoform X3 [Nicotiana tomentosiformis]
Length=502

 Score =   397 bits (1019),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 266/381 (70%), Gaps = 34/381 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FEY LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154   GYLAQVLAFEYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLK LSN   E  D   Q+L  + S  Q    +E+ L   SY   DSSL++AG
Sbjct  214   CRVLSSDTLKTLSNFLEENDDAANQHLSQKCSGSQLSRLAENILPSLSY--SDSSLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ HQR LESNL  +        G S+                  + +K V     A
Sbjct  392   ALRRQQHQRILESNLHYR--------GPSEY----------------GEPRKNV-----A  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
              FH+ SS ++ K+  ++ VD +SLF+KFC+SGL RL +   ++IDYS +W+E++ +   I
Sbjct  423   FFHEYSSIQNSKSRESSTVDRYSLFVKFCESGLGRLHLPCLEDIDYSAVWRESESYA--I  480

Query  1219  GPYWSLRAA-LGPVLETIILL  1278
             G +  L    +G ++ TI  L
Sbjct  481   GEHAYLFCTFIGHIINTIHYL  501



>ref|XP_009627586.1| PREDICTED: protein RRNAD1 isoform X5 [Nicotiana tomentosiformis]
Length=479

 Score =   395 bits (1016),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/357 (58%), Positives = 255/357 (71%), Gaps = 31/357 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FEY LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154   GYLAQVLAFEYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS +TLK LSN   E  D   Q+L  + S  Q    +E+ L   SY   DSSL++AG
Sbjct  214   CRVLSSDTLKTLSNFLEENDDAANQHLSQKCSGSQLSRLAENILPSLSY--SDSSLVIAG  271

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272   LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332   LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRRQ HQR LESNL  +        G S+                  + +K V     A
Sbjct  392   ALRRQQHQRILESNLHYR--------GPSEY----------------GEPRKNV-----A  422

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
              FH+ SS ++ K+  ++ VD +SLF+KFC+SGL RL +   ++IDYS +W+E++ + 
Sbjct  423   FFHEYSSIQNSKSRESSTVDRYSLFVKFCESGLGRLHLPCLEDIDYSAVWRESESYA  479



>ref|XP_009336670.1| PREDICTED: protein RRNAD1-like [Pyrus x bretschneideri]
 ref|XP_009336672.1| PREDICTED: protein RRNAD1-like [Pyrus x bretschneideri]
 ref|XP_009336673.1| PREDICTED: protein RRNAD1-like [Pyrus x bretschneideri]
 ref|XP_009336674.1| PREDICTED: protein RRNAD1-like [Pyrus x bretschneideri]
Length=555

 Score =   397 bits (1019),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 220/428 (51%), Positives = 287/428 (67%), Gaps = 45/428 (11%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  ++ AIDA SHHG +TDARAE+I+K+YA++IRKS S +R L+VPKT+T
Sbjct  156   GYLAQVLSFHYQHAVFAIDACSHHGRVTDARAEQIKKYYASQIRKSVSGNRSLTVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDS--SLIL  492
             C V+S +TLKAL++  L+K +V        SS+  + +             GDS  SL+L
Sbjct  216   CNVMSIDTLKALADIPLDKDNV--------SSLQTSCK-------------GDSGTSLVL  254

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSE+ +    S CGFP+S  VK+ G
Sbjct  255   AGLHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEDGSNHVGSQCGFPMSHGVKSAG  314

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKS+RDLACQSA+RWR L   AG+HNFELHAFRA FQM+L  YY +V+  SP+IGRQ
Sbjct  315   LSLGKSSRDLACQSAERWRCLENDAGVHNFELHAFRAAFQMVLSVYYPKVMTTSPSIGRQ  374

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             GK LRR+  +   +S+L  ++     S  SS  +   + + S S +       K    + 
Sbjct  375   GKALRRRQQRVTPDSSLHHKE-----STFSSLSQINSDMKGSWSHI-------KPTVQEA  422

Query  1033  DALFHKISSTRSVKNEN----------TNAVDSFSLFMKFCDSGLARLGINESQEIDYSG  1182
             D  F  +  T ++ NEN          +  +  + LF K+C SGL+RLG+   +E+D  G
Sbjct  423   DGSFDTVLETTTITNENSFNKATQCGKSKFIGKYPLFQKYCLSGLSRLGLEPLKEMDVHG  482

Query  1183  IWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPR  1362
             IWK+ +   E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA + PIF+P LSPR
Sbjct  483   IWKDVESSAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAEMQPIFNPALSPR  542

Query  1363  NMAIIGRK  1386
             N+AII +K
Sbjct  543   NVAIIAKK  550



>ref|XP_008444280.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Cucumis 
melo]
Length=543

 Score =   396 bits (1017),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 222/420 (53%), Positives = 268/420 (64%), Gaps = 45/420 (11%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS---ESEDRELSVPK  309
             GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+     E   L +PK
Sbjct  163   GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGFYRLEAENLRLPK  222

Query  310   TVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
              +T  VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+
Sbjct  223   AMTFHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLV  280

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLRTF+EC EVKAVI++GCCYNLL+E  +       GFP+S  VK+ 
Sbjct  281   LAGLHACGDLSVIMLRTFVECKEVKAVINIGCCYNLLTEYGSNNKGIQNGFPMSFGVKSS  340

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              L LGKS RDLACQSA+RWR L +  GLHNFELHAFRA FQM+L +YY +V+   P+IGR
Sbjct  341   SLSLGKSGRDLACQSAERWRNLEKEGGLHNFELHAFRAAFQMVLYKYYPDVVATCPSIGR  400

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ                K   G  S +  ED+   S SD G            
Sbjct  401   QGKALRRQ----------------KKREGSVSSQCREDKLEASQSDHG------------  432

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
                         S   E + +VD + LF KFC SGL RLG+  SQ+ D  GIW +T+PFT
Sbjct  433   ------------STPCEQSKSVDKYPLFEKFCHSGLIRLGLQSSQDTDCYGIWTDTEPFT  480

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E+IGPYWSLRAALGPVLET ILLDRLLFLQE    +EA L+PIFDP LSPRN+AII RK+
Sbjct  481   ELIGPYWSLRAALGPVLETCILLDRLLFLQEQGGSLEAILLPIFDPDLSPRNVAIIARKV  540



>ref|XP_009361759.1| PREDICTED: protein RRNAD1-like isoform X3 [Pyrus x bretschneideri]
Length=549

 Score =   395 bits (1016),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 217/426 (51%), Positives = 282/426 (66%), Gaps = 47/426 (11%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  ++ AIDA SHHG +TDARAE+I+K+YA++IRKS SE+R L+VPKT+T
Sbjct  156   GYLAQVLSFHYQHAVFAIDACSHHGRVTDARAEQIKKYYASQIRKSVSENRSLTVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S +TLKAL++  L+K +V     +  S  G +                 SSL+LAG
Sbjct  216   CNVMSIDTLKALADIPLDKDNVSS---LQTSCKGDS----------------GSSLVLAG  256

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSEE +    S CGFP+S  VK+ GL 
Sbjct  257   LHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEEGSKHVGSQCGFPMSHGVKSAGLS  316

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L   AG+HNFELHAFRA FQM+L  YY +V+  SP+IGRQGK
Sbjct  317   LGKSSRDLACQSAERWRCLENDAGVHNFELHAFRAAFQMVLSVYYPKVMTTSPSIGRQGK  376

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRR+  +   +S+L                  ++ T  S+S +   +D K   +     
Sbjct  377   ALRRRQQRVTPDSSLH----------------HKESTISSLSQI--NSDMKGSWSHIKPT  418

Query  1039  LFHKISSTRSVKNEN----------TNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
             +   +  T ++ NEN          +  +  + LF K+C SGL+RLG+   +E+D  GIW
Sbjct  419   VQEAVLETTTITNENSFNKATQCGKSKFIGKYPLFQKYCLSGLSRLGLEPLKEMDVHGIW  478

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             K+ +   E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA + PIF+P LSPRN+
Sbjct  479   KDVESSAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAEMQPIFNPALSPRNV  538

Query  1369  AIIGRK  1386
             AII +K
Sbjct  539   AIIAKK  544



>ref|XP_009361758.1| PREDICTED: protein RRNAD1-like isoform X2 [Pyrus x bretschneideri]
Length=551

 Score =   390 bits (1003),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 282/426 (66%), Gaps = 45/426 (11%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  ++ AIDA SHHG +TDARAE+I+K+YA++IRKS S    L+VPKT+T
Sbjct  156   GYLAQVLSFHYQHAVFAIDACSHHGRVTDARAEQIKKYYASQIRKSVS----LTVPKTIT  211

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S +TLKAL++  L+K +V     +  S  G +                 SSL+LAG
Sbjct  212   CNVMSIDTLKALADIPLDKDNVSS---LQTSCKGDS----------------GSSLVLAG  252

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TF+EC EVKAV+SVGCCYNLLSEE +    S CGFP+S  VK+ GL 
Sbjct  253   LHACGDLSVTMLKTFMECKEVKAVVSVGCCYNLLSEEGSKHVGSQCGFPMSHGVKSAGLS  312

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L   AG+HNFELHAFRA FQM+L  YY +V+  SP+IGRQGK
Sbjct  313   LGKSSRDLACQSAERWRCLENDAGVHNFELHAFRAAFQMVLSVYYPKVMTTSPSIGRQGK  372

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
              LRR+  +   +S+L  ++     S  SS  +   + + S S +       K    + D 
Sbjct  373   ALRRRQQRVTPDSSLHHKE-----STISSLSQINSDMKGSWSHI-------KPTVQEADG  420

Query  1039  LFHKISSTRSVKNEN----------TNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              F  +  T ++ NEN          +  +  + LF K+C SGL+RLG+   +E+D  GIW
Sbjct  421   SFDTVLETTTITNENSFNKATQCGKSKFIGKYPLFQKYCLSGLSRLGLEPLKEMDVHGIW  480

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             K+ +   E+IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA + PIF+P LSPRN+
Sbjct  481   KDVESSAELIGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAEMQPIFNPALSPRNV  540

Query  1369  AIIGRK  1386
             AII +K
Sbjct  541   AIIAKK  546



>gb|KDP37706.1| hypothetical protein JCGZ_06847 [Jatropha curcas]
Length=544

 Score =   388 bits (997),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 278/423 (66%), Gaps = 41/423 (10%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDA SHHG +T+ RAERI+KHYAA++RK +S +R   +PK +T
Sbjct  155   GYLAQVLSFQYHHSVIAIDACSHHGRVTETRAERIKKHYAAQMRKLDSGNRVPDMPKAIT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSE-DRLTPHSYMVGDSSLILA  495
             CRV+S + LKAL++ SL    V               EH +  R  P       +SL+LA
Sbjct  215   CRVMSIDMLKALTDASLHVDIV---------------EHPKLSRQVPDD----STSLVLA  255

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTMLRTF EC E+KAV+S+GCCYNLLSEE       HCGFP+S  VK+ G+
Sbjct  256   GLHACGDLSVTMLRTFSECKEIKAVVSIGCCYNLLSEECFDVAGPHCGFPMSLGVKSSGI  315

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK++RDLACQSA+RWR L +  GL NFELH FRA FQM+L +YY E++  SP+IGRQG
Sbjct  316   SLGKNSRDLACQSAERWRSLDKDVGLQNFELHTFRAAFQMVLSKYYPEIMKASPSIGRQG  375

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCG------NDGKKG  1017
             K LRRQ  ++ L S L               +  E++   S+S++ C        + K  
Sbjct  376   KALRRQQQRKILHSAL---------------RHGENKLPQSISEMDCNCVSVQPRESKTD  420

Query  1018  VTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKET  1197
              +   ++  + +S    ++ E   + D + LF KF  SGL+RLG+   QEID   IW+E 
Sbjct  421   DSSAAESSINTLSCNGIMRCEGNASADKYLLFEKFSHSGLSRLGLKPLQEIDLHEIWEEV  480

Query  1198  QPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAII  1377
             +PF E IG YWSLRAA GP++ET++LLDRLLFLQE    +EA ++PIFDPVLSPRN+AII
Sbjct  481   EPFAEFIGLYWSLRAAFGPLIETLLLLDRLLFLQEQGSSLEAIMLPIFDPVLSPRNVAII  540

Query  1378  GRK  1386
              ++
Sbjct  541   AKR  543



>ref|XP_009388957.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=441

 Score =   383 bits (984),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 208/425 (49%), Positives = 265/425 (62%), Gaps = 49/425 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSF+Y   ++AIDAS HH N+T+ARAERI+KHYAAK     S    L VP+T+T
Sbjct  56    GYLAQALSFQYQHPVIAIDASLHHANVTNARAERIKKHYAAK----NSASPHLKVPRTIT  111

Query  319   CRVLSPETLKALSNGSL------EKYDVGKQYLIGESSIGQAQEHSEDRL---TPHSYMV  471
             C +LS E L  LS  SL      E    G +   G+S   +        L    PHS   
Sbjct  112   CNILSSEALTDLSITSLCEDNTEESTGRGNKSEFGDSESSKPSVAKAINLYNKQPHS---  168

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
               +  +LAGLHACGDLSV MLR+F+ C  V+A+I +GCCYNLLSE+   K D+ CGFP+S
Sbjct  169   -GAFFVLAGLHACGDLSVNMLRSFVGCEHVRALIGIGCCYNLLSEDCLEKTDNSCGFPIS  227

Query  652   KSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVK  831
              + K   LVLGK+ARDLACQSA+RWR L   A L NF++HAFRA FQ++L +Y+ E+LV 
Sbjct  228   NAAKLSSLVLGKNARDLACQSAERWRILTADAALQNFDVHAFRAAFQLVLDKYFPEILVS  287

Query  832   SPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGK  1011
             SP+IGRQGK LRRQ  +R  ES L C+D                  RCS  ++     GK
Sbjct  288   SPSIGRQGKALRRQQCRRHRESELCCKD-----------------GRCSFFEV----SGK  326

Query  1012  KGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWK  1191
                           S+ +  +  +    +++ LF +FC SGL RLG   S++ID   IWK
Sbjct  327   LSY-----------SNAKGCQEFDVEGSNNYLLFKEFCKSGLTRLGCMFSEDIDLLEIWK  375

Query  1192  ETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMA  1371
             E Q +TE IGP+W+LRAALGP++E+ ILLDRLLFLQE  + VEA L PIFDP LSPRN+A
Sbjct  376   EAQSYTEFIGPFWALRAALGPLVESYILLDRLLFLQEQGNSVEAFLFPIFDPTLSPRNIA  435

Query  1372  IIGRK  1386
             +I R+
Sbjct  436   VIARR  440



>ref|XP_010645035.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Vitis 
vinifera]
Length=518

 Score =   384 bits (986),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 270/418 (65%), Gaps = 60/418 (14%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y LS++AID+ SHHGN+T+ARAERI+KHYAA++RKS S  R L+VPKTVT
Sbjct  157   GYLAQVLSFQYQLSVVAIDSCSHHGNVTNARAERIKKHYAAQMRKSGSGSRSLNVPKTVT  216

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSED--RLTPHSYMVGDSSLIL  492
             CRV+S + LKA+++  L + DV     IG+S I Q      D  RL     +  +SS +L
Sbjct  217   CRVMSADMLKAVNDMLLSEDDVQCPQQIGQS-ISQPSHPGLDKRRLPSLCDVHNESSFVL  275

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSVTMLRTFLEC EVKAV+S+GCCYNLLSEE      S CGFP+S  +K+ G
Sbjct  276   AGLHACGDLSVTMLRTFLECKEVKAVVSIGCCYNLLSEEVCESSSSQCGFPMSNVIKSAG  335

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             L LGKS+RDLACQ                            +L RYY EVL+ SPAIGRQ
Sbjct  336   LSLGKSSRDLACQ----------------------------VLYRYYPEVLITSPAIGRQ  367

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             GK LRRQ  +R LES+LQ +                              D K     + 
Sbjct  368   GKALRRQQQRRNLESSLQPE-----------------------------KDDKAAFAMEK  398

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
             D+LF  ISS  +  ++  N+VD +SLF KFC SGL RLG+    ++++  +W+E  PF E
Sbjct  399   DSLFQGISSDETTISDAINSVDKYSLFEKFCKSGLCRLGLKPLPDVNFKEVWEEAAPFAE  458

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              IGPYWSLRAALGP+LET+ILLDRLLFLQE    VEA ++PIFDPVLSPRN+AII +K
Sbjct  459   FIGPYWSLRAALGPLLETLILLDRLLFLQEQGSSVEAVMLPIFDPVLSPRNVAIIAKK  516



>ref|XP_009388956.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=521

 Score =   380 bits (975),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 207/425 (49%), Positives = 264/425 (62%), Gaps = 50/425 (12%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSF+Y   ++AIDAS HH N+T+ARAERI+KHYAAK          L VP+T+T
Sbjct  137   GYLAQALSFQYQHPVIAIDASLHHANVTNARAERIKKHYAAK-----KSSPHLKVPRTIT  191

Query  319   CRVLSPETLKALSNGSL------EKYDVGKQYLIGESSIGQAQEHSEDRL---TPHSYMV  471
             C +LS E L  LS  SL      E    G +   G+S   +        L    PHS   
Sbjct  192   CNILSSEALTDLSITSLCEDNTEESTGRGNKSEFGDSESSKPSVAKAINLYNKQPHS---  248

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
               +  +LAGLHACGDLSV MLR+F+ C  V+A+I +GCCYNLLSE+   K D+ CGFP+S
Sbjct  249   -GAFFVLAGLHACGDLSVNMLRSFVGCEHVRALIGIGCCYNLLSEDCLEKTDNSCGFPIS  307

Query  652   KSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVK  831
              + K   LVLGK+ARDLACQSA+RWR L   A L NF++HAFRA FQ++L +Y+ E+LV 
Sbjct  308   NAAKLSSLVLGKNARDLACQSAERWRILTADAALQNFDVHAFRAAFQLVLDKYFPEILVS  367

Query  832   SPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGK  1011
             SP+IGRQGK LRRQ  +R  ES L C+D                  RCS  ++     GK
Sbjct  368   SPSIGRQGKALRRQQCRRHRESELCCKD-----------------GRCSFFEVS----GK  406

Query  1012  KGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWK  1191
                           S+ +  +  +    +++ LF +FC SGL RLG   S++ID   IWK
Sbjct  407   LSY-----------SNAKGCQEFDVEGSNNYLLFKEFCKSGLTRLGCMFSEDIDLLEIWK  455

Query  1192  ETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMA  1371
             E Q +TE IGP+W+LRAALGP++E+ ILLDRLLFLQE  + VEA L PIFDP LSPRN+A
Sbjct  456   EAQSYTEFIGPFWALRAALGPLVESYILLDRLLFLQEQGNSVEAFLFPIFDPTLSPRNIA  515

Query  1372  IIGRK  1386
             +I R+
Sbjct  516   VIARR  520



>ref|XP_002442510.1| hypothetical protein SORBIDRAFT_08g021070 [Sorghum bicolor]
 gb|EES16348.1| hypothetical protein SORBIDRAFT_08g021070 [Sorghum bicolor]
Length=551

 Score =   378 bits (970),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 269/421 (64%), Gaps = 41/421 (10%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T ARAERI+KHYAAK      E + L VP+TVT
Sbjct  161   GYLAQSLSFEYQLPVVAIDASSHHASVTMARAERIKKHYAAKC----VEKQLLMVPRTVT  216

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYL----IGESSIGQAQEHSEDRLTPHSYMVGDSSL  486
             C VLS +TL A++  +  K D G +++         I Q QE ++          G   L
Sbjct  217   CHVLSSDTLAAVTLDAC-KDDHGGEHVRETKASTKKITQIQELTQ----------GSPPL  265

Query  487   ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             ILAGLHACGDLSV MLR F+ C +VKA++SVGCCYNLLSE++    D+  GFP+SK+ K 
Sbjct  266   ILAGLHACGDLSVNMLRVFVSCEQVKALVSVGCCYNLLSEDSNEDTDTCPGFPMSKAAKL  325

Query  667   VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
               LVLGKS RDLACQSA+RWR L     L NF++HAFRA FQM+L +Y+ EV   SP+IG
Sbjct  326   SELVLGKSIRDLACQSAERWRNLTMDIALQNFDVHAFRAAFQMVLEKYFPEVSRLSPSIG  385

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTC  1026
             RQGK LRRQ  ++ +ES +  +   K  +  SS  + +++                  T 
Sbjct  386   RQGKALRRQRLRKVVESQMTTE---KTDNFSSSTLKEQNKN-----------------TN  425

Query  1027  DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPF  1206
             D D++ H + +     + + NA   F+LF  F  SGL RLG    ++     IWK+ QPF
Sbjct  426   DVDSVIHGVDT--GPDDIHHNACQKFTLFKDFTLSGLGRLGCGSVEDSRLLEIWKDVQPF  483

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             +E IGP+W LRAALGP++ET ILLDRLL+LQE S+ VEA L P+FDP +SPRNMA+I  K
Sbjct  484   SEYIGPFWCLRAALGPLVETYILLDRLLYLQERSNLVEAMLFPLFDPTISPRNMAVIAWK  543

Query  1387  I  1389
             +
Sbjct  544   L  544



>ref|XP_011012779.1| PREDICTED: protein RRNAD1 isoform X1 [Populus euphratica]
 ref|XP_011012780.1| PREDICTED: protein RRNAD1 isoform X1 [Populus euphratica]
Length=558

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 220/420 (52%), Positives = 288/420 (69%), Gaps = 30/420 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y  S++AIDA SHHG +T+ RAERI+KHYAA++RK+       +VPKT+T
Sbjct  166   GYLAQVLTFQYQHSVVAIDACSHHGTVTEKRAERIKKHYAAQMRKNYPGIGIPNVPKTIT  225

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRV+S + LKAL++ S    +V +  LIG+ +        +D+          +SL++AG
Sbjct  226   CRVMSTDMLKALTSMSPHIDNVERPGLIGQVA--------DDK----------TSLVIAG  267

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TFLEC +VKAV+S+GCCYN+LSE       S CGFP+S  VK+ G+ 
Sbjct  268   LHACGDLSVTMLKTFLECKDVKAVVSIGCCYNMLSEGCLDIAGSQCGFPVSCGVKSAGIS  327

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L Q AGLHNFELHAFRA FQM+L ++Y E++  SP+IGRQGK
Sbjct  328   LGKSSRDLACQSAERWRSLKQDAGLHNFELHAFRAAFQMVLCKFYPEIITSSPSIGRQGK  387

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD--D  1032
              LRRQ  +R L+S++ C++         S+  S  ET   M +L       +  T D   
Sbjct  388   ALRRQQQRRILQSSINCKE---------SKHSSVPETISHMHELYLNPHMSESKTDDFSG  438

Query  1033  DALF-HKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
              AL  H++S     +   T A   + LF KF  SGL+RLG+   QE  +  IWKE +PF 
Sbjct  439   SALHSHELSCNGGTRYNETAAASKYLLFKKFAQSGLSRLGLKSLQETHFHEIWKEAEPFA  498

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E+IGPYWSLRAALGP+LET++LLDRLLFLQE    +EA ++PIFDP LSPRN+AII ++I
Sbjct  499   ELIGPYWSLRAALGPLLETLLLLDRLLFLQEQGSSLEAIMLPIFDPALSPRNVAIIAKRI  558



>gb|ACN25385.1| unknown [Zea mays]
 tpg|DAA55104.1| TPA: hypothetical protein ZEAMMB73_786454 [Zea mays]
Length=537

 Score =   373 bits (957),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/420 (49%), Positives = 265/420 (63%), Gaps = 40/420 (10%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T ARAERI+KHYAAK      E + L VP+ VT
Sbjct  148   GYLAQALSFEYQLRVVAIDASSHHASVTIARAERIKKHYAAKC----VEKQLLMVPRAVT  203

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESS---IGQAQEHSEDRLTPHSYMVGDSSLI  489
             C VLS +TL A++  +  K D G+     ++S   I Q QE ++          G   LI
Sbjct  204   CHVLSSDTLAAVTLDAC-KDDNGEHVRDTKTSTKKITQIQESTQ----------GTPPLI  252

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLR F+ C +VKA++S+GCCYNLLSE+     D+  GFP+SK+ K  
Sbjct  253   LAGLHACGDLSVNMLRVFVSCEQVKALVSIGCCYNLLSEDTYEDTDTCPGFPMSKAAKHS  312

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              LVLGKS RDLACQSA+RWR L     L NF++HAFRA FQM+L +Y+ EV   SP+IGR
Sbjct  313   ELVLGKSIRDLACQSAERWRNLTMDIALQNFDVHAFRAAFQMVLEKYFPEVSRLSPSIGR  372

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ  ++ +ES +  +   KN     S  + +++                  T D
Sbjct  373   QGKALRRQRLRKVVESQMTTK---KNDDFSCSTLKEQNKN-----------------TND  412

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
                + H++ +     + + NA   F LF  F  SGL RLG    ++     IWK+ QPF+
Sbjct  413   VHPVIHEVDT--GPDDIHQNAHQKFILFKDFTLSGLGRLGCGSVEDTSLLEIWKDVQPFS  470

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E IGP+W LRAALGP++ET ILLDRLL+LQE S+ VEA L P+FDP +SPRNMA+I  K+
Sbjct  471   EYIGPFWCLRAALGPLVETYILLDRLLYLQERSNLVEALLFPLFDPTISPRNMAVIAWKL  530



>ref|XP_008672243.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 ref|XP_008672244.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 ref|XP_008672245.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 ref|XP_008672246.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=551

 Score =   373 bits (958),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 205/420 (49%), Positives = 265/420 (63%), Gaps = 40/420 (10%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T ARAERI+KHYAAK      E + L VP+ VT
Sbjct  162   GYLAQALSFEYQLRVVAIDASSHHASVTIARAERIKKHYAAKC----VEKQLLMVPRAVT  217

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESS---IGQAQEHSEDRLTPHSYMVGDSSLI  489
             C VLS +TL A++  +  K D G+     ++S   I Q QE ++          G   LI
Sbjct  218   CHVLSSDTLAAVTLDAC-KDDNGEHVRDTKTSTKKITQIQESTQ----------GTPPLI  266

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLR F+ C +VKA++S+GCCYNLLSE+     D+  GFP+SK+ K  
Sbjct  267   LAGLHACGDLSVNMLRVFVSCEQVKALVSIGCCYNLLSEDTYEDTDTCPGFPMSKAAKHS  326

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              LVLGKS RDLACQSA+RWR L     L NF++HAFRA FQM+L +Y+ EV   SP+IGR
Sbjct  327   ELVLGKSIRDLACQSAERWRNLTMDIALQNFDVHAFRAAFQMVLEKYFPEVSRLSPSIGR  386

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ  ++ +ES +  +   KN     S  + +++                  T D
Sbjct  387   QGKALRRQRLRKVVESQMTTK---KNDDFSCSTLKEQNKN-----------------TND  426

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
                + H++ +     + + NA   F LF  F  SGL RLG    ++     IWK+ QPF+
Sbjct  427   VHPVIHEVDT--GPDDIHQNAHQKFILFKDFTLSGLGRLGCGSVEDTSLLEIWKDVQPFS  484

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E IGP+W LRAALGP++ET ILLDRLL+LQE S+ VEA L P+FDP +SPRNMA+I  K+
Sbjct  485   EYIGPFWCLRAALGPLVETYILLDRLLYLQERSNLVEALLFPLFDPTISPRNMAVIAWKL  544



>ref|XP_004963148.1| PREDICTED: methyltransferase-like protein 25-like isoform X2 
[Setaria italica]
Length=530

 Score =   372 bits (954),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 262/418 (63%), Gaps = 32/418 (8%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T ARAERI+KHYAAK      E + L+VP+TVT
Sbjct  137   GYLAQTLSFEYQLPVVAIDASSHHASVTIARAERIKKHYAAKWCNLHVEKQLLTVPRTVT  196

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C VLS +TL A++  +  K + G+      S        S   L P         LILAG
Sbjct  197   CHVLSSDTLAAVTLDAC-KDNHGEHV----SETKACTMKSPQILEPTQ---NSPPLILAG  248

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV MLR F+ C +VKA++SVGCCYNLLSE++    ++  GFP+SK+ K   LV
Sbjct  249   LHACGDLSVNMLRVFVSCEQVKALVSVGCCYNLLSEDSYEDTNTCSGFPMSKAAKLSKLV  308

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS RDLACQSA+RWR L     L NF++HAFRA FQM+L +Y+ EV   SP+IGRQGK
Sbjct  309   LGKSIRDLACQSAERWRSLTVDIALQNFDVHAFRAAFQMVLEKYFPEVSRLSPSIGRQGK  368

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD-D  1035
              LRRQ  ++ +ES +  +                      + DL C    ++ +  D+ D
Sbjct  369   ALRRQRLRKVVESQMATE---------------------KIDDLSCSTLKEQNMNTDNVD  407

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             ++ + + +     + + +    F+LF  F  SGL RLG    +++    +WK  QPF+E 
Sbjct  408   SVIYGVDT--GPDDIHHDQCRKFALFKDFALSGLGRLGCGSVEDMSLLEVWKSVQPFSEY  465

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             IGP+W LRAALGP++ET ILLDRLLFLQE S  VEA L P+FDP +SPRNMAII  K+
Sbjct  466   IGPFWCLRAALGPLVETYILLDRLLFLQEQSSLVEALLFPLFDPTMSPRNMAIIAWKL  523



>ref|XP_010060832.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Eucalyptus 
grandis]
Length=548

 Score =   372 bits (955),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 279/419 (67%), Gaps = 27/419 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDA SHHG++T+ARAERI+KHYAA+IR+S S +  L VPKTVT
Sbjct  155   GYLAQVLSFQYQHSVVAIDACSHHGSVTNARAERIKKHYAAQIRRSGSVNTSLLVPKTVT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVG-DSSLILA  495
             CRVLS + LKALS+  +  ++ G+  LIGE +     +         SY  G +  L+LA
Sbjct  215   CRVLSTDMLKALSDMFI--HEDGQTNLIGEDNEELCMK------IDSSYGRGKEDCLVLA  266

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTML+ F+EC EVKAV+S+GCCYNLLSEE        CGFP+S  VK+ G 
Sbjct  267   GLHACGDLSVTMLKNFVECVEVKAVVSIGCCYNLLSEEGVDNAGMQCGFPMSNGVKSEGF  326

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK ARDLACQSA+RWR L +    HNFELH+FRA FQM+L +YY EVL  SP+IGR G
Sbjct  327   SLGKCARDLACQSAERWRSLEKDDAGHNFELHSFRAAFQMVLSKYYPEVLKTSPSIGRHG  386

Query  856   KTLRRQHHQRALE-SNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             K LRRQ  +R LE S        ++  GG   ++ E ET            GK G+    
Sbjct  387   KALRRQQRRRILESSVNSSVQSQRDCEGGPLVRQIEAET-----------GGKSGL----  431

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTE  1212
               +  K+++    + E+T   D    F KF  SGL RLG+   Q I++  IWKE +PF E
Sbjct  432   --VVAKLAAQSGARCEDTLFGDKCLHFEKFNLSGLHRLGLKPLQGINFQTIWKEAEPFAE  489

Query  1213  MIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             +IGPYWSLRA+LG VLET+ILLDRLLFLQE    +EA ++P FDP LSPRN+AI+  KI
Sbjct  490   LIGPYWSLRASLGAVLETLILLDRLLFLQEKGSSLEAFMLPAFDPSLSPRNLAIVAVKI  548



>ref|XP_002310689.1| hypothetical protein POPTR_0007s08440g [Populus trichocarpa]
 gb|EEE91139.1| hypothetical protein POPTR_0007s08440g [Populus trichocarpa]
Length=548

 Score =   370 bits (951),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 222/420 (53%), Positives = 284/420 (68%), Gaps = 30/420 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDA SHHG +T+ RAERI+KHYAA++RK        +VPKT+T
Sbjct  156   GYLAQVLSFQYQHSVVAIDACSHHGTVTEKRAERIKKHYAAQMRKHYPGIGIPNVPKTIT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C V+S + LKAL++ S    +V +  LIG+ +        +D+          +SL+LAG
Sbjct  216   CHVMSIDMLKALTSMSPHIDNVKRPELIGQVA--------DDK----------TSLVLAG  257

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TFLEC +VKAV+S+GCCYNLLSE       S CGFP+S  VK+ G+ 
Sbjct  258   LHACGDLSVTMLKTFLECKDVKAVVSIGCCYNLLSEGCLDIAGSQCGFPVSCGVKSAGIS  317

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L Q AGLHNFELHAFRA FQM+L +YY E++  SP+IGRQGK
Sbjct  318   LGKSSRDLACQSAERWRSLEQDAGLHNFELHAFRAAFQMVLCKYYPEIIKSSPSIGRQGK  377

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD--D  1032
              LRRQ  +R L+S++ C +         S+  S  ET   M +L       +  T D   
Sbjct  378   ALRRQQQRRILQSSINCDE---------SKHSSMPETISHMQELYLNPHMSESKTDDYSG  428

Query  1033  DALF-HKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
              AL  H++S     +   T A   + LF KF  SGL+RLG+   QE  +  IWKE +PF 
Sbjct  429   SALHSHELSCNGGARYNETAAASKYLLFEKFTQSGLSRLGLKSLQETHFHEIWKEAEPFA  488

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
              +IGPYWSLRAALGP+LET++LLDRLLFLQE    +EA ++PIFDP LSPRN+AII ++I
Sbjct  489   GLIGPYWSLRAALGPLLETLLLLDRLLFLQEQGSSLEAIMLPIFDPALSPRNVAIIAKRI  548



>ref|XP_010060833.1| PREDICTED: protein RRNAD1 isoform X3 [Eucalyptus grandis]
Length=496

 Score =   367 bits (943),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 223/420 (53%), Positives = 279/420 (66%), Gaps = 28/420 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDA SHHG++T+ARAERI+KHYAA+IR+S S +  L VPKTVT
Sbjct  102   GYLAQVLSFQYQHSVVAIDACSHHGSVTNARAERIKKHYAAQIRRSGSVNTSLLVPKTVT  161

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVG-DSSLILA  495
             CRVLS + LKALS+  +  ++ G+  LIGE +     +         SY  G +  L+LA
Sbjct  162   CRVLSTDMLKALSDMFI--HEDGQTNLIGEDNEELCMK------IDSSYGRGKEDCLVLA  213

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTML+ F+EC EVKAV+S+GCCYNLLSEE        CGFP+S  VK+ G 
Sbjct  214   GLHACGDLSVTMLKNFVECVEVKAVVSIGCCYNLLSEEGVDNAGMQCGFPMSNGVKSEGF  273

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK ARDLACQSA+RWR L +    HNFELH+FRA FQM+L +YY EVL  SP+IGR G
Sbjct  274   SLGKCARDLACQSAERWRSLEKDDAGHNFELHSFRAAFQMVLSKYYPEVLKTSPSIGRHG  333

Query  856   KTLRRQHHQRALE-SNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             K LRRQ  +R LE S        ++  GG   ++ E ET            GK G+    
Sbjct  334   KALRRQQRRRILESSVNSSVQSQRDCEGGPLVRQIEAET-----------GGKSGL----  378

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT-  1209
               +  K+++    + E+T   D    F KF  SGL RLG+   Q I++  IWKE +PF  
Sbjct  379   --VVAKLAAQSGARCEDTLFGDKCLHFEKFNLSGLHRLGLKPLQGINFQTIWKEAEPFAQ  436

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E+IGPYWSLRA+LG VLET+ILLDRLLFLQE    +EA ++P FDP LSPRN+AI+  KI
Sbjct  437   ELIGPYWSLRASLGAVLETLILLDRLLFLQEKGSSLEAFMLPAFDPSLSPRNLAIVAVKI  496



>ref|XP_004963147.1| PREDICTED: methyltransferase-like protein 25-like isoform X1 
[Setaria italica]
Length=550

 Score =   369 bits (948),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 262/418 (63%), Gaps = 36/418 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T ARAERI+KHYAAK      E + L+VP+TVT
Sbjct  161   GYLAQTLSFEYQLPVVAIDASSHHASVTIARAERIKKHYAAKC----VEKQLLTVPRTVT  216

