BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29514_g1_i1 len=1278 path=[7:0-1277]

Length=1278
                                                                      Score     E

gb|AGS83386.1|  tempranillo                                             488   6e-168   
ref|XP_002281709.2|  PREDICTED: AP2/ERF and B3 domain-containing ...    485   2e-166   Vitis vinifera
ref|XP_011070834.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    483   1e-165   
emb|CAN68564.1|  hypothetical protein VITISV_032171                     480   9e-165   Vitis vinifera
ref|XP_011077234.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    476   2e-163   
ref|XP_009613275.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    476   8e-163   
ref|XP_007046304.1|  AP2 domain class transcription factor              475   8e-163   
emb|CDP00578.1|  unnamed protein product                                469   4e-160   
gb|AFH57270.1|  RAV                                                     467   1e-159   
ref|XP_006437734.1|  hypothetical protein CICLE_v10031846mg             466   4e-159   
ref|XP_006484413.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    465   8e-159   
ref|XP_010262942.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    463   3e-158   
gb|KDO70089.1|  hypothetical protein CISIN_1g017035mg                   462   1e-157   
ref|XP_010265251.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    462   2e-157   
gb|AEZ02303.1|  RAV1                                                    462   2e-157   
ref|XP_009796840.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    462   3e-157   
gb|ACF74549.1|  RAV                                                     461   4e-157   Nicotiana tabacum [American tobacco]
gb|ACT33043.1|  RAV transcription factor                                457   9e-156   Camellia sinensis [black tea]
ref|XP_002524409.1|  DNA-binding protein RAV1, putative                 457   2e-155   Ricinus communis
gb|KDP29366.1|  hypothetical protein JCGZ_18287                         456   2e-155   
gb|AAW83473.1|  RAV transcription factor                                455   2e-154   Capsicum annuum
gb|AAQ05799.1|AF478458_1  DNA binding protein Rav                       454   2e-154   Capsicum annuum
ref|XP_010093403.1|  AP2/ERF and B3 domain-containing transcripti...    453   5e-154   
gb|AGT55822.1|  tempranillo                                             450   3e-153   
ref|XP_004297140.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    451   4e-153   
ref|XP_011021709.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    446   2e-151   
ref|XP_004238962.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    446   7e-151   
ref|XP_002311438.2|  DNA-binding protein RAV2                           445   8e-151   Populus trichocarpa [western balsam poplar]
gb|ABY57635.1|  RAV2                                                    442   2e-149   
ref|XP_006362535.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    435   1e-146   
ref|XP_009614561.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    433   2e-146   
ref|XP_011008525.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    435   2e-146   
ref|XP_002315958.2|  DNA-binding protein RAV2                           432   1e-145   Populus trichocarpa [western balsam poplar]
ref|XP_003516851.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    430   6e-145   
ref|XP_008350869.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    429   4e-144   
ref|XP_008446558.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    426   8e-144   
ref|XP_008243173.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    427   3e-143   
ref|XP_004135113.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    424   3e-143   
gb|ADE41129.1|  AP2 domain class transcription factor                   426   4e-143   
ref|XP_009356262.1|  PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and ...    426   5e-143   
ref|XP_008339704.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    425   9e-143   
gb|EYU29942.1|  hypothetical protein MIMGU_mgv1a009431mg                422   4e-142   
ref|XP_010044293.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    422   5e-142   
ref|XP_009789826.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    422   6e-142   
ref|XP_004514325.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    421   2e-141   
ref|XP_003518682.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    422   2e-141   
gb|AID51427.1|  ethylene response factor 22                             417   1e-140   
ref|XP_010528045.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    418   2e-140   
ref|XP_008791228.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    417   3e-140   
ref|XP_007154354.1|  hypothetical protein PHAVU_003G111800g             417   7e-140   
ref|XP_010923453.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    415   3e-139   
ref|XP_010681667.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    414   3e-138   
ref|XP_009400502.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    410   2e-137   
emb|CDX97996.1|  BnaA06g07470D                                          407   8e-137   
emb|CDY61361.1|  BnaCnng37790D                                          407   1e-136   
gb|EPS68232.1|  hypothetical protein M569_06539                         407   1e-136   
ref|XP_010556384.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    407   2e-136   
ref|XP_006305243.1|  hypothetical protein CARUB_v10009612mg             407   2e-136   
ref|XP_009395563.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    407   3e-136   
ref|XP_006417140.1|  hypothetical protein EUTSA_v10010019mg             406   3e-136   
emb|CDX84999.1|  BnaC05g20560D                                          407   4e-136   
dbj|BAJ34161.1|  unnamed protein product                                406   4e-136   
ref|XP_006391089.1|  hypothetical protein EUTSA_v10019566mg             406   5e-136   
ref|XP_009148531.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    405   9e-136   
ref|XP_009336653.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    405   3e-135   
ref|XP_006415886.1|  hypothetical protein EUTSA_v10007983mg             404   7e-135   
ref|XP_002887208.1|  AP2 domain-containing protein RAP2.8               403   8e-135   
ref|XP_002889996.1|  hypothetical protein ARALYDRAFT_888685             402   1e-134   
gb|AES97413.2|  AP2/ERF and B3 domain transcription factor              403   2e-134   
ref|XP_010458777.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    402   2e-134   
ref|XP_010476321.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    402   2e-134   
ref|XP_008799316.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    402   2e-134   
ref|XP_010495155.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    402   2e-134   
ref|XP_010916479.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    402   2e-134   
ref|XP_007227469.1|  hypothetical protein PRUPE_ppa006243mg             404   4e-134   
ref|NP_172784.1|  AP2/ERF and B3 domain-containing transcription ...    400   7e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551303.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    400   1e-133   
emb|CDY24391.1|  BnaCnng04580D                                          399   2e-133   
ref|XP_003614455.1|  AP2 domain-containing transcription factor         402   2e-133   
ref|NP_564947.1|  AP2-EREBP family, RAVE subfamily protein RAV2         399   3e-133   Arabidopsis thaliana [mouse-ear cress]
gb|KFK41311.1|  ap2 erf and b3 domain-containing transcription fa...    399   3e-133   
ref|XP_010470843.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    399   4e-133   
gb|KFK43591.1|  ap2 erf and b3 domain-containing transcription fa...    397   9e-133   
ref|XP_010477910.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    398   9e-133   
ref|XP_010460355.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    397   2e-132   
ref|XP_010924129.1|  PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and ...    398   2e-132   
ref|XP_006302450.1|  hypothetical protein CARUB_v10020536mg             397   2e-132   
gb|AAM63120.1|  putative RAV2-like DNA-binding protein                  397   2e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49774.1|  AP2 domain containing protein RAP2.8                    396   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460354.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    397   2e-132   
emb|CDY16133.1|  BnaA09g28670D                                          397   2e-132   
ref|XP_009115339.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    397   4e-132   
emb|CDY36099.1|  BnaA08g19490D                                          395   1e-131   
gb|KFK35073.1|  hypothetical protein AALP_AA5G231800                    394   2e-131   
ref|XP_002890683.1|  hypothetical protein ARALYDRAFT_890147             395   2e-131   
ref|XP_009152116.1|  PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and ...    394   3e-131   
ref|XP_007143801.1|  hypothetical protein PHAVU_007G102800g             394   5e-131   
ref|XP_006395630.1|  hypothetical protein EUTSA_v10004508mg             393   6e-131   
ref|XP_010499095.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    393   8e-131   
ref|XP_010415512.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    392   2e-130   
ref|XP_010460353.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    392   2e-130   
ref|XP_009118012.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    391   3e-130   
ref|XP_010511905.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    391   4e-130   
emb|CDY58354.1|  BnaCnng33070D                                          390   4e-130   
ref|XP_009109894.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    391   8e-130   
ref|XP_002875273.1|  hypothetical protein ARALYDRAFT_484335             389   2e-129   
emb|CDY72302.1|  BnaAnng40580D                                          389   2e-129   
ref|NP_173927.1|  AP2/ERF and B3 domain-containing transcription ...    388   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409674.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    386   1e-128   
ref|XP_006366067.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    387   2e-128   
ref|XP_003556265.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    387   3e-128   
ref|XP_010926493.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    385   5e-128   
emb|CDX81561.1|  BnaC02g18650D                                          384   2e-127   
emb|CDX99755.1|  BnaC02g35650D                                          383   6e-127   
ref|XP_003591822.1|  AP2/ERF and B3 domain-containing transcripti...    384   9e-127   
ref|XP_009402997.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    382   1e-126   
ref|XP_010502448.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    382   1e-126   
ref|XP_009127674.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    381   3e-126   
ref|XP_009393568.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    381   3e-126   
ref|XP_009394443.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    379   8e-126   
ref|XP_010046598.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    379   8e-126   
ref|XP_004236999.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    380   1e-125   
ref|NP_001237600.1|  RAV-like DNA-binding protein                       379   2e-125   
emb|CDY40973.1|  BnaA02g27630D                                          376   1e-124   
ref|XP_010046597.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    376   2e-124   
ref|XP_009381393.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    375   4e-124   
gb|ACI46678.1|  DNA-binding protein                                     377   4e-124   Galega orientalis
ref|XP_009390239.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    375   8e-124   
ref|XP_010425223.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    375   1e-123   
gb|KFK44549.1|  ap2 erf and b3 domain-containing transcription fa...    373   3e-123   
ref|XP_009394714.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    373   5e-123   
ref|XP_009386126.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    372   1e-122   
ref|XP_004496199.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    373   1e-122   
ref|XP_006843763.1|  hypothetical protein AMTR_s00007p00238950          372   3e-122   
ref|XP_010514193.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    370   8e-122   
ref|NP_189201.1|  ethylene response DNA binding factor 3                369   2e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65499.1|  AP2 domain transcription factor                         368   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418388.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    367   2e-120   
ref|XP_004151060.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    360   2e-118   
ref|XP_004170315.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    358   6e-118   
ref|XP_010040940.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    360   6e-118   
ref|XP_002279732.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    355   4e-117   Vitis vinifera
ref|XP_006292936.1|  hypothetical protein CARUB_v10019207mg             369   5e-117   
ref|XP_008465773.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    354   6e-116   
ref|XP_009381733.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    354   6e-116   
ref|XP_008782355.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    353   9e-116   
ref|XP_004961326.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    355   1e-115   
gb|AGB07590.1|  ethylene-responsive transcription factor 7              352   1e-115   
ref|XP_009403983.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    353   2e-115   
ref|XP_009413643.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    350   2e-114   
ref|XP_002440193.1|  hypothetical protein SORBIDRAFT_09g027530          352   3e-114   Sorghum bicolor [broomcorn]
gb|EPS59202.1|  hypothetical protein M569_15607                         348   2e-113   
dbj|BAK03139.1|  predicted protein                                      350   2e-113   
ref|XP_007033326.1|  AP2 domain class transcription factor, putative    347   3e-113   
ref|NP_001043946.1|  Os01g0693400                                       349   5e-113   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA58010.1|  TPA: putative AP2/EREBP transcription factor sup...    346   7e-112   
gb|AIB05361.1|  AP2-EREBP transcription factor                          346   7e-112   
ref|XP_010536332.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    341   3e-111   
emb|CDX83547.1|  BnaC07g22870D                                          338   8e-110   
ref|NP_001151105.1|  DNA-binding protein RAV1                           340   9e-110   Zea mays [maize]
dbj|BAK00882.1|  predicted protein                                      340   1e-109   
gb|KCW75689.1|  hypothetical protein EUGRSUZ_D00053                     337   4e-109   
ref|NP_001141742.1|  putative AP2/EREBP transcription factor supe...    339   6e-109   Zea mays [maize]
ref|XP_006430818.1|  hypothetical protein CICLE_v10012300mg             335   9e-109   
ref|NP_001056237.1|  Os05g0549800                                       337   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006482296.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    334   2e-108   
ref|XP_003569603.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    335   2e-107   
emb|CDY13581.1|  BnaA06g33420D                                          343   2e-107   
gb|EAY98921.1|  hypothetical protein OsI_20876                          333   6e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_008656006.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    332   1e-106   
ref|XP_007216476.1|  hypothetical protein PRUPE_ppa026046mg             325   6e-105   
ref|XP_009371009.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    323   4e-104   
emb|CAN61373.1|  hypothetical protein VITISV_034843                     321   4e-104   Vitis vinifera
ref|XP_004969625.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    324   3e-103   
ref|XP_008230383.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    320   6e-103   
ref|XP_008341862.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    319   2e-102   
ref|XP_002458352.1|  hypothetical protein SORBIDRAFT_03g031860          320   3e-101   Sorghum bicolor [broomcorn]
ref|XP_002979064.1|  hypothetical protein SELMODRAFT_110104             311   4e-100   
ref|XP_001763731.1|  predicted protein                                  308   6e-99    
gb|EPS58447.1|  hypothetical protein M569_16368                         306   2e-98    
ref|XP_002991538.1|  hypothetical protein SELMODRAFT_133669             306   5e-98    
ref|XP_001771261.1|  predicted protein                                  302   4e-97    
ref|XP_009371008.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    301   1e-95    
ref|XP_008342069.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    300   4e-95    
ref|XP_008379887.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    300   5e-95    
emb|CDM81001.1|  unnamed protein product                                299   1e-94    
ref|XP_003565959.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    298   3e-93    
emb|CDJ26459.1|  unnamed protein product                                295   1e-92    
ref|XP_009357114.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    293   1e-92    
emb|CDM81004.1|  unnamed protein product                                295   1e-92    
emb|CDM81002.1|  unnamed protein product                                295   2e-92    
sp|Q9AWS7.1|Y1407_ORYSJ  RecName: Full=Putative AP2/ERF and B3 do...    291   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009357037.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    291   2e-91    
ref|XP_008379886.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    291   2e-91    
ref|XP_010230439.1|  PREDICTED: putative AP2/ERF and B3 domain-co...    291   2e-91    
gb|EAY72471.1|  hypothetical protein OsI_00326                          290   3e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_003565321.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    291   4e-91    
ref|XP_010230438.1|  PREDICTED: putative AP2/ERF and B3 domain-co...    291   5e-91    
gb|EAY75457.1|  hypothetical protein OsI_03358                          290   1e-90    Oryza sativa Indica Group [Indian rice]
dbj|BAJ93242.1|  predicted protein                                      289   3e-90    
dbj|BAJ94578.1|  predicted protein                                      288   8e-90    
ref|XP_002457391.1|  hypothetical protein SORBIDRAFT_03g006590          288   3e-89    Sorghum bicolor [broomcorn]
dbj|BAJ89405.1|  predicted protein                                      285   2e-88    
emb|CDM83359.1|  unnamed protein product                                282   4e-88    
ref|XP_004968155.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    284   5e-88    
dbj|BAJ92496.1|  predicted protein                                      280   3e-87    
ref|XP_006645486.1|  PREDICTED: putative AP2/ERF and B3 domain-co...    279   5e-87    
ref|XP_006646228.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    280   6e-87    
gb|EAY72473.1|  hypothetical protein OsI_00328                          279   5e-86    Oryza sativa Indica Group [Indian rice]
ref|NP_001041982.1|  Os01g0141000                                       273   8e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EMT31332.1|  AP2/ERF and B3 domain-containing protein                271   2e-83    
gb|EYU40862.1|  hypothetical protein MIMGU_mgv1a013817mg                261   2e-81    
ref|XP_004971642.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    263   5e-81    
emb|CBI16858.3|  unnamed protein product                                254   2e-78    
ref|XP_002961048.1|  hypothetical protein SELMODRAFT_71153              244   1e-74    
gb|EEC69916.1|  hypothetical protein OsI_00337                          244   5e-73    Oryza sativa Indica Group [Indian rice]
gb|AAR83846.1|  AP2 domain transcription factor                         236   3e-72    Capsicum annuum
ref|XP_010679664.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    232   6e-69    
ref|XP_010246118.1|  PREDICTED: B3 domain-containing protein At2g...    231   1e-67    
ref|XP_008657835.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    228   2e-67    
gb|EEE64597.1|  hypothetical protein OsJ_19449                          227   2e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ10480.1|  hypothetical protein OsJ_00312                          224   2e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010262926.1|  PREDICTED: B3 domain-containing protein At2g...    226   9e-66    
gb|AFW79017.1|  putative AP2/EREBP transcription factor superfami...    224   1e-65    
ref|XP_010679708.1|  PREDICTED: putative AP2/ERF and B3 domain-co...    213   2e-61    
ref|XP_006304241.1|  hypothetical protein CARUB_v10010429mg             207   5e-61    
gb|EAZ13178.1|  hypothetical protein OsJ_03098                          208   1e-60    Oryza sativa Japonica Group [Japonica rice]
gb|AFW68588.1|  hypothetical protein ZEAMMB73_576107                    201   8e-58    
gb|KCW86365.1|  hypothetical protein EUGRSUZ_B03050                     196   5e-57    
ref|XP_010241058.1|  PREDICTED: B3 domain-containing protein Os03...    204   8e-57    
ref|XP_002440616.1|  hypothetical protein SORBIDRAFT_09g004140          201   1e-56    Sorghum bicolor [broomcorn]
ref|XP_010251300.1|  PREDICTED: B3 domain-containing protein Os03...    202   7e-56    
pdb|1WID|A  Chain A, Solution Structure Of The B3 Dna-Binding Dom...    187   5e-54    
ref|XP_002325139.2|  hypothetical protein POPTR_0018s11780g             197   4e-53    Populus trichocarpa [western balsam poplar]
ref|XP_008451118.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    192   5e-53    
ref|XP_004149034.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    190   2e-52    
ref|XP_011033440.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    190   3e-52    
ref|XP_006453664.1|  hypothetical protein CICLE_v10010403mg             188   5e-52    
ref|XP_004497481.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    187   1e-51    
ref|XP_006473975.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    187   3e-51    
ref|XP_007030917.1|  AP2 domain-containing transcription factor, ...    186   6e-51    
emb|CBI27062.3|  unnamed protein product                                182   6e-51    