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C VLS +TL A++  +  K + G+      S        S   L P         LILAG
Sbjct  217   CHVLSSDTLAAVTLDAC-KDNHGEHV----SETKACTMKSPQILEPTQ---NSPPLILAG  268

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV MLR F+ C +VKA++SVGCCYNLLSE++    ++  GFP+SK+ K   LV
Sbjct  269   LHACGDLSVNMLRVFVSCEQVKALVSVGCCYNLLSEDSYEDTNTCSGFPMSKAAKLSKLV  328

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS RDLACQSA+RWR L     L NF++HAFRA FQM+L +Y+ EV   SP+IGRQGK
Sbjct  329   LGKSIRDLACQSAERWRSLTVDIALQNFDVHAFRAAFQMVLEKYFPEVSRLSPSIGRQGK  388

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD-D  1035
              LRRQ  ++ +ES +  +                      + DL C    ++ +  D+ D
Sbjct  389   ALRRQRLRKVVESQMATE---------------------KIDDLSCSTLKEQNMNTDNVD  427

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             ++ + + +     + + +    F+LF  F  SGL RLG    +++    +WK  QPF+E 
Sbjct  428   SVIYGVDT--GPDDIHHDQCRKFALFKDFALSGLGRLGCGSVEDMSLLEVWKSVQPFSEY  485

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             IGP+W LRAALGP++ET ILLDRLLFLQE S  VEA L P+FDP +SPRNMAII  K+
Sbjct  486   IGPFWCLRAALGPLVETYILLDRLLFLQEQSSLVEALLFPLFDPTMSPRNMAIIAWKL  543



>ref|XP_010060831.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Eucalyptus 
grandis]
Length=549

 Score =   367 bits (943),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 223/420 (53%), Positives = 279/420 (66%), Gaps = 28/420 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDA SHHG++T+ARAERI+KHYAA+IR+S S +  L VPKTVT
Sbjct  155   GYLAQVLSFQYQHSVVAIDACSHHGSVTNARAERIKKHYAAQIRRSGSVNTSLLVPKTVT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVG-DSSLILA  495
             CRVLS + LKALS+  +  ++ G+  LIGE +     +         SY  G +  L+LA
Sbjct  215   CRVLSTDMLKALSDMFI--HEDGQTNLIGEDNEELCMK------IDSSYGRGKEDCLVLA  266

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTML+ F+EC EVKAV+S+GCCYNLLSEE        CGFP+S  VK+ G 
Sbjct  267   GLHACGDLSVTMLKNFVECVEVKAVVSIGCCYNLLSEEGVDNAGMQCGFPMSNGVKSEGF  326

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK ARDLACQSA+RWR L +    HNFELH+FRA FQM+L +YY EVL  SP+IGR G
Sbjct  327   SLGKCARDLACQSAERWRSLEKDDAGHNFELHSFRAAFQMVLSKYYPEVLKTSPSIGRHG  386

Query  856   KTLRRQHHQRALE-SNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             K LRRQ  +R LE S        ++  GG   ++ E ET            GK G+    
Sbjct  387   KALRRQQRRRILESSVNSSVQSQRDCEGGPLVRQIEAET-----------GGKSGL----  431

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT-  1209
               +  K+++    + E+T   D    F KF  SGL RLG+   Q I++  IWKE +PF  
Sbjct  432   --VVAKLAAQSGARCEDTLFGDKCLHFEKFNLSGLHRLGLKPLQGINFQTIWKEAEPFAQ  489

Query  1210  EMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E+IGPYWSLRA+LG VLET+ILLDRLLFLQE    +EA ++P FDP LSPRN+AI+  KI
Sbjct  490   ELIGPYWSLRASLGAVLETLILLDRLLFLQEKGSSLEAFMLPAFDPSLSPRNLAIVAVKI  549



>gb|KCW67711.1| hypothetical protein EUGRSUZ_F01450 [Eucalyptus grandis]
Length=536

 Score =   364 bits (934),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 274/418 (66%), Gaps = 37/418 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDA SHHG++T+ARAERI+KHYAA+IR+S S +  L VPKTVT
Sbjct  155   GYLAQVLSFQYQHSVVAIDACSHHGSVTNARAERIKKHYAAQIRRSGSVNTSLLVPKTVT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVG-DSSLILA  495
             CRVLS + LKALS+  +  ++ G+  LIGE +     +         SY  G +  L+LA
Sbjct  215   CRVLSTDMLKALSDMFI--HEDGQTNLIGEDNEELCMK------IDSSYGRGKEDCLVLA  266

Query  496   GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGL  675
             GLHACGDLSVTML+ F+EC EVKAV+S+GCCYNLLSEE        CGFP+S  VK+ G 
Sbjct  267   GLHACGDLSVTMLKNFVECVEVKAVVSIGCCYNLLSEEGVDNAGMQCGFPMSNGVKSEGF  326

Query  676   VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
              LGK ARDLACQSA+RWR L +    HNFELH+FRA FQM+L +YY EVL  SP+IGR G
Sbjct  327   SLGKCARDLACQSAERWRSLEKDDAGHNFELHSFRAAFQMVLSKYYPEVLKTSPSIGRHG  386

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
             K LRRQ  +R LES++      +    G                      GK G+     
Sbjct  387   KALRRQQRRRILESSVNSSVQSQRDCEG----------------------GKSGL-----  419

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
              +  K+++    + E+T   D    F KF  SGL RLG+   Q I++  IWKE +PF E+
Sbjct  420   -VVAKLAAQSGARCEDTLFGDKCLHFEKFNLSGLHRLGLKPLQGINFQTIWKEAEPFAEL  478

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             IGPYWSLRA+LG VLET+ILLDRLLFLQE    +EA ++P FDP LSPRN+AI+  KI
Sbjct  479   IGPYWSLRASLGAVLETLILLDRLLFLQEKGSSLEAFMLPAFDPSLSPRNLAIVAVKI  536



>gb|EMT22192.1| hypothetical protein F775_20178 [Aegilops tauschii]
Length=637

 Score =   367 bits (941),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/432 (47%), Positives = 272/432 (63%), Gaps = 37/432 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L+++AIDASSHH ++T+ RAERI+KHYAAK      E ++  VP+TVT
Sbjct  213   GYLAQALSFEYQLAVIAIDASSHHASVTNTRAERIKKHYAAKC----VEKQQFKVPRTVT  268

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C VLS +TL A++  + +  D   +++   ++  Q+    E     HS       L+LAG
Sbjct  269   CHVLSSDTLAAVTLDACQ--DDHGEHITETNNCNQSIPQIEQ--PNHSI----PQLVLAG  320

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV MLR F+ C +V+A++SVGCCYNLLSE+     D+  GFP+SK+ K+  LV
Sbjct  321   LHACGDLSVNMLRVFVSCEQVQALVSVGCCYNLLSEDT----DTCPGFPISKAAKSSKLV  376

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS RDLACQSA+RWR L +   L NF++HAFRA FQM+L +Y+ EV   SP+IGRQGK
Sbjct  377   LGKSIRDLACQSAERWRNLTKEMALQNFDIHAFRAAFQMVLEKYFPEVSRLSPSIGRQGK  436

Query  859   TLRRQHHQRALESNL-----------QCQDCPKNSSGG--SSQKRSEDETRCSMSDLGCG  999
              LRRQ  ++ +ES+L            C++   N+ G   +     +    C      C 
Sbjct  437   ALRRQRLRKVMESHLAMGKADDLSYPNCKEQNMNTDGSLPTEPTAPKGAVEC------CS  490

Query  1000  NDGKKGVTCDDDALFHKISSTRSVKNENTNAVD--SFSLFMKFCDSGLARLGINESQEID  1173
             N+   G T    A+     S  +V   +TN  +    +LF  F  SGL RLG    ++++
Sbjct  491   NELCTGDTYSTSAVVGSSISRVNVGPSDTNLDECCKLTLFKDFTISGLGRLGCGFVEDVN  550

Query  1174  YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVL  1353
                IWK+ Q FTE IGP+W LRAALGP++ET ILLDRLLFLQE    VEA+L P+FDP +
Sbjct  551   LLEIWKDVQHFTEFIGPFWCLRAALGPLVETYILLDRLLFLQEQGSAVEASLFPLFDPAM  610

Query  1354  SPRNMAIIGRKI  1389
             SPRNMA++  K+
Sbjct  611   SPRNMALVAWKL  622



>dbj|BAJ99456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   365 bits (938),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 202/434 (47%), Positives = 271/434 (62%), Gaps = 37/434 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L+++AIDASSHH ++T+ RAERI+KHYAAK      E ++  VP+TVT
Sbjct  160   GYLAQALSFEYQLAVIAIDASSHHASVTNTRAERIKKHYAAKCL----EKQQFKVPRTVT  215

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQA--QEHSEDRLTPHSYMVGDSSLIL  492
             C VLS +TL A++  + +  D   +++   ++  Q+  Q    +   P         L+L
Sbjct  216   CHVLSSDTLAAVALDACQ--DDHGEHVTETNNCNQSVPQIGQPNHSIPQ--------LVL  265

Query  493   AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             AGLHACGDLSV MLR F+ C +V+A++SVGCCYNLLSE+     D+  GFP+SK+ K+  
Sbjct  266   AGLHACGDLSVNMLRVFVSCEQVQALVSVGCCYNLLSEDCHEVTDTCPGFPISKAAKSSK  325

Query  673   LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQ  852
             LVLGKS RDLACQSA+RWR L +   L NF++HAFRA FQM+L +Y+ E+   SP+IGRQ
Sbjct  326   LVLGKSIRDLACQSAERWRSLTKEMALQNFDIHAFRAAFQMVLEKYFPELSRLSPSIGRQ  385

Query  853   GKTLRRQHHQRALESNLQC-------------QDCPKNSSGGSSQKRSEDETRCSMSDLG  993
             GK LRRQ  ++ +ES+L               Q+   + S  +    S+    C      
Sbjct  386   GKALRRQRLRKEMESHLAMGKVDDLSYRNSKEQNMNTDGSLPTEPTASKGAVEC------  439

Query  994   CGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVD--SFSLFMKFCDSGLARLGINESQE  1167
             C N+   G T    A+     S  +V   +TN  +   F+LF  F  SGL RLG    ++
Sbjct  440   CSNELCTGDTYSTSAVVGSSISRVNVGPSDTNLDECCKFTLFKDFTISGLGRLGCGFVED  499

Query  1168  IDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDP  1347
             ++   IWK+ Q F E IGP+W LRAALGP++ET ILLDRLLFLQE    VEA+L P+FDP
Sbjct  500   VNLLEIWKDVQHFIEFIGPFWCLRAALGPLVETYILLDRLLFLQEQGSAVEASLFPLFDP  559

Query  1348  VLSPRNMAIIGRKI  1389
              +SPRNMAI+  K+
Sbjct  560   AMSPRNMAIVAWKL  573



>gb|EMS64937.1| hypothetical protein TRIUR3_03597 [Triticum urartu]
Length=728

 Score =   366 bits (939),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 200/426 (47%), Positives = 269/426 (63%), Gaps = 21/426 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L+++AIDASSHH ++T+ RAERI+KHYAAK      E ++  VP+TVT
Sbjct  134   GYLAQALSFEYQLAVIAIDASSHHASVTNTRAERIKKHYAAKC----VEKQQFKVPRTVT  189

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C VLS +TL A+   + +  D G+   + ES+     + S     P+  +     L+LAG
Sbjct  190   CHVLSSDTLAAVVLDACQD-DHGEH--VTESN--NCNQSSPQIGQPNHSI---PQLVLAG  241

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV MLR F+ C +V+A++SVGCCYNLLSE+     D+  GFP+S + K+  LV
Sbjct  242   LHACGDLSVNMLRVFVSCEQVQALVSVGCCYNLLSEDCHEDTDTSPGFPISNAAKSSKLV  301

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS RDLACQSA+RWR L +   L NF++HAFRA FQM+L +Y+ E+   SP+IGRQGK
Sbjct  302   LGKSIRDLACQSAERWRSLTKEMALQNFDIHAFRAAFQMVLEKYFPELSRLSPSIGRQGK  361

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLG-------CGNDGKKG  1017
              LRRQ  ++ +ES+L        S   S ++    +       +        C N+   G
Sbjct  362   ALRRQRLRKEMESHLAMGKADDLSYPNSKEQNMNTDGSLPTEPIAPKGAVQCCSNELCTG  421

Query  1018  VTCDDDALFHKISSTRSVKNENTNAVD--SFSLFMKFCDSGLARLGINESQEIDYSGIWK  1191
              T    A+     S  +V   +TN  +   F+LF  F  SGL RLG    ++++   IWK
Sbjct  422   DTYSTSAVVGSSISRVNVGPSDTNHDECCKFTLFKDFTISGLGRLGCGCVEDVNLLEIWK  481

Query  1192  ETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMA  1371
             + Q FTE IGP+W LRAALGP++ET +LLDRLLFLQE    VEA+L P+FDP +SPRNMA
Sbjct  482   DVQHFTEFIGPFWCLRAALGPLVETYVLLDRLLFLQEQGSAVEASLFPLFDPAMSPRNMA  541

Query  1372  IIGRKI  1389
             ++  K+
Sbjct  542   LVAWKL  547



>ref|XP_010237044.1| PREDICTED: protein RRNAD1 [Brachypodium distachyon]
Length=580

 Score =   361 bits (927),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 202/429 (47%), Positives = 263/429 (61%), Gaps = 28/429 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T+ RAERI+KHYAAK      E ++  VP+TVT
Sbjct  161   GYLAQALSFEYQLPVVAIDASSHHASVTNTRAERIKKHYAAKC----VEKQQFRVPRTVT  216

Query  319   CRVLSPETLKALSNGSLEKYD---VGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
             C VLS  TL A++  + +      V + Y  G S   +   HS  +L            +
Sbjct  217   CHVLSSATLAAVTLDACQDVHGEHVTETYCTGISPQIENPNHSIPQL------------V  264

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLR F+ C +V+A++SVGCCYNLLSE+     D+  GFP+S + K+ 
Sbjct  265   LAGLHACGDLSVNMLRVFVSCEQVQALVSVGCCYNLLSEDCHEDRDTCPGFPISNAAKSS  324

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              LVLGKS RDLACQSA+RWR L +   L NF++HAFRA FQM+L +Y+ EV   SP+IGR
Sbjct  325   KLVLGKSIRDLACQSAERWRNLTKEMALENFDVHAFRAAFQMVLEKYFPEVSRLSPSIGR  384

Query  850   QGKTLRRQHHQRALESNL---QCQDCP-KNSSGGSSQKRSEDETRCSMSDLGCGNDGKKG  1017
             QGK LRRQ  ++ +ES++   +  D P  NS   +    S   T  +  +   G    + 
Sbjct  385   QGKALRRQRLRKVMESHMAMGKNDDLPYSNSKEQNMTMDSSLPTEPTDLEGAVGCCSHQL  444

Query  1018  VTCDDDALFHKISSTRSVKNENTNAV-----DSFSLFMKFCDSGLARLGINESQEIDYSG  1182
              T D  +    + S+ S  N     +     D F+LF  F  SGLARL     +++    
Sbjct  445   CTGDTYSTSEVVDSSISRVNVGPTGIYLDECDKFTLFKDFTVSGLARLDCGFVEDVHLLE  504

Query  1183  IWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPR  1362
             IWK  Q F E IGP+W LRAALGP++ET ILLDRLLFLQE    VEA L P+FDP +SPR
Sbjct  505   IWKAVQRFAEFIGPFWCLRAALGPLVETYILLDRLLFLQEQGGAVEALLFPLFDPTMSPR  564

Query  1363  NMAIIGRKI  1389
             NMA++  K+
Sbjct  565   NMAVVAWKL  573



>ref|XP_006346052.1| PREDICTED: protein RRNAD1-like isoform X2 [Solanum tuberosum]
Length=500

 Score =   357 bits (915),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 206/256 (80%), Gaps = 2/256 (1%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVL+F+Y LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE SVPKTVT
Sbjct  154  GYLAQVLAFDYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNCSEQREFSVPKTVT  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CRVLS +TL ALSN  +E    G Q+L  + S+ Q    +ED L   SY   DS+L++AG
Sbjct  214  CRVLSSDTLSALSNSPVENDHAGNQHLSQKCSVSQPSRLAEDILPSRSY--SDSTLVIAG  271

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA    DS CGFP+S+ VK+ G++
Sbjct  272  LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEAIDIADSCCGFPVSQGVKSAGVM  331

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            L K+ARDLACQSADRWRGL + AGLHNFELHA RA FQ++L R+Y  +L++SPAIGRQGK
Sbjct  332  LDKNARDLACQSADRWRGLDEHAGLHNFELHALRAAFQIVLFRHYPNILLESPAIGRQGK  391

Query  859  TLRRQHHQRALESNLQ  906
             LRRQ +QR LESNL 
Sbjct  392  ALRRQQNQRILESNLH  407



>ref|XP_009627587.1| PREDICTED: protein RRNAD1 isoform X6 [Nicotiana tomentosiformis]
Length=437

 Score =   354 bits (909),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/256 (70%), Positives = 205/256 (80%), Gaps = 2/256 (1%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVL+FEY LS++AIDA SHHG ITDARAERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154  GYLAQVLAFEYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CRVLS +TLK LSN   E  D   Q+L  + S  Q    +E+ L   SY   DSSL++AG
Sbjct  214  CRVLSSDTLKTLSNFLEENDDAANQHLSQKCSGSQLSRLAENILPSLSY--SDSSLVIAG  271

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLSVTMLRTFLEC++ KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272  LHACGDLSVTMLRTFLECDKAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM+L R+Y  +L +SP IGRQGK
Sbjct  332  LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMVLFRHYPHILQESPTIGRQGK  391

Query  859  TLRRQHHQRALESNLQ  906
             LRRQ HQR LESNL 
Sbjct  392  ALRRQQHQRILESNLH  407



>ref|XP_006664734.1| PREDICTED: protein RRNAD1-like [Oryza brachyantha]
Length=514

 Score =   356 bits (913),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 192/420 (46%), Positives = 259/420 (62%), Gaps = 19/420 (5%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH  +T+ RAERI+KHYAAK    +    +L VP+TVT
Sbjct  102   GYLAQALSFEYQLPVVAIDASSHHATVTNTRAERIKKHYAAKCVGKQ----QLIVPRTVT  157

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             C VL  +TL A++   LE         + ES I    E ++    P+  +     L+LAG
Sbjct  158   CHVLCSDTLAAVT---LEACQDNHAEHVPESKI--FNESTQQIEKPNHSI---PPLVLAG  209

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV MLR F+ C +VKA+IS+GCCYNLLSEE      +  GFP+SK+ K   LV
Sbjct  210   LHACGDLSVNMLRVFVSCKQVKALISIGCCYNLLSEECHEDTKTCPGFPMSKAAKLSNLV  269

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LG+S RD+ CQSA+RWR L +   + NF++HAFRA FQM+L +++ EV   SP+IGRQGK
Sbjct  270   LGRSIRDVGCQSAERWRSLTKDIAIQNFDIHAFRAAFQMVLEKHFPEVSRSSPSIGRQGK  329

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMS--DLGCGNDGKKGVTCD-  1029
              LRRQ  ++ +ES++      + S     ++    + R   +  +     D +  ++   
Sbjct  330   ALRRQRLRKVMESHMAIGKINELSYSTPKEQIMTKDGRLPTNPDEFAVAVDCRPELSAGS  389

Query  1030  -DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPF  1206
              D A+F        +  + +     F+LF  F  SGL RLG +  +++    IWK+ QPF
Sbjct  390   VDSAVFGASIVPDDIYLDKSQ---KFTLFKDFTVSGLGRLGCDLVEDVSLLEIWKDVQPF  446

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              E IGP+W LR ALGP++ET ILLDRLLF+QE    +EA L P+FDP +SPRNMAII  K
Sbjct  447   MEFIGPFWCLRTALGPLVETYILLDRLLFIQEQGSAIEAYLFPLFDPTMSPRNMAIIAWK  506



>ref|NP_001067247.1| Os12g0610500 [Oryza sativa Japonica Group]
 gb|ABA99366.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30266.1| Os12g0610500 [Oryza sativa Japonica Group]
Length=576

 Score =   357 bits (915),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 202/433 (47%), Positives = 262/433 (61%), Gaps = 42/433 (10%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T+ RAERI+K+Y AK    +    +L VP+TVT
Sbjct  163   GYLAQALSFEYQLPVVAIDASSHHASVTNTRAERIKKYYTAKCVGKQ----QLRVPRTVT  218

Query  319   CRVLSPETLKALS-----NGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSS  483
             C VLS +TL A++     +   E     K +   ESS     E   D + P         
Sbjct  219   CHVLSSDTLAAVTLEACQDDHAEHVPESKNF--NESS--PQIEKPNDSIPP---------  265

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK  663
             L+LAGLHACGDLSV MLR F+ C +VKA+IS+GCCYNLLSEE     ++  GFP+SK+ K
Sbjct  266   LVLAGLHACGDLSVNMLRLFVSCEQVKALISIGCCYNLLSEECHEDTNTCPGFPMSKAAK  325

Query  664   AVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAI  843
                LVL KS RDL CQSA+RWR L +   L NF++HAFRA FQM L +++ EV   SP+I
Sbjct  326   LSNLVLRKSTRDLGCQSAERWRSLTKDIALQNFDIHAFRAAFQMFLEKHFPEVSRSSPSI  385

Query  844   GRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVT  1023
             GRQGK LRRQ  ++ +ES +   +   ++   S+QK   ++       L  G +  K V 
Sbjct  386   GRQGKALRRQRLRKVMESPMAMAE--TDALSYSTQK---EQIMTKDDPLPTGPNNFKEVH  440

Query  1024  CDDDALFHKISSTRSVKNENTNAV-----------DSFSLFMKFCDSGLARLGINESQEI  1170
              D    F    ST  V +  + A              F+LF  F  SGL RLG +  + +
Sbjct  441   VD----FLPELSTGFVDSAVSGAAVVPDDIYLDKSQKFTLFKDFTVSGLGRLGCDFVENV  496

Query  1171  DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPV  1350
                 IWK+ QPFTE IGP+W LR ALGP++ET ILLDRLLFLQE    +EA+L P+F+P 
Sbjct  497   SLLEIWKDVQPFTEFIGPFWCLRVALGPLVETYILLDRLLFLQEQGSVIEASLFPLFNPT  556

Query  1351  LSPRNMAIIGRKI  1389
             +SPRNMAII  K+
Sbjct  557   MSPRNMAIIAWKL  569



>gb|EEC69659.1| hypothetical protein OsI_39073 [Oryza sativa Indica Group]
Length=665

 Score =   359 bits (921),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 267/431 (62%), Gaps = 38/431 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T+ RAERI+K+YAAK    +    +L VP+TVT
Sbjct  159   GYLAQALSFEYQLPVVAIDASSHHASVTNTRAERIKKYYAAKCVGKQ----QLRVPRTVT  214

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQ---EHSEDRLTPHSYMVGDSSLI  489
             C VLS +TL A++  + +  D   +++    +  ++    E   D + P         L+
Sbjct  215   CHVLSSDTLAAVTLEACQ--DDHAEHVPESKNFNESSPQIEKPNDSIPP---------LV  263

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLR F+ C +VKA+IS+GCCYNLLSEE     ++  GFP+SK+ K  
Sbjct  264   LAGLHACGDLSVNMLRLFVSCEQVKALISIGCCYNLLSEECHEDTNTCPGFPMSKAAKLS  323

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              LVLGKS RDL CQSA+RWR L +   L NF++HAFRA FQM+L +++ EV   +P+IGR
Sbjct  324   NLVLGKSTRDLGCQSAERWRSLTKDIALQNFDIHAFRAAFQMVLEKHFPEVSRSNPSIGR  383

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ  ++ +ES +   +   ++   S+QK   ++       L  G +  K V  D
Sbjct  384   QGKALRRQRLRKVMESPMAMAE--TDALSYSTQK---EQIMTKDDPLPTGPNNFKEVHVD  438

Query  1030  DDALFHKISSTRSVKNENTNAV-----------DSFSLFMKFCDSGLARLGINESQEIDY  1176
                 F    ST  V +  + A              F+LF  F  SGL RLG +  + +  
Sbjct  439   ----FLPELSTGFVDSAVSGAAVVPDDIYLDKSQKFTLFKDFTVSGLGRLGCDFVENVSL  494

Query  1177  SGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLS  1356
               IWK+ QPFTE IGP+W LR ALGP++ET ILLDRLLFLQE    +EA+L P+F+P +S
Sbjct  495   LEIWKDVQPFTEFIGPFWCLRVALGPLVETYILLDRLLFLQEQGSVIEASLFPLFNPTMS  554

Query  1357  PRNMAIIGRKI  1389
             PRNMAII  K+
Sbjct  555   PRNMAIIAWKL  565



>gb|EPS72956.1| hypothetical protein M569_01800, partial [Genlisea aurea]
Length=514

 Score =   353 bits (906),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 199/424 (47%), Positives = 255/424 (60%), Gaps = 67/424 (16%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+FE+GLS++AIDAS HHG++T AR+ RI KHYAA+  K    ++    PKTVT
Sbjct  150   GYLAQVLAFEHGLSVVAIDASPHHGSVTAARSLRIEKHYAARKNKLGLTNKSFVSPKTVT  209

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRV SP  LK + N ++    VG   ++           S   L  ++     SS +LAG
Sbjct  210   CRVQSPSMLKDVLNCTIPTGSVGNSVMVPRDEAEPLLHDSASALRTNA----GSSFLLAG  265

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC +VKA++S+GCCYNLLSEE    DD H GFP+S+  K +  V
Sbjct  266   LHACGDLSVTMLRTFVECEDVKALVSIGCCYNLLSEE---DDDGHRGFPVSRGAKPLCSV  322

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVL--VKSPAIGRQ  852
             LGK+ARDLACQSA+RW+ L +  G HNFELHAFRA FQM+L RYY E L     P++GRQ
Sbjct  323   LGKNARDLACQSAERWKCLEEGDGFHNFELHAFRAAFQMLLFRYYPETLDGRSLPSVGRQ  382

Query  853   GKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDD  1032
             GKTLRR+ HQR                 GSS   S++ +                     
Sbjct  383   GKTLRRRQHQR-----------------GSSHLASKESS---------------------  404

Query  1033  DALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINE-SQEIDYSG-IWKETQPF  1206
                            E +     +S F++F  SGL +LG+ E S  I+YS  IW E + +
Sbjct  405   --------------EEPSFLAKRYSGFVEFSKSGLRKLGLPESSSHIEYSRIIWHEAEIY  450

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWV----EAALVPIFDPVLSPRNMAI  1374
              E+IGPYW+LRAALGPVLET ++LDR+L+LQE  +      E  LV +F P LSPRN+A+
Sbjct  451   FELIGPYWTLRAALGPVLETALMLDRVLYLQEQQEGSLLIEEVELVSVFHPFLSPRNLAL  510

Query  1375  IGRK  1386
             I  K
Sbjct  511   IASK  514



>ref|XP_010666178.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=461

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 270/429 (63%), Gaps = 57/429 (13%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYL+QVL+F+Y L ++AIDASSHHG +T+ RAERI+KHYAAK+ KS       ++P T+T
Sbjct  74    GYLSQVLAFQYQLPVVAIDASSHHGVVTNTRAERIKKHYAAKLHKSGKGPP--TMPTTIT  131

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDS------  480
               V+S   LK LSN   ++  +GK+   G+     + +  E         VGDS      
Sbjct  132   SHVMSSSMLKDLSNYCCQRDGLGKKEYSGKGPNNNSHKIVE---------VGDSRFSCSG  182

Query  481   -------SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG  639
                    S++LAGLHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE        +CG
Sbjct  183   ASAESSSSVVLAGLHACGDLSVTMLRTFVECKEVKAVVSIGCCYNLLSEIGCENGGFNCG  242

Query  640   FPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSE  819
             FP+SK +  +G+ LGK+ARDLACQSA+RW+ L + AG+ NF+LH FRA FQMIL RYY E
Sbjct  243   FPISKGINYMGVSLGKNARDLACQSAERWQSLEKEAGIQNFDLHGFRAAFQMILDRYYPE  302

Query  820   VLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCG  999
             VL  SP+IGRQGK L RQ  +   +S+    DC  N            E   +  ++   
Sbjct  303   VLSTSPSIGRQGKALLRQQKKIIPKSS----DCAMN------------EISKTTLEMDSA  346

Query  1000  NDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYS  1179
             +DG +   CD D             +   +  D ++LF KF  SGL  L I   Q++D  
Sbjct  347   SDGSQ---CDHD-------------DRKGSFNDKYTLFEKFSHSGLCHLCIEPLQDMDLR  390

Query  1180  GIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSP  1359
             G+W+E QP  E+IGPYWSLRAALGPVLET++LLDRLL+LQE  + VE  ++PIF PV SP
Sbjct  391   GLWREYQPLAELIGPYWSLRAALGPVLETLLLLDRLLYLQE-QESVEVLMLPIFHPVCSP  449

Query  1360  RNMAIIGRK  1386
             RN+AII +K
Sbjct  450   RNLAIIAQK  458



>gb|EEE53589.1| hypothetical protein OsJ_36831 [Oryza sativa Japonica Group]
Length=669

 Score =   355 bits (911),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 198/431 (46%), Positives = 264/431 (61%), Gaps = 38/431 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T+ RAERI+K+Y AK    +    +L VP+TVT
Sbjct  163   GYLAQALSFEYQLPVVAIDASSHHASVTNTRAERIKKYYTAKCVGKQ----QLRVPRTVT  218

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQ---EHSEDRLTPHSYMVGDSSLI  489
             C VLS +TL A++  + +  D   +++    +  ++    E   D + P         L+
Sbjct  219   CHVLSSDTLAAVTLEACQ--DDHAEHVPESKNFNESSPQIEKPNDSIPP---------LV  267

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLR F+ C +VKA+IS+GCCYNLLSEE     ++  GFP+SK+ K  
Sbjct  268   LAGLHACGDLSVNMLRLFVSCEQVKALISIGCCYNLLSEECHEDTNTCPGFPMSKAAKLS  327

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              LVL KS RDL CQSA+RWR L +   L NF++HAFRA FQM L +++ EV   SP+IGR
Sbjct  328   NLVLRKSTRDLGCQSAERWRSLTKDIALQNFDIHAFRAAFQMFLEKHFPEVSRSSPSIGR  387

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ  ++ +ES +   +   ++   S+QK   ++       L  G +  K V  D
Sbjct  388   QGKALRRQRLRKVMESPMAMAE--TDALSYSTQK---EQIMTKDDPLPTGPNNFKEVHVD  442

Query  1030  DDALFHKISSTRSVKNENTNAV-----------DSFSLFMKFCDSGLARLGINESQEIDY  1176
                 F    ST  V +  + A              F+LF  F  SGL RLG +  + +  
Sbjct  443   ----FLPELSTGFVDSAVSGAAVVPDDIYLDKSQKFTLFKDFTVSGLGRLGCDFVENVSL  498

Query  1177  SGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLS  1356
               IWK+ QPFTE IGP+W LR ALGP++ET ILLDRLLFLQE    +EA+L P+F+P +S
Sbjct  499   LEIWKDVQPFTEFIGPFWCLRVALGPLVETYILLDRLLFLQEQGSVIEASLFPLFNPTMS  558

Query  1357  PRNMAIIGRKI  1389
             PRNMAII  K+
Sbjct  559   PRNMAIIAWKL  569



>ref|XP_010666177.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=542

 Score =   350 bits (898),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 269/429 (63%), Gaps = 57/429 (13%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYL+QVL+F+Y L ++AIDASSHHG +T+ RAERI+KHYAAK+ KS       ++P T+T
Sbjct  155   GYLSQVLAFQYQLPVVAIDASSHHGVVTNTRAERIKKHYAAKLHKSGKGPP--TMPTTIT  212

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDS------  480
               V+S   LK LSN   ++  +GK+   G+     + +  E         VGDS      
Sbjct  213   SHVMSSSMLKDLSNYCCQRDGLGKKEYSGKGPNNNSHKIVE---------VGDSRFSCSG  263

Query  481   -------SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG  639
                    S++LAGLHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE        +CG
Sbjct  264   ASAESSSSVVLAGLHACGDLSVTMLRTFVECKEVKAVVSIGCCYNLLSEIGCENGGFNCG  323

Query  640   FPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSE  819
             FP+SK +  +G+ LGK+ARDLACQSA+RW+ L + AG+ NF+LH FRA FQMIL RYY E
Sbjct  324   FPISKGINYMGVSLGKNARDLACQSAERWQSLEKEAGIQNFDLHGFRAAFQMILDRYYPE  383

Query  820   VLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCG  999
             VL  SP+IGRQGK L RQ  +   +S+    DC  N            E   +  ++   
Sbjct  384   VLSTSPSIGRQGKALLRQQKKIIPKSS----DCAMN------------EISKTTLEMDSA  427

Query  1000  NDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYS  1179
             +DG +   CD D             +   +  D ++LF KF  SGL  L I   Q++D  
Sbjct  428   SDGSQ---CDHD-------------DRKGSFNDKYTLFEKFSHSGLCHLCIEPLQDMDLR  471

Query  1180  GIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSP  1359
             G+W+E QP  E+IGPYWSLRAALGPVLET++LLDRLL+LQE    VE  ++PIF PV SP
Sbjct  472   GLWREYQPLAELIGPYWSLRAALGPVLETLLLLDRLLYLQEQES-VEVLMLPIFHPVCSP  530

Query  1360  RNMAIIGRK  1386
             RN+AII +K
Sbjct  531   RNLAIIAQK  539



>ref|XP_006836403.1| hypothetical protein AMTR_s00092p00143460 [Amborella trichopoda]
 gb|ERM99256.1| hypothetical protein AMTR_s00092p00143460 [Amborella trichopoda]
Length=577

 Score =   347 bits (889),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 204/427 (48%), Positives = 276/427 (65%), Gaps = 15/427 (4%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y LS+ A+DAS+HH ++T  RAERI+K+Y  K RK+ + +    +PKT+T
Sbjct  154   GYLAQVLSFQYQLSVYALDASAHHASVTSERAERIKKYYTTKSRKTIAGNEHFMIPKTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQY----LIGESSIGQAQEHSEDRLTPHSY--MVGDS  480
             C + S   L ALS+ SL K  + +      L+G  SI   +   E    P S+      S
Sbjct  214   CNIPSSGALTALSDMSLLKNSIKESQESSKLLGALSIEDLESKEEKVSRPLSFDGKSVKS  273

Query  481   SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSV  660
             SL+LAGLHACGDLS  MLRTF+E +++KA+IS+GCCYNLLSE+ +    S  G P+S  V
Sbjct  274   SLVLAGLHACGDLSANMLRTFVESDDMKALISIGCCYNLLSEDCSESVASQYGCPMSNGV  333

Query  661   KAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPA  840
             K+VGL LG++ARDLACQSA+RWR L   A L NF+LHAFRA FQMI+  YY E++  +P+
Sbjct  334   KSVGLKLGRNARDLACQSAERWRSLRDDAALQNFDLHAFRAAFQMIVHDYYPELVDMNPS  393

Query  841   IGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGV  1020
             IGRQGK LRR+  ++AL S L  +D   NS+  S       E+  S      G + +   
Sbjct  394   IGRQGKALRRRQLRKALHSELIAKD---NSAFPSPSFNKISESFESSKAFVAG-EVRTSE  449

Query  1021  TCDDDALFHKISSTRSVKNENTNAVDSF---SLFMKFCDSGLARLGINESQEIDYSGIWK  1191
               +   +  +IS +   K E T +  SF   +LF +F  SGL RLGI    +ID+  +W+
Sbjct  450   LPNLSEMEERISKSGERK-ERTLSYRSFEKSALFEEFSRSGLDRLGIGPKDDIDFLCVWE  508

Query  1192  ETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESS-DWVEAALVPIFDPVLSPRNM  1368
             +  P+ E+IGPYWSLRA +GP++ET +LLDRLLFLQE     ++A ++P+FDPVLSPRN 
Sbjct  509   KAVPYAELIGPYWSLRALMGPLVETFLLLDRLLFLQEQGRSSIQAIMLPLFDPVLSPRNT  568

Query  1369  AIIGRKI  1389
             AII  K+
Sbjct  569   AIIAWKV  575



>ref|XP_002529955.1| protein with unknown function [Ricinus communis]
 gb|EEF32432.1| protein with unknown function [Ricinus communis]
Length=538

 Score =   343 bits (880),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 232/362 (64%), Gaps = 61/362 (17%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AIDASSHHG +TDARAERI+KHYAA++RKS S +   +VPKT+T
Sbjct  151   GYLAQVLSFQYNHSVVAIDASSHHGKVTDARAERIKKHYAAQMRKSGSGNSVPNVPKTIT  210

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CR++S + LKAL+N S+   +V +  L         ++ S+D+          +S +LAG
Sbjct  211   CRIMSNDMLKALTNMSVNVDEVEQPKL--------TKQDSDDK----------TSFVLAG  252

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TFLEC EVKAV+S+GCCYNLLSEE     DSHCGFP+S  VK+ G+ 
Sbjct  253   LHACGDLSVTMLKTFLECKEVKAVVSIGCCYNLLSEECLDAADSHCGFPMSSGVKSAGIS  312

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK++RDLACQSADRWR L +  GL NFELHAFRA FQM+L RYY +++ +SP+IGRQGK
Sbjct  313   LGKNSRDLACQSADRWRSLDKDVGLQNFELHAFRAVFQMVLCRYYPDIIKESPSIGRQGK  372

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVT-CDDD  1035
               RRQH +R L S L                          S+LG      KG+  C ++
Sbjct  373   ATRRQHQRRVLHSALP-------------------------SELGLDASLCKGIMRCKEN  407

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             A                 +VD + LF KF  +GL+RLG+    +ID+  IWKE +PF E 
Sbjct  408   A-----------------SVDKYLLFEKFSFAGLSRLGLKPLPDIDFHEIWKEAEPFAEK  450

Query  1216  IG  1221
              G
Sbjct  451   KG  452



>ref|XP_011012782.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Populus 
euphratica]
Length=502

 Score =   317 bits (813),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 238/369 (64%), Gaps = 35/369 (9%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVL+F+Y  S++AIDA SHHG +T+ RAERI+KHYAA++RK+       +VPKT+T
Sbjct  166   GYLAQVLTFQYQHSVVAIDACSHHGTVTEKRAERIKKHYAAQMRKNYPGIGIPNVPKTIT  225

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRV+S + LKAL++ S    +V +  LIG+ +        +D+          +SL++AG
Sbjct  226   CRVMSTDMLKALTSMSPHIDNVERPGLIGQVA--------DDK----------TSLVIAG  267

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTML+TFLEC +VKAV+S+GCCYN+LSE       S CGFP+S  VK+ G+ 
Sbjct  268   LHACGDLSVTMLKTFLECKDVKAVVSIGCCYNMLSEGCLDIAGSQCGFPVSCGVKSAGIS  327

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGKS+RDLACQSA+RWR L Q AGLHNFELHAFRA FQM+L ++Y E++  SP+IGRQGK
Sbjct  328   LGKSSRDLACQSAERWRSLKQDAGLHNFELHAFRAAFQMVLCKFYPEIITSSPSIGRQGK  387

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD--D  1032
              LRRQ  +R L+S++ C++         S+  S  ET   M +L       +  T D   
Sbjct  388   ALRRQQQRRILQSSINCKE---------SKHSSVPETISHMHELYLNPHMSESKTDDFSG  438

Query  1033  DALF-HKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
              AL  H++S     +   T A   + LF KF  SGL+RLG+   QE  +  IWKE +PF 
Sbjct  439   SALHSHELSCNGGTRYNETAAASKYLLFKKFAQSGLSRLGLKSLQETHFHEIWKEAEPFA  498

Query  1210  EMIGPYWSL  1236
                   WSL
Sbjct  499   -----VWSL  502



>ref|XP_008444279.1| PREDICTED: protein RRNAD1 isoform X2 [Cucumis melo]
Length=559

 Score =   316 bits (810),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 247/418 (59%), Gaps = 25/418 (6%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+  E   L +PK +T
Sbjct  163   GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGLEAENLRLPKAMT  222

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
               VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+LAG
Sbjct  223   FHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLVLAG  280

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSV MLRTF+EC EVKAVI++GCCYNLL+E  +       GFP+S  VK+  L 
Sbjct  281   LHACGDLSVIMLRTFVECKEVKAVINIGCCYNLLTEYGSNNKGIQNGFPMSFGVKSSSLS  340

Query  679   LGKSARDLACQS-ADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
             LGKS RDLACQ     W+    +  L             ++L ++YS  ++++       
Sbjct  341   LGKSGRDLACQKDGGIWKKKVASTIL--------SCMLSVLLSKWYSINIIQTWLQLAHP  392

Query  856   KTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDD  1035
               ++ +H             C     G     RS  +      +     D   G   + +
Sbjct  393   LGVKERH-------------CAVKRKGRVQYPRSVVKISLRHHNQYVA-DLIGGFQVNAN  438

Query  1036  ALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             A  H IS   S   E + +VD + LF KFC SGL RLG+  SQ+ D  GIW +T+PFTE+
Sbjct  439   AFSHTISDHGSTPCEQSKSVDKYPLFEKFCHSGLIRLGLQSSQDTDCYGIWTDTEPFTEL  498

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             IGPYWSLRAALGPVLET ILLDRLLFLQE    +EA L+PIFDP LSPRN+AII RK+
Sbjct  499   IGPYWSLRAALGPVLETCILLDRLLFLQEQGGSLEAILLPIFDPDLSPRNVAIIARKV  556



>ref|XP_008444283.1| PREDICTED: protein RRNAD1 isoform X6 [Cucumis melo]
Length=453

 Score =   312 bits (800),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 193/421 (46%), Positives = 247/421 (59%), Gaps = 28/421 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS---ESEDRELSVPK  309
             GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+     E   L +PK
Sbjct  54    GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGFYRLEAENLRLPK  113

Query  310   TVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
              +T  VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+
Sbjct  114   AMTFHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLV  171

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLRTF+EC EVKAVI++GCCYNLL+E  +       GFP+S  VK+ 
Sbjct  172   LAGLHACGDLSVIMLRTFVECKEVKAVINIGCCYNLLTEYGSNNKGIQNGFPMSFGVKSS  231

Query  670   GLVLGKSARDLACQS-ADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
              L LGKS RDLACQ     W+    +  L             ++L ++YS  ++++    
Sbjct  232   SLSLGKSGRDLACQKDGGIWKKKVASTIL--------SCMLSVLLSKWYSINIIQTWLQL  283

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTC  1026
                  ++ +H             C     G     RS  +      +     D   G   
Sbjct  284   AHPLGVKERH-------------CAVKRKGRVQYPRSVVKISLRHHNQYVA-DLIGGFQV  329

Query  1027  DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPF  1206
             + +A  H IS   S   E + +VD + LF KFC SGL RLG+  SQ+ D  GIW +T+PF
Sbjct  330   NANAFSHTISDHGSTPCEQSKSVDKYPLFEKFCHSGLIRLGLQSSQDTDCYGIWTDTEPF  389

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             TE+IGPYWSLRAALGPVLET ILLDRLLFLQE    +EA L+PIFDP LSPRN+AII RK
Sbjct  390   TELIGPYWSLRAALGPVLETCILLDRLLFLQEQGGSLEAILLPIFDPDLSPRNVAIIARK  449

Query  1387  I  1389
             +
Sbjct  450   V  450



>ref|XP_009802714.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Nicotiana 
sylvestris]
Length=400

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVLSFEY LS++AIDA SHHG ITDAR ERIRKHYAAK+RK+ SE RE+S+PKTVT
Sbjct  154  GYLAQVLSFEYQLSVIAIDACSHHGKITDARVERIRKHYAAKMRKNGSELREISMPKTVT  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CRVLS +TLK LSN   E  D   QYL  +SS  Q    +E+ L   SY   DSSL++AG
Sbjct  214  CRVLSSDTLKTLSNFREENDDAANQYLSRKSSGSQPSRLTENILPSLSY--SDSSLVIAG  271

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLSVTMLRTFLEC+  KAVISVGCCYNLLSEEA+   DS CGFP+S+ VK+ G+V
Sbjct  272  LHACGDLSVTMLRTFLECDNAKAVISVGCCYNLLSEEASDMVDSCCGFPVSQGVKSAGVV  331

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
            L K+ARDLACQSADRWRGL + AGLHNFELHAFRA FQM L
Sbjct  332  LDKNARDLACQSADRWRGLDEHAGLHNFELHAFRAAFQMTL  372



>ref|XP_009149103.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Brassica 
rapa]
Length=453

 Score =   310 bits (794),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 218/361 (60%), Gaps = 66/361 (18%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQVLSF+Y  S++AID+SSHHGN+TDARA RIRKH+A+++RKS S ++    P T+T
Sbjct  154   GYLAQVLSFQYKHSVVAIDSSSHHGNVTDARAARIRKHFASQMRKSGSGNKCPDAPTTIT  213

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             CRVLS E LK+L+N  LE+ D+     +  +++ +  + S              SL+LAG
Sbjct  214   CRVLSTEMLKSLTNVPLEENDLD----LDAAALNEGPKRS-------------CSLVLAG  256

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
             LHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE+ +      CGFP+S  +K++G  
Sbjct  257   LHACGDLSVTMLRTFMECEEVKAVVSIGCCYNLLSEKTSESSCYKCGFPMSAGLKSLGFS  316

Query  679   LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
             LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  317   LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  376

Query  859   TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDA  1038
               RRQ  ++ALE+  + +   K+                                 D  +
Sbjct  377   AFRRQKQRKALETPSKLETSRKD--------------------------------IDKKS  404

Query  1039  LFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMI  1218
               H  SS                 F KFC S  +RL +   Q++D +  W E   FT++ 
Sbjct  405   TTHTSSS-----------------FEKFCLSAFSRLNLEHPQDLDLTATWNEANAFTDLT  447

Query  1219  G  1221
             G
Sbjct  448   G  448



>ref|XP_008444281.1| PREDICTED: protein RRNAD1 isoform X4 [Cucumis melo]
Length=534

 Score =   312 bits (799),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 193/421 (46%), Positives = 247/421 (59%), Gaps = 28/421 (7%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS---ESEDRELSVPK  309
             GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+     E   L +PK
Sbjct  135   GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGFYRLEAENLRLPK  194

Query  310   TVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
              +T  VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+
Sbjct  195   AMTFHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLV  252

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLRTF+EC EVKAVI++GCCYNLL+E  +       GFP+S  VK+ 
Sbjct  253   LAGLHACGDLSVIMLRTFVECKEVKAVINIGCCYNLLTEYGSNNKGIQNGFPMSFGVKSS  312

Query  670   GLVLGKSARDLACQS-ADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
              L LGKS RDLACQ     W+    +  L             ++L ++YS  ++++    
Sbjct  313   SLSLGKSGRDLACQKDGGIWKKKVASTIL--------SCMLSVLLSKWYSINIIQTWLQL  364

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTC  1026
                  ++ +H             C     G     RS  +      +     D   G   
Sbjct  365   AHPLGVKERH-------------CAVKRKGRVQYPRSVVKISLRHHNQYVA-DLIGGFQV  410

Query  1027  DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPF  1206
             + +A  H IS   S   E + +VD + LF KFC SGL RLG+  SQ+ D  GIW +T+PF
Sbjct  411   NANAFSHTISDHGSTPCEQSKSVDKYPLFEKFCHSGLIRLGLQSSQDTDCYGIWTDTEPF  470

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             TE+IGPYWSLRAALGPVLET ILLDRLLFLQE    +EA L+PIFDP LSPRN+AII RK
Sbjct  471   TELIGPYWSLRAALGPVLETCILLDRLLFLQEQGGSLEAILLPIFDPDLSPRNVAIIARK  530

Query  1387  I  1389
             +
Sbjct  531   V  531



>gb|KDO53412.1| hypothetical protein CISIN_1g022433mg [Citrus sinensis]
 gb|KDO53413.1| hypothetical protein CISIN_1g022433mg [Citrus sinensis]
Length=297

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/292 (53%), Positives = 192/292 (66%), Gaps = 18/292 (6%)
 Frame = +1

Query  532   LRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLVLGKSARDLACQ  711
             + TF+EC EVKAV+S+GCCYNLLSEE      S  GFP+S  VK++G  LGKS+RDLACQ
Sbjct  14    IETFVECKEVKAVVSIGCCYNLLSEEGIDLAGSPSGFPISHGVKSLGFTLGKSSRDLACQ  73

Query  712   SADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRAL  891
             SA+RWR L   AG+ NFELHAFRA FQM+L +YY EV+V SP++GRQGK LRRQ  +R L
Sbjct  74    SAERWRSLEMDAGVRNFELHAFRAAFQMVLCKYYPEVIVTSPSVGRQGKALRRQQQRRIL  133

Query  892   ESNLQCQD--CPKNSSGGSSQKRSEDETRCS-----MSDLGCGNDGKKGVTCDDDALFHK  1050
             ES L  +D  CP           S D+  C      ++      D K     D  AL H 
Sbjct  134   ESRLHIEDHTCP-----------SFDQKHCGIAYSFLNPKESKMDNKSVSMLDTAALSHG  182

Query  1051  ISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYW  1230
              S  RS + E+T + D + LF K+C SGL RL +     ++   +W E +PF ++IGPYW
Sbjct  183   NSFNRSTRCEHTVSDDKYLLFEKYCLSGLCRLDLKPLDNLNLHRLWDEAEPFADIIGPYW  242

Query  1231  SLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             SLRAAL PVLET ILLDRLLFLQE    +EA ++P+FDPVLSPRN+AII +K
Sbjct  243   SLRAALAPVLETYILLDRLLFLQEQGSSLEAVMLPVFDPVLSPRNVAIIAKK  294



>ref|XP_007022295.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein, putative isoform 2 [Theobroma cacao]
 gb|EOY13820.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein, putative isoform 2 [Theobroma cacao]
Length=427

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 196/285 (69%), Gaps = 18/285 (6%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVL+FEY  S++AIDA SHHG +TDARA+RI+KHY A++ K+ S +++L+VP+T+T
Sbjct  155  GYLAQVLAFEYHHSVVAIDACSHHGKVTDARAKRIKKHYTAQMWKNGSGNKKLNVPQTIT  214

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CR++S ETLKAL+     K DV               E  E  L         SSL+LAG
Sbjct  215  CRIMSLETLKALTTLLPHKGDV---------------EQIEQDLEKFGLTGNKSSLVLAG  259

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLSVTML+T LEC EV+AVIS+GCCYNLLSEE         GFP+S  VK V   
Sbjct  260  LHACGDLSVTMLKTLLECEEVRAVISIGCCYNLLSEEGFENAGIQYGFPMSCGVKTVSFS  319

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            LGKS+RDLACQSA+RW+GLG+ AGLHNFELHAFRA FQM+L +YY EV++ SP+IGRQGK
Sbjct  320  LGKSSRDLACQSAERWKGLGKDAGLHNFELHAFRAAFQMVLHKYYPEVVIASPSIGRQGK  379

Query  859  TLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLG  993
             LRR+  +R +ES L  ++   +S     Q+ S     CS+   G
Sbjct  380  ALRRKQQRRRMESELHDEESTYSS---PPQRPSNMGEACSIKQSG  421



>ref|XP_010324218.1| PREDICTED: protein RRNAD1 isoform X2 [Solanum lycopersicum]
Length=456

 Score =   300 bits (768),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/284 (60%), Positives = 201/284 (71%), Gaps = 30/284 (11%)
 Frame = +1

Query  538   TFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLVLGKSARDLACQSA  717
             TFLEC++ KAVISVGCCYNLLSEEA  + DS CGFP+S+ VK+ G++L KSARDLACQSA
Sbjct  201   TFLECDKAKAVISVGCCYNLLSEEAICEADSCCGFPVSQGVKSAGVILAKSARDLACQSA  260

Query  718   DRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALES  897
             DRWRGLG+ AGLHNFELHAFRA FQ+ L R+Y  +L++SP IGRQGK LRRQ +QR LES
Sbjct  261   DRWRGLGENAGLHNFELHAFRAAFQIFLFRHYPSILLESPTIGRQGKALRRQQNQRILES  320

Query  898   NLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKN  1077
             NL          GGSS+     E R S+                  A  H+ SS     N
Sbjct  321   NLH--------HGGSSES---GEPRESV------------------AFLHEYSSI-QSSN  350

Query  1078  ENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPV  1257
               +NAVD  SLF KFC+SGL RL +    +  YS IW+E++ + E+IGPYWSLRAALGPV
Sbjct  351   SESNAVDRCSLFAKFCESGLGRLHLPHLADTAYSAIWRESESYAELIGPYWSLRAALGPV  410

Query  1258  LETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             LET+ILLDRLL LQE    +EA+L+PIF+PVLSPRNMAII RKI
Sbjct  411   LETLILLDRLLLLQEYGSDLEASLLPIFNPVLSPRNMAIIARKI  454


 Score = 81.6 bits (200),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS  276
            GYLAQVL+F+Y LS++AIDA SHHG ITDARAERIRKHYAAK+RK+
Sbjct  154  GYLAQVLAFDYQLSVIAIDACSHHGKITDARAERIRKHYAAKMRKN  199



>ref|XP_006307588.1| hypothetical protein CARUB_v10009211mg [Capsella rubella]
 gb|EOA40486.1| hypothetical protein CARUB_v10009211mg [Capsella rubella]
Length=428

 Score =   291 bits (744),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 185/253 (73%), Gaps = 8/253 (3%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVLSF+Y  S++AID+SSHHG +TDARA RIRKH+AA++RKS   ++   VP T+T
Sbjct  154  GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIRKHFAAQMRKSGLGNKCPDVPVTIT  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CRVLS E LKAL++  +EK D+        S++ +    S+     +       SL+LAG
Sbjct  214  CRVLSTEMLKALTDVPVEKNDLDS----NASALNEGPRRSQSSNDANR----SCSLVLAG  265

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLSVTMLRTF+EC E+KAV+S+GCCYNLLSE+++    S  GFPLS  +K +   
Sbjct  266  LHACGDLSVTMLRTFVECEEIKAVVSIGCCYNLLSEKSSEDSCSKYGFPLSAGLKFLNFS  325

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            LGK ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM+L ++Y EVL  SP+IGRQGK
Sbjct  326  LGKDARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMVLSKHYPEVLATSPSIGRQGK  385

Query  859  TLRRQHHQRALES  897
              RRQ  ++ALE+
Sbjct  386  AFRRQQQRKALET  398



>ref|NP_001136550.1| hypothetical protein [Zea mays]
 ref|XP_008672247.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF82153.1| unknown [Zea mays]
 tpg|DAA55105.1| TPA: hypothetical protein ZEAMMB73_786454 [Zea mays]
Length=493

 Score =   285 bits (730),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 217/366 (59%), Gaps = 40/366 (11%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
             GYLAQ LSFEY L ++AIDASSHH ++T ARAERI+KHYAAK      E + L VP+ VT
Sbjct  162   GYLAQALSFEYQLRVVAIDASSHHASVTIARAERIKKHYAAKC----VEKQLLMVPRAVT  217

Query  319   CRVLSPETLKALSNGSLEKYDVGKQYLIGESS---IGQAQEHSEDRLTPHSYMVGDSSLI  489
             C VLS +TL A++  +  K D G+     ++S   I Q QE ++          G   LI
Sbjct  218   CHVLSSDTLAAVTLDAC-KDDNGEHVRDTKTSTKKITQIQESTQ----------GTPPLI  266

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
             LAGLHACGDLSV MLR F+ C +VKA++S+GCCYNLLSE+     D+  GFP+SK+ K  
Sbjct  267   LAGLHACGDLSVNMLRVFVSCEQVKALVSIGCCYNLLSEDTYEDTDTCPGFPMSKAAKHS  326

Query  670   GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
              LVLGKS RDLACQSA+RWR L     L NF++HAFRA FQM+L +Y+ EV   SP+IGR
Sbjct  327   ELVLGKSIRDLACQSAERWRNLTMDIALQNFDVHAFRAAFQMVLEKYFPEVSRLSPSIGR  386

Query  850   QGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCD  1029
             QGK LRRQ  ++ +ES +  +   KN     S  + +++                  T D
Sbjct  387   QGKALRRQRLRKVVESQMTTK---KNDDFSCSTLKEQNKN-----------------TND  426

Query  1030  DDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFT  1209
                + H++ +     + + NA   F LF  F  SGL RLG    ++     IWK+ QPF+
Sbjct  427   VHPVIHEVDT--GPDDIHQNAHQKFILFKDFTLSGLGRLGCGSVEDTSLLEIWKDVQPFS  484

Query  1210  EMIGPY  1227
                G +
Sbjct  485   VPFGAF  490



>ref|XP_007213759.1| hypothetical protein PRUPE_ppa003763m1g, partial [Prunus persica]
 gb|EMJ14958.1| hypothetical protein PRUPE_ppa003763m1g, partial [Prunus persica]
Length=284

 Score =   272 bits (696),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 189/298 (63%), Gaps = 31/298 (10%)
 Frame = +1

Query  538   TFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLVLGKSARDLACQSA  717
             TF+EC EVKAV+SVGCCYNLLSEE      S CGFP+S  V + G+ LGKS+RDLACQSA
Sbjct  1     TFMECKEVKAVVSVGCCYNLLSEEGFNHVGSQCGFPMSCGVISAGISLGKSSRDLACQSA  60

Query  718   DRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALES  897
             +RW+ L   AGLHNFELHAFRA FQM+L  YY EV+  SP+IGRQGK LRR+  +    S
Sbjct  61    ERWKCLENDAGLHNFELHAFRAAFQMVLSVYYPEVMSTSPSIGRQGKALRRRQQRVVPNS  120

Query  898   NLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG----KKGVTCDDDALFHKISSTR  1065
             +L                    E +CS+S++     G    KK    + D  F  +  T 
Sbjct  121   SLH-----------------HKENKCSLSEINSHMTGSCYHKKSTELETDDSFDMMLETT  163

Query  1066  SVKNENTNA----------VDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEM  1215
             S  NEN++           + ++ LF K+C SGL RLG+   +E D  GIWK+ + F E+
Sbjct  164   SRTNENSSNKATKCERSEFIGNYPLFQKYCLSGLCRLGLEPLKETDIHGIWKQVESFAEL  223

Query  1216  IGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             IGPYWSLRAA GP+LET +LLDRLLFLQE    +EA ++PIF+  LSPRN+AII +K+
Sbjct  224   IGPYWSLRAAFGPLLETFLLLDRLLFLQEQGSSIEAVMLPIFNAALSPRNVAIIAKKL  281



>ref|XP_008444282.1| PREDICTED: methyltransferase-like protein 25 isoform X5 [Cucumis 
melo]
Length=457

 Score =   258 bits (660),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 187/282 (66%), Gaps = 15/282 (5%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS---ESEDRELSVPK  309
            GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+     E   L +PK
Sbjct  163  GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGFYRLEAENLRLPK  222

Query  310  TVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
             +T  VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+
Sbjct  223  AMTFHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLV  280

Query  490  LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
            LAGLHACGDLSV MLRTF+EC EVKAVI++GCCYNLL+E  +       GFP+S  VK+ 
Sbjct  281  LAGLHACGDLSVIMLRTFVECKEVKAVINIGCCYNLLTEYGSNNKGIQNGFPMSFGVKSS  340

Query  670  GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
             L LGKS RDLACQSA+RWR L +  GLHNFELHAFRA FQM+L +YY +V+   P+IGR
Sbjct  341  SLSLGKSGRDLACQSAERWRNLEKEGGLHNFELHAFRAAFQMVLYKYYPDVVATCPSIGR  400

Query  850  QGKTLRRQHHQRALESNLQCQD---------CPKNSSGGSSQ  948
            QGK LRRQ  +    S+ QC++         C ++  G SSQ
Sbjct  401  QGKALRRQKKREGSVSS-QCREDKLEASQSVCCRSYWGVSSQ  441



>gb|AAG10818.1|AC011808_6 Hypothetical protein [Arabidopsis thaliana]
Length=489

 Score =   257 bits (657),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 163/220 (74%), Gaps = 7/220 (3%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVLSF+Y  S++AID+SSHHG +TDARA RI+KH+AA++RKS S ++   VP T+T
Sbjct  162  GYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAARIKKHFAAQMRKSGSGNKCPDVPMTIT  221

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CRVLS E LKAL++  LEK +        +SS     E  + R    S      SL+LAG
Sbjct  222  CRVLSTEMLKALTDVHLEKDET-------DSSGSALNEEGQSRSQSSSDANRSCSLVLAG  274

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLSVTMLRTF+EC EVKA++S+GCCYNLLSE+++    S CG+P+S  ++++G  
Sbjct  275  LHACGDLSVTMLRTFMECEEVKALVSIGCCYNLLSEKSSEDSCSKCGYPMSAGLRSLGFS  334

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMI  798
            LGK+ARDLACQSA+RW  LG+ AGL NFELH+FRA FQM 
Sbjct  335  LGKNARDLACQSAERWSSLGEDAGLQNFELHSFRAAFQMF  374


 Score =   130 bits (327),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +1

Query  1096  DSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             D  S F KFC S  +RL +   +++D +  W E   FTE+IGPYWS+RAALGPVLET+IL
Sbjct  392   DMCSSFEKFCLSAFSRLNLEHPRDLDLNATWNEADAFTELIGPYWSIRAALGPVLETLIL  451

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             LDRL+FLQE  D ++  ++PIFDP +SPRN+AII R++
Sbjct  452   LDRLMFLQEQGDSIKVVMLPIFDPTISPRNVAIIARRL  489



>ref|XP_002974472.1| hypothetical protein SELMODRAFT_101072 [Selaginella moellendorffii]
 gb|EFJ24694.1| hypothetical protein SELMODRAFT_101072 [Selaginella moellendorffii]
Length=505

 Score =   257 bits (656),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 165/423 (39%), Positives = 231/423 (55%), Gaps = 87/423 (21%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSE---SEDRELSV-P  306
             GYLAQVL+F + L ++A+D S+H+  +T+ RA+RI+++YA++  K +      R  +  P
Sbjct  149   GYLAQVLAFHHKLPVVAVDCSAHNTTVTNKRADRIQRYYASRSGKLDIVLHTGRAANPGP  208

Query  307   KTVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSL  486
             KT TC + S        N SL+ +          SSI   +E  +     HS       +
Sbjct  209   KTATCLLGSGN-----ENVSLDAF---------LSSISIRKEDEQRSHEQHS-------I  247

Query  487   ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             +LAGLHACGDLS  MLRTF+   +V AVISVGCCYNLLSE     +D  CGFPLS+ VK 
Sbjct  248   VLAGLHACGDLSANMLRTFVNRQDVTAVISVGCCYNLLSE-----NDDKCGFPLSRGVKR  302

Query  667   VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
             + L LG + RDL CQSA RW+ +G    + NF++HAFRA FQ++L R+Y  + V SP++G
Sbjct  303   LNLRLGGAGRDLGCQSAHRWKDIGCEMAVANFDVHAFRAAFQILLHRFYPGIAVTSPSVG  362

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTC  1026
             R GK  RR+  ++    + +CQ C                             GK G   
Sbjct  363   RIGKAKRRKQMRK---PSSECQAC----------------------------HGKGG---  388

Query  1027  DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPF  1206
              DDA                     F  F  +    L RLG+ E    D + IWKE +PF
Sbjct  389   -DDA-------------------GKFVAFQHYSAEALKRLGLPEVSREDLAEIWKEVEPF  428

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVE---AALVPIFDPVLSPRNMAII  1377
               ++ P+WSLR+A+ PVLET++L+DRLL+L+E    V    A L+P+FDP +SPRNMA++
Sbjct  429   QALVSPFWSLRSAIAPVLETLLLMDRLLYLKEQESEVPSFSAMLLPVFDPCVSPRNMAVV  488

Query  1378  GRK  1386
               +
Sbjct  489   ATR  491



>ref|XP_002990829.1| hypothetical protein SELMODRAFT_132321 [Selaginella moellendorffii]
 gb|EFJ08102.1| hypothetical protein SELMODRAFT_132321 [Selaginella moellendorffii]
Length=505

 Score =   256 bits (653),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 164/423 (39%), Positives = 231/423 (55%), Gaps = 87/423 (21%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSE---SEDRELSV-P  306
             GYLAQVL+F + L ++A+D S+H+  +T+ RA+RI+++YA++  K +      R  +  P
Sbjct  149   GYLAQVLAFHHKLPVVAVDCSAHNTTVTNKRADRIQRYYASRSGKLDIVLHTGRAANPGP  208

Query  307   KTVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSL  486
             KT TC + S        N SL+ +          SSI   +E  +     HS       +
Sbjct  209   KTATCLLGSGN-----ENVSLDAF---------LSSISIRKEDEQRSHEQHS-------I  247

Query  487   ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             +LAGLHACGDLS  MLRTF+   +V AVISVGCCYNLLSE     +D  CGFPLS+ +K 
Sbjct  248   VLAGLHACGDLSANMLRTFVNRQDVTAVISVGCCYNLLSE-----NDDKCGFPLSRGMKR  302

Query  667   VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
             + L LG + RDL CQSA RW+ +G    + NF++HAFRA FQ++L R+Y  + V SP++G
Sbjct  303   LNLRLGGAGRDLGCQSAHRWKDIGCEMAVANFDVHAFRAAFQILLHRFYPGIAVTSPSVG  362

Query  847   RQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTC  1026
             R GK  RR+  ++    + +CQ C                             GK G   
Sbjct  363   RIGKAKRRKQMRK---PSSECQAC----------------------------HGKGG---  388

Query  1027  DDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPF  1206
              DDA                     F  F  +    L RLG+ E    D + IWKE +PF
Sbjct  389   -DDA-------------------GKFVAFQHYSAEALKRLGLPEVSREDLAEIWKEVEPF  428

Query  1207  TEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVE---AALVPIFDPVLSPRNMAII  1377
               ++ P+WSLR+A+ PVLET++L+DRLL+L+E    V    A L+P+FDP +SPRNMA++
Sbjct  429   QALVAPFWSLRSAIAPVLETLLLMDRLLYLKEQESEVPSFSAMLLPVFDPSVSPRNMAVV  488

Query  1378  GRK  1386
               +
Sbjct  489   ATR  491



>ref|XP_004167500.1| PREDICTED: methyltransferase-like protein 25-like, partial [Cucumis 
sativus]
Length=231

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 152/242 (63%), Gaps = 22/242 (9%)
 Frame = +1

Query  664   AVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAI  843
              +G +L +  +     SA+RWR L    GLHNFELHAFRA FQM+L +YY +V+   P++
Sbjct  2     VLGKILERYFQGKLLSSAERWRNLENEGGLHNFELHAFRAAFQMVLYKYYPDVVATCPSV  61

Query  844   GRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVT  1023
             GRQGK LRRQ  +R    + QC                ED+   S SDL        G+ 
Sbjct  62    GRQGKALRRQK-KREDSVSSQCH---------------EDKLEASQSDL------IGGLP  99

Query  1024  CDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQP  1203
              + +A  H +S   S   E + +VD + LF KFC SGL RLGI  SQ++D  GIW +T P
Sbjct  100   VNVNAFSHTVSDHGSTPCEQSKSVDKYPLFEKFCHSGLNRLGIQSSQDMDCYGIWMDTDP  159

Query  1204  FTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGR  1383
             FTE+IGPYWSLRAALGPVLET ILLDRLLFLQE    VEA L+PIFDP LSPRN+AII R
Sbjct  160   FTELIGPYWSLRAALGPVLETCILLDRLLFLQEQGGSVEAILLPIFDPSLSPRNVAIIAR  219

Query  1384  KI  1389
             K+
Sbjct  220   KV  221



>ref|XP_010666179.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=444

 Score =   229 bits (585),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 156/232 (67%), Gaps = 24/232 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+QVL+F+Y L ++AIDASSHHG +T+ RAERI+KHYAAK+ KS       ++P T+T
Sbjct  155  GYLSQVLAFQYQLPVVAIDASSHHGVVTNTRAERIKKHYAAKLHKSGKGPP--TMPTTIT  212

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDS------  480
              V+S   LK LSN   ++  +GK+   G+     + +  E         VGDS      
Sbjct  213  SHVMSSSMLKDLSNYCCQRDGLGKKEYSGKGPNNNSHKIVE---------VGDSRFSCSG  263

Query  481  -------SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG  639
                   S++LAGLHACGDLSVTMLRTF+EC EVKAV+S+GCCYNLLSE        +CG
Sbjct  264  ASAESSSSVVLAGLHACGDLSVTMLRTFVECKEVKAVVSIGCCYNLLSEIGCENGGFNCG  323

Query  640  FPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQM  795
            FP+SK +  +G+ LGK+ARDLACQSA+RW+ L + AG+ NF+LH FRA FQM
Sbjct  324  FPISKGINYMGVSLGKNARDLACQSAERWQSLEKEAGIQNFDLHGFRAAFQM  375



>gb|KGN58120.1| hypothetical protein Csa_3G523080 [Cucumis sativus]
Length=278

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 173/291 (59%), Gaps = 25/291 (9%)
 Frame = +1

Query  523   VTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLVLGKSARDL  702
             + +++TF+EC EVKAVI++GCCYNLL+E  +  +    GFP+S  VK+ GL LGKS R L
Sbjct  1     MCIIKTFVECKEVKAVINIGCCYNLLTEYGSNNEGVQNGFPMSFGVKSSGLSLGKSGRGL  60

Query  703   ACQSADRWRGLGQAAGLHNFELHAFRATFQMILL--RYYSEVLVKSPAIGRQGKTLRRQH  876
             ACQ         +  G+   ++ +   +  + +L  ++YS  ++++         ++ +H
Sbjct  61    ACQ---------KDGGIWKMKVASIILSCMLFVLLSKWYSINIIQTWLPLAHPLGVKERH  111

Query  877   HQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKIS  1056
                  +  +Q    P++    S +  ++           C  D   G+  + +A  H +S
Sbjct  112   CAVKRKGRIQY---PRSVMKISLRHHNQ-----------CVADLIGGLPVNVNAFSHTVS  157

Query  1057  STRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSL  1236
                S   E + +VD + LF KFC SGL RLGI  SQ++D  GIW +T PFTE+IGPYWSL
Sbjct  158   DHGSTPCEQSKSVDKYPLFEKFCHSGLNRLGIQSSQDMDCYGIWMDTDPFTELIGPYWSL  217

Query  1237  RAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             RAALGPVLET ILLDRLLFLQE    VEA L+PIFDP LSPRN+AII RK+
Sbjct  218   RAALGPVLETCILLDRLLFLQEQGGSVEAILLPIFDPSLSPRNVAIIARKV  268



>ref|XP_001772442.1| predicted protein [Physcomitrella patens]
 gb|EDQ62724.1| predicted protein [Physcomitrella patens]
Length=529

 Score =   226 bits (577),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 158/252 (63%), Gaps = 26/252 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSE---SEDRELSVPK  309
            GYLA VL+FEY LS++A+DA +HH ++T+ RA RI+KHY A+ RKS+   S   ++  P+
Sbjct  153  GYLALVLAFEYRLSVIAVDACAHHADVTNKRALRIQKHYDARSRKSQHNSSTYPDVRAPR  212

Query  310  TVTCRV---LSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYM----  468
            TVTCRV    SP  L +L     E  ++                 SED +  H       
Sbjct  213  TVTCRVGVGESPAPLSSLLPAIQESNNL--------------LHVSEDTIVDHGVKSVRE  258

Query  469  VGDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH--CGF  642
              D  ++LAGLHACGDLS TMLRTF+EC EV +VI+VGCCYNLLSEE +  D      GF
Sbjct  259  AKDCGVVLAGLHACGDLSATMLRTFIECKEVASVINVGCCYNLLSEETSNVDKKTPVLGF  318

Query  643  PLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
            P+S++V  +GL LG+SARDLACQSADRW+          FELHAFRA FQM+L RYY E 
Sbjct  319  PMSEAVANLGLDLGRSARDLACQSADRWKEHHPTKAALTFELHAFRAAFQMVLERYYPET  378