ref|XP_011025403.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    186   1e-50    
gb|AFD22858.1|  AP2 domain-containing transcription factor              181   1e-50    
gb|KGN66438.1|  hypothetical protein Csa_1G605670                       192   1e-50    
ref|XP_011015305.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    186   1e-50    
ref|XP_007030916.1|  AP2/B3 transcription factor family protein, ...    187   3e-50    
ref|XP_006445925.1|  hypothetical protein CICLE_v10017535mg             183   4e-50    
ref|XP_008443869.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    184   4e-50    
ref|XP_002304025.1|  AP2 domain-containing transcription factor f...    184   6e-50    Populus trichocarpa [western balsam poplar]
ref|XP_010249446.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    182   2e-49    
ref|XP_004146691.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    182   2e-49    
ref|XP_006492722.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    182   2e-49    
ref|XP_002529958.1|  DNA binding protein, putative                      182   3e-49    Ricinus communis
gb|KDP38666.1|  hypothetical protein JCGZ_04019                         182   3e-49    
ref|XP_002308395.2|  hypothetical protein POPTR_0006s20040g             179   1e-48    Populus trichocarpa [western balsam poplar]
ref|XP_009364153.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    180   1e-48    
gb|KDO59412.1|  hypothetical protein CISIN_1g018549mg                   179   2e-48    
emb|CBI38731.3|  unnamed protein product                                180   2e-48    
gb|KDP24888.1|  hypothetical protein JCGZ_24432                         180   2e-48    
ref|XP_002268399.1|  PREDICTED: B3 domain-containing transcriptio...    182   2e-48    Vitis vinifera
ref|XP_008338512.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    179   3e-48    
ref|XP_006645487.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    177   3e-48    
ref|XP_007014835.1|  AP2/B3 transcription factor family protein, ...    179   3e-48    
sp|Q0DXB1.2|Y2641_ORYSJ  RecName: Full=B3 domain-containing prote...    173   6e-48    Oryza sativa Japonica Group [Japonica rice]
gb|EMT06148.1|  AP2/ERF and B3 domain-containing protein                174   6e-48    
ref|XP_003592857.1|  AP2 domain-containing transcription factor         177   7e-48    
ref|XP_004296303.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    177   1e-47    
ref|XP_007206788.1|  hypothetical protein PRUPE_ppa026651mg             176   1e-47    
ref|XP_006655554.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    174   1e-47    
emb|CDX67872.1|  BnaA07g19120D                                          176   1e-47    
ref|XP_009104358.1|  PREDICTED: B3 domain-containing transcriptio...    175   2e-47    
ref|XP_006291541.1|  hypothetical protein CARUB_v10017696mg             176   2e-47    
ref|XP_002534427.1|  DNA-binding protein RAV1, putative                 177   2e-47    Ricinus communis
ref|XP_010656125.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    176   2e-47    
ref|XP_008243686.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    176   3e-47    
ref|XP_009598393.1|  PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and ...    176   4e-47    
ref|XP_006350629.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    176   5e-47    
emb|CDY69432.1|  BnaCnng63450D                                          173   1e-46    
gb|EAZ10482.1|  hypothetical protein OsJ_00314                          174   2e-46    
ref|XP_011083994.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    174   3e-46    
ref|XP_008357930.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    168   4e-46    
ref|XP_009771974.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    173   4e-46    
gb|EMT06147.1|  AP2/ERF and B3 domain-containing protein                168   7e-46    
gb|EPS68925.1|  hypothetical protein M569_05842                         166   7e-46    
ref|XP_004301436.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    171   1e-45    
ref|XP_009366167.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    172   1e-45    
ref|XP_009376608.1|  PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and ...    171   2e-45    
ref|XP_006402424.1|  hypothetical protein EUTSA_v10006123mg             170   2e-45    
ref|XP_010318116.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    171   2e-45    
ref|XP_010087389.1|  AP2/ERF and B3 domain-containing transcripti...    172   2e-45    
gb|KEH18550.1|  B3 DNA-binding domain protein                           175   3e-45    
ref|XP_009358462.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    171   3e-45    
ref|XP_006352299.1|  PREDICTED: B3 domain-containing transcriptio...    169   4e-45    
emb|CDY58763.1|  BnaA04g27470D                                          170   4e-45    
ref|XP_010512577.1|  PREDICTED: B3 domain-containing transcriptio...    169   4e-45    
emb|CDY58764.1|  BnaA04g27480D                                          170   4e-45    
emb|CDX90001.1|  BnaA10g00810D                                          171   4e-45    
emb|CDY15208.1|  BnaC05g00870D                                          170   5e-45    
ref|XP_009138742.1|  PREDICTED: B3 domain-containing transcriptio...    169   5e-45    
ref|XP_002276492.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    171   5e-45    
ref|XP_004244810.1|  PREDICTED: B3 domain-containing transcriptio...    169   6e-45    
ref|XP_006352221.1|  PREDICTED: B3 domain-containing transcriptio...    169   7e-45    
ref|XP_004246082.2|  PREDICTED: B3 domain-containing transcriptio...    171   7e-45    
ref|XP_006393122.1|  hypothetical protein EUTSA_v10012152mg             170   7e-45    
ref|XP_009602370.1|  PREDICTED: B3 domain-containing protein Os03...    171   8e-45    
ref|XP_002876649.1|  hypothetical protein ARALYDRAFT_486704             168   9e-45    
ref|XP_010656593.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    171   1e-44    
dbj|BAK03280.1|  predicted protein                                      167   1e-44    
ref|XP_006393121.1|  hypothetical protein EUTSA_v10012161mg             169   1e-44    
ref|XP_010413323.1|  PREDICTED: B3 domain-containing transcriptio...    168   1e-44    
ref|XP_010468999.1|  PREDICTED: B3 domain-containing transcriptio...    168   1e-44    
ref|XP_004244732.1|  PREDICTED: B3 domain-containing protein Os03...    169   2e-44    
ref|XP_003637862.1|  Maturase K                                         174   2e-44    
emb|CDP12254.1|  unnamed protein product                                171   2e-44    
ref|XP_009758550.1|  PREDICTED: B3 domain-containing transcriptio...    170   2e-44    
ref|XP_010544887.1|  PREDICTED: B3 domain-containing transcriptio...    168   3e-44    
emb|CDY11388.1|  BnaA09g39540D                                          167   3e-44    
emb|CDY22814.1|  BnaA06g02630D                                          168   3e-44    
ref|XP_006606945.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    168   3e-44    
ref|XP_009116868.1|  PREDICTED: B3 domain-containing transcriptio...    167   3e-44    
ref|XP_009617147.1|  PREDICTED: B3 domain-containing transcriptio...    170   4e-44    
ref|XP_009803160.1|  PREDICTED: B3 domain-containing transcriptio...    170   4e-44    
gb|AHJ58870.1|  NGATHAb                                                 170   4e-44    
ref|XP_010046693.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    168   4e-44    
ref|XP_008352693.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    169   5e-44    
ref|XP_008367756.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    167   5e-44    
ref|XP_008337197.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    167   5e-44    
gb|AHJ58869.1|  NGATHAa                                                 169   5e-44    
ref|XP_006577365.1|  PREDICTED: B3 domain-containing transcriptio...    168   6e-44    
emb|CDY27515.1|  BnaC04g51560D                                          166   6e-44    
ref|XP_007203443.1|  hypothetical protein PRUPE_ppa021899mg             168   7e-44    
emb|CDY62470.1|  BnaC01g44850D                                          164   8e-44    
ref|NP_191756.1|  B3 domain-containing transcription factor NGA2        166   8e-44    
gb|EPS62763.1|  hypothetical protein M569_12025                         166   8e-44    
dbj|BAC42301.1|  putative RAV                                           166   9e-44    
ref|XP_010457183.1|  PREDICTED: B3 domain-containing transcriptio...    167   9e-44    
ref|XP_010474686.1|  PREDICTED: B3 domain-containing transcriptio...    167   1e-43    
ref|XP_003520889.1|  PREDICTED: B3 domain-containing transcriptio...    169   1e-43    
ref|XP_010480723.1|  PREDICTED: B3 domain-containing transcriptio...    167   1e-43    
ref|XP_010522876.1|  PREDICTED: B3 domain-containing transcriptio...    167   1e-43    
ref|XP_010556651.1|  PREDICTED: B3 domain-containing transcriptio...    167   1e-43    
ref|XP_003553806.1|  PREDICTED: B3 domain-containing transcriptio...    168   1e-43    
ref|XP_011086824.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    167   1e-43    
ref|XP_008242968.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    167   1e-43    
ref|XP_006305173.1|  hypothetical protein CARUB_v10009540mg             167   1e-43    
ref|XP_009142460.1|  PREDICTED: B3 domain-containing transcriptio...    165   1e-43    
ref|XP_010039649.1|  PREDICTED: B3 domain-containing transcriptio...    167   1e-43    
gb|KHG04353.1|  hypothetical protein F383_29408                         165   1e-43    
ref|XP_011039561.1|  PREDICTED: B3 domain-containing transcriptio...    166   1e-43    
ref|XP_006418368.1|  hypothetical protein EUTSA_v10008068mg             167   1e-43    
emb|CDY48008.1|  BnaA04g26820D                                          165   1e-43    
ref|XP_002889390.1|  hypothetical protein ARALYDRAFT_470180             167   1e-43    
ref|NP_171611.1|  B3 domain-containing transcription factor NGA3        167   2e-43    
ref|XP_011081336.1|  PREDICTED: B3 domain-containing transcriptio...    168   2e-43    
ref|XP_006397878.1|  hypothetical protein EUTSA_v10001555mg             166   2e-43    
ref|NP_566089.1|  B3 domain-containing transcription factor NGA1        165   2e-43    
gb|ACP18971.1|  NGATHA1                                                 165   2e-43    
ref|XP_006375395.1|  hypothetical protein POPTR_0014s10290g             166   2e-43    
ref|XP_007139042.1|  hypothetical protein PHAVU_009G260100g             168   2e-43    
ref|XP_007142618.1|  hypothetical protein PHAVU_007G002900g             165   2e-43    
ref|XP_011025335.1|  PREDICTED: B3 domain-containing transcriptio...    167   2e-43    
ref|XP_006343756.1|  PREDICTED: B3 domain-containing transcriptio...    168   2e-43    
emb|CBI34625.3|  unnamed protein product                                167   3e-43    
emb|CDY41564.1|  BnaC04g00580D                                          164   3e-43    
gb|AAM67302.1|  RAV-like protein                                        164   3e-43    
ref|XP_010542813.1|  PREDICTED: B3 domain-containing transcriptio...    165   3e-43    
ref|XP_002515100.1|  hypothetical protein RCOM_1340820                  168   3e-43    
ref|XP_007051384.1|  AP2/B3-like transcriptional factor family pr...    167   3e-43    
ref|XP_011094281.1|  PREDICTED: B3 domain-containing protein At2g...    166   3e-43    
ref|XP_008239252.1|  PREDICTED: B3 domain-containing protein Os02...    168   3e-43    
ref|XP_011070416.1|  PREDICTED: B3 domain-containing transcriptio...    167   3e-43    
ref|XP_011094282.1|  PREDICTED: B3 domain-containing protein At2g...    165   3e-43    
ref|XP_009142591.1|  PREDICTED: B3 domain-containing transcriptio...    164   4e-43    
gb|EPS61236.1|  hypothetical protein M569_13563                         160   4e-43    
ref|XP_009124885.1|  PREDICTED: B3 domain-containing protein At3g...    163   4e-43    
ref|XP_006444696.1|  hypothetical protein CICLE_v10020450mg             166   5e-43    
ref|XP_010039648.1|  PREDICTED: B3 domain-containing transcriptio...    167   5e-43    
gb|KDO76784.1|  hypothetical protein CISIN_1g013565mg                   167   5e-43    
gb|EMT09996.1|  AP2/ERF and B3 domain-containing protein                164   5e-43    
ref|XP_006386670.1|  hypothetical protein POPTR_0002s18260g             166   5e-43    
ref|XP_010110369.1|  AP2/ERF and B3 domain-containing transcripti...    166   5e-43    
ref|XP_010104899.1|  B3 domain-containing transcription factor NGA1     167   5e-43    
ref|XP_002862757.1|  hypothetical protein ARALYDRAFT_497309             164   6e-43    
ref|XP_007210031.1|  hypothetical protein PRUPE_ppa019131mg             168   6e-43    
ref|XP_006439180.1|  hypothetical protein CICLE_v10020034mg             167   6e-43    
emb|CDY25209.1|  BnaC06g04340D                                          165   6e-43    
ref|XP_010056052.1|  PREDICTED: B3 domain-containing protein Os03...    164   6e-43    
emb|CDX73868.1|  BnaA03g31790D                                          162   6e-43    
ref|XP_002880271.1|  hypothetical protein ARALYDRAFT_483854             164   6e-43    
ref|XP_010501941.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    164   6e-43    
ref|XP_009133791.1|  PREDICTED: B3 domain-containing transcriptio...    164   7e-43    
ref|XP_006476252.1|  PREDICTED: B3 domain-containing protein Os03...    167   7e-43    
emb|CAZ68123.1|  NGATHA1                                                164   8e-43    
ref|XP_010676939.1|  PREDICTED: uncharacterized protein LOC104892653    167   8e-43    
gb|KDP28398.1|  hypothetical protein JCGZ_14169                         166   8e-43    
ref|XP_006598862.1|  PREDICTED: B3 domain-containing transcriptio...    167   9e-43    
ref|XP_011039544.1|  PREDICTED: B3 domain-containing transcriptio...    166   9e-43    
ref|XP_009119661.1|  PREDICTED: B3 domain-containing transcriptio...    164   9e-43    
emb|CDX83351.1|  BnaA03g21550D                                          163   9e-43    
ref|XP_010507960.1|  PREDICTED: B3 domain-containing transcriptio...    163   1e-42    
ref|XP_010107127.1|  B3 domain-containing protein                       167   1e-42    
ref|XP_010506701.1|  PREDICTED: B3 domain-containing transcriptio...    163   1e-42    
ref|XP_002884852.1|  hypothetical protein ARALYDRAFT_897360             162   1e-42    
ref|XP_010660370.1|  PREDICTED: B3 domain-containing protein Os03...    166   1e-42    
ref|XP_009418087.1|  PREDICTED: B3 domain-containing protein Os03...    164   1e-42    
ref|XP_010047119.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    164   1e-42    
ref|XP_010506703.1|  PREDICTED: B3 domain-containing transcriptio...    163   1e-42    
ref|XP_006375397.1|  hypothetical protein POPTR_0014s10290g             165   1e-42    
ref|XP_004140634.1|  PREDICTED: B3 domain-containing transcriptio...    164   1e-42    
ref|XP_010518374.1|  PREDICTED: B3 domain-containing transcriptio...    163   1e-42    
ref|XP_007135337.1|  hypothetical protein PHAVU_010G120900g             166   1e-42    
ref|XP_008459807.1|  PREDICTED: B3 domain-containing transcriptio...    164   2e-42    
gb|KGN46479.1|  hypothetical protein Csa_6G096440                       164   2e-42    
gb|KHN15868.1|  B3 domain-containing protein                            168   2e-42    
emb|CDY22826.1|  BnaA06g02510D                                          163   2e-42    
ref|NP_001047754.1|  Os02g0683500                                       165   2e-42    
gb|EAY87091.1|  hypothetical protein OsI_08488                          165   2e-42    
ref|XP_008375464.1|  PREDICTED: B3 domain-containing protein Os03...    166   2e-42    
ref|XP_008657605.1|  PREDICTED: B3 domain-containing protein Os03...    159   2e-42    
ref|XP_009360230.1|  PREDICTED: B3 domain-containing protein Os03...    166   2e-42    
gb|KEH24648.1|  B3 DNA-binding domain protein                           166   2e-42    
ref|XP_004985935.1|  PREDICTED: B3 domain-containing protein Os03...    162   2e-42    
emb|CDY50908.1|  BnaC03g72370D                                          162   3e-42    
ref|XP_004306604.1|  PREDICTED: B3 domain-containing transcriptio...    164   3e-42    
ref|XP_006294618.1|  hypothetical protein CARUB_v10023656mg             162   3e-42    
gb|AFW81719.1|  hypothetical protein ZEAMMB73_752087                    160   3e-42    
ref|XP_002891618.1|  hypothetical protein ARALYDRAFT_474227             163   3e-42    
ref|XP_011077828.1|  PREDICTED: B3 domain-containing protein At5g...    160   3e-42    
emb|CDP15642.1|  unnamed protein product                                162   3e-42    
ref|XP_004494224.1|  PREDICTED: B3 domain-containing protein At2g...    160   3e-42    
ref|XP_006846428.1|  hypothetical protein AMTR_s00018p00040300          159   4e-42    
emb|CAN73636.1|  hypothetical protein VITISV_009603                     166   4e-42    
ref|XP_010464875.1|  PREDICTED: B3 domain-containing protein At3g...    160   4e-42    
ref|XP_006377882.1|  hypothetical protein POPTR_0011s15270g             162   4e-42    
ref|XP_010486825.1|  PREDICTED: B3 domain-containing protein At3g...    160   6e-42    
gb|KCW64765.1|  hypothetical protein EUGRSUZ_G02345                     155   6e-42    
ref|XP_004494886.1|  PREDICTED: B3 domain-containing transcriptio...    163   6e-42    
gb|KFK35878.1|  hypothetical protein AALP_AA4G048600                    162   7e-42    
ref|XP_006399092.1|  hypothetical protein EUTSA_v10015675mg             160   7e-42    
ref|XP_007039313.1|  AP2/B3-like transcriptional factor family pr...    164   7e-42    
ref|XP_006407432.1|  hypothetical protein EUTSA_v10021305mg             160   8e-42    
ref|XP_009147781.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    161   8e-42    
gb|KFK37451.1|  hypothetical protein AALP_AA4G258600                    160   9e-42    
emb|CAE04153.1|  OSJNBa0088A01.1                                        160   9e-42    
ref|XP_011077827.1|  PREDICTED: B3 domain-containing protein At5g...    161   9e-42    
ref|XP_008437475.1|  PREDICTED: uncharacterized protein LOC103482885    162   1e-41    
ref|NP_175524.1|  AP2/ERF and B3 domain-containing transcription ...    161   1e-41    
ref|XP_009111204.1|  PREDICTED: B3 domain-containing transcriptio...    161   1e-41    
emb|CDY29599.1|  BnaA05g15710D                                          160   1e-41    
ref|NP_001174059.1|  Os04g0581400                                       160   1e-41    
ref|NP_850559.1|  AP2/B3-like transcriptional factor family protein     158   1e-41    
ref|XP_003529866.2|  PREDICTED: B3 domain-containing transcriptio...    164   1e-41    
ref|XP_002448384.1|  hypothetical protein SORBIDRAFT_06g026370          163   1e-41    
ref|XP_004976592.1|  PREDICTED: B3 domain-containing protein Os02...    162   1e-41    
ref|XP_006649293.1|  PREDICTED: B3 domain-containing protein Os03...    160   1e-41    
ref|XP_004309568.1|  PREDICTED: B3 domain-containing transcriptio...    164   1e-41    
ref|XP_002518948.1|  transcription factor, putative                     162   1e-41    
ref|XP_010259177.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    162   2e-41    
ref|XP_004162969.1|  PREDICTED: uncharacterized protein LOC101232454    161   2e-41    
ref|XP_004145963.1|  PREDICTED: uncharacterized protein LOC101211271    160   2e-41    
ref|XP_010497164.1|  PREDICTED: B3 domain-containing protein At3g...    159   2e-41    
emb|CDY22801.1|  BnaA06g02760D                                          160   2e-41    
ref|XP_010559163.1|  PREDICTED: B3 domain-containing transcriptio...    159   2e-41    
ref|XP_009600246.1|  PREDICTED: B3 domain-containing protein At2g...    160   2e-41    
ref|NP_175483.1|  AP2/ERF and B3 domain-containing transcription ...    160   2e-41    
ref|XP_009600245.1|  PREDICTED: B3 domain-containing protein At2g...    160   2e-41    
gb|EAY88313.1|  hypothetical protein OsI_09772                          159   2e-41    
ref|XP_006288430.1|  hypothetical protein CARUB_v10001689mg             158   2e-41    
ref|XP_010523853.1|  PREDICTED: B3 domain-containing transcriptio...    160   2e-41    
ref|XP_006396350.1|  hypothetical protein EUTSA_v10028783mg             160   2e-41    
gb|AAN74744.1|  hypothetical protein                                    165   2e-41    
gb|KHN06382.1|  B3 domain-containing protein                            164   2e-41    
ref|XP_006647694.1|  PREDICTED: B3 domain-containing protein Os02...    162   2e-41    
ref|NP_001048792.1|  Os03g0120900                                       159   2e-41    
ref|XP_002468620.1|  hypothetical protein SORBIDRAFT_01g049150          160   3e-41    
ref|XP_009382230.1|  PREDICTED: B3 domain-containing protein Os02...    160   3e-41    
ref|XP_004953463.1|  PREDICTED: B3 domain-containing protein Os02...    162   3e-41    
ref|XP_006288431.1|  hypothetical protein CARUB_v10001689mg             158   3e-41    
ref|XP_010463359.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    159   4e-41    
gb|AAT44949.1|  putative AP2/EREBP transcription factor                 159   4e-41    
dbj|BAJ97804.1|  predicted protein                                      159   4e-41    
ref|XP_011040641.1|  PREDICTED: B3 domain-containing transcriptio...    162   4e-41    
ref|XP_009588142.1|  PREDICTED: B3 domain-containing protein At2g...    159   4e-41    
gb|KDP25176.1|  hypothetical protein JCGZ_20332                         161   4e-41    
gb|KGN49957.1|  hypothetical protein Csa_5G146310                       161   4e-41    
ref|XP_008663443.1|  PREDICTED: B3 domain-containing protein Os02...    161   5e-41    
emb|CDP10630.1|  unnamed protein product                                160   5e-41    
ref|XP_008244188.1|  PREDICTED: B3 domain-containing transcriptio...    161   5e-41    
emb|CDY37130.1|  BnaC06g03690D                                          159   5e-41    
ref|XP_008668996.1|  PREDICTED: B3 domain-containing protein Os02...    161   5e-41    
ref|XP_009391640.1|  PREDICTED: B3 domain-containing protein Os03...    159   5e-41    
ref|NP_187765.2|  AP2/B3-like transcriptional factor family protein     157   5e-41    
ref|XP_007027866.1|  AP2/B3-like transcriptional factor family pr...    159   6e-41    
ref|XP_009147833.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    158   6e-41    
ref|XP_009144942.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    159   6e-41    
emb|CBI30344.3|  unnamed protein product                                156   7e-41    
ref|XP_009144943.1|  PREDICTED: AP2/ERF and B3 domain-containing ...    158   7e-41    
ref|XP_011038019.1|  PREDICTED: B3 domain-containing transcriptio...    161   8e-41    
emb|CDY43751.1|  BnaAnng07660D                                          156   8e-41    