Query  823  LVKSPAIGRQGK  858
               SP++GR GK
Sbjct  379  ARSSPSVGRLGK  390



>ref|XP_006441026.1| hypothetical protein CICLE_v10022203mg [Citrus clementina]
 gb|ESR54266.1| hypothetical protein CICLE_v10022203mg [Citrus clementina]
Length=215

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 140/221 (63%), Gaps = 18/221 (8%)
 Frame = +1

Query  745   AGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQD--C  918
             AG+HNFELHAFRA FQM+L +YY EV+V SP++GRQGK LRRQ  +R LES L+ +D  C
Sbjct  3     AGVHNFELHAFRAAFQMVLCKYYPEVIVTSPSVGRQGKALRRQQQRRILESRLRIEDHTC  62

Query  919   PKNSSGGSSQKRSEDETRCS-----MSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNEN  1083
             P           S D+  C      ++      D K     D  AL H  S  RS + E+
Sbjct  63    P-----------SFDQKHCGIAYSFLNPKESKMDNKSVSMLDTAALSHGNSFNRSTRCEH  111

Query  1084  TNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLE  1263
             T + D + LF K+C SG  RL +     ++   +W E +PF ++IGPYWSLRAAL PVLE
Sbjct  112   TVSDDKYLLFEKYCLSGSCRLDLKPLDNLNLHRLWDEAEPFADIIGPYWSLRAALAPVLE  171

Query  1264  TIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             T ILLDRLLFLQE    +EA ++P+FDPVLSPRN+AII +K
Sbjct  172   TYILLDRLLFLQEQGSSLEAVMLPVFDPVLSPRNVAIIAKK  212



>ref|XP_010087147.1| hypothetical protein L484_007397 [Morus notabilis]
 gb|EXB27052.1| hypothetical protein L484_007397 [Morus notabilis]
Length=503

 Score =   219 bits (558),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 148/230 (64%), Gaps = 20/230 (9%)
 Frame = +1

Query  712   SADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRAL  891
             SA+RWR L    G+HNFELHAFRA FQMIL +YY EV++ SP+IGRQGK LRR+  +  L
Sbjct  290   SAERWRCLEADDGIHNFELHAFRAAFQMILKKYYPEVMISSPSIGRQGKALRRRQKRETL  349

Query  892   ESNLQCQDCPKNSSGGSS---QKRSEDE-TRCSMSDLGCGNDGKKGVTCDDDALFHKISS  1059
             ES      C K+S+  SS   Q R ED       ++   G+    G              
Sbjct  350   ES----VPCHKDSTCASSSHIQSRMEDNCPPVKSTEPETGDRSSSGF------------E  393

Query  1060  TRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLR  1239
             T S    ++   D +SLF ++  SGL RLG+   Q+ID+  IW E +PF+EMIGPYWSLR
Sbjct  394   TASSLFRDSRKGDKYSLFQRYSLSGLRRLGLKPLQDIDFCRIWDEVEPFSEMIGPYWSLR  453

Query  1240  AALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             AALGP+LET ILLDRLLFLQE+ + +EA ++PIFDP LSPRN+AII +KI
Sbjct  454   AALGPLLETFILLDRLLFLQEAGNSIEAMMLPIFDPELSPRNVAIIAKKI  503


 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 24/138 (17%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+QVLSF+Y  S+LAIDASSHHG++T+ARA+RI KHYA  +RKS+SE   L VPKT+T
Sbjct  166  GYLSQVLSFQYNHSVLAIDASSHHGSVTNARAQRIYKHYAFLMRKSKSEKTSLMVPKTIT  225

Query  319  CRVLSPETLKAL----------SNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYM  468
            CRV+S + LK L           NGS +  D    Y  G+  + Q+     D        
Sbjct  226  CRVMSIDMLKDLITSEATTCSKDNGSEQHRD---DY--GDMGLQQSLCRVND--------  272

Query  469  VGDSSLILAGLHACGDLS  522
               SS++LAGLHACGDLS
Sbjct  273  -DTSSMLLAGLHACGDLS  289



>ref|XP_001779393.1| predicted protein [Physcomitrella patens]
 gb|EDQ55783.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   199 bits (506),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 147/224 (66%), Gaps = 10/224 (4%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESED---RELSVPK  309
            GYLA VL+FEY LS+ A+DA +HH ++T+ RA+RI K+Y  ++RKS+        +  P+
Sbjct  157  GYLALVLAFEYRLSVTAVDACAHHADVTNKRAQRIEKYYNTRLRKSQQVGLGCSAVRAPQ  216

Query  310  TVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLI  489
            TVTCRV + E   ALS+  L  ++  K   +  +   +  +H E+          + S++
Sbjct  217  TVTCRVGTGEFSAALSS-LLPAFEESKLSEVFANE--RPADHDENTFADSK----NCSVV  269

Query  490  LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAV  669
            LAGLHACGDLS TMLRTF+EC EV AVI+V CCY+LL+EE++       GFP+S+ V  +
Sbjct  270  LAGLHACGDLSATMLRTFIECKEVTAVINVACCYHLLTEESSNDKKEFYGFPMSEGVSNL  329

Query  670  GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
            GL LG+SAR+LAC+S DRW+       + NFELHAFRA FQ+++
Sbjct  330  GLELGRSARELACESPDRWKEHHPTRAIQNFELHAFRAAFQLLV  373


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 10/78 (13%)
 Frame = +1

Query  1183  IWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSD----------WVEAALV  1332
             IW E     +++GP++SLR  L PV+E+ ILLDRLL+++E ++           + + LV
Sbjct  422   IWSEVAAHQDLVGPFYSLRTVLAPVIESYILLDRLLYVKERAEILASKDEMSCQITSQLV  481

Query  1333  PIFDPVLSPRNMAIIGRK  1386
             P+F+P  SPRNMAII R+
Sbjct  482   PLFEPSTSPRNMAIIARR  499



>ref|XP_006441027.1| hypothetical protein CICLE_v10021587mg [Citrus clementina]
 gb|ESR54267.1| hypothetical protein CICLE_v10021587mg [Citrus clementina]
Length=278

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 9/133 (7%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVLSF+Y  S++AIDASSHHG +T+ARAERI+K+YAA++ K+ S ++  +VPKT+T
Sbjct  155  GYLAQVLSFQYQHSLVAIDASSHHGKVTNARAERIKKYYAAQMPKNGSGNKNPNVPKTIT  214

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
            CRV+S +TLKALSN SL   DV +  L     + Q  +  E R    S     +SL+LAG
Sbjct  215  CRVMSIDTLKALSNMSLHSDDVEQSKL-----VEQNHQECEGRKLRSSC----NSLVLAG  265

Query  499  LHACGDLSVTMLR  537
            LHACGDLSVTML+
Sbjct  266  LHACGDLSVTMLK  278



>gb|ADN33749.1| hypothetical protein [Cucumis melo subsp. melo]
Length=176

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVLSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y A+IRK+  E   L +PK +T
Sbjct  47   GYLAQVLSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLAQIRKAGLEAENLRLPKAMT  106

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              VLS + LK+L+N SLE   V K    G+      Q+ S+     +S    + SL+LAG
Sbjct  107  FHVLSVDALKSLANMSLEDDHVEKPSTTGDDQKKINQQESKCLTLCNSDQ--EPSLVLAG  164

Query  499  LHACGDLSVTML  534
            LHACGDLSV ML
Sbjct  165  LHACGDLSVIML  176



>ref|XP_007213760.1| hypothetical protein PRUPE_ppa003763m2g, partial [Prunus persica]
 gb|EMJ14959.1| hypothetical protein PRUPE_ppa003763m2g, partial [Prunus persica]
Length=265

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 88/133 (66%), Gaps = 25/133 (19%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQVLSF Y  +++AIDA SHHG +TDARAE+I+K+YAA++RKS S    L++PKTVT
Sbjct  157  GYLAQVLSFHYQHAVVAIDACSHHGRVTDARAEQIKKYYAAQLRKSVS----LTLPKTVT  212

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGD-SSLILA  495
            C V+S + LKAL++  L K +V                     L   S   G+ SSL+LA
Sbjct  213  CNVMSIDMLKALADTPLHKDNVS--------------------LLQSSCNAGNGSSLVLA  252

Query  496  GLHACGDLSVTML  534
            GLHACGDLSVTML
Sbjct  253  GLHACGDLSVTML  265



>gb|ERZ95423.1| hypothetical protein GLOINDRAFT_311324 [Rhizophagus irregularis 
DAOM 181602]
Length=531

 Score =   122 bits (305),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 139/264 (53%), Gaps = 41/264 (16%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS---------ESEDR  291
            GYL++VL++ Y L + A+DAS    NI    A++    Y  +  KS         E +D+
Sbjct  178  GYLSRVLAYTYNLCVFAVDAS----NIQTCGAQK----YQFRTEKSLGLLRKGKKEVDDK  229

Query  292  --ELSVPK----TVTCRVLSPETLKALS---NGSLEKYDVGKQYLIGESSIGQAQEHSED  444
              EL   K    T   + ++ ETL  L    N + E+++VG+   +G+    +    +++
Sbjct  230  SNELISEKKGGLTHVTQHVTTETLTNLISEWNKNKEQFNVGE---VGDYEFNKVVNDNKN  286

Query  445  RL---TPHSYMVGDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE---  606
             +       ++  D++ ++ GLH+CG+LS TML  F++  E+K V++VGCCY+LL E   
Sbjct  287  IVDGSCSAKHLKQDNNFLICGLHSCGELSSTMLDLFIKNEEIKCVVNVGCCYHLLHENEN  346

Query  607  ---EAAGKDDSHCGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAF  777
               E +  +D  C FPLSK  K     +G + R LACQ   RW  + Q + +  FE H F
Sbjct  347  SKQENSKDEDIKCSFPLSKFFKEKNFYMGLTIRHLACQVPSRW-SVQQESSIKAFEHHFF  405

Query  778  RATFQMILLRYYSEVLVKSPAIGR  849
            RA  Q IL++   +++  +P IG+
Sbjct  406  RALLQYILIK--KDLVKDTPRIGK  427


 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = +1

Query  1099  SFSLFMKFCDSGLARLG-----INESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLE  1263
             SF+ F  +C++ L +L      I +S+   Y   +K+ + +   I  +W+LRA LGP  E
Sbjct  432   SFTSFSTYCNAALKKLSLPLNSITQSESEKYYNEFKQ-KGYMRKIIVFWTLRAMLGPCFE  490

Query  1264  TIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             +IILLD+ L+L E++   E     IFD + SPRNM I+G K
Sbjct  491   SIILLDKCLYLFENNHVKEVKCFGIFDELKSPRNMVIVGIK  531



>gb|KGN58119.1| hypothetical protein Csa_3G523070 [Cucumis sativus]
Length=324

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLAQ LSF Y  S+LAIDA SHHGN+T AR+ RI+K+Y ++IRK+  E + L +PK +T
Sbjct  192  GYLAQALSFHYKHSVLAIDACSHHGNVTSARSARIKKYYLSQIRKAGLEAKNLRLPKAMT  251

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              VLS + LK+L+N SLE   V K  + G+      Q+ S+     +S    + SL+LAG
Sbjct  252  FHVLSVDALKSLANMSLEDDHVEKTSMTGDDQKKINQQDSKCLTLCNSD--EEPSLVLAG  309

Query  499  LHACGDLSVTMLR  537
            LHACGDLSV +LR
Sbjct  310  LHACGDLSVIILR  322



>ref|XP_006992367.1| PREDICTED: methyltransferase-like protein 25 [Peromyscus maniculatus 
bairdii]
Length=646

 Score =   114 bits (284),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 130/491 (26%), Positives = 206/491 (42%), Gaps = 95/491 (19%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHY--------------AAKIRKS  276
             GYL+  LS +YGL++  ID+S+ + +    R  +++KH+              A K+ + 
Sbjct  173   GYLSSFLSLKYGLNVYGIDSSNTNTHGAKERNRKLKKHWNLYHAQTRGDAHGPALKMPEE  232

Query  277   ESEDREL-------SVPK-TVTCRVLSPETLKALS----------NGSLEKYDVGKQYLI  402
             +   +E+       S PK T+  + LS + L   S           G+L    +   + +
Sbjct  233   KKVQKEVKCKGDFESAPKNTLVTQDLSADVLPEFSKSAGSVIRKWQGNLHAQPLETAFSL  292

Query  403   GE----------SSIGQAQEHSEDR---------------LTP-HSYMVGDSSL------  486
              +          SS     E SE R                +P  S++  DS L      
Sbjct  293   VDILPIEAIEPTSSQVHNTEMSEVRTRRRKVTSKPSDSSIYSPLTSFITADSELHDIVKD  352

Query  487   ----ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC----GF  642
                 ++ GLH CGDL+   LR F   +EVK V SVGCCY+LLSEE   +   +     GF
Sbjct  353   LEDCLVVGLHTCGDLAPNTLRIFASKSEVKGVCSVGCCYHLLSEEFEDQHKEYAQENWGF  412

Query  643   PLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
             P+ + +K      G++AR  AC + +R   +GQ  GL    L  +RA  Q I+  YY   
Sbjct  413   PMCRYLKEERWCCGRNARMSACLALER-VAVGQ--GLPTESLF-YRAVLQNIIKDYY---  465

Query  823   LVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGN  1002
                       G T  +        S     DC  NS G   Q     +  CS   L    
Sbjct  466   ----------GITKCQLELLDTPTSAQITWDC-GNSKGELEQASKVSKDVCSTLFLDTQT  514

Query  1003  DGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSG  1182
             +  +  +    + +    +  ++ N+   A +      +    G A   + + Q +    
Sbjct  515   EENRQTSI--SSYWSPSVAREAIVNKELWATEESGEQERAIPQGRAHRLVIQCQTVSEEI  572

Query  1183  I---WKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVL  1353
             I   +++ +P    +  +  L+  L P +ET+ILLDRL +L+E  D V +ALV +FDPV 
Sbjct  573   IMDYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDVVWSALVKLFDPVQ  632

Query  1354  SPRNMAIIGRK  1386
             SPR  A++  K
Sbjct  633   SPRCYALVALK  643



>gb|EPB87340.1| hypothetical protein HMPREF1544_05865 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=471

 Score =   108 bits (271),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  475  DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSK  654
            D   +L GLH CGDL+  MLR F +  E+   ++VGCCY+ L+E+ + +D+S  GFPLS 
Sbjct  240  DEKWLLTGLHTCGDLASMMLRLFTQSPEITCFVNVGCCYHFLTEKQSTQDNSTVGFPLSS  299

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
            +V+  G  LG +AR L+CQ+  RW    Q   L  +E H FRA  Q+I++         +
Sbjct  300  TVRNTGFKLGPTARMLSCQAPARWVD-QQEETLMAYEHHFFRALLQLIMVEKGLTDASIA  358

Query  835  PAIGRQGK  858
            P +GR  K
Sbjct  359  PVVGRLNK  366


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 57/108 (53%), Gaps = 9/108 (8%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINE----SQEID-YSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F+ F  +  + L RL   E    S+E + Y   +K  Q   + I   W+LR  LG
Sbjct  365   NKKKDFTSFPVYIKAALKRLKFPEDTITSEEAEAYYQEYKAKQ-VDKQITILWTLRVLLG  423

Query  1252  PVLETIILLDRLLFLQES---SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             P+LE+IIL+DR L+L E+   S      L P+FDPV SPRN+ I   K
Sbjct  424   PILESIILVDRFLYLNETIEDSPTKGVWLWPLFDPVTSPRNIVIAATK  471



>ref|XP_007901972.1| PREDICTED: methyltransferase-like protein 25 [Callorhinchus milii]
Length=596

 Score =   107 bits (268),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 133/306 (43%), Gaps = 81/306 (26%)
 Frame = +1

Query  487   ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH------CGFPL  648
             ++ GLH CGDL+   LR F+   E+KAV SVGCCY+LLSEE     DS+       GFP+
Sbjct  365   MMVGLHTCGDLASNTLRIFIAKPELKAVCSVGCCYHLLSEEYEEPADSNDCSQGSWGFPM  424

Query  649   SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             S+ ++      G++AR  AC   +R   +GQ  GL +  L  +RA  Q+I   +Y     
Sbjct  425   SQYLRDSVWQCGRNARMSACLPLER-VTVGQ--GLPSESLF-YRAVLQVIFKEHYGN---  477

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
                         R++H+   +E N   +   K  S  S      D TR SM  LG     
Sbjct  478   ------------RKRHN---VEQNTNSKHVGKIFSKSSG---FVDYTRKSMQKLG-----  514

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
                   DD  L                   S SL   + D               Y   W
Sbjct  515   -----MDDSKL-------------------SDSLIQGYYDI--------------YRPRW  536

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             KE + F         L+  L P +E +ILLDRL +L+E      +ALV +FDP+ SPR  
Sbjct  537   KELEAFNR-------LKVTLAPCIEGLILLDRLCYLKEQESIAWSALVQLFDPIKSPRCY  589

Query  1369  AIIGRK  1386
             A+IG K
Sbjct  590   AVIGVK  595



>emb|CDH60806.1| cra-b-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=467

 Score =   102 bits (255),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 119/241 (49%), Gaps = 47/241 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLA+ ++++YGL +LA+D S     +    A+RI  +   +  K   +   ++      
Sbjct  164  GYLARAIAWKYGLRVLAVDGSE----VQTCGAKRIDHNILKRTSKQNGQVHHVT------  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +++PE +    +G L  +         ++S GQ ++  E  L             L G
Sbjct  214  -EMVTPENI----SGILSNW---------QTSNGQHKDTMEPWL-------------LCG  246

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSV-KAVGL  675
            LHACGDLS  MLR F E +E+ ++++VGCC++ L++E         GFP+S  V K +G 
Sbjct  247  LHACGDLSSLMLRLFAESDEMGSLVNVGCCHHFLTQEE--------GFPMSSFVNKELGY  298

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
                +A  LACQ+  RW    +   L +FE H FRA  Q I++      + K+P +GR  
Sbjct  299  QQTSTAHMLACQTPSRWTDRAEET-LKSFEHHFFRALLQHIMVEKGLTPVDKAPIVGRLN  357

Query  856  K  858
            K
Sbjct  358  K  358


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 11/111 (10%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINE----SQEID-YSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F  F  +  + L R G+ E    +QE + Y   +K  +   + I   W++R  L 
Sbjct  357   NKKKDFISFPIYVRAALKRFGLPEDTISAQEAEAYYEKYKNHKQIDKQIAVLWTIRVLLA  416

Query  1252  PVLETIILLDRLLFLQES------SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L+ES      +      + P+FDP++SPRN  I+  K
Sbjct  417   PVLESIILMDRWLYLKESLLQYPDTKTKGVWMWPLFDPIISPRNTVIVASK  467



>emb|CDH60805.1| protein rrnad1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=491

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 119/241 (49%), Gaps = 47/241 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYLA+ ++++YGL +LA+D S     +    A+RI  +   +  K   +   ++      
Sbjct  188  GYLARAIAWKYGLRVLAVDGSE----VQTCGAKRIDHNILKRTSKQNGQVHHVT------  237

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +++PE +    +G L  +         ++S GQ ++  E  L             L G
Sbjct  238  -EMVTPENI----SGILSNW---------QTSNGQHKDTMEPWL-------------LCG  270

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSV-KAVGL  675
            LHACGDLS  MLR F E +E+ ++++VGCC++ L++E         GFP+S  V K +G 
Sbjct  271  LHACGDLSSLMLRLFAESDEMGSLVNVGCCHHFLTQEE--------GFPMSSFVNKELGY  322

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
                +A  LACQ+  RW    +   L +FE H FRA  Q I++      + K+P +GR  
Sbjct  323  QQTSTAHMLACQTPSRWTDRAEET-LKSFEHHFFRALLQHIMVEKGLTPVDKAPIVGRLN  381

Query  856  K  858
            K
Sbjct  382  K  382


 Score = 65.5 bits (158),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 11/111 (10%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINE----SQEID-YSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F  F  +  + L R G+ E    +QE + Y   +K  +   + I   W++R  L 
Sbjct  381   NKKKDFISFPIYVRAALKRFGLPEDTISAQEAEAYYEKYKNHKQIDKQIAVLWTIRVLLA  440

Query  1252  PVLETIILLDRLLFLQES------SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L+ES      +      + P+FDP++SPRN  I+  K
Sbjct  441   PVLESIILMDRWLYLKESLLQYPDTKTKGVWMWPLFDPIISPRNTVIVASK  491



>emb|CEG72862.1| hypothetical protein RMATCC62417_08345 [Rhizopus microsporus]
Length=361

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 103/240 (43%), Gaps = 48/240 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L++   L +LA+D+S           ERI KH                      
Sbjct  65   GYLSRSLAYRSNLKVLAVDSSEVQTCGAKRFDERIIKH----------------------  102

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
                            L+K DV + + + E            R +     V     +L G
Sbjct  103  ----------------LKKSDVLQLHHVNEFITPDNASTILSRWS----QVQSEKWLLCG  142

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDL+  +LR F    E+  +++VGCCY+ LSE++      HCGFPLS+++K   L 
Sbjct  143  LHTCGDLASMILRLFTASPEMTCLVNVGCCYHFLSEQSP-----HCGFPLSETIKKTNLF  197

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            +G +AR L+ Q  +RW        L   E H FRA  Q I++     V   +P IGR  K
Sbjct  198  IGHTARMLSSQVPERWVEKADDT-LIALEHHFFRALLQQIMVEKGLAVAGAAPVIGRLNK  256


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 9/108 (8%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINESQEID-----YSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F+ F  +  +  +RL +      D     Y   +K  Q     I   WSLRA L 
Sbjct  255   NKKKDFTSFPVYVKAAASRLNLPPDTITDKVAEEYYNDYKARQ-IDRQIAFVWSLRAILA  313

Query  1252  PVLETIILLDRLLFLQES---SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L ++   S   +  L P+FDP+ SPRNM I+  K
Sbjct  314   PVLESIILVDRWLYLNDAIPDSPTKKVCLWPLFDPMTSPRNMVIMATK  361



>emb|CEI98264.1| hypothetical protein RMCBS344292_12377 [Rhizopus microsporus]
Length=344

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 103/240 (43%), Gaps = 48/240 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L++   L +LA+D+S           ERI KH                      
Sbjct  48   GYLSRSLAYRSNLKVLAVDSSEVQTCGAKRFDERIIKH----------------------  85

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
                            L+K DV + + + E            R +     V     +L G
Sbjct  86   ----------------LKKSDVLQLHHVNEFITPDNASTILSRWS----QVQSEKWLLCG  125

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDL+  +LR F    E+  +++VGCCY+ LSE+       HCGFPLS+++K   L+
Sbjct  126  LHTCGDLASMILRLFTASPEMTCLVNVGCCYHFLSEQR-----PHCGFPLSETIKKTNLL  180

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            +G +AR L+ Q  +RW        L   E H FRA  Q I++     V   +P IGR  K
Sbjct  181  IGHTARMLSSQVPERWVEKADDT-LIALEHHFFRALLQQIMVEKGLAVAGAAPVIGRLNK  239


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (53%), Gaps = 9/108 (8%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLG-----INESQEIDYSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F+ F  +  +  +RL      I++    +Y   +K  Q     I   WSLRA L 
Sbjct  238   NKKKDFTSFPVYVKAAASRLNLPPDTISDKVAEEYYNDYKARQ-IDRQIAFVWSLRAILA  296

Query  1252  PVLETIILLDRLLFLQES---SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L ++   S   +  L P+FDP+ SPRNM I+  K
Sbjct  297   PVLESIILVDRWLYLNDAIPDSPTKKVYLWPLFDPMTSPRNMVIMATK  344



>emb|CEI93124.1| hypothetical protein RMCBS344292_07367 [Rhizopus microsporus]
Length=479

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 71/130 (55%), Gaps = 6/130 (5%)
 Frame = +1

Query  469  VGDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPL  648
            V     +L GLH CGDL+  +LR F    E+  +++VGCCY+ LSE++      HCGFPL
Sbjct  251  VQSEKWLLCGLHTCGDLASMILRLFTASPEMTCLVNVGCCYHFLSEQS-----PHCGFPL  305

Query  649  SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
            S+++K   L +G +AR L+ Q  +RW        L   E H FRA  Q I++     V  
Sbjct  306  SETIKKTNLFIGHTARMLSSQVPERWVEKADDT-LIALEHHFFRALLQQIMVEKGLAVAG  364

Query  829  KSPAIGRQGK  858
             +P IGR  K
Sbjct  365  AAPVIGRLNK  374


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 9/108 (8%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINESQEID-----YSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F+ F  +  +  +RL +      D     Y   +K  Q   + I   WSLRA L 
Sbjct  373   NKKKDFTSFPVYVKAAASRLNLPPDTITDKVAEEYYNDYKARQ-IDKQIAFVWSLRAILA  431

Query  1252  PVLETIILLDRLLFLQES---SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L ++   S   +  L P+FDP+ SPRNM I+  K
Sbjct  432   PVLESIILVDRWLYLNDAIPDSPTKKVCLWPLFDPMTSPRNMVIMATK  479



>ref|XP_002005659.1| GI20589 [Drosophila mojavensis]
 gb|EDW09594.1| GI20589 [Drosophila mojavensis]
Length=495

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 117/232 (50%), Gaps = 24/232 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  LS EYGLS+L IDA+  +     +R  ++++ +     ++E  ++  + P+   
Sbjct  160  GYLSSRLSLEYGLSVLGIDANESNTKNALSRDSKLQRAWNGLTERAEILNQGKTPPR---  216

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQ-AQEHSEDRLTPHSYMVGDSSLILA  495
             R     T +   N    KY     Y+  E ++    +EH +D L      V D  + L 
Sbjct  217  -RGKKSPTKETHINTPTNKYKTTSIYITTELNLSDLIKEHFKDEL-----QVVDPRICLT  270

Query  496  GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE----------EAAGKDDSHCGFP  645
            GLH CG+L+ T L+ F   N  + + +VGCCY+LL+E          +A  K  +  GFP
Sbjct  271  GLHTCGNLAATCLQVFHAQNNCRVLCNVGCCYHLLNERYSEQEFFGNKALMKQSTDYGFP  330

Query  646  LSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
            +S+ ++   + LG++AR LA QS +R      A  L N  L+ +RA  ++++
Sbjct  331  MSRYLQERKVKLGRNARMLAAQSIERTLS---AKELPNISLY-YRALLEVLV  378



>emb|CDS12570.1| hypothetical protein LRAMOSA04764 [Absidia idahoensis var. thermophila]
Length=467

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 120/241 (50%), Gaps = 47/241 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ ++++YGL +LA+D S     +    A+RI  +   +  K   +   ++      
Sbjct  164  GYLSRAIAWKYGLRVLAVDGSE----VQTCGAKRIDGNIFKRTCKQNGQLHHIT------  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +++P+ +     G L K+         +SS  Q Q+H+            ++  +L G
Sbjct  214  -EMVTPDNIA----GILSKW---------QSSHDQ-QQHT------------NAPWLLCG  246

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSV-KAVGL  675
            LHACGDLS  MLR F E + + ++++VGCC++ L+++         GFP+S  V + +G 
Sbjct  247  LHACGDLSSLMLRLFAESDAMGSLVNVGCCHHFLTQQE--------GFPMSNFVDQEIGY  298

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
                +A  LACQ+  RW    +   L +FE H FRA  Q I++      + K+P +GR  
Sbjct  299  HPTSTAHMLACQTPSRWTDRAEET-LQSFEHHFFRALLQHIMVEKGLTSVDKAPIVGRLN  357

Query  856  K  858
            K
Sbjct  358  K  358


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 11/111 (10%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINE----SQEID-YSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F  F  +  + L R G+ E    ++E + Y   +K  +   + I   W++R  L 
Sbjct  357   NKKKDFISFPIYVRAALKRFGLPEDTISAEEAETYYNKYKHHKQIDKQIAVLWTIRVLLA  416

Query  1252  PVLETIILLDRLLFLQES------SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L+ES      +      + P+FDP++SPRN  I+  K
Sbjct  417   PVLESIILMDRWLYLKESLAHYPDTKTKGVWMWPLFDPIISPRNTVIVASK  467



>ref|XP_002066087.1| GK22174 [Drosophila willistoni]
 gb|EDW77073.1| GK22174 [Drosophila willistoni]
Length=490

 Score = 94.0 bits (232),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 122/236 (52%), Gaps = 29/236 (12%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +Y   +L IDA++ +      R  ++++ +     ++E E R   +P    
Sbjct  159  GYLSSRLALQYKYRVLGIDANAANTENALERNRKLQRAWNGLTERAELESR--GIPPKCR  216

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQ--AQEHSEDRLTPHSYMVGDSSLIL  492
             +  SP+ L +L N     Y    +++  E ++ Q  A++ +E  ++P       S + L
Sbjct  217  DKQSSPKDLPSLQN-----YKTTSRFITTELNLNQLLAEQFTEFSISP------SSPICL  265

Query  493  AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGF  642
             GLH CG+L+ T L+ F   ++ + + ++GCCY+LL E  + ++           + CGF
Sbjct  266  TGLHTCGNLAATCLQVFHSQSQCQILCNIGCCYHLLKETFSQQEFFGNKSVMDLQTDCGF  325

Query  643  PLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRY  810
            PLS+ ++   + +G++AR LA QS +R      A  L N  L+ +RA  ++++ R+
Sbjct  326  PLSRYLQNRQVRMGRNARMLAAQSIER---TLNAKDLPNISLY-YRACLEVLVCRH  377



>gb|EIE75716.1| hypothetical protein RO3G_00420 [Rhizopus delemar RA 99-880]
Length=321

 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 104/240 (43%), Gaps = 48/240 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L++   L +LA+D+S           ERI KH                      
Sbjct  25   GYLSRSLAYRSNLKVLAVDSSEVQTCGAKRFDERIIKH----------------------  62

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
                            L+K DV + + + E    +       R +       +   +L G
Sbjct  63   ----------------LKKSDVLQLHHVNEFITPENASTILSRWSK----TQNEKWLLCG  102

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDL+  +LR F   +++  +++VGCCY+ LSE+       HCGFP+S  VK   LV
Sbjct  103  LHTCGDLASMILRLFASSDDMTCLVNVGCCYHFLSEQ-----KPHCGFPMSDVVKKTNLV  157

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGK  858
            +G ++R L+ Q  +RW    +   L   E H FRA  Q I+++        +P IGR  K
Sbjct  158  IGHTSRMLSSQVPERWVEKSEDT-LVALEHHFFRALLQFIMVKKGLAEPGAAPVIGRLNK  216


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 60/108 (56%), Gaps = 9/108 (8%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLG-----INESQEIDYSGIWKETQPFTEMIGPYWSLRAALG  1251
             N    F+ F  +  + L+RLG     I + +  DY  ++K  Q   + I   WSLRA L 
Sbjct  215   NKKKDFTSFSVYVQAALSRLGLPAGTITDEEANDYYNMYKAKQ-IDKQIAYVWSLRAILA  273

Query  1252  PVLETIILLDRLLFLQE---SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             PVLE+IIL+DR L+L +    S   +  L P+FDP+ SPRNM I+  K
Sbjct  274   PVLESIILIDRWLYLNDVIPDSPTKKVCLWPLFDPITSPRNMVIMATK  321



>ref|XP_007431353.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Python 
bivittatus]
Length=540

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 117/241 (49%), Gaps = 25/241 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  LS +Y L +  ID+S+ + +  + R  +++KH+ A  R++    R  ++ +   
Sbjct  196  GYLSSFLSLQYNLKVYGIDSSNTNTHGANERNRKLKKHWTAYQRRAGENVRGQALEEAKK  255

Query  319  CRVLSPETLKA-------LSNGSLEKYDVGKQYLIGESSIG-QAQEHSEDR---LTPHSY  465
                  E  KA        +N SLE      Q  +    +  +  E S D    +T   Y
Sbjct  256  RAEQDKEKCKANTSEKPLRTNNSLES-----QVRVAVPDVAFETAELSPDPNICITKKQY  310

Query  466  MVGDSS--LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH--  633
             +   +   ++ GLH CGDL+ + LR F    E+KAV SVGCCY+LLSEE    ++    
Sbjct  311  ELNPEAQDCVIVGLHTCGDLAPSTLRLFNAVPEIKAVCSVGCCYHLLSEEHEMHEEGTRG  370

Query  634  -CGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRY  810
              GFPLS+ +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   
Sbjct  371  IWGFPLSRYLKEEGWFCGRNARMAACLALER-VAVGQVLPTESL---FYRAVLQVIVEEC  426

Query  811  Y  813
            Y
Sbjct  427  Y  427



>ref|XP_002599929.1| hypothetical protein BRAFLDRAFT_74053 [Branchiostoma floridae]
 gb|EEN55941.1| hypothetical protein BRAFLDRAFT_74053 [Branchiostoma floridae]
Length=627

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = +1

Query  484  LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE-EAAGKDDSHCGFPLSKSV  660
            L+L GLH CGDLS TML  F+ C +   + SVGCCYNLL+E E  G  +  CGFPLS+ +
Sbjct  397  LLLTGLHTCGDLSPTMLHLFVTCPQATVLCSVGCCYNLLTEVEKPGAMEEKCGFPLSQLL  456

Query  661  KAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
            +   + LG+++R L+CQ+ +R    G+   +  F    +RA  Q+I+
Sbjct  457  QTKSVHLGRTSRMLSCQAVERISTEGRLPAMSLF----YRAVLQVII  499


 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQEID--YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L RL +  +   D   +  +++ Q     +  +  LRA L P +E  ILLDR
Sbjct  522   FVDYVRRALRRLQLEHAHLSDEEINSYFEQYQGKLRHLHAFIQLRACLAPCIEAFILLDR  581

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L FL E +    AALV +FDPV+SPR  A++  K
Sbjct  582   LCFLHEQTGVSHAALVHVFDPVISPRCYALVAIK  615



>ref|XP_006513594.1| PREDICTED: methyltransferase like 25 isoform X1 [Mus musculus]
Length=572

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 122/278 (44%), Gaps = 57/278 (21%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESE--------DRE  294
            GYL+  LS +YGL++  ID+S+ + +    R  +++KH++     S ++         RE
Sbjct  181  GYLSSFLSLKYGLNVYGIDSSNTNTHGAKERNRKLKKHWSLYHPHSRADANGWASERPRE  240

Query  295  LSVPKTVTCRVLSPETLKA-LSNGSLEKYDVGKQYLIGESSIGQAQEHSE----------  441
            L VPK V C+  +    ++ L N  L   D    +     S+ + Q+ +           
Sbjct  241  LKVPKGVECKGDAESVQRSRLGNPDLSATDGLPDFSGSAISVIRKQQKNVLAQPAEEENL  300

Query  442  --------------DRLTPHSYMVGDSS---------------LILAGLHACGDLSVTML  534
                          D + P S  V ++                 ++ GLH CGDL+ + L
Sbjct  301  YFEDAFSLIDFLPVDAIEPTSSQVQNTEKSGLRKERRNTASKDCLMVGLHTCGDLAPSTL  360

Query  535  RTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC-----GFPLSKSVKAVGLVLGKSARD  699
            R F    EVKAV SVGCCY+LLSEE   +    C     GFP+   +K      G++AR 
Sbjct  361  RIFTSKAEVKAVCSVGCCYHLLSEEFENQHKDRCANENWGFPMCHYLKEERWCCGRNARM  420

Query  700  LACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
             AC +  R   +GQ  GL    L  +RA  Q I+  YY
Sbjct  421  SACLALQR-VAVGQ--GLPTESLF-YRAVLQNIIKDYY  454


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINES---QEI--DYSGIWKETQPFTEMIGPYWSLRAALGPVLETI  1269
             S F+++    L +LG++ES   +EI  DY   ++  +P    +  +  L+  L P +ET+
Sbjct  471   SSFLEYVRMSLKKLGLDESKVSEEIIMDY---YENYKPRMNELEAFNMLKVVLAPCIETL  527

Query  1270  ILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ILLDRL +L+E      +ALV +FDPV SPR  A+I  K
Sbjct  528   ILLDRLCYLKEQDGVAWSALVKLFDPVQSPRCYAVIALK  566