>gb|AGS83386.1| tempranillo [Olea europaea]
Length=357

 Score =   488 bits (1256),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 253/359 (70%), Positives = 282/359 (79%), Gaps = 32/359 (9%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             ++A  LP TKSPESLCR+GSG+S IIDAE GVEAES RKLPSSRFKGVVPQPNGRWGAQI
Sbjct  21    SAASTLPVTKSPESLCRVGSGSSAIIDAEVGVEAES-RKLPSSRFKGVVPQPNGRWGAQI  79

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLS  809
             YEKHQRVWLGTFNEE+EAA+ YDIAAQRFRGRDAVTNFKPLSET      +DD E  FL+
Sbjct  80    YEKHQRVWLGTFNEEDEAAKAYDIAAQRFRGRDAVTNFKPLSETE-----EDDVETAFLN  134

Query  808   SHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPE----------ADRSAKSRERL  659
             SHSKAEIVDMLRKHTY+DELEQSR+ + + + +  R              DR+ KSRE+L
Sbjct  135   SHSKAEIVDMLRKHTYSDELEQSRKNYGLFDGSGQRIMNKDGLFSSFGGGDRAVKSREQL  194

Query  658   FEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNS  479
             FEKAVTPSDVGKLNRLVIPKQ AEKHFPL++G   SKGVLLNFED  GKVWRFRYSYWNS
Sbjct  195   FEKAVTPSDVGKLNRLVIPKQHAEKHFPLKSGN-NSKGVLLNFEDMGGKVWRFRYSYWNS  253

Query  478   SQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPV  299
             SQSYVLTKGWSRFVKEK+LKAGDIVSF RSTGP+ QL+IDWK RNG+    +  VP  P+
Sbjct  254   SQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGPDNQLYIDWKPRNGSNVVGL-PVPAQPI  312

Query  298   QVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              + RLFGVNI            +  +N  SCS GKR+RE  ME L LEC+KKQRVIDAL
Sbjct  313   PMVRLFGVNI-----------FEVPSN-ESCSTGKRMRE--MELLALECTKKQRVIDAL  357



>ref|XP_002281709.2| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Vitis vinifera]
Length=378

 Score =   485 bits (1248),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 254/351 (72%), Positives = 279/351 (79%), Gaps = 24/351 (7%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             LPATKSPESLCR+GSG SVI+D+E+ +EAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQ
Sbjct  45    LPATKSPESLCRVGSGTSVILDSESSIEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQ  103

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEEEEAA+ YDIAAQRFRGRDAVTNFKPLSET +     DD EA FL+SHSKA
Sbjct  104   RVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKPLSETEE-----DDIEAAFLNSHSKA  158

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPE-------ADRSAKSRERLFEKAVTPS  635
             EIVDMLRKHTY DELEQS+R + ++      + E       +DR  KSRE+LFEK VTPS
Sbjct  159   EIVDMLRKHTYNDELEQSKRNYGLDANGKRSRAEGLMTPFGSDRVTKSREQLFEKTVTPS  218

Query  634   DVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             DVGKLNRLVIPKQ AEKHFPLQ G  TSKGVLLNFED  GKVWRFRYSYWNSSQSYVLTK
Sbjct  219   DVGKLNRLVIPKQHAEKHFPLQTGT-TSKGVLLNFEDMGGKVWRFRYSYWNSSQSYVLTK  277

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GWSRFVKEK+LKAGDIVSF RSTG +KQL+IDWKARNG   P     PV PV++ RLFGV
Sbjct  278   GWSRFVKEKNLKAGDIVSFQRSTGGDKQLYIDWKARNG---PTNQINPVEPVEMVRLFGV  334

Query  274   NISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             NI K    P+  ++   NN S    GKR+ E  ME L  ECSKKQRVI A+
Sbjct  335   NIFK---VPVNSSVVVANNGSWT--GKRMIE--MELLSFECSKKQRVIGAV  378



>ref|XP_011070834.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Sesamum indicum]
Length=374

 Score =   483 bits (1242),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 280/359 (78%), Gaps = 27/359 (8%)
 Frame = -3

Query  1147  ATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRV  968
             A KSPESLCR+GSGASVIIDAENGVEAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRV
Sbjct  26    AAKSPESLCRVGSGASVIIDAENGVEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRV  84

Query  967   WLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEI  788
             WLGTFNEEEEAAR YD AAQRFRGRDAVTNFKPLSET +     D+ EA FL+SHSKAEI
Sbjct  85    WLGTFNEEEEAARAYDTAAQRFRGRDAVTNFKPLSETEE-----DEVEAAFLNSHSKAEI  139

Query  787   VDMLRKHTYTDELEQSRRAFNINNMTTPR----KPEADRSAKSRERLFEKAVTPSDVGKL  620
             VDMLRKHTY DELEQSRR +N                DR+A +RE+LFEKAVTPSDVGKL
Sbjct  140   VDMLRKHTYNDELEQSRRNYNGKRAGKDGPFSFSSGGDRAANAREQLFEKAVTPSDVGKL  199

Query  619   NRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             NRLVIPKQ AEKHFPLQ+G  TSKGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  200   NRLVIPKQHAEKHFPLQSGN-TSKGVLLNFEDMGGKVWRFRYSYWNSSQSYVLTKGWSRF  258

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVP---VHPVQVFRLFGVNI  269
             VKEK L+AGDIVSF RSTGP+KQL+IDWK+RN   +  ++ V      PVQ+FRLFGVNI
Sbjct  259   VKEKDLRAGDIVSFQRSTGPDKQLYIDWKSRNTGSNAAVAGVVSGRAQPVQMFRLFGVNI  318

Query  268   ----------SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                       S +T +    A    ++  SCS  KR+R   ME L L+CSKKQRVIDAL
Sbjct  319   LEVPSNCTAPSTATATATVTATAAIDSNGSCS-SKRMR--AMEILGLDCSKKQRVIDAL  374



>emb|CAN68564.1| hypothetical protein VITISV_032171 [Vitis vinifera]
Length=364

 Score =   480 bits (1235),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 251/347 (72%), Positives = 276/347 (80%), Gaps = 24/347 (7%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             LPATKSPESLCR+GSG SVI+D+E+ +EAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQ
Sbjct  25    LPATKSPESLCRVGSGTSVILDSESSIEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQ  83

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEEEEAA+ YDIAAQRFRGRDAVTNFKPLSET +     DD EA FL+SHSKA
Sbjct  84    RVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKPLSETEE-----DDIEAAFLNSHSKA  138

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPE-------ADRSAKSRERLFEKAVTPS  635
             EIVDMLRKHTY DELEQS+R + ++      + E       +DR  KSRE+LFEK VTPS
Sbjct  139   EIVDMLRKHTYNDELEQSKRNYGLDANGKRSRAEGLMTPFGSDRVTKSREQLFEKTVTPS  198

Query  634   DVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             DVGKLNRLVIPKQ AEKHFPLQ G  TSKGVLLNFED  GKVWRFRYSYWNSSQSYVLTK
Sbjct  199   DVGKLNRLVIPKQHAEKHFPLQTG-TTSKGVLLNFEDMGGKVWRFRYSYWNSSQSYVLTK  257

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GWSRFVKEK+LKAGDIVSF RSTG +KQL+IDWKARNG   P     PV PV++ RLFGV
Sbjct  258   GWSRFVKEKNLKAGDIVSFQRSTGGDKQLYIDWKARNG---PTNQINPVEPVEMVRLFGV  314

Query  274   NISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRV  134
             NI K    P+  ++   NN S    GKR+ E  ME L  ECSKKQR+
Sbjct  315   NIFK---VPVNSSVVVANNGSWT--GKRMIE--MELLSFECSKKQRM  354



>ref|XP_011077234.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Sesamum indicum]
Length=354

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 256/348 (74%), Positives = 276/348 (79%), Gaps = 24/348 (7%)
 Frame = -3

Query  1141  KSPE-SLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVW  965
             K PE SLCRMGSG SVIIDAENGVEAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVW
Sbjct  23    KPPEISLCRMGSGTSVIIDAENGVEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVW  81

Query  964   LGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIV  785
             LGTFNEEEEAAR YD AAQRFRGRDAVTNFKPL+E       +D+ EA FLSSHSKAEIV
Sbjct  82    LGTFNEEEEAARAYDTAAQRFRGRDAVTNFKPLAEK------EDEIEAAFLSSHSKAEIV  135

Query  784   DMLRKHTYTDELEQSRRAFNINNMT-----TPRKPEADRSAKSRERLFEKAVTPSDVGKL  620
             DMLRKHTY DELEQSRR +  N M      +      DR+ K+RE+LFEKAVTPSDVGKL
Sbjct  136   DMLRKHTYNDELEQSRRNYAGNKMAKDGLFSLSSGGGDRALKAREQLFEKAVTPSDVGKL  195

Query  619   NRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             NRLVIPKQ AEKHFPLQNG   SKGVLLN ED  GKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  196   NRLVIPKQHAEKHFPLQNGN-NSKGVLLNLEDKGGKVWRFRYSYWNSSQSYVLTKGWSRF  254

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR-NGTGSPDIS-TVPVHPVQVFRLFGVNIS  266
             VKEK+L+AGDIVSF RST P+KQL+IDWK R NG+ +  I  +  V PVQ+ RLFGVNI 
Sbjct  255   VKEKNLRAGDIVSFQRSTIPDKQLYIDWKPRNNGSNAAAIGLSGLVQPVQMVRLFGVNIF  314

Query  265   KSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             ++  +    A      I SCS GKR+RE  ME L LECSKKQRVIDAL
Sbjct  315   EAPRNGGDAAA-----IDSCS-GKRLRE--MEILGLECSKKQRVIDAL  354



>ref|XP_009613275.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Nicotiana tomentosiformis]
Length=379

 Score =   476 bits (1224),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 256/363 (71%), Positives = 282/363 (78%), Gaps = 28/363 (8%)
 Frame = -3

Query  1165  SALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             S   LP TKSPESLCRMGSG SVIIDAENGVEAES RKLPSSR+KGVVPQPNGRWGAQIY
Sbjct  23    STTTLPVTKSPESLCRMGSGTSVIIDAENGVEAES-RKLPSSRYKGVVPQPNGRWGAQIY  81

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE EAAR YD+AAQRFRGRDAVTNFKPL E  +    +DD E  FL+S
Sbjct  82    EKHQRVWLGTFNEENEAARAYDVAAQRFRGRDAVTNFKPLLENEE----NDDMEIAFLNS  137

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNI-----------NNMTTPRKPEADRSAKSRERL  659
             HSKAEIVDMLRKHTY DELEQS++ F             + + +      D+  K+RE+L
Sbjct  138   HSKAEIVDMLRKHTYIDELEQSKKNFGFSKDGKRTYCTKDGLMSSFFSSVDKVNKAREQL  197

Query  658   FEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNS  479
             FEKAVTPSDVGKLNRLVIPKQ AEKHFPLQNG  TSKGVLLNFED NGKVWRFRYSYWNS
Sbjct  198   FEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-TSKGVLLNFEDLNGKVWRFRYSYWNS  256

Query  478   SQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST-----V  314
             SQSYVLTKGWSRFVKEK+LKAGDIVSF RSTG +KQL+ID+KARN T  P IS+     V
Sbjct  257   SQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGGDKQLYIDFKARNVT--PTISSAVASHV  314

Query  313   PVHPVQVFRLFGVNISK-STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLE-CSKKQ  140
              V  VQ+ RLFGVNI +   VS + +  +  NN++SCSGGK  R + ME L  E C KKQ
Sbjct  315   QVPQVQMVRLFGVNICEVPAVSNVVVDNNNNNNMTSCSGGK--RRIEMELLTFESCRKKQ  372

Query  139   RVI  131
             RVI
Sbjct  373   RVI  375



>ref|XP_007046304.1| AP2 domain class transcription factor [Theobroma cacao]
 gb|EOY02136.1| AP2 domain class transcription factor [Theobroma cacao]
Length=358