>emb|CDS10716.1| hypothetical protein LRAMOSA11202 [Absidia idahoensis var. thermophila]
Length=449

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 103/222 (46%), Gaps = 53/222 (24%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L+F++ L +LA+D S     +    AE+  +      R +E++ + ++      
Sbjct  157  GYLSRALAFQHDLEVLAVDKS----EVQTRGAEKFDRRTMRAERTTETKLQHVT------  206

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +++PE +                                D LT       D   ++ G
Sbjct  207  -EMITPENIS-------------------------------DVLTRWGRCDDDKPWLICG  234

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LHACGDLS  ++R F E  +V  +++VGCCY+ LSE          GFP+S+ ++     
Sbjct  235  LHACGDLSPMIMRLFEESKQVTCLVNVGCCYHYLSE----------GFPMSQLLRERRYD  284

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILL  804
            LG +AR LAC S  +W+    AA   +FE H FRA  Q I++
Sbjct  285  LGTTARVLACHSPWQWKS-QVAASKKSFEQHFFRALLQQIMV  325


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 5/58 (9%)
 Frame = +1

Query  1228  WSLRAALGPVLETIILLDRLLFLQE-----SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             W++R+ L PVLE++IL+DR L+L+E     S++     + P+FDP  SPRN+  +  K
Sbjct  392   WTIRSLLAPVLESLILMDRWLYLKEAVGDRSNEHSGVWMWPLFDPTESPRNVVFVASK  449



>gb|EPB87587.1| hypothetical protein HMPREF1544_05569 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=463

 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 106/239 (44%), Gaps = 47/239 (20%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L+F+YGL +LA+D S      T       +K   ++  K E E+++ S+ K VT
Sbjct  163  GYLSRALAFDYGLEVLAVDMSEIQ---TQGAVRFDKKALKSQGIKEEDEEQQPSL-KHVT  218

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             ++      + L+  S E  D                               D   ++ G
Sbjct  219  EKITPENIAQVLAKWSPESSD-------------------------------DKKWLVTG  247

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG--  672
            LH CGDLS  +   F +  EV  V++VGCCYN L+           GFP+S  +K     
Sbjct  248  LHTCGDLSPMIFNLFAQSKEVSCVVNVGCCYNALTT---------SGFPMSDYLKEKKDL  298

Query  673  LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
            + +G +AR L+C S  RW   G+   +  F+ + FRA  Q +L+      +   P +GR
Sbjct  299  IKVGSTARVLSCHSPSRWVDEGEQC-IKAFDNYYFRALLQEMLVERNLSDINDPPRLGR  356



>ref|XP_007808434.1| hypothetical protein MAC_02094 [Metarhizium acridum CQMa 102]
 gb|EFY91809.1| hypothetical protein MAC_02094 [Metarhizium acridum CQMa 102]
Length=589

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 138/328 (42%), Gaps = 73/328 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYNL++E+       H          
Sbjct  300   LMAISIHSCGNLSHYAIRSLILNPDIRAIAIVGCCYNLMTEKLGPPTYKHAYLRPTLQAL  359

Query  637   --------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+SK        G+ L  +AR +ACQ+   W  +   A    F 
Sbjct  360   NGRVGRESSRFDPQGFPMSKKFCTYDDDGVRLNVTARMMACQAPKNWDSVDSEAF---FS  416

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H FRA  Q I L                   +++ HH             P+N+ G ++
Sbjct  417   RHFFRAVLQKIFL---------------DRGVVKQIHH------------VPENTDGQAT  449

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
             +K    +   S   +  G   K    C         SS R+        + + + + ++ 
Sbjct  450   RKPGPFD--VSTQPITVGGLRK---NC--------YSSLRAYVRGTIEKLTTSTEYRQYA  496

Query  1126  DSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
             D    ++     +EID Y     E  P  + +   WSL A    V+E++I++DR +FL+E
Sbjct  497   DVMNDKMADITDEEIDKYEA---EYLPRKKELCVTWSLMAFSAMVVESMIVVDRWMFLKE  553

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              ++  +A +  +FD  +SPRN+ ++G K
Sbjct  554   QAEVGDAWVETVFDYGISPRNLVVVGVK  581



>gb|EXM36406.1| hypothetical protein FOTG_00577 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM36407.1| hypothetical protein FOTG_00577 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=597

 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 88/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  304   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q I L     V+ K    G QG++                    +  + 
Sbjct  422   -FSRHFYRAVLQKIFLD--RGVVKKVRHTGSQGES--------------------QADTA  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  459   ASTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  504

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  505   EYKQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDR  561

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  562   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>emb|CEI91742.1| Putative Inositol oxygenase [Rhizopus microsporus]
Length=651

 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 106/237 (45%), Gaps = 53/237 (22%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L+F++G  ++A+D S     I    A R    +  K +K   +  E+S+ + VT
Sbjct  360  GYLSRALAFDHGFDVVAVDMSE----IQTKGAIR----FDEKAKKQARDKSEMSI-RHVT  410

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             +V      + L++  L+                                 G+   ++ G
Sbjct  411  EKVTPENVSQVLASTGLD---------------------------------GNKKWLVTG  437

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDLS T+ R F E +++  +++VGCCYN L+           GFP+S  ++   + 
Sbjct  438  LHTCGDLSPTIFRLFTESDKISCMVNVGCCYNALTP---------SGFPMSSLLREKKME  488

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
            L  +AR LAC S  RW  L     +  F+ + FRA  Q +L+      +   P +GR
Sbjct  489  LKSTARVLACHSPSRW--LEGEPCIEAFDNYFFRALLQEMLVERELSDINDPPILGR  543


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 12/103 (12%)
 Frame = +1

Query  1111  FMKFCDSGLARLG-----INESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F  F  + L RL      I E +  D+    KE Q   + +   W+LRA L  ++E+IIL
Sbjct  550   FTSFVAASLKRLKLPPDTITEQEARDHYLKAKEKQADKQFVT-LWTLRALLASIVESIIL  608

Query  1276  LDRLLFLQESSDWVEAA------LVPIFDPVLSPRNMAIIGRK  1386
             +DR L+L+ES   +E +        P+FD V SPRN+  +  K
Sbjct  609   VDRWLYLEESVSSLENSQHKGVWAYPLFDQVASPRNVVYVASK  651



>emb|CEG71773.1| hypothetical protein RMATCC62417_07446 [Rhizopus microsporus]
Length=460

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 106/237 (45%), Gaps = 53/237 (22%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L+F++G  ++A+D S     I    A R    +  K +K   +  E+S+ + VT
Sbjct  169  GYLSRALAFDHGFDVVAVDMSE----IQTKGAIR----FDEKAKKQARDKNEMSI-RHVT  219

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             +V      + L++  L+                                 G+   ++ G
Sbjct  220  EKVTPENVSQVLASTGLD---------------------------------GNKKWLVTG  246

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDLS T+ R F E +++  +++VGCCYN L+           GFP+S  ++   + 
Sbjct  247  LHTCGDLSPTIFRLFTESDKISCMVNVGCCYNALTP---------SGFPMSSLLREKKIE  297

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGR  849
            L  +AR LAC S  RW  L     +  F+ + FRA  Q +L+      +   P +GR
Sbjct  298  LKSTARVLACHSPSRW--LEGEPCIEAFDNYFFRALLQEMLVERELSDINDPPILGR  352


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 12/103 (12%)
 Frame = +1

Query  1111  FMKFCDSGLARLG-----INESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F  F  + L RL      I E +  D+    KE Q   + +   W+LRA L  ++E+IIL
Sbjct  359   FTSFVAASLKRLKLPPDTITEQEARDHYLKAKEKQADKQFVT-LWTLRALLASIVESIIL  417

Query  1276  LDRLLFLQESSDWVEAA------LVPIFDPVLSPRNMAIIGRK  1386
             +DR L+L+ES   +E +        P+FD V SPRN+  +  K
Sbjct  418   VDRWLYLEESVSSLENSQHKGVWAYPLFDQVASPRNVVYVASK  460



>ref|NP_001082903.1| protein RRNAD1 [Danio rerio]
Length=574

 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 84/320 (26%), Positives = 122/320 (38%), Gaps = 93/320 (29%)
 Frame = +1

Query  481   SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDD-----------  627
             S +L GLHACGDLS T+LR F  C  V  + SV CCY  +S +                 
Sbjct  324   SFVLTGLHACGDLSATLLRHFTNCPHVNVITSVACCYMKISTKENPNPPGVFQPPFFSDI  383

Query  628   ------SHCGFPLSKSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRAT  786
                   S  G+P+S  V+ + G  L   AR+ AC                    HA    
Sbjct  384   TTADFCSEFGYPMSNWVRGLTGHQLSYKAREGAC--------------------HAIEEY  423

Query  787   FQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDE  966
              Q +                R+  TL R H  RA+  N+                     
Sbjct  424   LQRL----------------REESTLLRTHCYRAILENI---------------------  446

Query  967   TRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARL  1146
              R    D+      + GV     A  H +S +          V  F    K+    L R+
Sbjct  447   IRAHRPDIR-----RPGVQTVKKA--HMLSFS--------ELVTFFCHIRKYARLALPRV  491

Query  1147  GINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAA  1326
             G+      D   +        +++  Y+SL   L PV+ET++LLDR++FLQE     ++ 
Sbjct  492   GLPADLPFDPVCVDAMLAQQGKVVA-YFSLVLLLAPVVETLVLLDRIIFLQERG--FQSK  548

Query  1327  LVPIFDPVLSPRNMAIIGRK  1386
             L+P+FD   SPRN+ ++  K
Sbjct  549   LIPLFDAAFSPRNLVLVAVK  568



>ref|XP_004083212.1| PREDICTED: methyltransferase-like protein 25-like [Oryzias latipes]
Length=591

 Score = 87.8 bits (216),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 127/298 (43%), Gaps = 77/298 (26%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHY---------------AAKIRK  273
            GYL+  LS +YGL +  ID+SS + +    R  +++K Y               A   R 
Sbjct  177  GYLSSFLSLQYGLQVYGIDSSSTNTHGAQERNRKLKKFYRVYQKQAKAGRTRGEATAQRG  236

Query  274  SESEDRELSVPKTVTC--------------------------RVLSPET----LKALSNG  363
            SE  + EL   +   C                            LSP++    L ALS  
Sbjct  237  SEKVEPELKEDEDALCVDASRNESQEEEGLPIISSSPAAGRQTELSPDSEELFLSALSAD  296

Query  364  SLEKYD--VGKQYLIGESSIGQAQEHSE-----------DRLTP-HSYMVGDSSL-----  486
             LE     V    L  E    + +E+ E           D  +P  SY+  ++ L     
Sbjct  297  VLEPASPRVPPSQLSDEEKERRKRENVERKAQSRRDGASDVFSPLTSYVTAETELRELIT  356

Query  487  -----ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCG  639
                 ++ GLH CG+L+ + LR F+   E+ AV SVGCCY+LLSEE   AG +  D  CG
Sbjct  357  ELEDAVMVGLHTCGNLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDPAGPESLDRSCG  416

Query  640  FPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            FPLS+ +       G++AR  AC + +R   LGQ   + +     +RA   +IL  +Y
Sbjct  417  FPLSQYLHDRSCFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHY  470


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L +L ++ES+  + D      + +P    +  +  L+  + P +E +ILLDR
Sbjct  489   FLDYVRRALRKLELDESKLSDNDIQDYHDKYRPRMAEMHAFNMLKVTIAPCIEGLILLDR  548

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  549   LCYLKEQEDVTFSALVQLFDPLLSPRCYAVIGLK  582



>gb|EMT65364.1| hypothetical protein FOC4_g10011347 [Fusarium oxysporum f. sp. 
cubense race 4]
Length=531

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  238   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  297

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  298   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  355

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L     V+ K    G QG++                    +  + 
Sbjct  356   -FSRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTA  392

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  393   ASTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  438

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  439   EYKQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDR  495

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  496   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  530



>gb|ENH64693.1| hypothetical protein FOC1_g10013969 [Fusarium oxysporum f. sp. 
cubense race 1]
Length=530

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  237   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  296

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  297   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  354

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L     V+ K    G QG++                    +  + 
Sbjct  355   -FSRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTA  391

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  392   ASTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  437

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  438   EYKQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDR  494

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  495   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  529



>gb|EWY98802.1| hypothetical protein FOYG_03115 [Fusarium oxysporum FOSC 3-a]
 gb|EWY98803.1| hypothetical protein FOYG_03115 [Fusarium oxysporum FOSC 3-a]
Length=597

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  304   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L     V+ K    G QG++                    +  + 
Sbjct  422   -FSRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTA  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  459   ASTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  504

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  505   EYKQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDR  561

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  562   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>gb|EGU81852.1| hypothetical protein FOXB_07647 [Fusarium oxysporum Fo5176]
 gb|EXK42257.1| hypothetical protein FOMG_05289 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXL85926.1| hypothetical protein FOPG_02195 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL85927.1| hypothetical protein FOPG_02195 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM08423.1| hypothetical protein FOIG_03088 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM08424.1| hypothetical protein FOIG_03088 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=597

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  304   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L     V+ K    G QG++                    +  + 
Sbjct  422   -FSRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTA  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  459   ASTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  504

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  505   EYKQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDR  561

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  562   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>emb|CDH52943.1| cra-b-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=448

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 105/222 (47%), Gaps = 53/222 (24%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L+F++ L +LA+D S     +    AE+  +      R +E++ + ++      
Sbjct  155  GYLSRALAFQHDLEVLAVDKS----EVQTRGAEKFDRRTMRAERTTETKLQHVT------  204

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +++PE +           DV  ++       G+  +              D   ++ G
Sbjct  205  -EMITPENIS----------DVLSRW-------GRCDD--------------DKPWLICG  232

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDLS  ++R F E  +V  +++VGCCY+ L+E          GFP+S+ ++     
Sbjct  233  LHTCGDLSPMIMRLFEESKQVTCLVNVGCCYHYLTE----------GFPMSRLLREREYE  282

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILL  804
            LG +AR LAC S  +W+     A   +FE H FRA  Q I++
Sbjct  283  LGTTARVLACHSPWQWKS-QVGASKKSFEQHFFRALLQQIMV  323


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 15/87 (17%)
 Frame = +1

Query  1159  SQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE----------S  1305
             S+EI+ Y   +K T+   + I   W++R+ L PVLE++IL+DR L+L++          S
Sbjct  366   SEEIESYYNDYKYTRAADKQIIALWTIRSLLAPVLESLILMDRWLYLKQAVGEDRNDEHS  425

Query  1306  SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
               W    + P+FDP  SPRN+  +  K
Sbjct  426   GVW----MWPLFDPTESPRNVVFVASK  448



>emb|CDH52942.1| cra-b-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=450

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 105/222 (47%), Gaps = 53/222 (24%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL++ L+F++ L +LA+D S     +    AE+  +      R +E++ + ++      
Sbjct  157  GYLSRALAFQHDLEVLAVDKS----EVQTRGAEKFDRRTMRAERTTETKLQHVT------  206

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +++PE +           DV  ++       G+  +              D   ++ G
Sbjct  207  -EMITPENIS----------DVLSRW-------GRCDD--------------DKPWLICG  234

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVGLV  678
            LH CGDLS  ++R F E  +V  +++VGCCY+ L+E          GFP+S+ ++     
Sbjct  235  LHTCGDLSPMIMRLFEESKQVTCLVNVGCCYHYLTE----------GFPMSRLLREREYE  284

Query  679  LGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILL  804
            LG +AR LAC S  +W+     A   +FE H FRA  Q I++
Sbjct  285  LGTTARVLACHSPWQWKS-QVGASKKSFEQHFFRALLQQIMV  325


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 15/87 (17%)
 Frame = +1

Query  1159  SQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE----------S  1305
             S+EI+ Y   +K T+   + I   W++R+ L PVLE++IL+DR L+L++          S
Sbjct  368   SEEIESYYNDYKYTRAADKQIIALWTIRSLLAPVLESLILMDRWLYLKQAVGEDRNDEHS  427

Query  1306  SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
               W    + P+FDP  SPRN+  +  K
Sbjct  428   GVW----MWPLFDPTESPRNVVFVASK  450



>ref|XP_006821789.1| PREDICTED: methyltransferase-like protein 25-like [Saccoglossus 
kowalevskii]
Length=541

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 123/271 (45%), Gaps = 49/271 (18%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+Q LS +YGL+++ ID+++ +      R  +I+K +    RK+  +   L   +++ 
Sbjct  163  GYLSQHLSLQYGLNVIGIDSANINTTGALERNRKIKKFWPGLHRKANVQKSPLKTDESMV  222

Query  319  CRVLSPETLKALSNGSLEKY-----DVGKQYLIGESS-------IGQAQEHSE-------  441
             ++ +      L + ++ K      + G    IG++        +  A   +E       
Sbjct  223  NKLGNDVMQIGLIDSTVSKMVDCQVEAGNLATIGDADGRGKTVDLKHAVVSAEIKDKMCS  282

Query  442  --------DRLTPHSYMVGD----SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGC  585
                    D  T  + M  D      L++ GLH CGDLS  +LR F   + VK + +VGC
Sbjct  283  FRPVTAYVDTQTQITSMFEDGDNIEDLLVTGLHTCGDLSACILRMFTHDDSVKILCNVGC  342

Query  586  CYNLLSEE--------------AAGKDDSHCGFPLSKSVKAVGLVLGKSARDLACQSADR  723
            CY+L+SE+               +   DS  GFP+S  ++     +G+SAR L+C S DR
Sbjct  343  CYHLISEKFEDESERHVAMPTCISSSSDSEYGFPMSDVLRRKEATIGRSARMLSCLSVDR  402

Query  724  WRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
                 +      F    +RA  Q+I+ ++Y+
Sbjct  403  IESDVKLPSQSLF----YRAVLQVIIQQHYT  429


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ----EI-DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F+++    L +L  +E++    EI +Y   + + + + E    Y   +A   P++E++I+
Sbjct  447   FVEYVRKSLKKLHYDENKLSDDEITEYYNKYSQQERYIECFTQY---KAIFAPIIESLII  503

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             LDR  +L +  D  EA +V +FDPV+SPR  A+I  K
Sbjct  504   LDRFAYLLQQDDICEAHIVKLFDPVISPRCFALIALK  540



>gb|KID86848.1| RNA small subunit methyltransferase [Metarhizium guizhouense 
ARSEF 977]
Length=584

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 140/328 (43%), Gaps = 73/328 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYNL++E        H          
Sbjct  300   LMAMSIHSCGNLSHYAIRSLILNPDIRAIAIVGCCYNLMTERLGPPTYKHAYLRPTLQAL  359

Query  637   --------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S+   +    G+ L  +AR +ACQ+   W  L   A    F 
Sbjct  360   NGRVGRESFRFDPQGFPMSQKFCTYDDDGVRLNVTARMMACQAPQNWDRLDSEAF---FS  416

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H FRA  Q I L                   +++ HH             P+++ G ++
Sbjct  417   RHFFRAVLQKIFL---------------DRGVVKQIHH------------VPEDTDGQAA  449

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
             ++    +   S   +  G   KK   C         SS R+      + + + + + ++ 
Sbjct  450   RRPGPFD--VSTQPVTVGGLPKK---C--------YSSLRAYVRGTIDKLTTSTEYRQYA  496

Query  1126  DSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
             D    ++     +EID Y     E  P  + +   WSL A    V+E++I++DR +FL+E
Sbjct  497   DVMNDKMADITDEEIDTYEA---EYLPRKKELCVTWSLMAFSAMVVESMIVVDRWMFLKE  553

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              ++  +A +  +FD  +SPRN+ ++G K
Sbjct  554   QAEVGDAWVETVFDYGISPRNLVVVGVK  581



>gb|KID73454.1| RNA small subunit methyltransferase, partial [Metarhizium brunneum 
ARSEF 3297]
Length=584

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 140/328 (43%), Gaps = 73/328 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYNL++E        H          
Sbjct  300   LMAMSIHSCGNLSHYAIRSLILNPDIRAIAIVGCCYNLMTERLGPPTYKHAYLRPTLQAL  359

Query  637   --------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S+   +    G+ L  +AR +ACQ+   W  L   A    F 
Sbjct  360   NGRVGRESFRFDPQGFPMSQKFCTYDDDGVRLNVTARMMACQAPQNWDRLDSEAF---FS  416

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H FRA  Q I L                   +++ HH             P+++ G ++
Sbjct  417   RHFFRAVLQKIFL---------------DRGVVKQIHH------------VPEDTDGQAA  449

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
             ++    +   S   +  G   KK   C         SS R+      + + + + + ++ 
Sbjct  450   RRPGPFDV--STQPVTVGGLPKK---C--------YSSLRAYVRGTIDKLTTSTEYRQYA  496

Query  1126  DSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
             D    ++     +EID Y     E  P  + +   WSL A    V+E++I++DR +FL+E
Sbjct  497   DVMNDKMADITDEEIDKYEA---EYLPRKKELCVTWSLMAFSAMVVESMIVVDRWMFLKE  553

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              ++  +A +  +FD  +SPRN+ ++G K
Sbjct  554   QAEVGDAWVETVFDYGISPRNLVVVGVK  581



>gb|KFG85114.1| hypothetical protein MANI_002150 [Metarhizium anisopliae]
 gb|KID64271.1| RNA small subunit methyltransferase, partial [Metarhizium anisopliae 
ARSEF 549]
Length=584

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 140/328 (43%), Gaps = 73/328 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYNL++E        H          
Sbjct  300   LMAMSIHSCGNLSHYAIRSLILNPDIRAIAIVGCCYNLMTERLGPPTYKHAYLRPTLQAL  359

Query  637   --------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S+   +    G+ L  +AR +ACQ+   W  L   A    F 
Sbjct  360   NGRVGRESFRFDPQGFPMSQKFCTYDDDGVRLNVTARMMACQAPQNWDRLDSEAF---FA  416

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H FRA  Q I L                   +++ HH             P+++ G ++
Sbjct  417   RHFFRAVLQKIFL---------------DRGVVKQIHH------------VPEDTDGQAA  449

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
             ++    +   S   +  G   KK   C         SS R+      + + + + + ++ 
Sbjct  450   RRPGPFDV--STQPVTVGGLPKK---C--------YSSLRAYVRGTIDKLTTSTEYRQYA  496

Query  1126  DSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
             D    ++     +EID Y     E  P  + +   WSL A    V+E++I++DR +FL+E
Sbjct  497   DVMNDKMADITDEEIDKYEA---EYLPRKKELCVTWSLMAFSAMVVESMIVVDRWMFLKE  553

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              ++  +A +  +FD  +SPRN+ ++G K
Sbjct  554   QAEVGDAWVETVFDYGISPRNLVVVGVK  581



>ref|XP_007817714.1| hypothetical protein MAA_01525 [Metarhizium robertsii ARSEF 23]
 gb|EFZ04451.1| RNA small subunit methyltransferase [Metarhizium robertsii ARSEF 
23]
 gb|EXV00238.1| methyltransferase [Metarhizium robertsii]
Length=584

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 140/328 (43%), Gaps = 73/328 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYNL++E        H          
Sbjct  300   LMAMSIHSCGNLSHYAIRSLILNPDIRAIAIVGCCYNLMTERLGPPTYKHAYLRPTLQAL  359

Query  637   --------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S+   +    G+ L  +AR +ACQ+   W  L   A    F 
Sbjct  360   NGRVGRESFRFDAQGFPMSQKFCTYDDDGVRLNVTARMMACQAPQNWDRLDSEAF---FS  416

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H FRA  Q I L                   +++ HH             P+++ G ++
Sbjct  417   RHFFRAVLQKIFL---------------DRGVVKQIHH------------VPEDTDGQAA  449

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
             ++    +   S   +  G   KK   C         SS R+      + + + + + ++ 
Sbjct  450   RRPGPFDV--STQPVTVGGLPKK---C--------YSSLRAYVRGTIDKLTTSTEYRQYA  496

Query  1126  DSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
             D    ++     +EID Y     E  P  + +   WSL A    V+E++I++DR +FL+E
Sbjct  497   DVMNDKMADITDEEIDKYEA---EYLPRKKELCVTWSLMAFSAMVVESMIVVDRWMFLKE  553

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              ++  +A +  +FD  +SPRN+ ++G K
Sbjct  554   QAEVGDAWVETVFDYGISPRNLVVVGVK  581



>ref|XP_005374447.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Chinchilla 
lanigera]
Length=552

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 123/256 (48%), Gaps = 42/256 (16%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHY---------------AAKIRK  273
            GYL+  LS +YGL++  ID+S+ + +    R  +++KH+               A K+ K
Sbjct  193  GYLSSFLSLKYGLNVYGIDSSNSNTHGAKERNRKLKKHWKLYRTQSRVDANGGLALKMAK  252

Query  274  SESEDRELSVPKTVTCRVLSPETLK--ALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDR  447
             +    E+   K  T +V +  + K   + N  + +   G++ ++ +S+    + +    
Sbjct  253  EKKVQNEMKY-KADTEKVCNNNSAKQEKIPNAEMSEAARGRRRMVPQSN----ESNIYSP  307

Query  448  LTPHSYMVGDSSL----------ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNL  597
            LT  S++  DS L          ++ GLH CGDL+   LR F   +E+K V SVGCCY+L
Sbjct  308  LT--SFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSKSEIKGVCSVGCCYHL  365

Query  598  LSEEAAGK----DDSHCGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
            LSEE   +     +   GFP+ + +K      G +AR  AC + +R   +GQ  GL    
Sbjct  366  LSEEFENEHKECTEEKWGFPMCQYLKEERWCCGHNARMSACLALERV-AIGQ--GLSTES  422

Query  766  LHAFRATFQMILLRYY  813
            L  +RA  Q I+   Y
Sbjct  423  LF-YRAVLQDIIKDCY  437


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 58/99 (59%), Gaps = 8/99 (8%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINESQE-----IDYSGIWKETQPFTEMIGPYWSLRAALGPVLETI  1269
             S F+ +    L +LG++E++      +DY   +++ +P    +  +  L+  L P +ET+
Sbjct  454   SSFLDYVRKSLKKLGLDETKLPENTILDY---YEKYKPRRNELEAFNMLKVVLAPCVETL  510

Query  1270  ILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ILLDRL +L+E  D   +ALV +FDPV SPR  AII  K
Sbjct  511   ILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAIIALK  549



>gb|EXA50152.1| hypothetical protein FOVG_02983 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA50153.1| hypothetical protein FOVG_02983 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXL00405.1| hypothetical protein FOQG_00594 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL00406.1| hypothetical protein FOQG_00594 [Fusarium oxysporum f. sp. raphani 
54005]
Length=597

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 87/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  304   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L     V+ K    G QG++                    +  + 
Sbjct  422   -FSRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTA  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  459   VSTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  504

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  505   EYKQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDR  561

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  562   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>gb|EWZ44884.1| hypothetical protein FOZG_05456 [Fusarium oxysporum Fo47]
 gb|EWZ44885.1| hypothetical protein FOZG_05456 [Fusarium oxysporum Fo47]
 gb|EXL62210.1| hypothetical protein FOCG_00956 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL62211.1| hypothetical protein FOCG_00956 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=597

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 86/333 (26%), Positives = 141/333 (42%), Gaps = 73/333 (22%)
 Frame = +1

Query  481   SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC--------  636
             SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H         
Sbjct  306   SLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTLQA  365

Query  637   ---------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLHNF  762
                            GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG   F
Sbjct  366   VNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF--F  422

Query  763   ELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGS  942
               H +RA  Q + L     V+ K    G QG++                    +  +  S
Sbjct  423   SRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTAAS  460

Query  943   SQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL---F  1113
             +Q  SE     S + +  G+  K              S   S K+    AV+  +    +
Sbjct  461   TQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNNEY  506

Query  1114  MKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLL  1290
              ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR  
Sbjct  507   KQYADVMQEKMGDISDEEIERYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDRWT  563

Query  1291  FLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  564   FLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>gb|ERL89579.1| hypothetical protein D910_06944 [Dendroctonus ponderosae]
Length=425

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 125/284 (44%), Gaps = 49/284 (17%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+ +L+  Y + +L +DAS  + N    RA ++ K +   +   ++ +  ++  K +T
Sbjct  125  GYLSSMLALHYQIPVLGVDASEINTNGAVDRANKLSKVWNGVVTNIKTRETSINCYKQIT  184

Query  319  C----RVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSL  486
                 +V  PE +   SN  L+K D           IG                      
Sbjct  185  KFVDEKVDFPELI---SNIFLQKSD----------KIG----------------------  209

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             L GLH CG+L+ T L+ + EC+ ++ + +VGCCY+ L+EE      +  GFPLS  +K 
Sbjct  210  -LVGLHTCGNLTPTCLKIYNECDSIRTICNVGCCYHHLTEEFPKAPSNKIGFPLSAFLKN  268

Query  667  VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
                +G+ AR +A QS +R            F    +RA F++I  ++     +K   +G
Sbjct  269  KECAIGRGARMVAAQSIERILDSKDQPNRSIF----YRALFEIIKNQHSQAECLKEKQVG  324

Query  847  RQGKTL-----RRQHHQRALESNLQCQDCPKNSSGGSSQKRSED  963
            R  K +       Q   + LE  L+  +   N+     + RS++
Sbjct  325  RFRKPIPLFLDYVQKASKRLEMPLEVSETYINALLAEFEHRSDE  368


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  1108  LFMKFCDSGLARLGIN-ESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             LF+ +      RL +  E  E   + +  E +  ++ I  ++ +RA L PV+E++I+LDR
Sbjct  332   LFLDYVQKASKRLEMPLEVSETYINALLAEFEHRSDEIDLFYLIRAMLAPVVESLIILDR  391

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             +LFL E+  +  + +V  FDPVLSPR   I+  K
Sbjct  392   VLFLLENEHY-NSFIVQFFDPVLSPRCYGIVSIK  424



>gb|EWZ98235.1| hypothetical protein FOWG_02427 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ98236.1| hypothetical protein FOWG_02427 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=597

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 86/333 (26%), Positives = 141/333 (42%), Gaps = 73/333 (22%)
 Frame = +1

Query  481   SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC--------  636
             SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H         
Sbjct  306   SLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTLQA  365

Query  637   ---------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLHNF  762
                            GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG   F
Sbjct  366   VNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF--F  422

Query  763   ELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGS  942
               H +RA  Q + L     V+ K    G QG++                    +  +  S
Sbjct  423   SRHFYRAVLQKMFLD--RGVVKKVRHTGSQGES--------------------QADTAAS  460

Query  943   SQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL---F  1113
             +Q  SE     S + +  G+  K              S   S K+    AV+  +    +
Sbjct  461   TQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNNEY  506

Query  1114  MKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLL  1290
              ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR  
Sbjct  507   KQYADVMQEKMGDISDEEIEKYEALY---MPRKKELCAVWSLMAFSAMAVESLIVSDRWT  563

Query  1291  FLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  564   FLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>gb|ENN81253.1| hypothetical protein YQE_02347, partial [Dendroctonus ponderosae]
Length=425

 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 125/284 (44%), Gaps = 49/284 (17%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+ +L+  Y + +L +DAS  + N    RA ++ K +   +   ++ +  ++  K +T
Sbjct  125  GYLSSMLALHYQIPVLGVDASEINTNGAVDRANKLSKVWNGVVTNIKTRETSINCYKQIT  184

Query  319  C----RVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSL  486
                 +V  PE +   SN  L+K D           IG                      
Sbjct  185  KFVDEKVDFPELI---SNIFLQKSD----------QIG----------------------  209

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA  666
             L GLH CG+L+ T L+ + EC+ ++ + +VGCCY+ L+EE      +  GFPLS  +K 
Sbjct  210  -LVGLHTCGNLTPTCLKIYNECDAIRTICNVGCCYHHLTEEFPKAPSNKIGFPLSAFLKN  268

Query  667  VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIG  846
                +G+ AR +A QS +R            F    +RA F++I  ++     +K   +G
Sbjct  269  KECAIGRGARMVAAQSIERILDSKDQPNRSIF----YRALFEIIKNQHSQAECLKEKQVG  324

Query  847  RQGKTL-----RRQHHQRALESNLQCQDCPKNSSGGSSQKRSED  963
            R  K +       Q   + LE  L+  +   N+     + RS++
Sbjct  325  RFRKPIPLFLDYVQKASKRLEMPLEVSETYINALLAEFEHRSDE  368


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  1108  LFMKFCDSGLARLGIN-ESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             LF+ +      RL +  E  E   + +  E +  ++ I  ++ +RA L PV+E++I+LDR
Sbjct  332   LFLDYVQKASKRLEMPLEVSETYINALLAEFEHRSDEIDLFYLIRAMLAPVVESLIILDR  391

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             +LFL E+  +  + +V  FDPVLSPR   I+  K
Sbjct  392   VLFLLENEHY-NSFIVQFFDPVLSPRCYGIVSIK  424



>gb|ELU10992.1| hypothetical protein CAPTEDRAFT_157654 [Capitella teleta]
Length=475

 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/232 (29%), Positives = 112/232 (48%), Gaps = 28/232 (12%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL   LS  + L +L ID+S  + +  D R +R+ KH+   +R SE+ +R+    +  +
Sbjct  142  GYLGCHLSLMHNLCVLGIDSSEVNTSSADQRKQRLEKHWQGLLRNSENPERKKGRRRRKS  201

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDS---SLI  489
             +   P +  A SN     Y     ++  E+ + Q        +T H    GD+   + +
Sbjct  202  PQG-QPRSTPAKSN-----YVPITHFVTNETDLMQL-------VTDHFPFEGDAECGNFM  248

Query  490  LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGK--------DDSHCGFP  645
            LAGLH CG+L  +++R F   +++  + ++GCCY+LL E+            D    GFP
Sbjct  249  LAGLHTCGNLGASIMRLFASNSDLGILCNIGCCYHLLEEDYLRNPHLKHDEPDSPLTGFP  308

Query  646  LSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
            L   +      +G++AR LA QS +R   +     L N  L  +RA  Q++L
Sbjct  309  LCSYLTGKKAQIGRNARMLAAQSLER---MADGCQLPNISLF-WRAVLQVML  356


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  1201  PFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIG  1380
             P  + +  ++ L+A   P +E++ILLDRL FL E     +A LV +F PV SPR  AI+ 
Sbjct  410   PLQKQMSAFFLLKALFAPCIESLILLDRLAFLLEQPHIQDAHLVRLFHPVTSPRCYAIVA  469

Query  1381  RK  1386
             +K
Sbjct  470   QK  471



>gb|KID98549.1| RNA small subunit methyltransferase, partial [Metarhizium majus 
ARSEF 297]
Length=584

 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 138/328 (42%), Gaps = 73/328 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYNL++E        H          
Sbjct  300   LMAMSIHSCGNLSHYAIRSLILNPDIRAIAIVGCCYNLMTERLGPPTYKHAYLRPTLQAL  359

Query  637   --------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S+   +    G+ L  +AR +ACQ+   W  L   A    F 
Sbjct  360   NGRVGRESFRFDPQGFPMSQKFCTYDDDGVRLNVTARMMACQAPQNWDILDSEAF---FS  416

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H FRA  Q I L                   +++ HH             P+++ G ++
Sbjct  417   RHFFRAVLQKIFL---------------DRGVVKQIHH------------VPEDTDGRAA  449

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
               R       S   +  G   KK   C         SS R+      + + + + + ++ 
Sbjct  450   --RISGPFDVSTQPVTVGGLPKK---C--------YSSLRAYVRGTIDKLTTSTEYRQYA  496

Query  1126  DSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
             D    ++     +EID Y     E  P  + +   WSL A    V+E++I++DR +FL+E
Sbjct  497   DVMNDKMADITDEEIDKYEA---EYLPRKKELCVTWSLMAFSAMVVESMIVVDRWMFLKE  553

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              ++  +A +  +FD  +SPRN+ ++G K
Sbjct  554   QAEVGDAWVETVFDYGISPRNLVVVGVK  581



>emb|CCE27765.1| uncharacterized protein CPUR_01239 [Claviceps purpurea 20.1]
Length=648