 Score =   475 bits (1222),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 252/349 (72%), Positives = 274/349 (79%), Gaps = 24/349 (7%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQR  971
             PATKSP+SLCR+GSGASVI+D+E GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQR
Sbjct  28    PATKSPDSLCRVGSGASVIVDSEAGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQR  86

Query  970   VWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAE  791
             VWLGTFNEE+EAA+ YDIAAQRFRGRDAVTNFK L ET +     DD E  FL+SHSKAE
Sbjct  87    VWLGTFNEEDEAAKAYDIAAQRFRGRDAVTNFKHLRETEE-----DDIEMAFLNSHSKAE  141

Query  790   IVDMLRKHTYTDELEQSRRA--FNINNMTTPRKPEADRS----AKSRERLFEKAVTPSDV  629
             IVDMLRKHTY DELEQSRR+  F+ N     R      S     K+RE+LFEKAVTPSDV
Sbjct  142   IVDMLRKHTYNDELEQSRRSYGFDGNGKRVVRHDGGFGSFGLELKAREQLFEKAVTPSDV  201

Query  628   GKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGW  449
             GKLNRLVIPKQ AEK+FPLQ+G+ +SKGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGW
Sbjct  202   GKLNRLVIPKQHAEKYFPLQSGSASSKGVLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGW  261

Query  448   SRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             SRFVKEK+LKAGDIVSF RSTG EKQL+IDWK R G GS      PV PVQ+ RLFGVNI
Sbjct  262   SRFVKEKNLKAGDIVSFQRSTGLEKQLYIDWKTRTGLGSG--LENPVGPVQMVRLFGVNI  319

Query  268   SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              K       +       I  C  GKR RE  ME L LECSKKQRVIDAL
Sbjct  320   FK-------IPGSENVGIVGCI-GKRTRE--MELLELECSKKQRVIDAL  358



>emb|CDP00578.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   469 bits (1206),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 250/360 (69%), Positives = 279/360 (78%), Gaps = 27/360 (8%)
 Frame = -3

Query  1159  LNLPATKSPESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYE  983
             +N+ ++   +SLCR+GSGAS +IIDAE GVEAES RKLPSSRFKGVVPQPNGRWGAQIYE
Sbjct  32    VNIKSSPEQQSLCRVGSGASSMIIDAEVGVEAES-RKLPSSRFKGVVPQPNGRWGAQIYE  90

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             KHQRVWLGTFNEEEEAAR YDIAAQRFRGRDAVTNFKPL+E  +     DD EA FLS H
Sbjct  91    KHQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKPLNEAEE-----DDVEAAFLSCH  145

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNIN-NMTTPRKPEA-------DRSAKSRERLFEKA  647
             SKAEIVDMLRKHTY DELEQS+R + ++ N     K  A        ++ K+RE+LFEKA
Sbjct  146   SKAEIVDMLRKHTYNDELEQSKRNYGLDGNGKKGCKGIAGLHSFGYQKTTKAREQLFEKA  205

Query  646   VTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSY  467
             VTPSDVGKLNRLVIPKQ AEKHFPLQ+G  TSKGVLLNFED  GKVWRFRYSYWNSSQSY
Sbjct  206   VTPSDVGKLNRLVIPKQHAEKHFPLQSGN-TSKGVLLNFEDMGGKVWRFRYSYWNSSQSY  264

Query  466   VLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIS-----TVPVHP  302
             VLTKGWSRFVKEK+LKAGDIVSF RSTG +KQL+IDWK RNG            ++P+ P
Sbjct  265   VLTKGWSRFVKEKNLKAGDIVSFQRSTGADKQLYIDWKRRNGAAEAAPPVAAGISIPIQP  324

Query  301   VQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             VQ+ RLFGVNI K  +    + MD+    SSCS GKR+R   ME L LECSKK R I AL
Sbjct  325   VQMVRLFGVNIFKVPLPVNGVVMDSN---SSCS-GKRVRG--MELLGLECSKKPRAIGAL  378



>gb|AFH57270.1| RAV [Gossypium hirsutum]
Length=357

 Score =   467 bits (1201),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 246/349 (70%), Positives = 272/349 (78%), Gaps = 30/349 (9%)
 Frame = -3

Query  1144  TKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVW  965
             TKSP+SL R+GSG SVI+D+E+GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVW
Sbjct  31    TKSPDSLYRVGSGTSVIVDSESGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVW  89

Query  964   LGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIV  785
             LGTFNEE+EAA+ YDIAAQRFRGRDAVTNFK L E  D     DD +  FL+SHSKAEIV
Sbjct  90    LGTFNEEDEAAKAYDIAAQRFRGRDAVTNFKHLHEMED-----DDIQIAFLNSHSKAEIV  144

Query  784   DMLRKHTYTDELEQSRRA--FNINNMTTPRKPEA----DRSAKSRERLFEKAVTPSDVGK  623
             DMLRKHTY DELEQSRR+  F+ N     RK +         K+RE+LFEKAVTPSDVGK
Sbjct  145   DMLRKHTYNDELEQSRRSYGFDGNGKRIVRKEDGFGTLGFELKAREQLFEKAVTPSDVGK  204

Query  622   LNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             LNRLVIPKQ AEK+FPLQ+G+ +SKGVLLNFED  GKVWRFRYSYWNSSQSYVL KGWSR
Sbjct  205   LNRLVIPKQHAEKYFPLQSGSASSKGVLLNFEDVTGKVWRFRYSYWNSSQSYVLIKGWSR  264

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISK  263
             FVKEK+LKAGDIVSF RSTG EKQL+IDWKAR G GS        +PVQ+ RLFGVNI K
Sbjct  265   FVKEKNLKAGDIVSFQRSTGTEKQLYIDWKARTGLGSG-----LENPVQMVRLFGVNIFK  319

Query  262   STVSPMAMAMDTTNNISSCSG--GKRIREVVMEFLPLECSKKQRVIDAL  122
                      M  + N+    G  GKR RE  ME L LECSKKQRVIDAL
Sbjct  320   ---------MPGSENVGLAGGCNGKRTRE--MELLELECSKKQRVIDAL  357



>ref|XP_006437734.1| hypothetical protein CICLE_v10031846mg [Citrus clementina]
 gb|ESR50974.1| hypothetical protein CICLE_v10031846mg [Citrus clementina]
Length=377

 Score =   466 bits (1199),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 281/357 (79%), Gaps = 24/357 (7%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             ++P TKSPESLCR+GSGAS VI+D+E GVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  31    SIPPTKSPESLCRVGSGASSVILDSEAGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  89

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD-DYEAVFLSSH  803
             HQRVWLGTFNEEEEAAR YDIAAQRFRGRDAVTNFK +S    G + D+ D E  FLSSH
Sbjct  90    HQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKQMS--CAGTSSDEGDIEMAFLSSH  147

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNI--NNMTTPRKPE---------ADRSAKSRERLF  656
             SK+EIVDMLRKHTY DELEQS+R + +  N     +  E         +DR  K+R++LF
Sbjct  148   SKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVATAFGSDRVLKARDQLF  207

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             EKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+ TSKG+LLNFED  GKVWRFRYSYWNSS
Sbjct  208   EKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS-TSKGLLLNFEDVTGKVWRFRYSYWNSS  266

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK+LKAGDIVSFHRSTG ++QL+IDWKAR G         PV PVQ
Sbjct  267   QSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDRQLYIDWKARTGP-----VENPVEPVQ  321

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             + RLFGVNI K   + +        NI++ + GKR+RE  ME L +ECSKKQR+I A
Sbjct  322   MMRLFGVNIFKIPGNGLVGVDKIGCNINNNNDGKRLRE--MELLSIECSKKQRMIGA  376



>ref|XP_006484413.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Citrus sinensis]
Length=377

 Score =   465 bits (1197),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 281/357 (79%), Gaps = 24/357 (7%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             ++P TKSPESLCR+GSGAS VI+D+E GVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  31    SIPPTKSPESLCRVGSGASSVILDSEAGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  89

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD-DYEAVFLSSH  803
             HQRVWLGTFNEEEEAA+ YDIAAQRFRGRDAVTNFK +S    G + D+ D E  FLSSH
Sbjct  90    HQRVWLGTFNEEEEAAKAYDIAAQRFRGRDAVTNFKQMS--CAGTSSDEGDIEMAFLSSH  147

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNI--NNMTTPRKPE---------ADRSAKSRERLF  656
             SK+EIVDMLRKHTY DELEQS+R + +  N     +  E         +DR  K+R++LF
Sbjct  148   SKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGVATAFGSDRVLKARDQLF  207

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             EKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+ TSKG+LLNFED  GKVWRFRYSYWNSS
Sbjct  208   EKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS-TSKGLLLNFEDVTGKVWRFRYSYWNSS  266

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK+LKAGDIVSFHRSTG ++QL+IDWKAR G         PV PVQ
Sbjct  267   QSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDRQLYIDWKARTGP-----VENPVEPVQ  321

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             + RLFGVNI K   + +        NI++ + GKR+RE  ME L LECSKKQR+I A
Sbjct  322   MMRLFGVNIFKIPGNGLVGVDKIGCNINNNNDGKRLRE--MELLSLECSKKQRMIGA  376



>ref|XP_010262942.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Nelumbo nucifera]
Length=365

 Score =   463 bits (1192),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 249/366 (68%), Positives = 280/366 (77%), Gaps = 36/366 (10%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             A   +LP  K  E LCRMGSGASV+ID+++GVEAES RKLPSS++KGVVPQPNGRWGAQI
Sbjct  19    APVSSLPEKKETERLCRMGSGASVVIDSDSGVEAES-RKLPSSQYKGVVPQPNGRWGAQI  77

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLS  809
             YEKHQRVWLGTFNEEEEAAR YDIAAQRFRGRDAVTNFKPLSET      +DD E +FL+
Sbjct  78    YEKHQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKPLSETD-----EDDIETIFLN  132

Query  808   SHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRK---------PEADRSAKSRERLF  656
             SHSKAEIVDMLRKHTY DELEQS+R +  N   + R            +DR+AK+RE LF
Sbjct  133   SHSKAEIVDMLRKHTYNDELEQSKRNYGRNGDVSKRNRGGGCFGDSGGSDRAAKARELLF  192

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             +KAVTPSDVGKLNRLVIPKQ AEKHFPLQ G+ TSKGVLLNFED  GKVWRFRYSYWNSS
Sbjct  193   DKAVTPSDVGKLNRLVIPKQHAEKHFPLQIGS-TSKGVLLNFEDNGGKVWRFRYSYWNSS  251

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVH---  305
             QSYVLTKGWSRFVKEK+LKAGD+VSF RSTGP+KQLFIDWK R  +    +  + VH   
Sbjct  252   QSYVLTKGWSRFVKEKNLKAGDVVSFQRSTGPDKQLFIDWKPRAASTYMALPQL-VHPLN  310

Query  304   ----PVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLE-CSKKQ  140
                 PV+V RLFGVNI K  VS +  + +          GKR+R+ V EF  LE CSKKQ
Sbjct  311   PAAQPVEVVRLFGVNIFKIPVSSVVNSWN----------GKRLRD-VDEFSSLEPCSKKQ  359

Query  139   RVIDAL  122
             RV+ AL
Sbjct  360   RVLGAL  365



>gb|KDO70089.1| hypothetical protein CISIN_1g017035mg [Citrus sinensis]
Length=378

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 248/360 (69%), Positives = 283/360 (79%), Gaps = 27/360 (8%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             ++P TKSPESLCR+GSGAS VI+D+E GVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  31    SIPPTKSPESLCRVGSGASSVILDSEAGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  89

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD-DYEAVFLSSH  803
             HQRVWLGTFNEEEEAAR YDIAAQRFRGRDAVTNFK +S    G + DD D E  FLSSH
Sbjct  90    HQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKQIS--CAGTSSDDGDIEMAFLSSH  147

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNI--NNMTTPRKPEADRSA---------KSRERLF  656
             SK+EIVDMLRKHTY DELEQS+R + +  N     +  E D +A         K+R++LF
Sbjct  148   SKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGAATAFGSDRVLKARDQLF  207

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             EKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+ TSKG+LLNFED  GKVWRFRYSYWNSS
Sbjct  208   EKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS-TSKGLLLNFEDVTGKVWRFRYSYWNSS  266

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK+LKAGDIVSFHRSTG ++QL+IDWKAR G         PV PVQ
Sbjct  267   QSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDRQLYIDWKARTGP-----IENPVEPVQ  321

Query  295   VFRLFGVNISKSTVSPMAMAMDTTN--NISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             + RLFGVNI K   + + + +D       ++ + GKR+RE  ME L LECSKKQR+I AL
Sbjct  322   MMRLFGVNIFKIPGNGL-VGVDKIGCNINNNNNNGKRLRE--MELLSLECSKKQRMIGAL  378



>ref|XP_010265251.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Nelumbo nucifera]
Length=365

 Score =   462 bits (1188),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/362 (68%), Positives = 279/362 (77%), Gaps = 32/362 (9%)
 Frame = -3

Query  1162  ALNLPATKSPESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
              L LP  K PE LCR+GSGAS V++D+E+GVEAES RKLPSS++KGVVPQPNGRWGAQIY
Sbjct  21    VLALPGKKEPEKLCRVGSGASSVVLDSESGVEAES-RKLPSSQYKGVVPQPNGRWGAQIY  79

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEEEEAAR YDIAAQRFRGRDAVTNFKPLSET      +DD E +FL+S
Sbjct  80    EKHQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKPLSETD-----EDDIETIFLNS  134

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPE---------ADRSAKSRERLFE  653
             HSKAEIVDMLRKHTY DELEQ++R +  N   + R            +DR AK+RE+LF+
Sbjct  135   HSKAEIVDMLRKHTYHDELEQTKRNYGCNGDGSRRIRGGGGFGDSTGSDRVAKAREQLFD  194

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             KAVTPSDVGKLNRLVIPKQ AEKHFPLQ G+ TSK VLLNFED  GKVWRFRYSYWNSSQ
Sbjct  195   KAVTPSDVGKLNRLVIPKQHAEKHFPLQIGS-TSKCVLLNFEDNGGKVWRFRYSYWNSSQ  253

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTV-----PV  308
             SYVLTKGWSRFVKEK+LKAGD+VSF RSTGP+KQL+IDWK R  +    +  +     PV
Sbjct  254   SYVLTKGWSRFVKEKNLKAGDVVSFQRSTGPDKQLYIDWKPRAASTYMALPQLVHPVNPV  313

Query  307   HPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVID  128
              PV+V RLFGVNI K    P++  +DT N       GKR+R+V  +F  LE  KKQRV+ 
Sbjct  314   QPVEVVRLFGVNIFK---IPVSSVVDTWN-----INGKRLRDV--DFSSLESCKKQRVVG  363

Query  127   AL  122
             AL
Sbjct  364   AL  365



>gb|AEZ02303.1| RAV1 [Castanea sativa]
Length=383

 Score =   462 bits (1189),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/361 (67%), Positives = 280/361 (78%), Gaps = 30/361 (8%)
 Frame = -3

Query  1144  TKSPESLCRMGSG--ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQR  971
             TKSPESLCR+GSG  +++I+D+E+G+EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQR
Sbjct  33    TKSPESLCRVGSGTTSTLILDSESGIEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQR  91

Query  970   VWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNG-----DDDYEAVFLSS  806
             VWLGTFNEE+EAA+ YDIAAQRFRGRDAVTNFKP   TTD  +      +DD E VFL+S
Sbjct  92    VWLGTFNEEDEAAKAYDIAAQRFRGRDAVTNFKPCG-TTDHHHHHHHHQEDDIETVFLNS  150

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADR---------SAKSRERLFE  653
             HSKAEIVDMLRKHTY DELEQS+R + +++    +               S K+RE+LFE
Sbjct  151   HSKAEIVDMLRKHTYNDELEQSKRNYGLDSTRRSKGESLGHGLLERVNYYSMKAREQLFE  210

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTS----KGVLLNFEDTNGKVWRFRYSYW  485
             KAVTPSDVGKLNRLVIPKQ AEKHFPLQN    S    KG+LLNFED  GKVWRFRYSYW
Sbjct  211   KAVTPSDVGKLNRLVIPKQHAEKHFPLQNSGSNSTTSSKGLLLNFEDVGGKVWRFRYSYW  270

Query  484   NSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVH  305
             NSSQSYVLTKGWSRFVKEK+LKAGDIVSFHRSTGP+ QLFI+WKAR G   P  S+   +
Sbjct  271   NSSQSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGPDNQLFIEWKARAG---PSSSSSSSN  327

Query  304   PVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             PVQ+ RLFGVNI K    P    +  + NI  C+GGKR+RE  M+ L LECSKKQR++ A
Sbjct  328   PVQMVRLFGVNILK---IPGVGGVVESGNIGGCNGGKRMRE--MDLLALECSKKQRIVGA  382

Query  124   L  122
             L
Sbjct  383   L  383



>ref|XP_009796840.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Nicotiana sylvestris]
Length=389

 Score =   462 bits (1188),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 252/371 (68%), Positives = 279/371 (75%), Gaps = 34/371 (9%)
 Frame = -3

Query  1165  SALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             S   LP  KSPESLCRMGSG SVIIDAENGVEAES RKLPSSR+KGVVPQPNGRWGAQIY
Sbjct  23    STSTLPVMKSPESLCRMGSGTSVIIDAENGVEAES-RKLPSSRYKGVVPQPNGRWGAQIY  81

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE EAAR YD+AAQRFRGRDAVTNFKPL E  +    +DD E  FL+S
Sbjct  82    EKHQRVWLGTFNEENEAARAYDVAAQRFRGRDAVTNFKPLLENEE----NDDMEIAFLNS  137

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNI-----------NNMTTPRKPEADRSAKSRERL  659
             HSKAEIVDMLRKHTY DELEQS++ +             + + +      D+  K+RE+L
Sbjct  138   HSKAEIVDMLRKHTYIDELEQSKKNYGFSKDGKRTYCTKDGLMSSFFSSVDKVNKAREQL  197

Query  658   FEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNS  479
             FEKAVTPSDVGKLNRLVIPKQ AEKHFPLQNG  TSKGVLLNFED NGKVWRFRYSYWNS
Sbjct  198   FEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-TSKGVLLNFEDLNGKVWRFRYSYWNS  256

Query  478   SQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTG--SPDIST----  317
             SQSYVLTKGWSRFVKEK+LKAGDIVSF RSTG +KQL+ID+KARN T   SP +++    
Sbjct  257   SQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGEDKQLYIDFKARNATPTISPTVASQVQV  316

Query  316   -VPVHPVQVFRLFGVNISK-------STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLP  161
              V V  VQ+ RLFGVNI K          +      +  NN++SCSGGK  R + ME L 
Sbjct  317   QVQVPQVQMVRLFGVNICKVPAVNNVVIDNNNNNNNNNDNNMTSCSGGK--RRIEMELLT  374

Query  160   LE-CSKKQRVI  131
              E C KKQRVI
Sbjct  375   FESCRKKQRVI  385



>gb|ACF74549.1| RAV [Nicotiana tabacum]
Length=385

 Score =   461 bits (1187),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 280/367 (76%), Gaps = 30/367 (8%)
 Frame = -3

Query  1165  SALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             S   LP  KSPESLCRMGSG SVIIDAENGVEAES RKLPSSR++GVVPQPNGRWGAQIY
Sbjct  23    STSTLPVMKSPESLCRMGSGTSVIIDAENGVEAES-RKLPSSRYEGVVPQPNGRWGAQIY  81

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE EAAR YD+AAQRFRGRDAVTNFKPL E  +    +DD E  FL+S
Sbjct  82    EKHQRVWLGTFNEENEAARAYDVAAQRFRGRDAVTNFKPLLENEE----NDDMEIAFLNS  137

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNI-----------NNMTTPRKPEADRSAKSRERL  659
             HSKAEIVDMLRKHTY DELEQS++ +             + + +      D+  K+RE+L
Sbjct  138   HSKAEIVDMLRKHTYIDELEQSKKNYGFSKDGKRTYCTKDGLMSSFFSSVDKVNKAREQL  197

Query  658   FEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNS  479
             FEKAVTPSDVGKLNRLVIPKQ AEKHFPLQNG  TSKGVLLNFED NGKVWRFRYSYWNS
Sbjct  198   FEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-TSKGVLLNFEDLNGKVWRFRYSYWNS  256

Query  478   SQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTG--SPDIST---V  314
             SQSYVLTKGWSRFVKEK+LKAGDIVSF RSTG +KQL+ID+KARN T   SP +++   V
Sbjct  257   SQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGEDKQLYIDFKARNATPTISPTVASQVQV  316

Query  313   PVHPVQVFRLFGVNISK-----STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLE-C  152
              V  VQ+ RLFGVNI K     + V       +  NN++SCSGGK  R + ME L  E C
Sbjct  317   QVPQVQMVRLFGVNICKVPAVNNVVINNNNNNNNDNNMTSCSGGK--RRIEMELLTFESC  374

Query  151   SKKQRVI  131
              KKQRVI
Sbjct  375   RKKQRVI  381



>gb|ACT33043.1| RAV transcription factor [Camellia sinensis]
Length=362

 Score =   457 bits (1176),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 251/367 (68%), Positives = 279/367 (76%), Gaps = 38/367 (10%)
 Frame = -3

Query  1177  VAHASALNLPATK----SPESLCRMGSGASVIIDA-ENGVEAESGRKLPSSRFKGVVPQP  1013
             +A AS   L ATK    SP+SLCR+GSG S I+D+ E G EAES RKLPSSRFKGVVPQP
Sbjct  19    LASASTSILLATKTKASSPKSLCRVGSGTSAILDSLEGGAEAES-RKLPSSRFKGVVPQP  77

Query  1012  NGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD  833
             NGRWGAQIYEKHQRVWLGTFNEE+EAAR YDIAAQRFRGRDAVTNFKPLSE  +     D
Sbjct  78    NGRWGAQIYEKHQRVWLGTFNEEDEAARAYDIAAQRFRGRDAVTNFKPLSENEE----QD  133

Query  832   DYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAF---NINNMTTPRKPEADRS------  680
             + E +FL+SHSK+EIVDMLRKHTY DE EQSR+ +    INN    +    ++S      
Sbjct  134   ELETLFLNSHSKSEIVDMLRKHTYNDEPEQSRKNYIGGFINNNGNKKACCNEKSTTNYKN  193

Query  679   -AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWR  503
               K+ E+LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+   TSKGVLLNF+D  GKVWR
Sbjct  194   NVKATEQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQS-ETTSKGVLLNFKDVAGKVWR  252

Query  502   FRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDI  323
             FRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF+RSTG + QLFIDWK RNG      
Sbjct  253   FRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFYRSTGSDNQLFIDWKPRNG------  306

Query  322   STVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKK  143
             S   V PVQ+ RLFGVNI K    P++  +D     S+C GGKR+RE  ME L LECSKK
Sbjct  307   SNPVVQPVQMVRLFGVNIFK---VPISGGLD-----SNC-GGKRMRE--MELLALECSKK  355

Query  142   QRVIDAL  122
              RVI AL
Sbjct  356   VRVIGAL  362



>ref|XP_002524409.1| DNA-binding protein RAV1, putative [Ricinus communis]
 gb|EEF38020.1| DNA-binding protein RAV1, putative [Ricinus communis]
Length=371

 Score =   457 bits (1175),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/360 (67%), Positives = 281/360 (78%), Gaps = 34/360 (9%)
 Frame = -3

Query  1153  LPATKSPES-LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
             LP+ KSPES LCR+GSG SV++D+E+G+EAES RKLPSS++KGVVPQPNGRWGAQIYEKH
Sbjct  30    LPS-KSPESPLCRVGSGTSVVLDSESGIEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKH  87

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSK  797
             QRVWLGTFNEE+EAA+ YDIAAQRFRGRDA+TNFKP  + TD ++ +D+ E  FL+SHSK
Sbjct  88    QRVWLGTFNEEDEAAKAYDIAAQRFRGRDAITNFKP--QATDHQSEEDEIETAFLNSHSK  145

Query  796   AEIVDMLRKHTYTDELEQSRRAFNINN-----------MTTPRKPEADRS-AKSRERLFE  653
             AEIVDMLRKHTY DELEQS+R +  NN           M       ++R   K+RE+LFE
Sbjct  146   AEIVDMLRKHTYNDELEQSKRNYTSNNGRGDKFQNRTNMNNVGLSGSERIIMKAREQLFE  205

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             KAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+ ++KGVLLNFED  GKVWRFRYSYWNSSQ
Sbjct  206   KAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSNSTKGVLLNFEDITGKVWRFRYSYWNSSQ  265

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIS---TVPVHP  302
             SYVLTKGWSRFVKEK+LKAGDIV F +STGP+KQL+IDWK R  T +P +S      V P
Sbjct  266   SYVLTKGWSRFVKEKNLKAGDIVRFLKSTGPDKQLYIDWKVR--TLTPTVSNPVVCSVQP  323

Query  301   VQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             VQ+ RLFGVNI K         +   ++I  C+ GKRIRE  ME L L+C KKQRVI AL
Sbjct  324   VQMVRLFGVNIFK---------VPGNSHIEGCN-GKRIRE--MELLSLDCIKKQRVIGAL  371



>gb|KDP29366.1| hypothetical protein JCGZ_18287 [Jatropha curcas]
Length=360

 Score =   456 bits (1173),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/357 (67%), Positives = 272/357 (76%), Gaps = 22/357 (6%)
 Frame = -3

Query  1162  ALNLPATKSPES-LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             +L  P   SPES LCR+GSG SVI+D+E+GVEAES RKLPSS++KGVVPQPNGRWGAQIY
Sbjct  16    SLTPPTKSSPESPLCRVGSGTSVILDSESGVEAES-RKLPSSKYKGVVPQPNGRWGAQIY  74

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE+EAA+ YDIAAQRFRGRDA+ NFK  +  T+    DDD E  FL+S
Sbjct  75    EKHQRVWLGTFNEEDEAAKAYDIAAQRFRGRDAIANFKLEANETE----DDDIETAFLNS  130

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKP---------EADRSAKSRERLFE  653
             HSKAEIVDMLRKHTY DELEQS+R + I+     +            ++R  K+RE+LFE
Sbjct  131   HSKAEIVDMLRKHTYNDELEQSKRNYRIDGQGKHKNHGGVNNVGLIASERVLKAREQLFE  190

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             KAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+ ++KGVLLNFED  GKVWRFRYSYWNSSQ
Sbjct  191   KAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSNSTKGVLLNFEDITGKVWRFRYSYWNSSQ  250

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK+LKAGDIVSF RSTGP+KQL+IDWK R  +GS  +    V PVQ+
Sbjct  251   SYVLTKGWSRFVKEKNLKAGDIVSFQRSTGPDKQLYIDWKVRT-SGSNQVVCPMVQPVQM  309

Query  292   FRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              RLFGVNI K   +              CS GKR+RE  M+ L LE SKKQ VI AL
Sbjct  310   VRLFGVNIFKVAGNGNGGVEGVV---GGCS-GKRMRE--MDLLSLEYSKKQMVIGAL  360



>gb|AAW83473.1| RAV transcription factor [Capsicum annuum]
Length=399

 Score =   455 bits (1170),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 278/373 (75%), Gaps = 35/373 (9%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             ++  TK PESLCRMGSG +SVIID ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  34    SMTTTKPPESLCRMGSGTSSVIIDGENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  92

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTFNEE EAAR YD+AAQRFRGRDAVTNFKPL E  +    DDD E  FL+SHS
Sbjct  93    HQRVWLGTFNEENEAARAYDVAAQRFRGRDAVTNFKPLLENQE---SDDDVEIAFLNSHS  149

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNIN---NMTTPRKPEADRSA-------------KSR  668
             KAEIVDMLRKHTY DELEQS++ F       M   +    D S+             K R
Sbjct  150   KAEIVDMLRKHTYIDELEQSKKLFGYTKDGTMAKNKDGLIDISSFFGGGGTIDKVNNKVR  209

Query  667   ERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSY  488
             E+LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQNG   SKGVLLNFED NGKVWRFRYSY
Sbjct  210   EQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-NSKGVLLNFEDLNGKVWRFRYSY  268

Query  487   WNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST---  317
             WNSSQSYVLTKGWSRFVKEK+LKAGDIVSF RST  +KQL+ID+KARN   +  + T   
Sbjct  269   WNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTSGDKQLYIDFKARNMAPTNPVVTNQV  328

Query  316   ---VPVHPVQVFRLFGVNISK---STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLE  155
                V V  VQ+ RLFGVNI K   +  + +    +  NN+++CSGGKR+ E  ME L  E
Sbjct  329   QAQVQVPRVQMMRLFGVNICKIPATINNVVDNNNNNNNNMANCSGGKRMME--MELLTFE  386

Query  154   -CSKKQRV-IDAL  122
              C KKQRV IDAL
Sbjct  387   SCRKKQRVIIDAL  399



>gb|AAQ05799.1|AF478458_1 DNA binding protein Rav [Capsicum annuum]
Length=386

 Score =   454 bits (1169),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 250/372 (67%), Positives = 277/372 (74%), Gaps = 35/372 (9%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
             +  TK PESLCRMGSG +SVIID ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKH
Sbjct  22    MTTTKPPESLCRMGSGTSSVIIDGENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKH  80

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSK  797
             QRVWLGTFNEE EAAR YD+AAQRFRGRDAVTNFKPL E  +    DDD E  FL+SHSK
Sbjct  81    QRVWLGTFNEENEAARAYDVAAQRFRGRDAVTNFKPLLENQE---SDDDVEIAFLNSHSK  137

Query  796   AEIVDMLRKHTYTDELEQSRRAFNIN---NMTTPRKPEADRSA-------------KSRE  665
             AEIVDMLRKHTY DELEQS++ F       M   +    D S+             K RE
Sbjct  138   AEIVDMLRKHTYIDELEQSKKLFGYTKDGTMAKNKDGLIDISSFFGGGGTIDKVNNKVRE  197

Query  664   RLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYW  485
             +LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQNG   SKGVLLNFED NGKVWRFRYSYW
Sbjct  198   QLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-NSKGVLLNFEDLNGKVWRFRYSYW  256

Query  484   NSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST----  317
             NSSQSYVLTKGWSRFVKEK+LKAGDIVSF RST  +KQL+ID+KARN   +  + T    
Sbjct  257   NSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTSGDKQLYIDFKARNMAPTNPVVTNQVQ  316

Query  316   --VPVHPVQVFRLFGVNISK---STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLE-  155
               V V  VQ+ RLFGVNI K   +  + +    +  NN+++CSGGKR+ E  ME L  E 
Sbjct  317   AQVQVPRVQMMRLFGVNICKIPATINNVVDNNNNNNNNMANCSGGKRMME--MELLTFES  374

Query  154   CSKKQRV-IDAL  122
             C KKQRV IDAL
Sbjct  375   CRKKQRVIIDAL  386



>ref|XP_010093403.1| AP2/ERF and B3 domain-containing transcription factor RAV1 [Morus 
notabilis]
 gb|EXB53997.1| AP2/ERF and B3 domain-containing transcription factor RAV1 [Morus 
notabilis]
Length=378

 Score =   453 bits (1166),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 248/361 (69%), Positives = 282/361 (78%), Gaps = 33/361 (9%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGAS-VIIDAE-------NGVEAESGRKLPSSRFKGVVPQPNGRWGA  995
             PA +S  +LCR+GSGAS V++D+E        G +AESGRKLPSS++KGVVPQPNGRWGA
Sbjct  33    PAAES--TLCRVGSGASSVVVDSEMITNAINGGADAESGRKLPSSKYKGVVPQPNGRWGA  90

Query  994   QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
             QIYEKHQRVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKPLSETT+    +D+ E+VF
Sbjct  91    QIYEKHQRVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPLSETTE----EDEIESVF  146

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRR-AFNINNMTTPRKPE-------ADRSAK-SRER  662
             L+SHSKAEIVDMLRKHTY DELEQS+R +F I+     RKP        +D +A  +RE+
Sbjct  147   LNSHSKAEIVDMLRKHTYNDELEQSKRNSFGIDGNGN-RKPSRTGLLFGSDLTASMAREQ  205

Query  661   LFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWN  482
             LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+ A T KGVLLNFED  GKVWRFRYSYWN
Sbjct  206   LFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQS-ANTCKGVLLNFEDVGGKVWRFRYSYWN  264

Query  481   SSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARN-GTGSPDISTVPVH  305
             SSQSYVLTKGWSRFVKEKSLKAGDIVSF RSTGP+KQL+IDWKAR+  +GS   +   V 
Sbjct  265   SSQSYVLTKGWSRFVKEKSLKAGDIVSFQRSTGPDKQLYIDWKARDVDSGS---AGGAVG  321

Query  304   PVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             PVQ+ RLFGVNI K   S M +          C+ GKR R+  ME L LECSKK R+I A
Sbjct  322   PVQMVRLFGVNIFKLPGSEM-VEGIGIGIGGGCN-GKRTRD--MELLELECSKKPRIIGA  377

Query  124   L  122
             L
Sbjct  378   L  378



>gb|AGT55822.1| tempranillo [Antirrhinum majus]
Length=354

 Score =   450 bits (1158),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 246/350 (70%), Positives = 269/350 (77%), Gaps = 37/350 (11%)
 Frame = -3

Query  1132  ESLCRMGSGASVIIDA-ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             + LCR+GSG SVI+DA E GVEAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  29    DKLCRVGSGTSVILDAAECGVEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  87

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FNEE EAAR YD AAQRFRGRDAVTNFK LSET       DD EA FL+SHSK+EIVDML
Sbjct  88    FNEESEAARAYDTAAQRFRGRDAVTNFKLLSETE-----HDDVEASFLNSHSKSEIVDML  142

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKP-----EADRSAKSRERLFEKAVTPSDVGKLNRL  611
             RKHTY DELEQSR+ F+ N+      P      AD  A++RE+LFEKAVTPSDVGKLNRL
Sbjct  143   RKHTYNDELEQSRKNFSNNSGVNKSCPFVLSGSADAKARAREQLFEKAVTPSDVGKLNRL  202

Query  610   VIPKQQAEKHFPLQ------NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGW  449
             VIPKQ AEKHFPLQ      N + TSKGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGW
Sbjct  203   VIPKQHAEKHFPLQNNGNNGNSSSTSKGVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGW  262

Query  448   SRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR-NGTGSPDISTVPVHPVQVFRLFGVN  272
             SRFVKEK+LKAGD+V+F RSTG +KQL+IDWK R NG GS  ++ +    VQ+ RLFGVN
Sbjct  263   SRFVKEKNLKAGDVVTFQRSTGVDKQLYIDWKVRSNGNGSDQVTGL-TGRVQMVRLFGVN  321