 Score = 85.9 bits (211),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 136/327 (42%), Gaps = 64/327 (20%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   E++A+  VGCCYNL++E+       H          
Sbjct  342   LMAISIHSCGNLSHYAIRSLVLNPEIRAIAIVGCCYNLMTEKLGPPGYRHAFLRPTLQAL  401

Query  637   --------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S  +      G+ L  +AR +ACQ+   W   G+      F 
Sbjct  402   NGRVGRESARYDPQGFPMSSRLSTYNNDGIRLNVTARMMACQAPRNW---GRMDSEAFFA  458

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H +RA  Q I L               +G   + +HH++  +++            G++
Sbjct  459   RHFYRAVLQKIYLD--------------RGVVQQIRHHEQDQQTS--------EPVAGAA  496

Query  946   QKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFC  1125
             + R+      S   +  G   K   +C         SS R+    +   + +   + ++ 
Sbjct  497   ETRTPGPFDMSTQPVSIGGLRK---SC--------YSSLRAYVRGSIEKLTTSKEYRQYA  545

Query  1126  DSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQES  1305
             D   A++     +EI       E  P  + +   WSL A    V+E++I+ DR LFL+E 
Sbjct  546   DVMNAKMADITDEEI--QRYEDEFLPRKKELCVIWSLMAFSAMVVESLIVTDRWLFLREQ  603

Query  1306  SDWVEAALVPIFDPVLSPRNMAIIGRK  1386
              D   A +  +FD   SPRN+ ++G K
Sbjct  604   RDVKSAWVDTVFDYGESPRNLVVVGVK  630



>gb|KDB18770.1| hypothetical protein UV8b_161 [Ustilaginoidea virens]
Length=620

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 75/328 (23%), Positives = 132/328 (40%), Gaps = 57/328 (17%)
 Frame = +1

Query  481   SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC--------  636
             +++   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H         
Sbjct  318   TMMAMSIHSCGNLSHHAIRSLVLNPDIRAVAVVGCCYNLMTEKLGPPSYRHAYLRPTLDA  377

Query  637   ---------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLHNF  762
                            GFP+S+        G+ L  +AR +ACQ+   W   G+      F
Sbjct  378   LNGRVGRESSRFDPQGFPMSRRFTTYANDGIRLNVTARMMACQAPRNW---GRVDSEAFF  434

Query  763   ELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGS  942
               H +RA  Q + L                   +++ HH++  E +      P N+    
Sbjct  435   SRHFYRAVLQKMFL---------------DRGVVKQIHHRKTQEDSSSPLPSPANTKADG  479

Query  943   SQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKF  1122
             +          S   +  G   K    C         +S R+        + + +   ++
Sbjct  480   THDAKPGPFDTSTQPVTIGGLRKP---C--------YASLRAYVRGCIEKLTTSAECRQY  528

Query  1123  CDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQE  1302
              D    ++     +EID      E  P  + +   WSL A    V+E++I+ DR +FL+E
Sbjct  529   ADVMNEKMAGITDEEID--AYEAEFLPRKKELSVIWSLMACSAMVVESLIITDRWMFLKE  586

Query  1303  SSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
               +  +A +  +FD   SPRNM ++G K
Sbjct  587   QPEVKDAWVETVFDYGQSPRNMVVVGVK  614



>gb|EPY88647.1| protein RRNAD1-like protein [Camelus ferus]
Length=497

 Score = 85.1 bits (209),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 133/304 (44%), Gaps = 72/304 (24%)
 Frame = +1

Query  478   SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKS  657
             + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS+ 
Sbjct  250   ARLLLTGLHACGDLSVALLRHFCCCPEVAALASVGCCYMKLSDAG--------GYPLSQW  301

Query  658   VKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
             V  + G  L    R+ AC + + +    Q AG      H +RA  + ++     E  ++ 
Sbjct  302   VAGLPGYELPYRLREGACHALEEYAERLQKAG-PGLRTHCYRAALETVIRHARPE--LRR  358

Query  835   PAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK  1014
             P +                      Q  P                R  +S  G    G  
Sbjct  359   PGV----------------------QGIP----------------RVGLSSGGQACRGSP  380

Query  1015  GVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKE  1194
             G            S++  +K+E          F  +   GL R+G++    ++ + + + 
Sbjct  381   G------------STSSRLKSEAGK-------FGGYVQRGLQRVGLDPQLPLNLAAL-RA  420

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
              Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+ +
Sbjct  421   HQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNLVL  478

Query  1375  IGRK  1386
             +  K
Sbjct  479   VATK  482



>ref|XP_002015829.1| GL10807 [Drosophila persimilis]
 gb|EDW31719.1| GL10807 [Drosophila persimilis]
Length=494

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 118/235 (50%), Gaps = 23/235 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  ++ +YG  +L IDA++ +      R  ++++ +     ++E + + ++ PK   
Sbjct  157  GYLSSRMALQYGHRVLGIDANAANTESALNRNRKLQRAWNGLTERAELQSQGIT-PKRRG  215

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQA-QEHSEDRLTPHSYMVGDSSLILA  495
             +  SP    A S   LE Y    +++  E++ G    EH      P     G+ S+ L 
Sbjct  216  KK--SPTRNTAKSIPVLENYKTTAKFINTETNFGNLLAEH-----FPKPSSAGNLSICLT  268

Query  496  GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFP  645
            GLH CG+L+ T L+ F    + + + ++GCCY+LL E  + ++           +  GFP
Sbjct  269  GLHTCGNLAATCLQVFHAQPDCQILCNIGCCYHLLKERYSQQEFFGNKTLMEMQTDFGFP  328

Query  646  LSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRY  810
            LS+ ++   + LG++AR LA QS +R         L N  L+ +RA  ++++ R+
Sbjct  329  LSQYLQMRQIRLGRNARMLAAQSIERTLN---GKELPNITLY-YRALLEVLVCRH  379



>ref|XP_008313882.1| PREDICTED: methyltransferase-like protein 25 [Cynoglossus semilaevis]
Length=587

 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 122/295 (41%), Gaps = 73/295 (25%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKH---YAAKIR-------------  270
            GYL+  LS +YGL +  ID+SS + +    R  +++K    Y  +I+             
Sbjct  178  GYLSSFLSLQYGLQVYGIDSSSINTHGAQERNRKLKKFSRSYQKRIKAVEAQREAEQSHQ  237

Query  271  -KSESEDRELSVPKTVTC----RVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEH  435
              SE E    S    V C     ++S ET K  S+ S  + +   + +   +      E 
Sbjct  238  DTSEEEKVGFSGDGGVLCGAEGEIMSEETEKDFSDVSSARPNPETEEMFLSALSLDVIET  297

Query  436  SEDRLTPH----------------------------------SYMVGDSSL---------  486
               R++P                                   SY+  ++ L         
Sbjct  298  MPPRISPTLLSAEERERRKKENLEKKALNRTDGTSAVFSPLTSYVTAETELRELISELEH  357

Query  487  -ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE----AAGKDDSHCGFPLS  651
             ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LL+EE      G  D  CGFPLS
Sbjct  358  AVMVGLHTCGDLAPSTLRMFVAKPELSAVCSVGCCYHLLTEEFDPAVQGCPDRLCGFPLS  417

Query  652  KSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
              +       G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  418  HYLHTHSWFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHYS  468


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (3%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVL  1260
             N     + F+ +    L +L ++ES+    D        +P    +  +  L+  L P +
Sbjct  478   NVYSKATSFVDYVRRALRKLELDESKLSNSDVQEFHDRFRPRMNEMLAFNMLKVTLAPCI  537

Query  1261  ETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI  1389
             E +ILLDRL +L+E  D   +ALV +FDP+LSPR  A++G K+
Sbjct  538   EGLILLDRLCYLKEQ-DVPVSALVQLFDPLLSPRCYAVVGLKM  579



>ref|XP_003050086.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU44373.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=597

 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 86/332 (26%), Positives = 137/332 (41%), Gaps = 67/332 (20%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D  L+   +H+CG+LS   +R+ +    ++AV  VGCCYNL++E+       H       
Sbjct  304   DLRLMAMSIHSCGNLSHFGIRSLVLNPSIQAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+SK        G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESDKHDPQGFPMSKKFSTYEGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H FRA  Q I L               +G   + +H           Q  P+  + 
Sbjct  422   -FSRHFFRAVLQKIFL--------------DRGVVTKVRHS--------DAQGGPEADAT  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFM  1116
              +++  SE     S + +  G+  K       D +        +V+   TN     S F 
Sbjct  459   VATKSESESPFDISTNPVIIGSLRKNCYGSFKDYV------RGAVQKLTTN-----SDFK  507

Query  1117  KFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLF  1293
             ++ D    ++G    +EI+ Y   +    P  + +   WSL A     +E++I+ DR  F
Sbjct  508   QYADVMQEKMGDITDEEIERYEATY---LPRKQELCAVWSLMAFSAMAVESLIVSDRWTF  564

Query  1294  LQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             L+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  565   LREHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>ref|XP_001959359.1| GF12827 [Drosophila ananassae]
 gb|EDV36181.1| GF12827 [Drosophila ananassae]
Length=492

 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 121/235 (51%), Gaps = 26/235 (11%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +YG  +L IDA++ +     +R  ++++ +     ++E + + ++ PK   
Sbjct  156  GYLSSRLALQYGHHVLGIDANAANTENALSRNRKLQRAWNGLTERAELQSQGIT-PKRRG  214

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQA-QEHSEDRLTPHSYMVGDSSLILA  495
             +  SP    + +  +LE Y    +++  E + G+  +EH   + T        S + L 
Sbjct  215  KK--SPTRDSSKTVPALENYKTTARFITTEINFGELLEEHFSKKET--------SEICLT  264

Query  496  GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFP  645
            GLH CG+L+ T L+ F   ++ + + ++GCCY+LL E  +  +           S  GFP
Sbjct  265  GLHTCGNLASTCLQVFHAQSDCRILCNIGCCYHLLRERYSTNEFFGNKALMDMQSDFGFP  324

Query  646  LSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRY  810
            LS+ ++   + LG++AR LA QS +R      A  L N  L+ +RA  ++++ R+
Sbjct  325  LSQYLQLKKVRLGRNARMLAAQSIERTLA---AKELPNMTLY-YRALLEVLVCRH  375



>gb|EKG18830.1| hypothetical protein MPH_03846 [Macrophomina phaseolina MS6]
Length=672

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 86/348 (25%), Positives = 138/348 (40%), Gaps = 96/348 (28%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE---------------  609
             D ++++  LH+CG+L    LR+      VKAV  +GCCYNL++E                
Sbjct  376   DPNVMVISLHSCGNLVHHGLRSLTLNPAVKAVAMIGCCYNLMTERLGPPSYKLPQLRPNH  435

Query  610   -----AAGKDDSHCGFPLSKSVKA--------VGLVLGKSARDLACQSADRWRGLGQAAG  750
                   A   D H GFP+S+            VG+ L  +AR +A Q+   W   G A  
Sbjct  436   PRLEATANAFDPH-GFPMSERYATYPVPGTDDVGVRLNITARMMAVQAPQNW---GPADS  491

Query  751   LHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNS  930
                F  H FRA  Q + L +    +V+ P     G       + RA+             
Sbjct  492   EAFFTRHFFRALLQRVFLDHG---VVEPPPSNANGDNNNAFQNGRAV-------------  535

Query  931   SGGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL  1110
              GG            S+S  GC + G+  V          I S +            ++ 
Sbjct  536   -GG------------SVSPAGCSSGGEPIV----------IGSLKK---------SCYTN  563

Query  1111  FMKFCDSGLARLGINESQEIDYSGIWKETQP----------------FTEMIGPYWSLRA  1242
             F+ +    +A++  N+ Q  + + + K+                     + +   WSL A
Sbjct  564   FVAYVRGAVAKIEANKDQHPEKAELVKKNMANITDEEIRRYEEEYRERKKELAVVWSLMA  623

Query  1243  ALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
                 V+E +I++DR L+L+E  +   A + P+FD  LSPRN+ ++G K
Sbjct  624   FSAGVIEAMIVVDRWLWLKEQKEVESAWVEPVFDYKLSPRNLVVVGVK  671



>gb|EWG48384.1| hypothetical protein FVEG_08175 [Fusarium verticillioides 7600]
Length=597

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 86/335 (26%), Positives = 140/335 (42%), Gaps = 73/335 (22%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  304   DLSLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L               +G   + +H     ES        +  + 
Sbjct  422   -FSRHFYRAVLQKMFL--------------DRGVVKKVRHTGSQEES--------QADTA  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL--  1110
              S+Q  SE     S + +  G+  K              S   S K+    AV+  +   
Sbjct  459   ASTQDDSESPFDISTNPVIIGSLRK--------------SCYGSFKSYVRGAVEKLTTNN  504

Query  1111  -FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
              + ++ D    ++G    +EI  Y  ++    P  + +   WSL A     +E++I+ DR
Sbjct  505   EYKQYADVIQEKMGDISDEEIQRYEALY---LPRKKELCAVWSLMAFSAMAVESLIVSDR  561

Query  1285  LLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
               FL+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  562   WTFLKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>gb|KFH64852.1| hypothetical protein MVEG_09581 [Mortierella verticillata NRRL 
6337]
Length=731

 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 84/314 (27%), Positives = 117/314 (37%), Gaps = 95/314 (30%)
 Frame = +1

Query  490   LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGK-----DDSHCGFPLSK  654
             L GLHACGDL+  M++ FLE +    + SVGCCY+ ++E          DD   GFPLS 
Sbjct  497   LCGLHACGDLTSNMVKLFLESS-ATCLFSVGCCYHWITERYDKDGHVVLDDGSHGFPLSS  555

Query  655   SVKAVGLVLGKSARDLACQSADRWRGLGQAA--GLHNFELHAFRATFQMILLR--YYSEV  822
                A    LG  A+ +ACQS +RW    + +   +H    H FRA    +++    Y   
Sbjct  556   VFNARKAHLGDHAKMIACQSPERWLPYQKESEDAIHG---HYFRALLHKLMVEKGLYPGP  612

Query  823   LVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGN  1002
                +P +GR GK  R +     L + LQ    P  +      +R+ D             
Sbjct  613   PAIAPVLGRMGKH-RLKGFPHYLATALQRLKMPAEAITAEEAQRAYD-------------  658

Query  1003  DGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSG  1182
                                                    F +  L R+GI          
Sbjct  659   --------------------------------------TFLERDLYRIGI----------  670

Query  1183  IWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQES------SDWVEAALVPIFD  1344
              W        M+GP          + E +ILLDR + L E+      +      LV  FD
Sbjct  671   FWA----LRTMLGP----------LFEGMILLDRAMHLHETIMSRPNTKTASVQLVAGFD  716

Query  1345  PVLSPRNMAIIGRK  1386
              V SPRNM +I  K
Sbjct  717   VVESPRNMVLIALK  730



>ref|NP_001033941.1| CG33964, partial [Drosophila melanogaster]
 gb|AAO39598.1| GM20958p [Drosophila melanogaster]
 gb|AAF58558.4| CG33964, partial [Drosophila melanogaster]
Length=494

 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 121/238 (51%), Gaps = 21/238 (9%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +YG  +L IDA++ +      R  ++++ +     ++E + + ++ PK  +
Sbjct  155  GYLSSRLALQYGHRVLGIDANAANTENALNRNRKLQRAWNGLTERAELQVQGIT-PKRRS  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             +  + E+ K  S  +LE Y    +++  E + G     +  +  P        ++ L G
Sbjct  214  KKSPARESTK--SAPALENYKTTAKFITTELNFGALLAENFTQFRPED----SPNICLTG  267

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFPL  648
            LH CG+L+ T L+ F    + + + +VGCCY+LL E  + ++           +  GFPL
Sbjct  268  LHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPL  327

Query  649  SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
            S+ ++   + +G++AR LA QS +R     +   L N  L+ +RA  ++++ R+  E+
Sbjct  328  SQYLRERQVRMGRNARMLAAQSIERTLDTKE---LPNVTLY-YRALLEILVCRHAPEL  381



>ref|XP_005451683.1| PREDICTED: methyltransferase-like protein 25-like isoform X3 
[Oreochromis niloticus]
Length=479

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG++   S CGFPLS+
Sbjct  366  VMVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDPAGQECLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475



>ref|XP_010780717.1| PREDICTED: methyltransferase-like protein 25 [Notothenia coriiceps]
Length=437

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 125/289 (43%), Gaps = 68/289 (24%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERI-------RKHYAA-----KIRKSES  282
            GYL+  LS +YGL +  ID+SS + +    R  ++       +KH  A     K   S  
Sbjct  42   GYLSSFLSLQYGLHVYGIDSSSSNTHGAQERNRKLKKFSRAYQKHNKAVRAQGKAAHSPQ  101

Query  283  EDRELSVP------------------------------------KTVTCRVLSPETLKAL  354
            E+ E   P                                      ++  V+ P + +  
Sbjct  102  EESEEIKPGVEGDNDFSHGDGVGLSQEEEKEWDSEPNQEQDFFLSALSVDVMQPSSPRVP  161

Query  355  SNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTP-HSYMVGDSSL----------ILAGL  501
            S+  L   +  ++         Q +  + D  +P  SY+  ++ L          ++ GL
Sbjct  162  SS-QLTDEERERRKRESLERKAQNRTSANDMFSPLTSYVTAETELRELIDELEDAVMVGL  220

Query  502  HACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKDDSH--CGFPLSKSVKAV  669
            H CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG++  H  CGFPLS+ ++  
Sbjct  221  HTCGDLAPSTLRMFVAKPELSAVCSVGCCYHLLSEEFDPAGQECLHGVCGFPLSQYLRQG  280

Query  670  GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
                G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  281  SWFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHYS  325


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ----EI-DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F+ +    L RL ++ES+    +I DY   +K   P    +  +  L+  L P +E +IL
Sbjct  343   FVDYVHRALLRLELDESKLSDRDIQDYHDTYK---PRMGEMHAFNLLKVTLAPCIEGLIL  399

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             LDRL +L+E  D   +ALV +FDP+LSPR  A++G K
Sbjct  400   LDRLCYLKEQEDLSFSALVQLFDPLLSPRCYAVVGLK  436



>emb|CCT65868.1| uncharacterized protein FFUJ_02848 [Fusarium fujikuroi IMI 58289]
Length=597

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 140/332 (42%), Gaps = 67/332 (20%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D SL+   +H+CG+LS   +++ +   +++AV  VGCCYNL++E+       H       
Sbjct  304   DLSLMAMSIHSCGNLSHFGIKSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  363

Query  637   -----------------GFPLSKSVKAV---GLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+   A    G+ L  +AR +ACQ+   W    ++AG  
Sbjct  364   QAVNGRLVRESEKHDPQGFPMSQKFSAYQGDGVRLNITARMMACQAPQNWTE-KESAGF-  421

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSG  936
              F  H +RA  Q + L               +G   + +H     ES +           
Sbjct  422   -FSRHFYRAVLQKMFL--------------DRGVVKKVRHTGSQEESQVDV--------A  458

Query  937   GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFM  1116
              S+Q  SE     S + +  G+  K   +C          S +S        + + + + 
Sbjct  459   ASTQDDSESPFDISTNPVIIGSLRK---SC--------YGSFKSYVRGAMEKLTTNNEYK  507

Query  1117  KFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLF  1293
             ++ D    ++G    +EI+ Y  ++    P  + +   WSL A     +E++I+ DR  F
Sbjct  508   QYADVMQEKMGDISDEEIERYEALY---LPRKKELCAVWSLMAFSAMAVESLIVSDRWTF  564

Query  1294  LQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             L+E  D V  A V  +FD   SPRN+ ++G K
Sbjct  565   LKEHDDLVRHAWVETVFDYEQSPRNLVVVGVK  596



>ref|XP_010741455.1| PREDICTED: methyltransferase-like protein 25 [Larimichthys crocea]
Length=663

 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG++     CGFPLS+
Sbjct  435  VMVGLHTCGDLAPSTLRMFVAKAELAAVCSVGCCYHLLSEEFDPAGQERLGGMCGFPLSQ  494

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++   L  G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  495  YLRNQSLFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHYS  544



>ref|XP_005451682.1| PREDICTED: methyltransferase-like protein 25-like isoform X2 
[Oreochromis niloticus]
Length=582

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG++   S CGFPLS+
Sbjct  366  VMVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDPAGQECLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475



>ref|XP_005451681.1| PREDICTED: methyltransferase-like protein 25-like isoform X1 
[Oreochromis niloticus]
Length=594

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG++   S CGFPLS+
Sbjct  366  VMVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDPAGQECLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ----EI-DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F+ +    L RL ++ES+    +I DY   ++      + +  +  L+  L P +E +IL
Sbjct  493   FVDYVRRALRRLELDESKLSDSDIQDYHNTYRVRM---DEMHAFNMLKVTLAPCIEGLIL  549

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             LDRL +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  550   LDRLCYLKEQEDVSFSALVQLFDPLLSPRCYAVIGLK  586



>gb|ETN67646.1| hypothetical protein AND_000532 [Anopheles darlingi]
Length=494

 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/246 (26%), Positives = 115/246 (47%), Gaps = 36/246 (15%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  ++ E+G+ +L +D +  + +  + R +R++      ++K+  E+ E        
Sbjct  177  GYLSSRIAVEHGIKVLGVDCNEDNTSNAEKRRDRLKTKIPKAVKKANLEEDEHFT-----  231

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
              +L  +TLK+L       Y    Q +  E+ +    +H       H       +  L G
Sbjct  232  -NLLQGDTLKSL-------YRTTTQLIDFETDLIALAKH-------HFPADNHRTFCLCG  276

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE---------AAGKDDSHCGFPLS  651
            LH CG+L    LR F +   +  +++VGCCY+L+ EE         A   D+   GFP+S
Sbjct  277  LHTCGNLGPNCLRLFHQNRTIAGIMNVGCCYHLMREEFVMDDFYNPAKISDNPGYGFPMS  336

Query  652  KSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVK  831
              ++     +G++AR+LA +S +R          +  +   +RA  Q++LL+Y  +   K
Sbjct  337  SYLRNRQFAIGRNARNLASESIER----ACINRENPSDKLGYRALLQIVLLQYGQK---K  389

Query  832  SPAIGR  849
            S  +GR
Sbjct  390  SLQVGR  395



>ref|XP_002091112.1| GE12415 [Drosophila yakuba]
 gb|EDW90824.1| GE12415 [Drosophila yakuba]
Length=492

 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 118/238 (50%), Gaps = 21/238 (9%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +YG  +L IDA++ +     +R  ++++ +     ++E + + ++ PK   
Sbjct  155  GYLSSRLALQYGHRVLGIDANAENTQNALSRNRKLQRAWNGLTERAELQIQGIT-PKRRG  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             +  SP      S  +LE Y    +++  E + G        +L P        +  L G
Sbjct  214  KK--SPARDSTKSAPALENYKTTAKFITTELNFGALLAEHFTQLGPED----SPNFCLTG  267

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFPL  648
            LH CG+L+ T L+ F    + + + +VGCCY+LL E  + ++           +  GFPL
Sbjct  268  LHTCGNLAATCLQVFHAQADCRLLCNVGCCYHLLRERYSQQEFFGNKALMDLQTDYGFPL  327

Query  649  SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
            S+ ++   + +G++AR LA QS +R      A  L N  L+ +RA  ++++ R+  ++
Sbjct  328  SQYLQERKVRMGRNARMLAAQSIER---TVDAKELPNVTLY-YRALLEILVCRHAPQL  381



>gb|KEF51507.1| hypothetical protein A1O9_12424 [Exophiala aquamarina CBS 119918]
Length=614

 Score = 82.4 bits (202),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 125/486 (26%), Positives = 188/486 (39%), Gaps = 128/486 (26%)
 Frame = +1

Query  139   GYLAQVL-SFEYGLSILAIDASSHHGNITDARAERIRKHYAAK---IRKSESEDRELSVP  306
              YL + L S  Y   ++AI+   H  NI  AR+  +    A K   +R  +   R+L++P
Sbjct  181   NYLGRTLASPPYHKHVIAIERKHH--NIDGARSMDVHARLAKKEKIMRNKKEWKRQLTMP  238

Query  307   KTVTCR---------------VL-----SPETLKALSNGSLE--KYDVGKQYL---IGES  411
               VT                 VL     SP  L   +NGS+   ++D+   +L   +  +
Sbjct  239   SEVTTPQSERLEQKPLPVPDVVLDSSDDSPRKLIDRNNGSMSYVEHDIKDGHLESILYPA  298

Query  412   SIGQAQE-----HSEDRLTP---HSYMVGD----SSLILAGLHACGDLSVTMLRTFLECN  555
                +A +      S+ R  P    S  VG     S  ++  LH+CG+L    LR+ +   
Sbjct  299   DYSEADDCDNTMSSQGRAVPLADDSDSVGPIGKRSKAMVVSLHSCGNLLHHGLRSLILNP  358

Query  556   EVKAVISVGCCYNLLSEE-------------------AAGKDDSHCGFPLSKSVKAV---  669
              + AV  +GCCYNLL+E                    A G      GFP+SK+ +     
Sbjct  359   SICAVAMIGCCYNLLTERLGPATYKLPQLRPNHPRLVATGNAFDPHGFPMSKTFEDFERH  418

Query  670   ---GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPA  840
                GL L  +AR +A Q+   W   G       F+ H +RA  Q ILL            
Sbjct  419   GEKGLRLNITARMMAVQAPYNW---GPDDSKAFFQRHFYRALLQRILL------------  463

Query  841   IGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKKGV  1020
                             L    QC D P + +GGS   +  D T   +  L      +K  
Sbjct  464   ---------------DLGVVHQCSD-PGSLAGGSITGKDTDGTPLIVGSL------RKAC  501

Query  1021  TCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQ  1200
               +  A  +   +   ++++  +      L     D  +A          DY   W  TQ
Sbjct  502   FVNFRAYVN--GALAKLRDDPVDGPMIAQLTQPLNDDMIA----------DYEARWGYTQ  549

Query  1201  PFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSD----WVEAALVPIFDPVLSPRNM  1368
                 +I   WSL A    V+E++I +DR LFL+E       WVE     +FD   SPRN+
Sbjct  550   KNLAVI---WSLMAFSAGVVESLIAVDRYLFLKEQDSVEDCWVET----VFDYKHSPRNL  602

Query  1369  AIIGRK  1386
              ++G K
Sbjct  603   VVVGIK  608



>emb|CEI92606.1| Putative Inositol oxygenase [Rhizopus microsporus]
Length=443

 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 13/140 (9%)
 Frame = +1

Query  436  SEDRLTPH-SYMVGDSSLI-LAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE  609
            ++D L P  SY++   S   L GLH CGDLS T+ R F E +++  +++VGCCYN L+  
Sbjct  207  TKDYLPPEASYVIRYHSFYPLTGLHTCGDLSPTIFRLFTESDKISCMVNVGCCYNALTP-  265

Query  610  AAGKDDSHCGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATF  789
                     GFP+S  ++   + L  +AR LAC S  RW  L     +  F+ + FRA  
Sbjct  266  --------SGFPMSSLLREKKIELKSTARVLACHSPSRW--LEGEPCIEAFDNYFFRALL  315

Query  790  QMILLRYYSEVLVKSPAIGR  849
            Q +L+      +   P +GR
Sbjct  316  QEMLVERGLSDINDPPILGR  335


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 12/103 (12%)
 Frame = +1

Query  1111  FMKFCDSGLARL-----GINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F  F  + L RL      I E +  D+    KE Q   + +   W+LRA L  ++E+IIL
Sbjct  342   FTSFVAASLKRLKLSPDTITEQEARDHYLKAKEKQADKQFVT-LWTLRALLASIVESIIL  400

Query  1276  LDRLLFLQESSDWVEAA------LVPIFDPVLSPRNMAIIGRK  1386
             +DR L+L+ES   +E +        P+FD V SPRN+  +  K
Sbjct  401   VDRWLYLEESVSSLENSQHKGVWAYPLFDQVASPRNVVYVASK  443



>ref|XP_001809803.1| PREDICTED: methyltransferase-like protein 25 [Tribolium castaneum]
 gb|EEZ98698.1| hypothetical protein TcasGA2_TC001236 [Tribolium castaneum]
Length=451

 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 117/233 (50%), Gaps = 41/233 (18%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+ +L+ ++ + ++ IDAS+ +      RA ++ K +   I K+  +    S+PK  T
Sbjct  152  GYLSSMLALQHQIPVVGIDASNTNTCGAIKRATKLSKVWNG-IPKAPHK----SLPKK-T  205

Query  319  CRVLSP--ETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLIL  492
                SP  E  K ++    E++D+          +G  ++     + P+   +G     L
Sbjct  206  ENFASPHVELYKQVTRFVDERFDL----------LGLVRD-----VFPNVSHLG-----L  245

Query  493  AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKAVG  672
             GLH CGDL+ + L+ F     VK+V +VGCCY+LL E          GFPLS+ +   G
Sbjct  246  VGLHTCGDLAASSLKIFSRNEAVKSVCNVGCCYHLLDES---------GFPLSRFLTDRG  296

Query  673  LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVK  831
             VLG+SAR +A QS +R    G+   +  F    +RA  Q++L  + +++  K
Sbjct  297  FVLGRSARMIANQSVERVLQEGELPNITIF----YRAILQVLLEEFCTDLPTK  345



>ref|XP_006633669.1| PREDICTED: methyltransferase-like protein 25-like [Lepisosteus 
oculatus]
Length=1003

 Score = 82.8 bits (203),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 69/116 (59%), Gaps = 8/116 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEA----AGKDDSHCGFPLSK  654
            ++ GLH CGDL+ +MLR F+  +E+KAV SVGCCY+LLSEE         D+  GFPLS+
Sbjct  377  VMVGLHTCGDLAPSMLRMFVSKSELKAVCSVGCCYHLLSEEFDCARQENPDTVWGFPLSQ  436

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
             ++  G   G++AR  AC + +R   +GQ   + +     +RA   +IL  +Y  +
Sbjct  437  YMRQRGWYCGRNARMSACLALERV-AVGQGLPIESL---FYRAVLHVILRDHYGAI  488


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQEID--YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L +L ++ES+  D      ++  +P  + +  +  L+ AL P +E +ILLDR
Sbjct  504   FVDYIKKALKKLDLDESKLSDSLIQDYYETFKPRMKEMEAFNMLKVALAPCIEGLILLDR  563

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI*SLHELVS*SVDAKLE  1437
             L +L+E  +   +ALV +FDP++SPR   +IG K  +L  L   S+ +KL+
Sbjct  564   LCYLKEQDNVSFSALVQLFDPLMSPRCFGVIGIKRPALESLCGASIFSKLD  614



>ref|XP_009859760.1| PREDICTED: protein RRNAD1-like isoform X3 [Ciona intestinalis]
Length=420

 Score = 81.3 bits (199),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/239 (26%), Positives = 111/239 (46%), Gaps = 56/239 (23%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPK---  309
            G+L++VL+ ++ L + A+D    H       AE+  K    ++ K++ + +   +P    
Sbjct  163  GHLSRVLALQHTLPVSAVDNVQSHIKA----AEKYDKEATKQLSKAKKQHKNTLIPPQHY  218

Query  310  --TVTCRVLSPETLKALS----NGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMV  471
              ++ C     ET+K L     N +  +Y   ++YL                        
Sbjct  219  VHSLPCIGCPQETMKKLKTDIYNANGNEYQEKERYL------------------------  254

Query  472  GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG----  639
                  L GLHACGDLS TM++ F+EC EV +V+SV CCY  ++ +    + SHCG    
Sbjct  255  ------LTGLHACGDLSATMVKMFVECEEVTSVVSVACCYMKITTDF---EVSHCGVGGK  305

Query  640  ----FPLSKSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
                +PLS  +K++ G  L   +R+ +C + + ++ L       + ++H +RA  + ++
Sbjct  306  DTYRYPLSDFLKSISGHELPYKSREASCHAIEDYK-LRLKENTDHLKMHCYRAALETLI  363



>ref|XP_001360363.2| GA17328 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL24938.2| GA17328 [Drosophila pseudoobscura pseudoobscura]
Length=494

 Score = 81.6 bits (200),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 63/235 (27%), Positives = 117/235 (50%), Gaps = 23/235 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  ++ +Y   +L IDA++ +      R  ++++ +     ++E + + ++ PK   
Sbjct  157  GYLSSRMALQYEHRVLGIDANAANTESALNRNRKLQRAWNGLTERAELQSQGIT-PKRRG  215

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQA-QEHSEDRLTPHSYMVGDSSLILA  495
             +  SP    A S   LE Y    +++  E++ G    EH      P     G+ S+ L 
Sbjct  216  KK--SPTRNTAKSIPVLENYKTTARFINTETNFGNLLAEH-----FPKPSSAGNLSICLT  268

Query  496  GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFP  645
            GLH CG+L+ T L+ F    + + + ++GCCY+LL E  + ++           +  GFP
Sbjct  269  GLHTCGNLAATCLQVFHAQPDCQILCNIGCCYHLLKERYSQQEFFGNKTLMEMQTDFGFP  328

Query  646  LSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRY  810
            LS+ ++   + LG++AR LA QS +R         L N  L+ +RA  ++++ R+
Sbjct  329  LSQYLQMRQIRLGRNARMLAAQSIERTLN---GKELPNITLY-YRALLEVLVCRH  379



>ref|XP_001975969.1| GG20255 [Drosophila erecta]
 gb|EDV56369.1| GG20255 [Drosophila erecta]
Length=492

 Score = 81.6 bits (200),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 118/238 (50%), Gaps = 21/238 (9%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +YG  +L IDA++ +     +R  ++++ +     ++E + + ++ PK   
Sbjct  155  GYLSSRLALQYGHRVLGIDANAENTQNALSRNLKLQRAWNGLTERAELQIQGIT-PKRRG  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             +  SP      S  +LE Y    +++  E + G        +L P        ++ L G
Sbjct  214  KK--SPARDSTKSAPALENYKTTAKFITTELNFGALLAEHFTQLGPKE----SPNICLTG  267

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFPL  648
            LH CG+L+ T L+ F    + + + +VGCCY+LL E  + ++           +  GFPL
Sbjct  268  LHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKALMDLQTDYGFPL  327

Query  649  SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
            S+ ++   + +G++AR LA QS +R      A  L N  L+ +RA  + ++ R+  ++
Sbjct  328  SQYLQERQVRMGRNARMLAAQSIER---TVDAKELPNVTLY-YRALLETLVYRHAPQL  381



>gb|KFO72573.1| Methyltransferase-like 25, partial [Cuculus canorus]
Length=499

 Score = 81.6 bits (200),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 74/290 (26%), Positives = 122/290 (42%), Gaps = 69/290 (24%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKS-------------E  279
            GYL+  LS +Y L +  ID+S+ + +    R  +++KH+ A  R+              +
Sbjct  98   GYLSSFLSMQYDLKVYGIDSSNSNTSGAHERNRKLKKHWKAYQRRGRTNLKSQRWENSLQ  157

Query  280  SEDRELSVPKTVTCRVLSPETLKALSNGSLEKY--------------------DVGKQYL  399
            S+D+    P      + + ET K     S+ +                     D  + + 
Sbjct  158  SQDQVALQPSCSFTEIPTSETSKQTEVDSVARTRSDDSRLSEEVLAMLNVLPADAVEDFS  217

Query  400  IGESSIGQ-----------------AQEHSEDRL-----------TPHSYMVGD-SSLIL  492
            + + + G+                 A E SE  L           T  S ++ D    ++
Sbjct  218  LSQRNYGELCEEEKAQRKMASLKAKASESSESNLYIPLTSCITAETELSDIISDLEDCMM  277

Query  493  AGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---CGFPLSKSVK  663
             GLH CGDL+   LR F    E+KAV +VGCCY+LLSE+   ++D      GFP+ + +K
Sbjct  278  VGLHTCGDLAANTLRIFTAKPEIKAVCTVGCCYHLLSEQFENQEDCPEGVWGFPMCQYLK  337

Query  664  AVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
              G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  338  DKGWCCGRNARMSACLALER-VAVGQMLPTESL---FYRAVLQVIIEEIY  383


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (43%), Gaps = 34/184 (18%)
 Frame = +1