Query  271   ISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             I +    PM       NN      GKRIRE+  E L LECSKKQRVIDAL
Sbjct  322   IFE---VPM-------NN-----DGKRIREI--EMLELECSKKQRVIDAL  354



>ref|XP_004297140.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Fragaria vesca subsp. vesca]
Length=383

 Score =   451 bits (1160),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 245/354 (69%), Positives = 276/354 (78%), Gaps = 25/354 (7%)
 Frame = -3

Query  1135  PESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             P+SLCR+GSGAS VI+D+ENG+EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLG
Sbjct  39    PQSLCRVGSGASSVILDSENGIEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLG  97

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPL---SETTDGRNGDDDYEAVFLSSHSKAEI  788
             TFNEE+EAAR YD+AAQRFRGRDAVTNFKPL   S TT   N DD+ EA FL+SHSK+EI
Sbjct  98    TFNEEDEAARAYDVAAQRFRGRDAVTNFKPLTESSTTTTTDNDDDEIEAAFLNSHSKSEI  157

Query  787   VDMLRKHTYTDELEQSRRAFNINN------------MTTPRKPEADRSAKSRERLFEKAV  644
             VDMLRKHTY DELEQS+R++  ++            +T    P  DR+AK+RE+LFEKAV
Sbjct  158   VDMLRKHTYNDELEQSKRSYGFDSNGKRRARGEGGPLTGAFGP--DRAAKAREQLFEKAV  215

Query  643   TPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYV  464
             TPSDVGKLNRLVIPKQ AEKHFPLQ+G+ T KGVLLNFED  GKVWRFRYSYWNSSQSYV
Sbjct  216   TPSDVGKLNRLVIPKQHAEKHFPLQSGS-TCKGVLLNFEDVGGKVWRFRYSYWNSSQSYV  274

Query  463   LTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRL  284
             LTKGWSRFVKEK+LKAGDIVSF RSTGP++QL+IDWK R  TG    + V   PVQ+ RL
Sbjct  275   LTKGWSRFVKEKNLKAGDIVSFQRSTGPDRQLYIDWKTRTSTGP---NPVQAGPVQMVRL  331

Query  283   FGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             FGVNI K   S  A        I     GKR+RE   E L LE SKKQR+I AL
Sbjct  332   FGVNIFKVPGSGGAAGTTVEAPIGCNVVGKRMRE--FELLELEFSKKQRIIGAL  383



>ref|XP_011021709.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Populus euphratica]
Length=369

 Score =   446 bits (1148),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/360 (64%), Positives = 269/360 (75%), Gaps = 38/360 (11%)
 Frame = -3

Query  1150  PATKS---PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             PAT +   PESLCR+GSG SVI+D E+GVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  31    PATTTKSPPESLCRVGSGNSVILDLESGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  89

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTFNEE+EAAR YD AAQRFRGRDAVTNFK ++ET D     D+ EA FL +HS
Sbjct  90    HQRVWLGTFNEEDEAARAYDTAAQRFRGRDAVTNFKQVNETED-----DEIEAAFLITHS  144

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPE-------------ADRSAKSRERL  659
             KAEIVDMLRKHTY+DELEQS+R    NN    ++ +               R  K+RE+L
Sbjct  145   KAEIVDMLRKHTYSDELEQSKRNHRSNNGVNGKQYKNTANYGSNSYDHGCGRVLKAREQL  204

Query  658   FEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ-NGAVTSKGVLLNFEDTNGKVWRFRYSYWN  482
             FEKAVTPSDVGKLNRLVIPKQ AEKHFPLQ   + ++KGVLLN ED +GKVWRFRYSYWN
Sbjct  205   FEKAVTPSDVGKLNRLVIPKQHAEKHFPLQGTSSCSTKGVLLNLEDMSGKVWRFRYSYWN  264

Query  481   SSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHP  302
             SSQSYVLTKGWSRFVKEKSLKAGDIV F RSTGP+KQL+IDWKAR+G+        PV P
Sbjct  265   SSQSYVLTKGWSRFVKEKSLKAGDIVCFQRSTGPDKQLYIDWKARSGSN----QVHPVQP  320

Query  301   VQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             +Q+ RLFGVNI            +     + C+G + +RE+ +  L  + SKKQR+I AL
Sbjct  321   IQMVRLFGVNI-----------FNVPGMENGCNGKRSVREMELLSLDHQYSKKQRIIGAL  369



>ref|XP_004238962.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Solanum lycopersicum]
Length=395

 Score =   446 bits (1147),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 276/378 (73%), Gaps = 38/378 (10%)
 Frame = -3

Query  1177  VAHASALNLPATKSPES-LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRW  1001
             +  ++ + LP    PES LCRMGSG SVIIDAENGVEAES RKLPSSR+KGVVPQPNGRW
Sbjct  30    IKSSTTIKLP----PESGLCRMGSGTSVIIDAENGVEAES-RKLPSSRYKGVVPQPNGRW  84

Query  1000  GAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEA  821
             GAQIYEKHQRVWLGTFNEE EAAR YDIAAQRFRGRDAVTNFKPL E  +     DD E 
Sbjct  85    GAQIYEKHQRVWLGTFNEENEAARAYDIAAQRFRGRDAVTNFKPLLENQE----SDDMEI  140

Query  820   VFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEA-----------DR-SA  677
              FL+SHSKAEIVDMLRKHTY DELEQS+R F        ++ +            D+ + 
Sbjct  141   AFLNSHSKAEIVDMLRKHTYIDELEQSKRLFGFTKDGMIKRKDGLVISSFFGSTNDKVNC  200

Query  676   KSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFR  497
             K+RE+LFEK VTPSDVGKLNRLVIPKQ AEKHFPLQNG   SKGVLLNFED NGKVWRFR
Sbjct  201   KAREQLFEKVVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-NSKGVLLNFEDLNGKVWRFR  259

Query  496   YSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST  317
             YSYWNSSQSYVLTKGWSRFVKEK+LKAGDIVSF RST  +KQL+ID+KA+N   +  + T
Sbjct  260   YSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTSGDKQLYIDFKAKNVGNTSMVVT  319

Query  316   ------VPVHPVQVFRLFGVNISK-----STVSPMAMAMDTTNNISSCSGGKRIREVVME  170
                   V V  VQ+ RLFGVNI K     S V       +  NN++S  GGKR  E  ME
Sbjct  320   NQVQAQVQVPLVQMVRLFGVNICKVPANVSNVVIDNNNNNNNNNMTSWGGGKRRME--ME  377

Query  169   FLPLE-CSKKQRV-IDAL  122
              L  E C KKQRV IDAL
Sbjct  378   LLTFESCRKKQRVIIDAL  395



>ref|XP_002311438.2| DNA-binding protein RAV2 [Populus trichocarpa]
 gb|EEE88805.2| DNA-binding protein RAV2 [Populus trichocarpa]
Length=369

 Score =   445 bits (1144),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 229/352 (65%), Positives = 265/352 (75%), Gaps = 35/352 (10%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             PESLCR+GSG SVI+D E GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  39    PESLCRVGSGNSVILDLELGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGT  97

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FNEE+EAAR YD AAQRFRGRDAVTNFK ++ET D     D+ EA FL +HSKAEIVDML
Sbjct  98    FNEEDEAARAYDTAAQRFRGRDAVTNFKQVNETED-----DEIEAAFLITHSKAEIVDML  152

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPE-------------ADRSAKSRERLFEKAVTPS  635
             RKHTY+DELEQS+R    NN    ++ +               R  K+RE+LFEKAVTPS
Sbjct  153   RKHTYSDELEQSKRNQRSNNGVNGKQYKNTANYGSNSYDHGCGRVLKAREQLFEKAVTPS  212

Query  634   DVGKLNRLVIPKQQAEKHFPLQN-GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             DVGKLNRLVIPKQ AEKHFPLQ+  + ++KGVLLN ED +GKVWRFRYSYWNSSQSYVLT
Sbjct  213   DVGKLNRLVIPKQHAEKHFPLQSTSSCSTKGVLLNLEDMSGKVWRFRYSYWNSSQSYVLT  272

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFG  278
             KGWSRFVKEKSLKAGDIV F RSTGP+KQL+IDWKAR+G+        PV P+Q+ RLFG
Sbjct  273   KGWSRFVKEKSLKAGDIVCFQRSTGPDKQLYIDWKARSGSN----QVQPVQPIQMVRLFG  328

Query  277   VNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             VNI            +     + C+G + +RE+ +  L  + SKKQR+I AL
Sbjct  329   VNI-----------FNVPGMENGCNGKRSVREMELLSLDHQYSKKQRIIGAL  369



>gb|ABY57635.1| RAV2 [Solanum lycopersicum]
Length=395

 Score =   442 bits (1137),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 248/378 (66%), Positives = 276/378 (73%), Gaps = 38/378 (10%)
 Frame = -3

Query  1177  VAHASALNLPATKSPES-LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRW  1001
             +  ++ + LP    PES LCRMGSG SVIIDAENGVEAES +KLPSSR+KGVVPQPNGRW
Sbjct  30    IKSSTTIKLP----PESGLCRMGSGTSVIIDAENGVEAES-KKLPSSRYKGVVPQPNGRW  84

Query  1000  GAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEA  821
             GAQIYEKHQRVWLGTFNEE EAAR YDIAAQRFRGRDAVTNFKPL E  +     DD E 
Sbjct  85    GAQIYEKHQRVWLGTFNEENEAARAYDIAAQRFRGRDAVTNFKPLLENQE----SDDMEI  140

Query  820   VFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEA-----------DR-SA  677
              FL+SHSKAEIVD+LRKHTY DELEQS+R F        ++ +            D+ + 
Sbjct  141   AFLNSHSKAEIVDVLRKHTYIDELEQSKRLFGFTKDGMIKRKDGLVISSFFGSTNDKVNC  200

Query  676   KSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFR  497
             K+RE+LFEK VTPSDVGKLNRLVIPKQ AEKHFPLQNG   SKGVLLNFED NGKVWRFR
Sbjct  201   KAREQLFEKVVTPSDVGKLNRLVIPKQHAEKHFPLQNGN-NSKGVLLNFEDLNGKVWRFR  259

Query  496   YSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST  317
             YSYWNSSQSYVLTKGWSRFVKEK+LKAGDIVSF RST  +KQL+ID+KA+N   +  + T
Sbjct  260   YSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTSGDKQLYIDFKAKNVGNTSMVVT  319

Query  316   ------VPVHPVQVFRLFGVNISK-----STVSPMAMAMDTTNNISSCSGGKRIREVVME  170
                   V V  VQ+ RLFGVNI K     S V       +  NN++S  GGKR  E  ME
Sbjct  320   NQVQAQVQVPLVQMVRLFGVNICKVPANVSNVVIDNNNNNNNNNMTSWGGGKRRME--ME  377

Query  169   FLPLE-CSKKQRV-IDAL  122
              L  E C KKQRV IDAL
Sbjct  378   LLTFESCRKKQRVIIDAL  395



>ref|XP_006362535.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Solanum tuberosum]
Length=398

 Score =   435 bits (1119),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 245/363 (67%), Positives = 269/363 (74%), Gaps = 36/363 (10%)
 Frame = -3

Query  1135  PES-LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             PES LCRMGSG SVIIDAENGVEAES RKLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLG
Sbjct  40    PESGLCRMGSGTSVIIDAENGVEAES-RKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLG  98

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TFNEE EAAR YD+AAQRFRGRDAVTNFKPL E  +     DD E  FL+SHSKAEIVDM
Sbjct  99    TFNEENEAARAYDVAAQRFRGRDAVTNFKPLLENQES----DDMEIAFLNSHSKAEIVDM  154

Query  778   LRKHTYTDELEQSRRAFNINNMTTPRKPEA-----------DR-SAKSRERLFEKAVTPS  635
             LRKHTY DELEQS+R F        ++ +            D+ + K+RE+LFEKAVTPS
Sbjct  155   LRKHTYLDELEQSKRLFGFTKDGMIKRKDGQIISSFFGSTNDKVNCKAREQLFEKAVTPS  214

Query  634   DVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             DVGKLNRLVIPKQ AEKHFPLQNG   SKGVLLNFED NGKVWRFRYSYWNSSQSYVLTK
Sbjct  215   DVGKLNRLVIPKQHAEKHFPLQNGN-NSKGVLLNFEDLNGKVWRFRYSYWNSSQSYVLTK  273

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARN-GTGS-----PDISTVPVHPVQV  293
             GWSRFVKEK+LKAGDIVSF RST  +KQL+ID+KA+N G  S          + V  VQ+
Sbjct  274   GWSRFVKEKNLKAGDIVSFQRSTSGDKQLYIDFKAKNVGNTSVVVTNQVQVQIQVPQVQM  333

Query  292   FRLFGVNISKSTVSPMAMAMD--------TTNNISSCSGGKRIREVVMEFLPLE-CSKKQ  140
              RLFGVNI K   +   + +D          NN++S SGGKR  E  ME L  E C KKQ
Sbjct  334   VRLFGVNICKVPANVSNVVIDNNNNNNNNNNNNMTSWSGGKRRME--MELLTFESCRKKQ  391

Query  139   RVI  131
             RVI
Sbjct  392   RVI  394



>ref|XP_009614561.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Nicotiana tomentosiformis]
Length=362

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/349 (65%), Positives = 268/349 (77%), Gaps = 28/349 (8%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAE--NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             L RMGSG +SVIIDAE   G+EAES +KLPSSRFKGVVPQPNGRWGAQIYEKHQR+WLGT
Sbjct  28    LSRMGSGTSSVIIDAELNCGIEAESIKKLPSSRFKGVVPQPNGRWGAQIYEKHQRIWLGT  87

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FN+E+EAA+ YD+AAQRFRG+DAVTNFKPL ++       ++ E  FL+S SKAEIVDML
Sbjct  88    FNDEDEAAKAYDVAAQRFRGKDAVTNFKPLFDSE-----KEEIEISFLNSRSKAEIVDML  142

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPE--------ADRSAKSRERLFEKAVTPSDVGKL  620
             RKHTY DELE S++ ++ N        E         ++ +K+RE +FEKAVTPSDVGKL
Sbjct  143   RKHTYYDELEHSKKVYSFNKNGKRTCCEDGVVTSFAVEKLSKARELMFEKAVTPSDVGKL  202

Query  619   NRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             NRLVIPKQ AE++FPL+N    SKG+LLN ED NGKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  203   NRLVIPKQHAERYFPLEN---NSKGMLLNLEDMNGKVWRFRYSYWNSSQSYVLTKGWSRF  259

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSP--DISTVPVHPVQVFRLFGVNIS  266
             VKEK+LKAG IVSF RS G +KQL+IDWKAR  + +P  D   V V PV++ RLFGVNI 
Sbjct  260   VKEKNLKAGYIVSFGRSNGVDKQLYIDWKARISSTTPVLDKLQVQVQPVKMVRLFGVNIC  319

Query  265   K-STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             K   V+ + +     NN+SSC+GGKR+RE  ME L  EC KKQRVIDAL
Sbjct  320   KVHDVNNIVVE----NNLSSCNGGKRMRE--MESLAFECRKKQRVIDAL  362



>ref|XP_011008525.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Populus euphratica]
Length=407

 Score =   435 bits (1118),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 266/353 (75%), Gaps = 39/353 (11%)
 Frame = -3

Query  1135  PESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             PESLCR+GSG +SVI+D+E+GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLG
Sbjct  79    PESLCRVGSGNSSVILDSESGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLG  137

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TFNEE EAAR YDIAA+RFRGRDAVTNFK ++ET      DD+ EA FL++HSKAEIVDM
Sbjct  138   TFNEENEAARAYDIAARRFRGRDAVTNFKQVNETE-----DDEIEAAFLNAHSKAEIVDM  192

Query  778   LRKHTYTDELEQSRRAFNINNMTTPRKPE-------------ADRSAKSRERLFEKAVTP  638
             LRKHTY+DELEQS+R    NN    ++ +               R  K+RE+LFEKAVTP
Sbjct  193   LRKHTYSDELEQSKRNHRSNNGVNGKQYKNTANYENNSYDHGCGRVLKAREQLFEKAVTP  252

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTS-KGVLLNFEDTNGKVWRFRYSYWNSSQSYVL  461
             SDVGKLNRLVIPKQ AEKHFPLQ+ +  S KGVLLN ED +GKVWRFRYSYWNSSQSYVL
Sbjct  253   SDVGKLNRLVIPKQHAEKHFPLQSTSSNSTKGVLLNLEDVSGKVWRFRYSYWNSSQSYVL  312

Query  460   TKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLF  281
             TKGWSRFVKEKSLKAGDIV F RSTGP+KQL+IDWKAR+G+         V PVQ+ RLF
Sbjct  313   TKGWSRFVKEKSLKAGDIVCFQRSTGPDKQLYIDWKARSGSNQ-------VQPVQMVRLF  365

Query  280   GVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             GVNI            +     + C G + +R++ +  +  + SKK+R++ AL
Sbjct  366   GVNI-----------FNVPGMENGCDGKRSMRDMELLSIDHQYSKKRRIVGAL  407



>ref|XP_002315958.2| DNA-binding protein RAV2 [Populus trichocarpa]
 gb|EEF02129.2| DNA-binding protein RAV2 [Populus trichocarpa]
Length=401

 Score =   432 bits (1112),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 263/353 (75%), Gaps = 39/353 (11%)
 Frame = -3

Query  1135  PESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             PESLCR+ SG +SVI+D+E+GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLG
Sbjct  73    PESLCRVRSGNSSVILDSESGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLG  131

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TFNEE EAAR YDIAAQRFRGRDAVTNFK ++ET      DD+ EA FL++HSKAEIVDM
Sbjct  132   TFNEENEAARAYDIAAQRFRGRDAVTNFKQVNETE-----DDEIEAAFLNAHSKAEIVDM  186

Query  778   LRKHTYTDELEQSRRAFNINNMTTPRKPE-------------ADRSAKSRERLFEKAVTP  638
             LRKHTY+DELEQS+R    NN    ++ +               R  K+RE+LFEKAVTP
Sbjct  187   LRKHTYSDELEQSKRNHRSNNGGNGKQYKNTANYENNSYDHGCGRVLKAREQLFEKAVTP  246

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTS-KGVLLNFEDTNGKVWRFRYSYWNSSQSYVL  461
             SDVGKLNRLVIPKQ AEKHFPLQ+ +  S KGVLLN ED +GKVWRFRYSYWNSSQSYVL
Sbjct  247   SDVGKLNRLVIPKQHAEKHFPLQSTSSNSTKGVLLNLEDVSGKVWRFRYSYWNSSQSYVL  306

Query  460   TKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLF  281
             TKGWSRFVKEK+LKAGDIV F RSTGP+ QL+IDWKAR G+         V PVQ+ RLF
Sbjct  307   TKGWSRFVKEKNLKAGDIVCFQRSTGPDNQLYIDWKARCGSNQ-------VQPVQMVRLF  359

Query  280   GVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             GVNI            +     + C G + IR++ +  +  + SKKQR++ AL
Sbjct  360   GVNI-----------FNVPGMENGCDGKRSIRDMELLSIDRQYSKKQRIVGAL  401



>ref|XP_003516851.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Glycine max]
Length=384

 Score =   430 bits (1106),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 229/368 (62%), Positives = 264/368 (72%), Gaps = 43/368 (12%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAEN-----GVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             P+   P  LCR+GSGAS ++D++        E ES RKLPSS++KGVVPQPNGRWG+QIY
Sbjct  35    PSPPPPNRLCRVGSGASAVVDSDGGGGGGSTEVES-RKLPSSKYKGVVPQPNGRWGSQIY  93

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE+EAAR YD+A QRFRG+DAVTNFKPLS T D     DD E+ FL+S
Sbjct  94    EKHQRVWLGTFNEEDEAARAYDVAVQRFRGKDAVTNFKPLSGTDD-----DDGESEFLNS  148

Query  805   HSKAEIVDMLRKHTYTDELEQSRR-------------AFNINNMTTPRKPEADRSAKSRE  665
             HSK+EIVDMLRKHTY DELEQS+R             A N N+++           K+RE
Sbjct  149   HSKSEIVDMLRKHTYNDELEQSKRSRGFVRRRGSAAGAGNGNSIS------GACVMKARE  202

Query  664   RLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ---NG----AVTSKGVLLNFEDTNGKVW  506
             +LF+KAVTPSDVGKLNRLVIPKQ AEKHFPLQ   NG    A  +KGVLLNFED  GKVW
Sbjct  203   QLFQKAVTPSDVGKLNRLVIPKQHAEKHFPLQSAANGVSATATAAKGVLLNFEDVGGKVW  262

Query  505   RFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPD  326
             RFRYSYWNSSQSYVLTKGWSRFVKEK+LKAGD V F RSTGP++QL+IDWK RN      
Sbjct  263   RFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDTVCFQRSTGPDRQLYIDWKTRNVVNEVA  322

Query  325   ISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSK  146
             +    V P+Q+ RLFGVNI K    P + ++   NN S C  GKR RE  ME   LECSK
Sbjct  323   LFGPVVEPIQMVRLFGVNILK---LPGSDSIANNNNASGCCNGKR-RE--MELFSLECSK  376

Query  145   KQRVIDAL  122
             K ++I AL
Sbjct  377   KPKIIGAL  384



>ref|XP_008350869.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Malus domestica]
Length=406

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 268/374 (72%), Gaps = 45/374 (12%)
 Frame = -3

Query  1129  SLCRMGSGAS-VIIDAE-------NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             SLCR+GSGAS VI+D E        GVEAES RKLPSSR+KGVVPQPNGRWGAQIYEKHQ
Sbjct  40    SLCRVGSGASSVILDPELSSSGGTGGVEAES-RKLPSSRYKGVVPQPNGRWGAQIYEKHQ  98

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE--TTDGRNGDDDYEAVFLSSHS  800
             RVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKP S    +     +DD EA FLSSHS
Sbjct  99    RVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPSSAEPISSDDEENDDAEAAFLSSHS  158

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS-----------AKSRERLFE  653
             K+EIVDMLRKHTY DELEQS+R    NN    ++  ++ S            K+RE+LFE
Sbjct  159   KSEIVDMLRKHTYNDELEQSKR----NNSAYGKRSRSNGSLGLFGTDNSGVPKAREQLFE  214

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTS---------KGVLLNFEDTNGKVWRF  500
             KAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+  +         KGVLLNFED  GKVWRF
Sbjct  215   KAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSAATLTVSASTACKGVLLNFEDVGGKVWRF  274

Query  499   RYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR---NGTGSP  329
             RYSYWNSSQSYVLTKGWSRFVKEK+L AGDIVSF RSTGP+KQL+IDWKAR   N T + 
Sbjct  275   RYSYWNSSQSYVLTKGWSRFVKEKNLMAGDIVSFQRSTGPDKQLYIDWKARMSVNNTNNN  334

Query  328   DISTVPVHPVQVFRLFGVNISK---STVSPMAMAMDTTNNISSCSG--GKRIREVVMEFL  164
               S V V PV + RLFGVNI K   S+    A A         C+   GKR+RE  ME L
Sbjct  335   GSSPVQVGPVPMVRLFGVNIFKIPGSSGPGSADAAAAAAIGGGCNNNIGKRMRE--MELL  392

Query  163   PLECSKKQRVIDAL  122
              LE  KK R+I AL
Sbjct  393   ELEFGKKPRIIGAL  406



>ref|XP_008446558.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Cucumis melo]
Length=344

 Score =   426 bits (1095),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 229/353 (65%), Positives = 269/353 (76%), Gaps = 34/353 (10%)
 Frame = -3

Query  1144  TKSP---ESLCRMGSGA-SVIIDAEN---GVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             +KSP    SLCR+GSG  SV++D+++   GVEAES RKLPSSR+KGVVPQPNGRWGAQIY
Sbjct  14    SKSPPPDNSLCRVGSGVTSVVLDSDSSGGGVEAES-RKLPSSRYKGVVPQPNGRWGAQIY  72

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKPL   T G   +DD  + FL+S
Sbjct  73    EKHQRVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPL---THGGGEEDDIVSAFLNS  129

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRK----PEADRSAKSRERLFEKAVTP  638
             HSKAEIVDMLRKHTY DEL QS+R   ++     R        D    +RE LFEKAVTP
Sbjct  130   HSKAEIVDMLRKHTYLDELHQSKRNAGLSGSDRKRNRLLSGSDDEPETARELLFEKAVTP  189

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAV-TSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVL  461
             SDVGKLNRLVIPKQ AEK+FPLQ G+  +SKG+LLNFED  GKVWRFRYSYWNSSQSYVL
Sbjct  190   SDVGKLNRLVIPKQHAEKNFPLQTGSTASSKGLLLNFEDGGGKVWRFRYSYWNSSQSYVL  249

Query  460   TKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLF  281
             TKGWSRFVKEK+LKAGDIVSF +STG +KQL+I+WKAR  + +   +   ++PVQ FRLF
Sbjct  250   TKGWSRFVKEKNLKAGDIVSFLKSTGQDKQLYIEWKARKASTT---TGSAINPVQTFRLF  306

Query  280   GVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             GV+I K++ +            S CS  KR RE  +EFL L+C+KKQR++ AL
Sbjct  307   GVDIIKASPN------------SGCS-EKRRRE--LEFLTLQCTKKQRIVGAL  344



>ref|XP_008243173.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Prunus mume]
Length=417

 Score =   427 bits (1098),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 247/392 (63%), Positives = 280/392 (71%), Gaps = 51/392 (13%)
 Frame = -3

Query  1162  ALNLPATKSP--ESLCRMGSGAS-VIIDAE-----NGVEAESGRKLPSSRFKGVVPQPNG  1007
             A++  A  SP  +SLCR+GSGAS VI+D+E      G+EAES RKLPSS++KGVVPQPNG
Sbjct  32    AMSPIAKSSPHADSLCRLGSGASSVILDSEISSGGVGIEAES-RKLPSSKYKGVVPQPNG  90

Query  1006  RWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGD--D  833
             RWGAQIYEKHQRVWLGTFNEE+EAA+ YD+AAQRFRGRDAVTNFKP S T  G + D  D
Sbjct  91    RWGAQIYEKHQRVWLGTFNEEDEAAKAYDVAAQRFRGRDAVTNFKP-SPTGTGTDDDESD  149

Query  832   DYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRA----FNINNMTT----PRKP-EADRS  680
             D EA FL++HSK+EIVDMLRKHTY DELEQS+R      + N        P  P  +DR 
Sbjct  150   DVEAAFLNTHSKSEIVDMLRKHTYNDELEQSKRNNYGFLDANGKRARAHGPLGPFGSDRV  209

Query  679   AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNG-------------AVTSKGVL  539
              K+RE+LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G                 KGVL
Sbjct  210   PKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGNNFNNHTTTSTSGGSACKGVL  269

Query  538   LNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFID  359
             LNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+LKAGDIVSF RSTG +KQL+ID
Sbjct  270   LNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGQDKQLYID  329

Query  358   WKAR---NGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTT----------NN  218
             WK R   N   S  + +VPV PVQ+ RLFGVNI K   S     +D            NN
Sbjct  330   WKPRMNVNNNNSSGVGSVPVQPVQMVRLFGVNIFKIPGSGGGAVVDAATAAIGGGSCNNN  389

Query  217   ISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             I++   GKR+RE  ME L LE SKK R+I AL
Sbjct  390   INNV--GKRMRE--MELLELEFSKKPRIIGAL  417



>ref|XP_004135113.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Cucumis sativus]
 ref|XP_004171558.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Cucumis sativus]
 gb|KGN52050.1| DNA-binding protein RAV1 [Cucumis sativus]
Length=344

 Score =   424 bits (1091),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 236/356 (66%), Positives = 271/356 (76%), Gaps = 40/356 (11%)
 Frame = -3

Query  1144  TKSP---ESLCRMGSGA-SVIIDAEN---GVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             +KSP    SLCR+GSG  SV++D+++   GVEAES RKLPSSR+KGVVPQPNGRWGAQIY
Sbjct  14    SKSPPPDTSLCRVGSGVTSVVLDSDSSGGGVEAES-RKLPSSRYKGVVPQPNGRWGAQIY  72

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKPL   T G   +DD  + FL+S
Sbjct  73    EKHQRVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPL---THGGGEEDDIVSAFLNS  129

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKP------EADRSAKSRERLFEKAV  644
             HSKAEIVDMLRKHTY DEL QS+R   ++   + RK         D    +RE LFEKAV
Sbjct  130   HSKAEIVDMLRKHTYLDELHQSKRNAGLSG--SDRKQNRFLSGSDDDPETARELLFEKAV  187

Query  643   TPSDVGKLNRLVIPKQQAEKHFPLQNGAV-TSKGVLLNFEDTNGKVWRFRYSYWNSSQSY  467
             TPSDVGKLNRLVIPKQ AEK+FPLQ G+  +SKG+LLNFED  GKVWRFRYSYWNSSQSY
Sbjct  188   TPSDVGKLNRLVIPKQHAEKNFPLQTGSTASSKGLLLNFEDGGGKVWRFRYSYWNSSQSY  247

Query  466   VLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST-VPVHPVQVF  290
             VLTKGWSRFVKEK+LKAGDIVSF +STG +KQL+I+WKAR     P  +T   ++PVQ F
Sbjct  248   VLTKGWSRFVKEKNLKAGDIVSFLKSTGQDKQLYIEWKARK----PSTTTGSAINPVQTF  303

Query  289   RLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             RLFGV+I K  VSP           S CS  KR RE  +EFL L+C+KKQRV+ AL
Sbjct  304   RLFGVDIIK--VSPN----------SGCS-EKRRRE--LEFLTLQCTKKQRVVGAL  344



>gb|ADE41129.1| AP2 domain class transcription factor [Malus domestica]
Length=406

 Score =   426 bits (1096),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 240/374 (64%), Positives = 267/374 (71%), Gaps = 45/374 (12%)
 Frame = -3

Query  1129  SLCRMGSGAS-VIIDAE-------NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             SLCR+GSGAS VI+D E        GVEAES RKLPSSR+KGVVPQPNGRWGAQIYEKHQ
Sbjct  40    SLCRIGSGASSVILDPELSSSGGTGGVEAES-RKLPSSRYKGVVPQPNGRWGAQIYEKHQ  98

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE--TTDGRNGDDDYEAVFLSSHS  800
             RVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKP S    +     +DD EA FLS HS
Sbjct  99    RVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPSSAEPISSDDEENDDAEAAFLSCHS  158

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS-----------AKSRERLFE  653
             K+EIVDMLRKHTY DELEQS+R    NN    ++  ++ S            K+RE+LFE
Sbjct  159   KSEIVDMLRKHTYNDELEQSKR----NNSAYGKRSRSNGSLGLFGTDNSGVPKAREQLFE  214

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTS---------KGVLLNFEDTNGKVWRF  500
             KAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+  +         KGVLLNFED  GKVWRF
Sbjct  215   KAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSAATLTVSASTACKGVLLNFEDVGGKVWRF  274

Query  499   RYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR---NGTGSP  329
             RYSYWNSSQSYVLTKGWSRFVKEK+L AGDIVSF RSTGP+KQL+IDWKAR   N T + 
Sbjct  275   RYSYWNSSQSYVLTKGWSRFVKEKNLMAGDIVSFQRSTGPDKQLYIDWKARMSVNNTNNN  334

Query  328   DISTVPVHPVQVFRLFGVNISK---STVSPMAMAMDTTNNISSCSG--GKRIREVVMEFL  164
               S V V PV + RLFGVNI K   S+    A A         C+   GKR+RE  ME L
Sbjct  335   GSSPVQVGPVPMVRLFGVNIFKIPGSSGPGSADAAAAAAIGGGCNNNIGKRMRE--MELL  392

Query  163   PLECSKKQRVIDAL  122
              LE  KK R+I AL
Sbjct  393   ELEFGKKPRIIGAL  406



>ref|XP_009356262.1| PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and B3 domain-containing 
transcription factor RAV1-like [Pyrus x bretschneideri]
Length=413

 Score =   426 bits (1096),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 240/385 (62%), Positives = 270/385 (70%), Gaps = 58/385 (15%)
 Frame = -3

Query  1132  ESLCRMGSGAS-VIIDAE-------NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
             +SLCR+GSGAS VI+D++        GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKH
Sbjct  39    DSLCRVGSGASSVILDSDLSSSGGTGGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKH  97

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE----TTDGRNGDDDYEAVFLS  809
             QRVWLGTFNEE+EAAR YD+AAQRFRGRDAVTN KP S     + D  N  DD EAVFLS
Sbjct  98    QRVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNLKPSSAEPIFSDDEEN--DDVEAVFLS  155

Query  808   SHSKAEIVDMLRKHTYTDELEQSRRAFNI-------NNMTTPRKPEADRSAKSRERLFEK  650
             SHSK+EIVDMLRKHTY DELEQS+R +         N        +  R  K+RE+LFEK
Sbjct  156   SHSKSEIVDMLRKHTYNDELEQSKRNYCAYGKRGRSNGPLGLFGMDNSRVQKAREQLFEK  215

Query  649   AVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTS---------KGVLLNFEDTNGKVWRFR  497
             AVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+  +         KGVLLNFED  GKVWRFR
Sbjct  216   AVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTATVTVSASSACKGVLLNFEDVGGKVWRFR  275

Query  496   YSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST  317
             YSYWNSSQSYVLTKGWSRFVKEK+LKAGDIVSF RSTGP+KQL+IDWK R    +    +
Sbjct  276   YSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGPDKQLYIDWKTRMSVNNNSNGS  335

Query  316   VPVH----PVQVFRLFGVNISK----------STVSPM------AMAMDTTNNISSCSGG  197
              PV     PVQ+ RLFGVNI K             +P+      A+     NNI     G
Sbjct  336   NPVQGQVAPVQMVRLFGVNIFKIPGSVGAGPVDAAAPLXXXPAAAIGGGCNNNI-----G  390

Query  196   KRIREVVMEFLPLECSKKQRVIDAL  122
             KR+RE  ME L LE SKK R+I AL
Sbjct  391   KRMRE--MELLKLEFSKKPRIIGAL  413



>ref|XP_008339704.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Malus domestica]
Length=401

 Score =   425 bits (1093),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 235/370 (64%), Positives = 267/370 (72%), Gaps = 40/370 (11%)
 Frame = -3

Query  1132  ESLCRMGSGAS-VIIDAE-------NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
             +SLCR+GSGAS VI+D++        GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKH
Sbjct  39    DSLCRVGSGASSVILDSDLSSGGGTGGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKH  97

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSK  797
             QRVWLGTFNEE+EAA  YD+AAQRFRGRDAVTNFKP S+  +    +D  EA FLSSHSK
Sbjct  98    QRVWLGTFNEEDEAATAYDVAAQRFRGRDAVTNFKPSSDDEE----NDXVEAAFLSSHSK  153

Query  796   AEIVDMLRKHTYTDELEQSRR-AFNINNMTTPRKP------EADRSAKSRERLFEKAVTP  638
             +EIVDMLRKHTY DELEQS+R  F+         P      +  R  K+RE+LFEKAVTP
Sbjct  154   SEIVDMLRKHTYNDELEQSKRNYFSYGKRGXSNGPLGLFGTDNSRVQKAREQLFEKAVTP  213