Query  910   QDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK-----------GVTCDDDALFHK--  1050
             +DCP+   G    +  +D+  C      CG + +            G     ++LF++  
Sbjct  321   EDCPEGVWGFPMCQYLKDKGWC------CGRNARMSACLALERVAVGQMLPTESLFYRAV  374

Query  1051  ----ISSTRSVKNENTNAVDSFSL---FMKFCDSGLARLGINESQE-----IDYSGIWKE  1194
                 I     V   N +   +FS    F+ +    L +L +++S+      +DY   +K 
Sbjct  375   LQVIIEEIYGVTKSNRHVGKTFSKSSSFIDYVRKSLKKLELDDSKLPDSCIMDYYEKYKH  434

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
                  E       L+  L P +E +ILLDRL +L+E  +   + LV +FDPV SPR  A+
Sbjct  435   RMNELEAFN---MLKVVLAPCIEVLILLDRLCYLKEQDNIAWSGLVKLFDPVKSPRCYAV  491

Query  1375  IGRK  1386
             I  K
Sbjct  492   IALK  495



>gb|KFA64840.1| hypothetical protein S40285_08653 [Stachybotrys chlorohalonata 
IBT 40285]
Length=595

 Score = 81.6 bits (200),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 85/330 (26%), Positives = 139/330 (42%), Gaps = 74/330 (22%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE-------------------  606
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYN+L+E                   
Sbjct  306   LMAVSIHSCGNLSHHAIRSLILNQDIRAIAIVGCCYNMLTERLGPPVYKHTYLRPTLQAL  365

Query  607   -----EAAGKDDSHCGFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNF  762
                  + + K D H GFP+S+   S    G+ L  +AR +ACQ+   W   G++     F
Sbjct  366   NGRVFKESDKHDPH-GFPMSQRFCSYNDYGVRLNITARMMACQAPYNW-TRGESDNF--F  421

Query  763   ELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGS  942
             + H +RA  Q + L             G  GK      H+   ES+   +  P+     S
Sbjct  422   DRHFYRAVIQRMFLDR-----------GVVGKV----RHREPSESDKTGESKPETPFDTS  466

Query  943   SQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKF  1122
             +        R       C N  K  V      +  K++++   K              ++
Sbjct  467   TNPIVIGSLRKP-----CYNSLKAYVR----GVVEKLTTSEEYK--------------QY  503

Query  1123  CDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQ  1299
              D    ++G    +EI+ Y   +   +P   +I   WSL A    V E++I+ DR  FL+
Sbjct  504   SDVMQEKMGDVTDEEIERYERTYLPRRPELCVI---WSLMAFAATVAESLIVTDRWTFLK  560

Query  1300  ESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             E  D V+ A V  +FD   SPRN+ ++G K
Sbjct  561   EHGDVVQEAWVETVFDYRESPRNLVVVGIK  590



>ref|XP_004548337.1| PREDICTED: methyltransferase-like protein 25-like [Maylandia 
zebra]
Length=594

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG+    S CGFPLS+
Sbjct  366  VMVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDHAGQKCLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L RL ++ES+  + D        +   + +  +  L+  L P +E +ILLDR
Sbjct  493   FVDYVRRALRRLELDESKLSDSDIQDYHNTYRVRMDEMHAFNMLKVTLAPCIEGLILLDR  552

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  553   LCYLKEQEDVSFSALVQLFDPLLSPRCYAVIGLK  586



>ref|XP_005733519.1| PREDICTED: methyltransferase-like protein 25-like [Pundamilia 
nyererei]
Length=594

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE   AG+    S CGFPLS+
Sbjct  366  VMVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDHAGQKCLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L RL ++ES+  + D        +   + +  +  L+  L P +E +ILLDR
Sbjct  493   FVDYVRRALRRLELDESKLSDSDIQDYHNTYRVRMDEMHAFNMLKVTLAPCIEGLILLDR  552

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  553   LCYLKEQEDVSFSALVQLFDPLLSPRCYAVIGLK  586



>ref|XP_005097520.1| PREDICTED: protein RRNAD1-like [Aplysia californica]
Length=611

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = +1

Query  484  LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG-------F  642
             +LAGLHACGDL+ T+LR F EC     + SV CCY  ++  +   D+S  G       +
Sbjct  375  FVLAGLHACGDLTPTLLRVFTECPTAVGLASVACCYMKIAATSCPADESSNGPPSSLDNY  434

Query  643  PLSKSVKAVG-LVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLR  807
            P+S  +KA+    L   AR++AC  AD +R   + +  H  ++H++RA FQ ++ R
Sbjct  435  PMSSVLKAIPHHHLTYEAREMACHFADAYRDRLEKSPPH-LKIHSYRAAFQYLITR  489



>ref|XP_002130567.1| PREDICTED: protein RRNAD1-like isoform X2 [Ciona intestinalis]
Length=477

 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/239 (26%), Positives = 111/239 (46%), Gaps = 56/239 (23%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPK---  309
            G+L++VL+ ++ L + A+D    H       AE+  K    ++ K++ + +   +P    
Sbjct  163  GHLSRVLALQHTLPVSAVDNVQSHIKA----AEKYDKEATKQLSKAKKQHKNTLIPPQHY  218

Query  310  --TVTCRVLSPETLKALS----NGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMV  471
              ++ C     ET+K L     N +  +Y   ++YL                        
Sbjct  219  VHSLPCIGCPQETMKKLKTDIYNANGNEYQEKERYL------------------------  254

Query  472  GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG----  639
                  L GLHACGDLS TM++ F+EC EV +V+SV CCY  ++ +    + SHCG    
Sbjct  255  ------LTGLHACGDLSATMVKMFVECEEVTSVVSVACCYMKITTDF---EVSHCGVGGK  305

Query  640  ----FPLSKSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
                +PLS  +K++ G  L   +R+ +C + + ++ L       + ++H +RA  + ++
Sbjct  306  DTYRYPLSDFLKSISGHELPYKSREASCHAIEDYK-LRLKENTDHLKMHCYRAALETLI  363



>ref|XP_008568612.1| PREDICTED: protein RRNAD1 [Galeopterus variegatus]
Length=475

 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+  +        +PLS
Sbjct  248   GGARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPGS--------YPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC               H  E +A R                
Sbjct  300   QWVAGLPGYELPYRLREGAC---------------HALEEYAER----------------  328

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
                 + ++G  LR   ++  LE+ ++C               +  E R           G
Sbjct  329   ----LQKEGPGLRTHCYRAVLETVIRC---------------ARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + +W
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQQGLQRVGLDPQLPLNLAALW  397

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  398   AHQAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>ref|XP_009859759.1| PREDICTED: protein RRNAD1-like isoform X1 [Ciona intestinalis]
Length=497

 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/239 (26%), Positives = 111/239 (46%), Gaps = 56/239 (23%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPK---  309
            G+L++VL+ ++ L + A+D    H       AE+  K    ++ K++ + +   +P    
Sbjct  163  GHLSRVLALQHTLPVSAVDNVQSHIKA----AEKYDKEATKQLSKAKKQHKNTLIPPQHY  218

Query  310  --TVTCRVLSPETLKALS----NGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMV  471
              ++ C     ET+K L     N +  +Y   ++YL                        
Sbjct  219  VHSLPCIGCPQETMKKLKTDIYNANGNEYQEKERYL------------------------  254

Query  472  GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCG----  639
                  L GLHACGDLS TM++ F+EC EV +V+SV CCY  ++ +    + SHCG    
Sbjct  255  ------LTGLHACGDLSATMVKMFVECEEVTSVVSVACCYMKITTDF---EVSHCGVGGK  305

Query  640  ----FPLSKSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
                +PLS  +K++ G  L   +R+ +C + + ++ L       + ++H +RA  + ++
Sbjct  306  DTYRYPLSDFLKSISGHELPYKSREASCHAIEDYK-LRLKENTDHLKMHCYRAALETLI  363



>ref|XP_004948256.1| PREDICTED: protein RRNAD1 isoform X3 [Gallus gallus]
Length=784

 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 109/433 (25%), Positives = 182/433 (42%), Gaps = 87/433 (20%)
 Frame = +1

Query  139   GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKI--------------RKS  276
             G+L++ L+F  GLS+ A++         D R   + +H+  ++              R  
Sbjct  391   GHLSRFLAFSLGLSVTAVEG--------DGRLVSLAEHFDQELLRELEKAQARGYSRRLP  442

Query  277   ESEDRELSVPKTVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTP  456
              S+    + P       L P   + ++ G L+    G+++L+  +  G A         P
Sbjct  443   PSQRHPNTTPDPTDPASLCPRRPQHVA-GWLDPQAPGQEFLLAPTP-GPALAARN----P  496

Query  457   HSYMVGDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC  636
              +  V    ++L GLHACGDLSV +LR F    +V AV S  CCY  LS        S  
Sbjct  497   LAGPVDSEQVLLTGLHACGDLSVALLRHFAHSPQVAAVTSAACCYMKLSTCPEPTAPSLP  556

Query  637   GFPLSKSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
             G+PLS  V  + G  L   AR+ AC + +                              Y
Sbjct  557   GYPLSTWVAGLPGHTLSYRAREAACHAVEE-----------------------------Y  587

Query  814   SEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLG  993
             +E L       R  + LR   ++  LE+ +Q  D  K   G  + K++      ++S   
Sbjct  588   TERL------RRDSECLRIHCYRAVLETLIQAADPSKKHLGVQTVKKAH-----TLSFPE  636

Query  994   CGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQ-EI  1170
             C   G     C  + L           +  T   D  +L  ++   GL  +G++ +   +
Sbjct  637   CVWGG-----CPFNPLL--------ASSLGTCGTD-MALTHRYARLGLTLVGLDSAAVPL  682

Query  1171  DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPV  1350
             D   +        +++  ++SL   L P++ET+ILLDRLL+L+E     + ALVP+F+P 
Sbjct  683   DSESVCAMLCQQHKVVA-FFSLVLLLAPLVETLILLDRLLYLREQG--FQCALVPLFNPR  739

Query  1351  LSPRNMAIIGRKI  1389
              SPRN+ ++  ++
Sbjct  740   FSPRNLVLVAARV  752



>ref|XP_005188726.1| PREDICTED: methyltransferase-like protein 25-like [Musca domestica]
Length=497

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 115/247 (47%), Gaps = 38/247 (15%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVP----  306
            GYL+  L+ EYG ++L ID++  +      R ++++K +     ++E E + ++ P    
Sbjct  163  GYLSSRLALEYGYNVLGIDSNPSNTENAMERNKKLKKAWNGLKDRAELESKGITPPRRGR  222

Query  307  -KTVTCRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMV----  471
             K  T    +P    + +  ++EK+      + G                 H Y      
Sbjct  223  QKQKTNDNTNPNVTDSDNYKTVEKFITTDLDIAG---------------LIHDYFPELPE  267

Query  472  GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD---------  624
              +++ L GLH CG+L+   L+ F    + K + ++GCCY+LL E  +G++         
Sbjct  268  QQTAVCLTGLHTCGNLASACLKLFHHQEKCKILCNIGCCYHLLKEMYSGQEFFGNKHILD  327

Query  625  -DSHCGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
             +   GFPLS  ++   L LG++AR LA QS DR +    +  L N  L  +RA F++++
Sbjct  328  MNPETGFPLSSYLQEKRLSLGRNARMLAVQSTDRTK---TSKELPNISL-LYRALFEILV  383

Query  802  LRYYSEV  822
                 E+
Sbjct  384  CEALPEM  390



>ref|XP_008291047.1| PREDICTED: methyltransferase-like protein 25 [Stegastes partitus]
Length=590

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKDDSH--CGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE    G++  H  CGFPLS+
Sbjct  362  VVVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDPVGRECLHSLCGFPLSQ  421

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  422  YLRDQSWFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHYS  471


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 2/102 (2%)
 Frame = +1

Query  1087  NAVDSFSLFMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVL  1260
             N       F+ +    L RL ++ES+  + D  G  +  +   + +  +  L+  L P +
Sbjct  481   NVYSKTKTFVDYVRRALRRLELDESKLSDSDIEGYHETYRARRDEMHAFNMLKVTLAPCI  540

Query  1261  ETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             E +ILLDRL +L+E  D   + LV +FDP+LSPR  A++G K
Sbjct  541   EGLILLDRLCYLKEQEDVSLSTLVQLFDPLLSPRCYAVVGLK  582



>ref|XP_002080517.1| GD10526 [Drosophila simulans]
 gb|EDX06102.1| GD10526 [Drosophila simulans]
Length=367

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 104/229 (45%), Gaps = 30/229 (13%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            G+LA+VL + YGL +   +          AR   ++    A    S+ E R    P  +T
Sbjct  150  GHLARVLGYGYGLRVCCYEMQPDLNQ--QAREIDLKLESMAAKHLSQDETRHFQRPVHLT  207

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             R              LE     +Q+L   SSI QA + ++D     ++  G     + G
Sbjct  208  HR--------------LESSTTPEQFL---SSIRQALQLTDD-----NFQFG-----VIG  240

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK-AVGL  675
            LH CG+L  T++R FL C + K +  VGCCY  ++ +A    +   G+PLS  +K   G 
Sbjct  241  LHPCGNLGPTLMRMFLGCPQAKFLNFVGCCYQKMTTQATHPREQVHGYPLSSVLKDKNGC  300

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
             L   AR+++C + + +    +     +  +H+ RA  + I++  + E+
Sbjct  301  QLSYEAREISCHAMEVYHDRLRMGDYQHLRIHSLRAAAERIIVHQFPEL  349



>ref|XP_008109118.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Anolis 
carolinensis]
 ref|XP_008109119.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Anolis 
carolinensis]
 ref|XP_008109120.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Anolis 
carolinensis]
Length=506

 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 66/112 (59%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE-AAGKDDSH--CGFPLSKS  657
            +L GLH CGDL+ + LR F    E+KAV SVGCCY+LLSEE    KD +H   GFPL + 
Sbjct  277  MLVGLHTCGDLAPSTLRLFNAKPEIKAVCSVGCCYHLLSEEHEIEKDGTHRVWGFPLCRY  336

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I++  Y
Sbjct  337  LKEEGWFCGRNARMAACLALERV-AVGQMLPTESL---FYRAVLQVIVVEEY  384


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIG---PYWSLRAALGPVLETIIL  1275
             S F+ +    L +L ++ES+ I  S + +  + +   +     +  L+  LGP +E +IL
Sbjct  401   SSFLDYVRKSLKKLELDESK-ISDSRVMEYFEKYKHRMNEMEAFNMLKVVLGPCIEVLIL  459

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI*SLH  1401
             LDRL +LQE  +   + LV +FDP+ SPR  A++  K  + H
Sbjct  460   LDRLCYLQEQDNIAWSGLVKLFDPIKSPRCYAVVSLKKRAFH  501



>gb|KFO96116.1| Methyltransferase-like 25, partial [Calypte anna]
Length=495

 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 125/289 (43%), Gaps = 68/289 (24%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAA---------KIRKSESEDR  291
            GYL+  LS +Y L +  ID+S  + N    R+ +++KH+ A         K +  +S D+
Sbjct  98   GYLSSFLSMQYNLKVYGIDSSITNTNGALERSRKLKKHWRAYQTRGRTNLKNQSLQSLDQ  157

Query  292  ---ELSVPKTVTCRVLSPETLK---------------ALSNGSLEKYDV----------G  387
               + SVP      ++  ET K                LS   L   DV           
Sbjct  158  VPIQDSVPSCGLTEIVVSETSKLTEVDLVAQTQPEDSKLSEEVLATLDVLPVDAVEVFSS  217

Query  388  KQYLIGE------------SSIGQAQEHSEDRL-----------TPHSYMVGD-SSLILA  495
             Q+  GE            S   +A++ SE  L           T  S ++ D    ++ 
Sbjct  218  SQHNCGELCEEEKAQRRMASLKAKAKKSSESNLYFPLTSCITAETELSDIITDLEDCVMV  277

Query  496  GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD---DSHCGFPLSKSVKA  666
            GLH CG+L+   LR F    E+KAV SVGCCY+LLSE+   ++   +   GFP+ + +K 
Sbjct  278  GLHTCGNLAANTLRIFTAKPEIKAVCSVGCCYHLLSEQFENQEACPEEMWGFPMCQYLKD  337

Query  667  VGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
             G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  338  KGWCCGRNARMSACLALER-VAVGQMLPTESL---FYRAVLQVIIEEIY  382



>ref|XP_007564094.1| PREDICTED: methyltransferase-like protein 25 [Poecilia formosa]
Length=584

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 82/296 (28%), Positives = 130/296 (44%), Gaps = 74/296 (25%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIR-------KHYAAKIRKSESE----  285
            GYL+  LS +YGL +  ID+SS + +    R  +++       KH  A   ++E++    
Sbjct  174  GYLSSFLSLQYGLQVFGIDSSSINTHGAQERNRKLKKFSRAYQKHSKAARTQAEAQSSPQ  233

Query  286  ------------DRE--------------LSVPKTVTCRVLSPET----LKALSNGSLEK  375
                        DR+              +  P   T   L PE     L ALS   ++ 
Sbjct  234  TETVERKPGPNRDRDALAGSGSQQDVGASVDAPAAETQSALGPEAGELFLSALSADVIQP  293

Query  376  YD--VGKQYLIGESSIGQAQEHSEDR-----------LTP-HSYMVGDSSL---------  486
                V    L  E    + +E+ E +            +P  SY+  ++ L         
Sbjct  294  PSPRVPPSQLSAEERERRKRENLEKKARSRGEGADGVFSPLTSYVTSETELRDLITELEE  353

Query  487  -ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKDD---SHCGFPL  648
             ++ GLH CGDL+ + LR F+   E+ AV  VGCCY+LLSEE    G+++   + CGFPL
Sbjct  354  AVMVGLHTCGDLAASTLRMFVAKPELSAVCGVGCCYHLLSEEFNPNGQEEPLQTACGFPL  413

Query  649  SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
            S+ ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  414  SQYLRDQSCFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHYS  465


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L RL +++S+  + D        +   + +  +  L+  L P +E +ILLDR
Sbjct  483   FVDYVRRALHRLELDDSKLCDSDIQSYHDAYEARMDEMHAFNMLKVTLAPCIEGLILLDR  542

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L +L+E  D   +ALV +FDP+LSPR  A++G K
Sbjct  543   LCYLKEQEDVSFSALVQLFDPLLSPRCYAVVGLK  576



>ref|XP_009254179.1| hypothetical protein FPSE_02785 [Fusarium pseudograminearum CS3096]
 gb|EKJ77141.1| hypothetical protein FPSE_02785 [Fusarium pseudograminearum CS3096]
Length=598

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 82/331 (25%), Positives = 142/331 (43%), Gaps = 68/331 (21%)
 Frame = +1

Query  481   SLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC--------  636
             +L+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H         
Sbjct  306   NLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTLQA  365

Query  637   ---------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNF  762
                            GFP+S+   + +  G+ L  +AR +ACQ+   W    ++AG   F
Sbjct  366   VNGRLVRESDKHDPQGFPMSQRFSTYQGDGVRLNITARMMACQAPQNWTE-KESAGF--F  422

Query  763   ELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNS-SGG  939
               H +RA  Q I L                   +R+  H          Q  P+++ +  
Sbjct  423   SRHFYRAVLQKIFL---------------DRGVVRKIRHG-------DSQGEPRDADTAP  460

Query  940   SSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMK  1119
             S+Q  SE     S + +  G+  K   +C          + RS        + + + + +
Sbjct  461   SAQDDSESPFDISTNPVIIGSLRK---SC--------YGTFRSYVRGAVEKLTTNTDYKQ  509

Query  1120  FCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFL  1296
             + +    ++G    +EI+ Y     +  P  + +   WSL A     +E++I+ DR  FL
Sbjct  510   YAEVMQEKMGGITDEEIEQYEA---QYLPRKKELCAIWSLMAFSAMAVESLIVSDRWTFL  566

Query  1297  QESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             +E  D V  A V  +FD  LSPRN+ ++G K
Sbjct  567   KEHDDLVRHAWVETVFDYGLSPRNLVVVGVK  597



>ref|XP_005203782.1| PREDICTED: protein RRNAD1 isoform X1 [Bos taurus]
Length=411

 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 132/304 (43%), Gaps = 94/304 (31%)
 Frame = +1

Query  478   SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKS  657
             + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS+ 
Sbjct  186   ARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDPG--------GYPLSQW  237

Query  658   VKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
             V  + G  L    R+ AC +                             L  Y+E L K+
Sbjct  238   VAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQKA  268

Query  835   PAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK  1014
                   G +LR   ++ ALE+ ++C               ++ E R           G +
Sbjct  269   ------GPSLRTHCYRAALETVIRC---------------AQPELR---------RPGVQ  298

Query  1015  GVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKE  1194
             G           I     +K E            ++   GL R+G++    ++ + + + 
Sbjct  299   G-----------IPRVHELKIE------------EYVQRGLQRVGLDPHLPLNVAAL-RA  334

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
              Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+ +
Sbjct  335   HQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNLVL  392

Query  1375  IGRK  1386
             +  K
Sbjct  393   VATK  396



>ref|XP_003221187.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Anolis 
carolinensis]
Length=626

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 66/112 (59%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE-AAGKDDSH--CGFPLSKS  657
            +L GLH CGDL+ + LR F    E+KAV SVGCCY+LLSEE    KD +H   GFPL + 
Sbjct  397  MLVGLHTCGDLAPSTLRLFNAKPEIKAVCSVGCCYHLLSEEHEIEKDGTHRVWGFPLCRY  456

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I++  Y
Sbjct  457  LKEEGWFCGRNARMAACLALERV-AVGQMLPTESL---FYRAVLQVIVVEEY  504


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIG---PYWSLRAALGPVLETIIL  1275
             S F+ +    L +L ++ES+ I  S + +  + +   +     +  L+  LGP +E +IL
Sbjct  521   SSFLDYVRKSLKKLELDESK-ISDSRVMEYFEKYKHRMNEMEAFNMLKVVLGPCIEVLIL  579

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRKI*SLH  1401
             LDRL +LQE  +   + LV +FDP+ SPR  A++  K  + H
Sbjct  580   LDRLCYLQEQDNIAWSGLVKLFDPIKSPRCYAVVSLKKRAFH  621



>gb|ELQ38217.1| hypothetical protein OOU_Y34scaffold00548g33 [Magnaporthe oryzae 
Y34]
 gb|ELQ65881.1| hypothetical protein OOW_P131scaffold00450g10 [Magnaporthe oryzae 
P131]
Length=534

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 90/349 (26%), Positives = 136/349 (39%), Gaps = 100/349 (29%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE----------------  606
             D  L+   +H+CG+LS   +R+ L    ++AV  VGCCYNL++E                
Sbjct  240   DLRLLAVSIHSCGNLSHYGIRSMLMNPTIRAVAIVGCCYNLMTERLGPPTFKPAFERPTF  299

Query  607   ---------EAAGKDDSHCGFPLSKSV-------KAVGLVLGKSARDLACQSADRWRGLG  738
                      E   KD    GFP+S  +        A G+ L  +AR +ACQ+   W    
Sbjct  300   DSVNGRVRKEEERKDPQ--GFPMSNRLGTYRSRKGAEGVRLNITARMMACQAPQNWTE-A  356

Query  739   QAAGLHNFELHAFRATFQMILLR-------YYSEVLVKSPAIGRQGKTLRRQHHQRALES  897
             ++AG   ++ H +RA  Q +LL        YY E     P  G +G              
Sbjct  357   ESAGF--YDRHFYRAVLQRVLLDRGAITKLYYREDAADGPTTGGEG--------------  400

Query  898   NLQCQDCPKNSSG-----GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISST  1062
                 ++ P N S      GS +K      +C  S           +  +DD   +     
Sbjct  401   ---WKETPFNMSTNPVIIGSLRK------QCYTSLTAYIRGAIDKLMTNDDYSQYSAVIK  451

Query  1063  RSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRA  1242
               V +     ++S++           R G   ++    S +W              SL A
Sbjct  452   EKVSDITDEEIESYN----------QRYGHRRNE---LSSVW--------------SLMA  484

Query  1243  ALGPVLETIILLDRLLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
                 V+E++I  DR LFL+E  D V  A V P+FD   SPRN+ ++G K
Sbjct  485   FSACVVESLIATDRWLFLKEHPDHVRDAWVEPVFDYRQSPRNLVVVGIK  533



>ref|XP_005203783.1| PREDICTED: protein RRNAD1 isoform X2 [Bos taurus]
Length=396

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 132/304 (43%), Gaps = 94/304 (31%)
 Frame = +1

Query  478   SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKS  657
             + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS+ 
Sbjct  171   ARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDPG--------GYPLSQW  222

Query  658   VKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
             V  + G  L    R+ AC +                             L  Y+E L K+
Sbjct  223   VAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQKA  253

Query  835   PAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK  1014
                   G +LR   ++ ALE+ ++C               ++ E R           G +
Sbjct  254   ------GPSLRTHCYRAALETVIRC---------------AQPELR---------RPGVQ  283

Query  1015  GVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKE  1194
             G           I     +K E            ++   GL R+G++    ++ + + + 
Sbjct  284   G-----------IPRVHELKIE------------EYVQRGLQRVGLDPHLPLNVAAL-RA  319

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
              Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+ +
Sbjct  320   HQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNLVL  377

Query  1375  IGRK  1386
             +  K
Sbjct  378   VATK  381



>ref|XP_309746.4| AGAP010960-PA [Anopheles gambiae str. PEST]
 gb|EAA45304.4| AGAP010960-PA [Anopheles gambiae str. PEST]
Length=510

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 96/208 (46%), Gaps = 24/208 (12%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  ++ E+G+ +L +D +  + +  + R ER++       RK +  +   SV     
Sbjct  180  GYLSSRIALEHGIKVLGVDCNEENTSNAEKRRERLKVRMKDWSRKGKI-NLFSSVSSEQN  238

Query  319  CRVLSPETLKALSNGSLEK-YDVGKQYL-IGESSIGQAQEHSEDRLTPHSYMVG--DSSL  486
             +         L  GSL+  Y    Q +    + I  AQE          Y  G   S+ 
Sbjct  239  TKSQDEHFTNLLQRGSLDTLYRTATQLIDFNTNLIELAQE----------YFPGGHHSTF  288

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE---------AAGKDDSHCG  639
             L GLH CG+L    LR F E   +K + +VGCCY+L+ E+             D+   G
Sbjct  289  CLCGLHTCGNLGPNCLRLFHENPTIKGICNVGCCYHLMQEQFVVDEFYNPTKVSDNPGYG  348

Query  640  FPLSKSVKAVGLVLGKSARDLACQSADR  723
            FP+SK ++     LG++AR+LA +S +R
Sbjct  349  FPMSKYLQGKSFYLGRNARNLAAESIER  376



>ref|XP_005930335.1| PREDICTED: methyltransferase-like protein 25-like isoform X2 
[Haplochromis burtoni]
Length=549

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CG+L+ + LR F+   E+ AV SVGCCY+LLSEE   AG+    S CGFPLS+
Sbjct  321  VMVGLHTCGNLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDHAGQKCLQSVCGFPLSQ  380

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  381  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  430


 Score = 62.4 bits (150),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ----EI-DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F+ +    L RL ++ES+    +I DY   ++      + +  +  L+  L P +E +IL
Sbjct  448   FVDYVRRALRRLELDESKLSDSDIQDYHNTYRVR---MDEMHAFNMLKVTLAPCIEGLIL  504

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             LDRL +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  505   LDRLCYLKEQEDVSFSALVQLFDPLLSPRCYAVIGLK  541



>ref|XP_006780801.1| PREDICTED: methyltransferase-like protein 25-like [Neolamprologus 
brichardi]
Length=594

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEA--AGKD--DSHCGFPLSK  654
            ++ GLH CGDL+ + LR F+   E+ AV SVGCCY+LLSEE    G+    S CGFPLS+
Sbjct  366  VMVGLHTCGDLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDHGGQKCLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ----EI-DYSGIWKETQPFTEMIGPYWSLRAALGPVLETIIL  1275
             F+ +    L RL ++ES+    +I DY   ++      + +  +  L+  L P +E +IL
Sbjct  493   FVDYVRRALRRLELDESKLSDSDIQDYHNTYRVRM---DEMHAFNMLKVTLAPCIEGLIL  549

Query  1276  LDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             LDRL +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  550   LDRLCYLKEQEDVSFSALVQLFDPLLSPRCYAVIGLK  586



>ref|XP_003475444.1| PREDICTED: protein RRNAD1 isoform X1 [Cavia porcellus]
Length=474

 Score = 79.3 bits (194),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 62/111 (56%), Gaps = 10/111 (9%)
 Frame = +1

Query  472  GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
            GD+ L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LSE          G+PLS
Sbjct  247  GDTRLLLTGLHACGDLSVALLRHFCCCPEVAALASVGCCYMKLSEPG--------GYPLS  298

Query  652  KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMIL  801
            + V  + G  L    R+ AC + + +    Q AG      H +RAT + ++
Sbjct  299  QWVAGLPGFELPYRLREGACHALEDYAERLQKAG-PGLRTHCYRATLETVI  348



>ref|XP_005930334.1| PREDICTED: methyltransferase-like protein 25-like isoform X1 
[Haplochromis burtoni]
Length=594

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKD--DSHCGFPLSK  654
            ++ GLH CG+L+ + LR F+   E+ AV SVGCCY+LLSEE   AG+    S CGFPLS+
Sbjct  366  VMVGLHTCGNLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDHAGQKCLQSVCGFPLSQ  425

Query  655  SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
             ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  426  YLRDQSCFCGRNARMSACLALERV-ALGQGIQMESL---FYRAVLHVILRDHYS  475


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L RL ++ES+  + D        +   + +  +  L+  L P +E +ILLDR
Sbjct  493   FVDYVRRALRRLELDESKLSDSDIQDYHNTYRVRMDEMHAFNMLKVTLAPCIEGLILLDR  552

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L +L+E  D   +ALV +FDP+LSPR  A+IG K
Sbjct  553   LCYLKEQEDVSFSALVQLFDPLLSPRCYAVIGLK  586



>ref|XP_003712212.1| hypothetical protein MGG_09528 [Magnaporthe oryzae 70-15]
 gb|EHA52405.1| hypothetical protein MGG_09528 [Magnaporthe oryzae 70-15]
Length=611

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 90/349 (26%), Positives = 136/349 (39%), Gaps = 100/349 (29%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE----------------  606
             D  L+   +H+CG+LS   +R+ L    ++AV  VGCCYNL++E                
Sbjct  317   DLRLLAVSIHSCGNLSHYGIRSMLMNPTIRAVAIVGCCYNLMTERLGPPTFKPAFERPTF  376

Query  607   ---------EAAGKDDSHCGFPLSKSV-------KAVGLVLGKSARDLACQSADRWRGLG  738
                      E   KD    GFP+S  +        A G+ L  +AR +ACQ+   W    
Sbjct  377   DSVNGRVRKEEERKDPQ--GFPMSNRLGTYRSRKGAEGVRLNITARMMACQAPQNWTE-A  433

Query  739   QAAGLHNFELHAFRATFQMILLR-------YYSEVLVKSPAIGRQGKTLRRQHHQRALES  897
             ++AG   ++ H +RA  Q +LL        YY E     P  G +G              
Sbjct  434   ESAGF--YDRHFYRAVLQRVLLDRGAITKLYYREDAADGPTTGGEG--------------  477

Query  898   NLQCQDCPKNSSG-----GSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISST  1062
                 ++ P N S      GS +K      +C  S           +  +DD   +     
Sbjct  478   ---WKETPFNMSTNPVIIGSLRK------QCYTSLTAYIRGAIDKLMTNDDYSQYSAVIK  528

Query  1063  RSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRA  1242
               V +     ++S++           R G   ++    S +W              SL A
Sbjct  529   EKVSDITDEEIESYN----------QRYGHRRNE---LSSVW--------------SLMA  561

Query  1243  ALGPVLETIILLDRLLFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
                 V+E++I  DR LFL+E  D V  A V P+FD   SPRN+ ++G K
Sbjct  562   FSACVVESLIATDRWLFLKEHPDHVRDAWVEPVFDYRQSPRNLVVVGIK  610



>ref|XP_005245292.1| PREDICTED: protein RRNAD1 isoform X2 [Homo sapiens]
Length=405

 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 91/307 (30%), Positives = 132/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  178   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  229

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC                    HA         L  Y+E L 
Sbjct  230   QWVAGLPGYELPYRLREGAC--------------------HA---------LEEYAERLQ  260

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  261   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  290

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  291   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  327

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  328   AHVAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  384

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  385   VLVATKM  391



>emb|CCF32634.1| hypothetical protein CH063_04982 [Colletotrichum higginsianum]
Length=600

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 99/397 (25%), Positives = 159/397 (40%), Gaps = 104/397 (26%)
 Frame = +1

Query  328   LSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQE---HSEDRLTPHSYMVGDSSLILAG  498
             L P+  +AL  GS+        Y++G    G   E     E  + P      +  ++   
Sbjct  263   LEPQYNRALGKGSV-------SYVVGRLESGDLTEVIGRIEKEVLPEE-EDKELKMMAVS  314

Query  499   LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE------------------------  606
             +H+CG+LS   +R+ +    + +V  VGCCYNLL+E                        
Sbjct  315   IHSCGNLSHYGIRSLVMNPAIHSVAIVGCCYNLLTEKLGPPTYKYTYARPSLQALNGRVV  374

Query  607   -EAAGKDDSHCGFPLSKSV---KAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHA  774
              E+A  D    GFPLS+++   K  G+ +  +AR +ACQ+   W    Q      F  H 
Sbjct  375   RESARHDPE--GFPLSETLSTYKGEGVRMNITARMMACQAPQNW---TQTESDDFFTRHL  429

Query  775   FRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKR  954
             FRA  Q I L                 + +  + + R ++ N    D     +G +    
Sbjct  430   FRAVLQKIFL----------------DRGVINKVYHRGMDDNEAASD----ENGDARPDE  469

Query  955   SEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL---FMKFC  1125
             S   T  +   +G                  + +  RS+K+    AV   +    + ++ 
Sbjct  470   SPFNTSTNPVIIGS----------------LRKACYRSLKDYVRGAVAKLTTNREYSQYS  513

Query  1126  DSGLARL-GINE----SQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLL  1290
             D    ++ GI++    + E DY    KE       +   WSL A    V+E++I+ DR L
Sbjct  514   DVIRDKMAGISDEDIAAYERDYLCRKKE-------VAAVWSLMAFSATVVESLIVTDRWL  566

Query  1291  FLQESSD-----WVEAALVPIFDPVLSPRNMAIIGRK  1386
             FL+E +D     WVE     +FD   SPRNM ++G K
Sbjct  567   FLREHTDVVRDCWVET----VFDYKESPRNMVVVGIK  599



>ref|XP_387182.1| hypothetical protein FG07006.1 [Fusarium graminearum PH-1]
 gb|ESU13186.1| hypothetical protein FGSG_07006 [Fusarium graminearum PH-1]
 gb|EYB23786.1| hypothetical protein FG05_07006 [Fusarium graminearum]
 emb|CEF83781.1| unnamed protein product [Fusarium graminearum]
Length=584

 Score = 79.3 bits (194),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 86/333 (26%), Positives = 142/333 (43%), Gaps = 68/333 (20%)
 Frame = +1

Query  475   DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC------  636
             D +L+   +H+CG+LS   +R+ +   +++AV  VGCCYNL++E+       H       
Sbjct  290   DLNLMAMSIHSCGNLSHFGIRSLVLNPDIRAVAIVGCCYNLMTEKLGPPTYKHAFLRPTL  349

Query  637   -----------------GFPLSKSV---KAVGLVLGKSARDLACQSADRWRGLGQAAGLH  756
                              GFP+S+     +  G+ L  +AR +ACQ+   W    ++AG  
Sbjct  350   QAVNGRLVRESDKHDPQGFPMSQRFSTHQGDGVRLNITARMMACQAPQNWTE-KESAGF-  407

Query  757   NFELHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNS-S  933
              F  H +RA  Q I L                   +R+  H          Q  P+++ +
Sbjct  408   -FSRHFYRAVLQKIFL---------------DRGVVRKIRHG-------DSQGEPRDADT  444

Query  934   GGSSQKRSEDETRCSMSDLGCGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLF  1113
               S+Q  SE     S + +  G+  K   +C     F   S  R    + T   D    +
Sbjct  445   APSAQDDSESPFDISTNPVIIGSLRK---SC--YGTFK--SYVRGAVEKLTTNTD----Y  493

Query  1114  MKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRLL  1290
              ++ +    ++G    +EI+ Y     +  P  + +   WSL A     +E++I+ DR  
Sbjct  494   KQYTEVMQEKMGGITDEEIEQYEA---QYLPRKKELCAIWSLMAFSAMAVESLIVSDRWT  550

Query  1291  FLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
             FL+E  D V  A V  +FD  LSPRN+ ++G K
Sbjct  551   FLKEHDDLVRHAWVETVFDYGLSPRNLVVVGVK  583



>ref|XP_007974913.1| PREDICTED: protein RRNAD1 isoform X3 [Chlorocebus sabaeus]
 ref|XP_007974914.1| PREDICTED: protein RRNAD1 isoform X3 [Chlorocebus sabaeus]
Length=418

 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  191   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  242

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  243   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  273

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  274   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  303

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  304   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  340

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  341   AHQAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  397

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  398   VLVATKM  404



>ref|XP_007431352.1| PREDICTED: methyltransferase-like protein 25 isoform X1 [Python 
bivittatus]
Length=622

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 68/120 (57%), Gaps = 8/120 (7%)
 Frame = +1

Query  466  MVGD-SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---  633
            +VGD    ++ GLH CGDL+ + LR F    E+KAV SVGCCY+LLSEE    ++     
Sbjct  394  IVGDLEDCVIVGLHTCGDLAPSTLRLFNAVPEIKAVCSVGCCYHLLSEEHEMHEEGTRGI  453

Query  634  CGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
             GFPLS+ +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  454  WGFPLSRYLKEEGWFCGRNARMAACLALERV-AVGQVLPTESL---FYRAVLQVIVEECY  509



>ref|XP_002076314.1| GD15405 [Drosophila simulans]
 gb|EDX15539.1| GD15405 [Drosophila simulans]
Length=494

 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 120/238 (50%), Gaps = 21/238 (9%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +YG  +L IDA++ +      R  ++++ +     ++E + + ++ PK   
Sbjct  155  GYLSSRLALQYGHRVLGIDANAANTENALNRNRKLQRAWNGLTERAELQVQGIT-PKRRG  213

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             +  + E+ K  +  +LE Y    +++  E + G        +L P        ++ L G
Sbjct  214  KKSPARESTK--TAPALENYKTTAKFITTELNFGALLAGHFTQLGPED----SPNICLTG  267

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKD----------DSHCGFPL  648
            LH CG+L+ T L+ F   ++   + +VGCCY+LL E  + ++           +  GFPL
Sbjct  268  LHTCGNLAATCLQVFHAQSDCHLLCNVGCCYHLLRERYSQQEFFGNKALMELQTDYGFPL  327

Query  649  SKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
            S+ ++   + +G++AR LA QS +R      A  L N  L+ +RA  ++++ R+  ++
Sbjct  328  SQYLRERQVRMGRNARMLAAQSIER---TVDAKELPNVTLY-YRALLEILVHRHAPQL  381



>ref|XP_005541468.1| PREDICTED: protein RRNAD1 isoform X4 [Macaca fascicularis]
Length=409

 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  182   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  233

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  234   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  264

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  265   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  294

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  295   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  331

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  332   AHQAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  388

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  389   VLVATKM  395



>ref|XP_007974915.1| PREDICTED: protein RRNAD1 isoform X4 [Chlorocebus sabaeus]
Length=403

 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 91/307 (30%), Positives = 132/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  176   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  227

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC                    HA         L  Y+E L 
Sbjct  228   QWVAGLPGYELPYRLREGAC--------------------HA---------LEEYAERLQ  258

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  259   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  288

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  289   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  325

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  326   AHQAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  382

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  383   VLVATKM  389



>gb|KEY73383.1| hypothetical protein S7711_01496 [Stachybotrys chartarum IBT 
7711]
 gb|KFA52627.1| hypothetical protein S40293_05467 [Stachybotrys chartarum IBT 
40293]
 gb|KFA71397.1| hypothetical protein S40288_09420 [Stachybotrys chartarum IBT 
40288]
Length=595

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 79/334 (24%), Positives = 138/334 (41%), Gaps = 82/334 (25%)
 Frame = +1

Query  484   LILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---------  636
             L+   +H+CG+LS   +R+ +   +++A+  VGCCYN+L+E        H          
Sbjct  306   LMAVSIHSCGNLSHHAIRSLILNQDIRAIAIVGCCYNMLTERLGPPAYKHTYLRPTLQAL  365

Query  637   --------------GFPLSK---SVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFE  765
                           GFP+S+   S    G+ L  +AR +ACQ+   W   G++     F+
Sbjct  366   NGRVFKESDKHDPQGFPMSQRFCSYNDYGVRLNITARMMACQAPYNWT-RGESDNF--FD  422

Query  766   LHAFRATFQMILLRYYSEVLVKSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSS  945
              H +RA  Q + L                          R +   ++ ++  ++   G S
Sbjct  423   RHFYRAVIQRMFL-------------------------DRGVVGKVRHREPGESDKTGDS  457

Query  946   QKRSEDETRCSMSDLG-----CGNDGKKGVTCDDDALFHKISSTRSVKNENTNAVDSFSL  1110
             +  +  +T  +   +G     C N  K  V      +  K++++   K            
Sbjct  458   KPETPFDTSTNPIVIGSLRKPCYNSLKAYVR----GVVEKLTTSEEYK------------  501

Query  1111  FMKFCDSGLARLGINESQEID-YSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDRL  1287
               ++ D    ++G    +EI+ Y   +   +P   +I   WSL A    V E++I+ DR 
Sbjct  502   --QYSDVMQDKMGDVTDEEIERYEKTYLPRRPELCVI---WSLMAFAATVAESLIVTDRW  556

Query  1288  LFLQESSDWVEAALV-PIFDPVLSPRNMAIIGRK  1386
              FL+E  D V+ A V  +FD   SPRN+ ++G K
Sbjct  557   TFLKEHGDVVQEAWVETVFDYRESPRNLVVVGIK  590



>gb|ACE75363.1| conserved hypothetical protein [Glyptapanteles indiensis]
Length=452

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 115/242 (48%), Gaps = 38/242 (16%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            G+LA+ LS++Y LS++ ++ +    ++    A++    Y                   VT
Sbjct  146  GHLARQLSYKYNLSVIGVEQTKELSDL----AKKYDDEY------------------MVT  183

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             + L P+     S     K D  ++ L  +S IG   E  E+     S   G     L G
Sbjct  184  LKKLLPDFDSRSSYHLCAKLD--QEDLSNDSLIGNINEIFENTFGERSVEEG---FGLIG  238

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVKA-VGL  675
            LH CGDL+VT+L+ +++   VK +  VGCCY  L+   +GK +S  G+PLS  +K+    
Sbjct  239  LHPCGDLAVTLLKLYVKQPNVKFISIVGCCYMKLT--TSGKINS-LGYPLSNYLKSKSNN  295

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKSPAIGRQG  855
             L  +A ++AC + + +    +    +N ++HA+R   +MIL++       KS  I R G
Sbjct  296  YLSYAALEVACHAVENYCDKMKTGDYNNLKVHAYRGMLEMILIK-------KSGLIMRHG  348

Query  856  KT  861
            + 
Sbjct  349  RV  350



>tpg|DAA31801.1| TPA: hypothetical protein LOC532204 [Bos taurus]
Length=475

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 132/304 (43%), Gaps = 94/304 (31%)
 Frame = +1

Query  478   SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKS  657
             + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS+ 
Sbjct  250   ARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDPG--------GYPLSQW  301

Query  658   VKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
             V  + G  L    R+ AC +                             L  Y+E L K+
Sbjct  302   VAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQKA  332

Query  835   PAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK  1014
                   G +LR   ++ ALE+ ++C               ++ E R           G +
Sbjct  333   ------GPSLRTHCYRAALETVIRC---------------AQPELR---------RPGVQ  362

Query  1015  GVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKE  1194
             G           I     +K E            ++   GL R+G++    ++ + + + 
Sbjct  363   G-----------IPRVHELKIE------------EYVQRGLQRVGLDPHLPLNVAAL-RA  398

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
              Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+ +
Sbjct  399   HQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNLVL  456

Query  1375  IGRK  1386
             +  K
Sbjct  457   VATK  460



>ref|XP_005898808.1| PREDICTED: protein RRNAD1 [Bos mutus]
 gb|ELR54291.1| hypothetical protein M91_20914 [Bos mutus]
Length=475

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 132/304 (43%), Gaps = 94/304 (31%)
 Frame = +1

Query  478   SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKS  657
             + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS+ 
Sbjct  250   ARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDPG--------GYPLSQW  301

Query  658   VKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
             V  + G  L    R+ AC +                             L  Y+E L K+
Sbjct  302   VAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQKA  332

Query  835   PAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK  1014
                   G +LR   ++ ALE+ ++C               ++ E R           G +
Sbjct  333   ------GPSLRTHCYRAALETVIRC---------------AQPELR---------RPGVQ  362

Query  1015  GVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKE  1194
             G           I     +K E            ++   GL R+G++    ++ + + + 
Sbjct  363   G-----------IPRVHELKIE------------EYVQRGLQRVGLDPHLPLNVAAL-RA  398

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
              Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+ +
Sbjct  399   HQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNLVL  456

Query  1375  IGRK  1386
             +  K
Sbjct  457   VATK  460



>gb|KFU98332.1| Methyltransferase-like 25, partial [Tauraco erythrolophus]
Length=505

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 99/202 (49%), Gaps = 25/202 (12%)
 Frame = +1

Query  265  IRKSESEDRELSVPKTVTCRVLSPETLKALS-----NGSLEKYDVGKQYLIGESSIGQAQ  429
            + +++S++ +LS        VL  + ++  S     NG L K +  ++ +   S   QA 
Sbjct  195  VTRTQSDEDKLSEEALAVLNVLPADAVELFSSSRCNNGELCKEEKAQRKM--ASLKAQAS  252

Query  430  EHSEDRL-----------TPHSYMVGD-SSLILAGLHACGDLSVTMLRTFLECNEVKAVI  573
            + SE  L           T  S ++ D    ++ GLH CGDL+   LR F    E+KAV 
Sbjct  253  KSSESNLYLPLTCCITAETELSDIITDLEDCMMVGLHTCGDLAANTLRIFTAKPEIKAVC  312

Query  574  SVGCCYNLLSEEAAGKD--DSHCGFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAA  747
            SVGCCY+LLSE+   +D  D   GFP+ + +K  G   G++AR  AC + +R   +GQ  
Sbjct  313  SVGCCYHLLSEQFENQDRPDEVWGFPMCQYLKDKGWCCGRNARMSACLALERV-AVGQIL  371

Query  748  GLHNFELHAFRATFQMILLRYY  813
               +     +RA  Q+I+   Y
Sbjct  372  PTESL---FYRAVLQVIIEEMY  390



>ref|NP_057081.3| protein RRNAD1 isoform 1 [Homo sapiens]
 sp|Q96FB5.2|RRNAD_HUMAN RecName: Full=Protein RRNAD1; AltName: Full=Ribosomal RNA adenine 
dimethylase domain-containing protein 1 [Homo sapiens]
Length=475

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  397

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  398   AHVAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>ref|XP_004436289.1| PREDICTED: protein RRNAD1 [Ceratotherium simum simum]
Length=475

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 132/306 (43%), Gaps = 94/306 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GGARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R++ E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRAQPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAAL-  396

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             +  Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  397   RAHQAQENRVVTFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRK  1386
              ++  K
Sbjct  455   VLVATK  460



>ref|XP_009432793.1| PREDICTED: LOW QUALITY PROTEIN: protein RRNAD1 [Pan troglodytes]
Length=480

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  253   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  304

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  305   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  335

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  336   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  365

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  366   VQG-----------IPRVHELKIE------------EYVQQGLQRVGLDPQLPLNLAALQ  402

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  403   AHLAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPQLSPRNL  459

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  460   VLVATKM  466



>ref|XP_008398852.1| PREDICTED: methyltransferase-like protein 25 [Poecilia reticulata]
Length=583

 Score = 79.0 bits (193),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE--AAGKDD---SHCGFPLS  651
            ++ GLH CGDL+ + LR F+   E+ AV  VGCCY+LLSEE    G+++   + CGFPLS
Sbjct  354  VMVGLHTCGDLAASTLRMFVAKPELSAVCGVGCCYHLLSEEFNPDGQEEPLQTACGFPLS  413

Query  652  KSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYS  816
            + ++      G++AR  AC + +R   LGQ   + +     +RA   +IL  +YS
Sbjct  414  QYLRDQSCFCGRNARMSACLALERV-SLGQGIQMESL---FYRAVLHVILRDHYS  464


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +1

Query  1111  FMKFCDSGLARLGINESQ--EIDYSGIWKETQPFTEMIGPYWSLRAALGPVLETIILLDR  1284
             F+ +    L RL +++S+  + D        +   + +  +  L+  L P +E +ILLDR
Sbjct  482   FVDYVRRALRRLELDDSKLCDSDIQSYHDTYEARMDEMHAFNMLKVTLAPCIEGLILLDR  541

Query  1285  LLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             L +L+E      +ALV +FDP+LSPR  A++G K
Sbjct  542   LCYLKEQEGVSFSALVQLFDPLLSPRCYAVVGLK  575



>ref|XP_002049394.1| GJ20770 [Drosophila virilis]
 gb|EDW60587.1| GJ20770 [Drosophila virilis]
Length=493

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 115/234 (49%), Gaps = 23/234 (10%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  L+ +YG  +L +DA   +     AR  ++ + +     ++E + + +  P    
Sbjct  158  GYLSSRLALQYGHYVLGVDAKKSNTESALARNRKLERAWNGLTERAELQSQGIR-PSRRG  216

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQ-AQEHSEDRLTPHSYMVGDSSLILA  495
             +  + ET   ++     KY    +++  E ++    +EH E    P+   V    + L 
Sbjct  217  KKSATKET--PVNRPVQNKYKTTSRFITTELNLCDLVKEHFEQE--PN---VTKPRICLT  269

Query  496  GLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSE----------EAAGKDDSHCGFP  645
            GLH CG+L+ T L+ F   +  + + +VGCCY+LL E          +A  ++ +  GFP
Sbjct  270  GLHTCGNLAATCLQVFHAQDNCRVLCNVGCCYHLLRERYSQQESYENKALMEESTDYGFP  329

Query  646  LSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLR  807
            LS+ ++   + LG++AR LA QS +R      +  L N  L+ +RA  ++++ R
Sbjct  330  LSRYLQQRSVCLGRNARMLAAQSIERTLS---SKELPNITLY-YRALLEILICR  379


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 55/101 (54%), Gaps = 1/101 (1%)
 Frame = +1

Query  1084  TNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKETQPFTEMIGPYWSLRAALGPVLE  1263
              +  ++F  ++K C   L    +    E +   + ++       +  ++ LR +  PVLE
Sbjct  393   VHKFNNFFEYVKICAKKLNEPWLAAVGEAELEALLQQHDVDWHYLSLFYLLRMSFAPVLE  452

Query  1264  TIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ++ILLDRLL+L+E   +  + L+ +FD V+SPR+ AI+  K
Sbjct  453   SVILLDRLLYLKELG-YEHSFLIDLFDAVISPRHYAIVAFK  492



>ref|XP_002080519.1| GD10527 [Drosophila simulans]
 gb|EDX06104.1| GD10527 [Drosophila simulans]
Length=456

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 103/229 (45%), Gaps = 30/229 (13%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            G+LA+VL + YGL +   +          AR   ++    A    S+ E R    P  +T
Sbjct  150  GHLARVLGYGYGLRVCCYEMQPDLNQ--QAREIDLKLESMAAKHLSQDETRHFQRPVHLT  207

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             R              LE     + +L   SSI QA + ++D     ++  G     + G
Sbjct  208  HR--------------LESSTTPEHFL---SSIRQALQLTDD-----NFRFG-----VIG  240

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK-AVGL  675
            LH CG+L  T++R FL C + K +  VGCCY  ++ +A    +   G+PLS  +K   G 
Sbjct  241  LHPCGNLGPTLMRMFLGCPQAKFLNFVGCCYQKMTTQATHPREQVHGYPLSSIIKDKNGC  300

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
             L   AR+++C + + +    +     +  +H+ RA  + I++  + E+
Sbjct  301  QLSYEAREISCHAMEVYHDRLRMGDYQHLRIHSLRAAAERIIVHQFPEL  349



>ref|XP_001866633.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS43658.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=459

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 97/204 (48%), Gaps = 33/204 (16%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            GYL+  ++ E+G+ +L ID +  +    + R +++RK     +++S+    E S+ K   
Sbjct  146  GYLSSRIALEHGIKVLGIDCNEGNTASAERRRDQLRKKVPVALKRSKLT--EESILKD--  201

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
                +PE     +   +  +      L+ E    Q  +    R T            LAG
Sbjct  202  ----APEDPLYKTTTKMIDFQTNLIELVRE----QFPQTQATRFT------------LAG  241

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEA---------AGKDDSHCGFPLS  651
            LH CG+L+   LR F +   ++A+ +VGCCY+LL E             +D++  GFP+S
Sbjct  242  LHTCGNLAPNSLRLFHQNRHIRALCNVGCCYHLLRERFCEDEFFNRDKARDNAGFGFPMS  301

Query  652  KSVKAVGLVLGKSARDLACQSADR  723
              +   G  LG++AR+LA +S +R
Sbjct  302  AFMAGKGFALGRNARNLAAESIER  325



>gb|KFZ57621.1| Methyltransferase-like 25, partial [Podiceps cristatus]
Length=493

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHC---GFPLSKS  657
            ++ GLH CGDL+   LR F +  E+KAV SVGCCY+LLSE+   ++D      GFP+ + 
Sbjct  270  VMVGLHTCGDLAANTLRIFTDKPEIKAVCSVGCCYHLLSEQFENQEDCSAKVWGFPMCQY  329

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  330  LKDKGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  377



>ref|XP_009667902.1| PREDICTED: methyltransferase-like protein 25 [Struthio camelus 
australis]
Length=535

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---CGFPLSKS  657
            I+ GLH CGDL+   LR F+   E+KAV SVGCCY+LLSE+   ++D      GFP+ + 
Sbjct  311  IMVGLHTCGDLAPNTLRIFIAKPEIKAVCSVGCCYHLLSEQYENQEDCTEEVWGFPMCQY  370

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  371  LKDEGWCCGRNARMSACLALER-VAVGQMLPTESL---FYRAVLQVIIEEIY  418



>ref|XP_010353702.1| PREDICTED: protein RRNAD1 isoform X1 [Rhinopithecus roxellana]
Length=475

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 132/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLSGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAAL-  396

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             +  Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  397   QAHQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>ref|XP_003892886.1| PREDICTED: protein RRNAD1 isoform X1 [Papio anubis]
Length=475

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 132/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAAL-  396

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             +  Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  397   QAHQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>ref|XP_002032836.1| GM20996 [Drosophila sechellia]
 gb|EDW46849.1| GM20996 [Drosophila sechellia]
Length=456

 Score = 77.8 bits (190),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 103/229 (45%), Gaps = 30/229 (13%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDASSHHGNITDARAERIRKHYAAKIRKSESEDRELSVPKTVT  318
            G+LA+VL + YGL +   +          AR   ++    A    S+ E R    P  +T
Sbjct  150  GHLARVLGYGYGLRVCCYEMQPDLNQ--QAREIDLKLESMATKHLSQDETRHFQRPVHLT  207

Query  319  CRVLSPETLKALSNGSLEKYDVGKQYLIGESSIGQAQEHSEDRLTPHSYMVGDSSLILAG  498
             R              LE     +Q+L   S I QA + ++D     ++  G     + G
Sbjct  208  HR--------------LESSTTPEQFL---SIIRQALQLTDD-----NFRFG-----VIG  240

Query  499  LHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKSVK-AVGL  675
            LH CG+L  T++R FL C + K +  VGCCY  ++ +A    +   G+PLS  +K   G 
Sbjct  241  LHPCGNLGPTLMRMFLGCPQAKFLNFVGCCYQKMTTQATHPREQVHGYPLSSVIKDKNGC  300

Query  676  VLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEV  822
             L   AR+++C + + +    +     +  +H+ RA  + I++  + E+
Sbjct  301  QLSYEAREISCHAMEVYHDRLRMGDYQHLRIHSLRAAAERIIVHQFPEL  349



>ref|NP_001244410.1| protein RRNAD1 [Macaca mulatta]
 ref|XP_005541465.1| PREDICTED: protein RRNAD1 isoform X1 [Macaca fascicularis]
 ref|XP_007974911.1| PREDICTED: protein RRNAD1 isoform X1 [Chlorocebus sabaeus]
 gb|EHH15355.1| hypothetical protein EGK_01431 [Macaca mulatta]
 gb|EHH62863.1| hypothetical protein EGM_19583 [Macaca fascicularis]
Length=475

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  397

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  398   AHQAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>ref|XP_008321156.1| PREDICTED: protein RRNAD1 isoform X2 [Cynoglossus semilaevis]
Length=510

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 70/254 (28%), Positives = 114/254 (45%), Gaps = 38/254 (15%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDA--------SSHHGNITDARAERIRKHYAAKIRKSESEDRE  294
            G+L + LSF  GLS+ A++A        +   G +  A  +  R+   +++   ES  R 
Sbjct  138  GHLTRFLSFGLGLSVTAVEADCTLVDMATRFDGQLLWALEKEKRRKTGSELPGQESAPRH  197

Query  295  LSVPKTVTCRVLSPETLKAL-SNGSLEKYDVGKQYLIGESSIGQAQ-EHSEDRLTPHSYM  468
            ++    V  R    + +K L S G+  K   G ++ +G     Q +        TP + +
Sbjct  198  VTA--WVNPRGTWMDFMKQLNSTGTRRKSQCGPEHHMGCCHPAQTRCSPVVQEWTPQTNI  255

Query  469  VG------DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE-------  609
                    D   IL GLHACGDLS T+LR F+ C  V+ + SV CCY  ++ E       
Sbjct  256  CAEGFNSRDHDFILTGLHACGDLSATLLRHFVNCPHVRGITSVACCYMKITTEENPVPPG  315

Query  610  -------AAGKDDSHCGFPLSKSVKAV-GLVLGKSARDLACQSADRW--RGLGQAAGLHN  759
                       D S  G+P+S  V+++ G  L   AR+ AC + + +  R   Q+  L  
Sbjct  316  VVEAPAPTLDSDPSVFGYPMSSWVRSLTGHRLSYKAREGACHALEDYVSRLKDQSELL--  373

Query  760  FELHAFRATFQMIL  801
              +H +RA  + ++
Sbjct  374  -RIHCYRAILETVI  386


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +1

Query  1225  YWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ++SL   L PV+ET++LLDR+++LQE+   V + LV +FDP  SPRN  ++  K
Sbjct  446   FFSLTLLLAPVVETLVLLDRMVYLQENG--VNSQLVALFDPNFSPRNFVLVAVK  497



>gb|KFV89525.1| Methyltransferase-like 25, partial [Fulmarus glacialis]
Length=526

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDD---SHCGFPLSKS  657
            ++ GLH CGDL+   LR F    E+KAV SVGCCY+LLSE+   ++D      GFP+ + 
Sbjct  303  VMVGLHTCGDLAANTLRIFTAKPEIKAVCSVGCCYHLLSEQFENQEDCPEEAWGFPMCQY  362

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K +G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  363  LKDMGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  410


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 8/99 (8%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINESQE-----IDYSGIWKETQPFTEMIGPYWSLRAALGPVLETI  1269
             S F+ +    L +L +++S+      +DY   +K      E    +  L+  L P +E +
Sbjct  427   SSFIDYVRKSLKKLELDDSKLPDSCIMDYYEKYKHRMNELE---AFNMLKVVLAPCIEVL  483

Query  1270  ILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ILLDRL +L+E  +   + LV +FDPV SPR  A+I  K
Sbjct  484   ILLDRLCYLKEQDNIAWSGLVKLFDPVKSPRCYAVIALK  522



>gb|KFV78549.1| Methyltransferase-like 25, partial [Struthio camelus australis]
Length=509

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---CGFPLSKS  657
            I+ GLH CGDL+   LR F+   E+KAV SVGCCY+LLSE+   ++D      GFP+ + 
Sbjct  286  IMVGLHTCGDLAPNTLRIFIAKPEIKAVCSVGCCYHLLSEQYENQEDCTEEVWGFPMCQY  345

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  346  LKDEGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  393



>ref|XP_009585664.1| PREDICTED: methyltransferase-like protein 25 [Fulmarus glacialis]
Length=534

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDD---SHCGFPLSKS  657
            ++ GLH CGDL+   LR F    E+KAV SVGCCY+LLSE+   ++D      GFP+ + 
Sbjct  310  VMVGLHTCGDLAANTLRIFTAKPEIKAVCSVGCCYHLLSEQFENQEDCPEEAWGFPMCQY  369

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K +G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  370  LKDMGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  417


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 8/99 (8%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINESQE-----IDYSGIWKETQPFTEMIGPYWSLRAALGPVLETI  1269
             S F+ +    L +L +++S+      +DY   +K      E    +  L+  L P +E +
Sbjct  434   SSFIDYVRKSLKKLELDDSKLPDSCIMDYYEKYKHRMNELE---AFNMLKVVLAPCIEVL  490

Query  1270  ILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ILLDRL +L+E  +   + LV +FDPV SPR  A+I  K
Sbjct  491   ILLDRLCYLKEQDNIAWSGLVKLFDPVKSPRCYAVIALK  529



>ref|XP_005039553.1| PREDICTED: methyltransferase-like protein 25 isoform X4 [Ficedula 
albicollis]
 ref|XP_005039554.1| PREDICTED: methyltransferase-like protein 25 isoform X5 [Ficedula 
albicollis]
Length=472

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---CGFPLSKS  657
            ++ GLH CGDL+   LR F    E+KAV SVGCCY+LLSE+   +++ H    GFP+ + 
Sbjct  341  MMVGLHTCGDLAADTLRIFTAKPEIKAVCSVGCCYHLLSEQFENQEECHDRVWGFPMCQY  400

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  401  LKDKGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  448



>gb|AAD34037.1|AF151800_1 CGI-41 protein [Homo sapiens]
Length=475

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  397

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  398   AHLAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>gb|EAW52916.1| chromosome 1 open reading frame 66, isoform CRA_b [Homo sapiens]
 gb|EAW52918.1| chromosome 1 open reading frame 66, isoform CRA_b [Homo sapiens]
 gb|AIC56378.1| RRNAD1, partial [synthetic construct]
Length=475

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  397

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  398   AHLAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>gb|AAH11382.1| Chromosome 1 open reading frame 66 [Homo sapiens]
Length=475

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  248   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  299

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  300   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  330

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  331   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  360

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  361   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  397

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  398   AHLAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQE--QLFHAELLPIFSPELSPRNL  454

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  455   VLVATKM  461



>gb|EAW52915.1| chromosome 1 open reading frame 66, isoform CRA_a [Homo sapiens]
Length=473

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  246   GRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLS  297

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC +                             L  Y+E L 
Sbjct  298   QWVAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQ  328

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
             K+      G  LR   ++ ALE+ +               +R+  E R           G
Sbjct  329   KA------GPGLRTHCYRAALETVI---------------RRARPELR---------RPG  358

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  359   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAALQ  395

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
                     ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  396   AHLAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNL  452

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  453   VLVATKM  459



>ref|XP_008262522.1| PREDICTED: protein RRNAD1 isoform X2 [Oryctolagus cuniculus]
Length=436

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 88/307 (29%), Positives = 131/307 (43%), Gaps = 94/307 (31%)
 Frame = +1

Query  472   GDSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLS  651
             G + L+L GLHACGDLS  +LR F  C EV A+ SVGCCY  LS+          G+PLS
Sbjct  209   GGARLLLTGLHACGDLSAALLRHFCCCPEVVALASVGCCYMKLSDPG--------GYPLS  260

Query  652   KSVKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLV  828
             + V  + G  L    R+ AC               H  E +A R                
Sbjct  261   QWVAGLPGHTLPYRLREGAC---------------HALEEYAVR----------------  289

Query  829   KSPAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDG  1008
                 + + G  LR   ++ ALE+ +               +R++ E R           G
Sbjct  290   ----LQKAGPGLRTHCYRAALETVI---------------RRAQPELR---------RPG  321

Query  1009  KKGVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIW  1188
              +G           I     +K E            ++   GL R+G++    ++ + + 
Sbjct  322   VQG-----------IPRVHELKIE------------EYVQRGLQRVGLDPQLPLNLAAL-  357

Query  1189  KETQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNM  1368
             +  Q     +  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+
Sbjct  358   QAHQAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEHG--FHAELLPIFSPELSPRNL  415

Query  1369  AIIGRKI  1389
              ++  K+
Sbjct  416   VLVATKM  422



>ref|XP_008321155.1| PREDICTED: protein RRNAD1 isoform X1 [Cynoglossus semilaevis]
Length=543

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/254 (28%), Positives = 114/254 (45%), Gaps = 38/254 (15%)
 Frame = +1

Query  139  GYLAQVLSFEYGLSILAIDA--------SSHHGNITDARAERIRKHYAAKIRKSESEDRE  294
            G+L + LSF  GLS+ A++A        +   G +  A  +  R+   +++   ES  R 
Sbjct  171  GHLTRFLSFGLGLSVTAVEADCTLVDMATRFDGQLLWALEKEKRRKTGSELPGQESAPRH  230

Query  295  LSVPKTVTCRVLSPETLKAL-SNGSLEKYDVGKQYLIGESSIGQAQ-EHSEDRLTPHSYM  468
            ++    V  R    + +K L S G+  K   G ++ +G     Q +        TP + +
Sbjct  231  VTA--WVNPRGTWMDFMKQLNSTGTRRKSQCGPEHHMGCCHPAQTRCSPVVQEWTPQTNI  288

Query  469  VG------DSSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE-------  609
                    D   IL GLHACGDLS T+LR F+ C  V+ + SV CCY  ++ E       
Sbjct  289  CAEGFNSRDHDFILTGLHACGDLSATLLRHFVNCPHVRGITSVACCYMKITTEENPVPPG  348

Query  610  -------AAGKDDSHCGFPLSKSVKAV-GLVLGKSARDLACQSADRW--RGLGQAAGLHN  759
                       D S  G+P+S  V+++ G  L   AR+ AC + + +  R   Q+  L  
Sbjct  349  VVEAPAPTLDSDPSVFGYPMSSWVRSLTGHRLSYKAREGACHALEDYVSRLKDQSELL--  406

Query  760  FELHAFRATFQMIL  801
              +H +RA  + ++
Sbjct  407  -RIHCYRAILETVI  419


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +1

Query  1225  YWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ++SL   L PV+ET++LLDR+++LQE+   V + LV +FDP  SPRN  ++  K
Sbjct  479   FFSLTLLLAPVVETLVLLDRMVYLQENG--VNSQLVALFDPNFSPRNFVLVAVK  530



>ref|XP_005956008.1| PREDICTED: protein RRNAD1 [Pantholops hodgsonii]
Length=475

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 88/304 (29%), Positives = 131/304 (43%), Gaps = 94/304 (31%)
 Frame = +1

Query  478   SSLILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSHCGFPLSKS  657
             + L+L GLHACGDLSV +LR F  C EV A+ SVGCCY  LS+          G+PLS+ 
Sbjct  250   ARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG--------GYPLSQW  301

Query  658   VKAV-GLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYYSEVLVKS  834
             V  + G  L    R+ AC +                             L  Y+E L K+
Sbjct  302   VAGLPGYELPYRLREGACHA-----------------------------LEEYAERLQKA  332

Query  835   PAIGRQGKTLRRQHHQRALESNLQCQDCPKNSSGGSSQKRSEDETRCSMSDLGCGNDGKK  1014
                   G +LR   ++ ALE+ ++C               ++ E R           G +
Sbjct  333   ------GPSLRTHCYRAALETVIRC---------------AQPELR---------RPGVQ  362

Query  1015  GVTCDDDALFHKISSTRSVKNENTNAVDSFSLFMKFCDSGLARLGINESQEIDYSGIWKE  1194
             G           I     +K E            ++   GL R+G++    ++ + +   
Sbjct  363   G-----------IPRVHELKIE------------EYVQRGLQRVGLDPHLPLNMAALQAH  399

Query  1195  TQPFTEMIGPYWSLRAALGPVLETIILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAI  1374
                   ++  ++SL   L P++ET+ILLDRLL+LQE      A L+PIF P LSPRN+ +
Sbjct  400   QAQENRVVA-FFSLALLLAPLVETLILLDRLLYLQEQG--FHAELLPIFSPELSPRNLVL  456

Query  1375  IGRK  1386
             +  K
Sbjct  457   VATK  460



>ref|XP_005039552.1| PREDICTED: methyltransferase-like protein 25 isoform X3 [Ficedula 
albicollis]
Length=485

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---CGFPLSKS  657
            ++ GLH CGDL+   LR F    E+KAV SVGCCY+LLSE+   +++ H    GFP+ + 
Sbjct  341  MMVGLHTCGDLAADTLRIFTAKPEIKAVCSVGCCYHLLSEQFENQEECHDRVWGFPMCQY  400

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  401  LKDKGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  448



>ref|XP_005358159.1| PREDICTED: methyltransferase-like protein 25 isoform X2 [Microtus 
ochrogaster]
Length=596

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 70/132 (53%), Gaps = 18/132 (14%)
 Frame = +1

Query  460  SYMVGDSSL----------ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEE  609
            S++  DS L          ++ GLH CGDL+   LR F   +EVK V SVGCCY+LLSEE
Sbjct  354  SFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFASKSEVKGVCSVGCCYHLLSEE  413

Query  610  AAGKDDSHC----GFPLSKSVKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAF  777
               +D  +     GFP+ + +K      G++AR  AC + +R   +GQ  GL    L  +
Sbjct  414  FENQDKEYAQENWGFPMCRYLKEERWCCGRNARMSACLALERV-AVGQ--GLPTESLF-Y  469

Query  778  RATFQMILLRYY  813
            RA  Q I+  YY
Sbjct  470  RAVLQNIIKDYY  481


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = +1

Query  1105  SLFMKFCDSGLARLGINES---QEI--DYSGIWKETQPFTEMIGPYWSLRAALGPVLETI  1269
             S F+ +    L +LG++ES   +EI  DY   +++ +P    +  +  L+  L P +ET+
Sbjct  498   SSFLDYVRMSLKKLGLDESKISEEIIMDY---YEKYRPRMNELEAFNMLKVVLAPCIETL  554

Query  1270  ILLDRLLFLQESSDWVEAALVPIFDPVLSPRNMAIIGRK  1386
             ILLDRL +L+E  D   +ALV +FDPV SPR  A+I  K
Sbjct  555   ILLDRLCYLKEQEDVSWSALVKLFDPVQSPRCYAVIALK  593



>gb|KFO64767.1| Methyltransferase-like 25, partial [Corvus brachyrhynchos]
Length=526

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  487  ILAGLHACGDLSVTMLRTFLECNEVKAVISVGCCYNLLSEEAAGKDDSH---CGFPLSKS  657
            ++ GLH CGDL+   LR F    E+KAV SVGCCY+LLSE+   +++ H    GFP+ + 
Sbjct  303  MMVGLHTCGDLAANTLRIFTAKPEIKAVCSVGCCYHLLSEQFENQEECHDQVWGFPMCQY  362

Query  658  VKAVGLVLGKSARDLACQSADRWRGLGQAAGLHNFELHAFRATFQMILLRYY  813
            +K  G   G++AR  AC + +R   +GQ     +     +RA  Q+I+   Y
Sbjct  363  LKDKGWCCGRNARMSACLALERV-AVGQMLPTESL---FYRAVLQVIIEEIY  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6091926715680