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTS---------KGVLLNFEDTNGKVWRFRYSYW  485
             SDVGKLNRLVIPKQ AEKHFPLQ+G+  +         KGVLLNFED  GKVWRFRYSYW
Sbjct  214   SDVGKLNRLVIPKQHAEKHFPLQSGSTATITVSASSACKGVLLNFEDVGGKVWRFRYSYW  273

Query  484   NSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVH  305
             NSSQSYVLTKGWSRFVKEK+LKAGDIVSF RSTGP+K L+IDWK R    +    + PV 
Sbjct  274   NSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGPDKHLYIDWKTRMSVYNNSNGSNPVQ  333

Query  304   ----PVQVFRLFGVNISK---STVSPMAMAMDTTNNISSCSG--GKRIREVVMEFLPLEC  152
                 PVQ+ RLFGVNI K   S+ +    A         C+   GKR+RE  MEFL LE 
Sbjct  334   GQXAPVQMVRLFGVNIFKIPGSSGAGPVDAAAAAAIGGGCNNNIGKRMRE--MEFLKLEF  391

Query  151   SKKQRVIDAL  122
             SKK R+I AL
Sbjct  392   SKKPRIIGAL  401



>gb|EYU29942.1| hypothetical protein MIMGU_mgv1a009431mg [Erythranthe guttata]
Length=342

 Score =   422 bits (1084),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 231/358 (65%), Positives = 258/358 (72%), Gaps = 50/358 (14%)
 Frame = -3

Query  1153  LPATKSP-ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
             + A+KSP ESLCR+GSGAS I DAENGVEAES RKLPSSRFKGVVPQPNGRWGAQIYEKH
Sbjct  21    VAASKSPPESLCRVGSGASAITDAENGVEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKH  79

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSK  797
             QR                     RFRGRDAVTNFKPLSET +     D  E  FL++HSK
Sbjct  80    QR---------------------RFRGRDAVTNFKPLSETQE-----DGVETAFLNTHSK  113

Query  796   AEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPE-------ADRSAKSRERLFEKAVTP  638
             AEIVDMLRKHTY DELEQSRR++N N   T             DR+AK+RE+LFEKAVTP
Sbjct  114   AEIVDMLRKHTYGDELEQSRRSYNSNGRRTAEDGPFGFSGRGGDRAAKAREQLFEKAVTP  173

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             SDVGKLNRLVIPKQ AE+HFPLQ+G+ TSKGVLLNFED  GKVWRFRYSYWNSSQSYVLT
Sbjct  174   SDVGKLNRLVIPKQHAERHFPLQSGS-TSKGVLLNFEDAGGKVWRFRYSYWNSSQSYVLT  232

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVP------VHPVQ  296
             KGWSRFVKEK L+AGDIVSF RST P+ QL+IDWK+RN     + +           PV 
Sbjct  233   KGWSRFVKEKGLRAGDIVSFQRSTAPDNQLYIDWKSRNINNGSNAAAAVVAVSGRAQPVV  292

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             + RLFGVNI ++  S  A+     +   SCS GKR+RE  ME L L+CSKKQRVI AL
Sbjct  293   MVRLFGVNIFEAAPSDAAI-----DGYGSCS-GKRMRE--MELLGLDCSKKQRVIGAL  342



>ref|XP_010044293.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Eucalyptus grandis]
 gb|KCW86364.1| hypothetical protein EUGRSUZ_B03048 [Eucalyptus grandis]
Length=364

 Score =   422 bits (1085),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 231/346 (67%), Positives = 255/346 (74%), Gaps = 30/346 (9%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  947
             LCR GSG SVI+D+E  VEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFNE
Sbjct  38    LCRHGSGTSVIVDSEGCVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  96

Query  946   EEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKH  767
             E+EAA  YD+AAQRFRG DAVTNFK  SE  D      D EA FLS+HSK EIVDMLRKH
Sbjct  97    EDEAAMAYDVAAQRFRGGDAVTNFKRKSEAED-----YDLEAAFLSAHSKPEIVDMLRKH  151

Query  766   TYTDELEQSRRAFNINNMTTPRKPE----ADRS-----AKSRERLFEKAVTPSDVGKLNR  614
             TY DELEQS+R    +N    R        D S     A  R+ LFEKAVTPSDVGKLNR
Sbjct  152   TYRDELEQSKRKCLNSNGGGKRASMTEVLGDLSSPGGIAMVRQLLFEKAVTPSDVGKLNR  211

Query  613   LVIPKQQAEKHFPLQNG--AVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             LVIPKQ AEKHFPL+NG  + TSKGVLLNFED+ GKVWRFRYSYWNSSQSYVLT+GWSRF
Sbjct  212   LVIPKQHAEKHFPLRNGTSSATSKGVLLNFEDSGGKVWRFRYSYWNSSQSYVLTRGWSRF  271

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKS  260
             VKEK L AGDIVSFH+S GPEKQL I ++ R+  G     + PV PVQ+ RLFGVNI K 
Sbjct  272   VKEKGLTAGDIVSFHQSAGPEKQLHIGYRRRSSLG----GSGPVLPVQMVRLFGVNIFKV  327

Query  259   TVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             +    A   D T + S    GKR+REV  E L L C+KKQ VI AL
Sbjct  328   SA---AGGGDDTGDWS----GKRMREV--ELLSLGCNKKQMVIGAL  364



>ref|XP_009789826.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Nicotiana sylvestris]
Length=362

 Score =   422 bits (1084),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 225/350 (64%), Positives = 262/350 (75%), Gaps = 30/350 (9%)
 Frame = -3

Query  1126  LCRMGSGAS-VIIDAE--NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             L RMGSG S VIIDAE    +EAES +KL SSRFKGVVPQPNGRWGAQIYEKHQR+WLGT
Sbjct  28    LSRMGSGTSCVIIDAELNCTIEAESNKKLASSRFKGVVPQPNGRWGAQIYEKHQRIWLGT  87

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FN+E+EAA+ YDIAAQRFRG+DAVTNFKPL ++        + E  FL++ SKAEIVDML
Sbjct  88    FNDEDEAAKAYDIAAQRFRGKDAVTNFKPLCDSDKV-----EIEISFLNARSKAEIVDML  142

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPE--------ADRSAKSRERLFEKAVTPSDVGKL  620
             RKHTY DELE S++ ++ +     R  E         +  +K+RE +FEKAVTPSDVGKL
Sbjct  143   RKHTYNDELEHSKKVYSFDK-NDKRGCENALVNSFDVENMSKARELMFEKAVTPSDVGKL  201

Query  619   NRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             NRLVIPKQ AE++FPL+N    SKG+LLN ED NGKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  202   NRLVIPKQHAERYFPLEN---NSKGMLLNLEDMNGKVWRFRYSYWNSSQSYVLTKGWSRF  258

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR-NGTGSP--DISTVPVHPVQVFRLFGVNI  269
             VKEK+LKAGDIV F RS G +K+L+ID KAR + T +P  D   V V PV++ RLFGVNI
Sbjct  259   VKEKNLKAGDIVCFGRSNGVDKKLYIDLKARISSTITPILDKIQVQVQPVKMVRLFGVNI  318

Query  268   SK-STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              K   V+ + +     NN+SSCSGGKR RE  ME L  EC KKQRVID L
Sbjct  319   CKVQDVNNIVVE----NNMSSCSGGKRTRE--MELLAFECRKKQRVIDVL  362



>ref|XP_004514325.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Cicer arietinum]
Length=382

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 226/359 (63%), Positives = 253/359 (70%), Gaps = 30/359 (8%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGV--EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWL  962
             P SLCR+GSGAS ++D++ G   EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWL
Sbjct  33    PNSLCRVGSGASAVVDSDGGGVGEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWL  91

Query  961   GTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVD  782
             GTFN+E+EAA+ YD+AAQRFRG+DAVTNFKPLS      N DDD EA FL+SHSK+EIVD
Sbjct  92    GTFNQEDEAAKAYDVAAQRFRGKDAVTNFKPLSGDD---NNDDDMEAEFLNSHSKSEIVD  148

Query  781   MLRKHTYTDELEQS--------RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVG  626
             MLRKHTY DELEQS        RR      +T      +    K+RE LFEKAVTPSDVG
Sbjct  149   MLRKHTYNDELEQSKHSRGFVARRHGCAGGVTFAGLATSACVKKAREALFEKAVTPSDVG  208

Query  625   KLNRLVIPKQQAEKHFPLQ-------NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSY  467
             KLNRLVIPKQ AEKHFPLQ         A   KGVLLNFED  GKVWRFRYSYWNSSQSY
Sbjct  209   KLNRLVIPKQHAEKHFPLQKSVDCGVGSASAGKGVLLNFEDVGGKVWRFRYSYWNSSQSY  268

Query  466   VLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVP----VHPV  299
             VLTKGWSRFVKEK+LKAGD V FHRSTGP+KQLFIDWK R       +  VP    V P+
Sbjct  269   VLTKGWSRFVKEKNLKAGDTVCFHRSTGPDKQLFIDWKDRKNVNEVGL-FVPVGPVVEPI  327

Query  298   QVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             Q+ RLFGVNI K   S              C+G +R     ME   L+C KK ++I AL
Sbjct  328   QMVRLFGVNILKLPGSDANNNNGNAIAAVFCNGKRR----EMEMFNLDCCKKPKIIGAL  382



>ref|XP_003518682.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Glycine max]
Length=401

 Score =   422 bits (1084),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 230/362 (64%), Positives = 257/362 (71%), Gaps = 38/362 (10%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAE---NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             LCR+GSGAS ++D +   +G E ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  51    LCRVGSGASAVVDPDGGGSGAEVES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGT  109

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FNEE+EAAR YDIAAQRFRG+DAVTNFKPL+   D     DD E+ FL+SHSK EIVDML
Sbjct  110   FNEEDEAARAYDIAAQRFRGKDAVTNFKPLAGADD-----DDGESEFLNSHSKPEIVDML  164

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPEADRS------AKSRERLFEKAVTPSDVGKLNR  614
             RKHTY DELEQS+R+  +             S       K+RE+LFEKAVTPSDVGKLNR
Sbjct  165   RKHTYNDELEQSKRSRGVVRRRGSAAAGTANSISGACFTKAREQLFEKAVTPSDVGKLNR  224

Query  613   LVIPKQQAEKHFPLQ--NGA------------VTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             LVIPKQ AEKHFPLQ  NG               +KGVLLNFED  GKVWRFRYSYWNSS
Sbjct  225   LVIPKQHAEKHFPLQSSNGVSATTIAAVTATPTAAKGVLLNFEDVGGKVWRFRYSYWNSS  284

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVP----V  308
             QSYVLTKGWSRFVKEK+LKAGD V FHRSTGP+KQL+IDWK RN   +      P    V
Sbjct  285   QSYVLTKGWSRFVKEKNLKAGDTVCFHRSTGPDKQLYIDWKTRNVVNNEVALFGPVGPVV  344

Query  307   HPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVID  128
              P+Q+ RLFGVNI K   S   +     NN S C  GKR RE  ME   LECSKK ++I 
Sbjct  345   EPIQMVRLFGVNILKLPGSDTIVG--NNNNASGCCNGKR-RE--MELFSLECSKKPKIIG  399

Query  127   AL  122
             AL
Sbjct  400   AL  401



>gb|AID51427.1| ethylene response factor 22 [Diospyros kaki]
Length=339

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 255/351 (73%), Gaps = 40/351 (11%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQR  971
             PATKSPESL          +D++ G E ES  KLPSSRFKGVVPQPNGRWGAQIYEKHQR
Sbjct  21    PATKSPESL----------VDSDGGGEVESRGKLPSSRFKGVVPQPNGRWGAQIYEKHQR  70

Query  970   VWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAE  791
             VWLGTFNEEEEAAR YD+AAQRFRGRDAVTN + L+   D     D+ EA FLSSHSKAE
Sbjct  71    VWLGTFNEEEEAARAYDVAAQRFRGRDAVTNLRLLAAEGDA----DEAEAAFLSSHSKAE  126

Query  790   IVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS----AKSRERLFEKAVTPSDVGK  623
             IVDMLRKHTY DEL+QSRR F I+N    +K   D++      + E+LFEK VTPSDVGK
Sbjct  127   IVDMLRKHTYNDELQQSRRTFCIDN--NGKKVNKDKTVTEIGTASEQLFEKNVTPSDVGK  184

Query  622   LNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             LNRLVIPKQ AE+HFPLQ G   SKG+LLNF+D  GKVWRFRYSYWNSSQSYVLTKGWSR
Sbjct  185   LNRLVIPKQYAERHFPLQIGG-NSKGLLLNFKDVAGKVWRFRYSYWNSSQSYVLTKGWSR  243

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVH----PVQVFRLFGV  275
             FVKEK+LKAGD+VSFHRSTG EKQL+I  K R  +     S +P      PVQ+ RLFGV
Sbjct  244   FVKEKNLKAGDVVSFHRSTGAEKQLYIACKPRAESAVARFS-IPASQVQAPVQILRLFGV  302

Query  274   NISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             +I K  V  ++  +D          GKR RE  ME L LECSKK R+I AL
Sbjct  303   DIFK--VPAVSCVVD----------GKRSRE--MELLALECSKKPRIIGAL  339



>ref|XP_010528045.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Tarenaya hassleriana]
Length=364

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 263/360 (73%), Gaps = 43/360 (12%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQR  971
             PA KSPE L RMGSG+SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQR
Sbjct  29    PARKSPEKLYRMGSGSSVVLDSENGVEFES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQR  87

Query  970   VWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAE  791
             VWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFK      + R  DD  E  FL++HSK+E
Sbjct  88    VWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFK------NARLDDD--EVAFLNAHSKSE  139

Query  790   IVDMLRKHTYTDELEQSRRAF-----NIN-------NMTTPRKPEADRSA-----KSRER  662
             IVDMLRKHTY +ELEQS+R       N N       N  +P   + +        +S E 
Sbjct  140   IVDMLRKHTYNEELEQSKRRSRSRYGNSNGNDDRNGNGKSPGTGDGNDGVSGTEFRSAEA  199

Query  661   LFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWN  482
             LFEKAVTPSDVGKLNRLVIPK  AEKHFPL +G V+ KGVLLNFED  GKVWRFRYSYWN
Sbjct  200   LFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSGNVSVKGVLLNFEDVTGKVWRFRYSYWN  259

Query  481   SSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHP  302
             SSQSYVLTKGWSRFVKEK+LKAGD+VSF RS G ++QL+I WKAR+    PD       P
Sbjct  260   SSQSYVLTKGWSRFVKEKNLKAGDVVSFSRSNGQDQQLYIGWKARS---DPD-----SEP  311

Query  301   VQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGG-KRIREVVMEFLPLECSKKQRVIDA  125
              +V +LFGVNIS STV       D +N++ + SGG KR REV    L L C KKQRV  A
Sbjct  312   GRVVKLFGVNIS-STV-------DCSNDVVARSGGQKRAREVEETMLSLGCCKKQRVFVA  363



>ref|XP_008791228.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Phoenix dactylifera]
Length=363

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 244/340 (72%), Gaps = 26/340 (8%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             PESL R+GSGASV++D E G+EAES RKLPSS FKGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  21    PESLQRVGSGASVVLDPEVGIEAES-RKLPSSHFKGVVPQPNGRWGAQIYEKHQRVWLGT  79

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FNEE EAAR YD+AAQRFRGRDAVTNFKPLSET D     D  E  FL+SHSKAEIVDML
Sbjct  80    FNEESEAARAYDVAAQRFRGRDAVTNFKPLSETDDA----DAAELSFLASHSKAEIVDML  135

Query  775   RKHTYTDELEQSRRAFNINNMTTP------------RKPEADRSAKSRERLFEKAVTPSD  632
             RKHTY DE+ QS+RAF       P            R   A      RE LF+KA+TPSD
Sbjct  136   RKHTYDDEVRQSKRAFGAGRRNMPAGSGGGGGGLGARFLAASGGGAQREHLFDKALTPSD  195

Query  631   VGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKG  452
             VGKLNRLVIPKQ AEKHFPLQ  +   KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKG
Sbjct  196   VGKLNRLVIPKQHAEKHFPLQIRSAACKGVLLNFEDACGKVWRFRYSYWNSSQSYVLTKG  255

Query  451   WSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVN  272
             WSRFVKEKSLKAGD ++FHRSTGP+KQLFIDWK     G  +       PVQ  RLFGVN
Sbjct  256   WSRFVKEKSLKAGDAITFHRSTGPDKQLFIDWKPPAVGGHAE-----ARPVQGIRLFGVN  310

Query  271   ISKSTVSPMAMAMDTTNN---ISSCSGGKRIREVVMEFLP  161
             + K+    +  A    N    +  CS  K IR++  + +P
Sbjct  311   LLKTPAVKVGGAGLDGNGRVYVVGCS-TKGIRDMDHQSMP  349



>ref|XP_007154354.1| hypothetical protein PHAVU_003G111800g [Phaseolus vulgaris]
 gb|ESW26348.1| hypothetical protein PHAVU_003G111800g [Phaseolus vulgaris]
Length=387

 Score =   417 bits (1073),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 233/364 (64%), Positives = 261/364 (72%), Gaps = 28/364 (8%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSGASVIIDAENG--VEAESGRKLPSSRFKGVVPQPNGRWGAQIYE  983
             NL       +LCR+GSGAS I+D +     EAES RKLPSS++KGVVPQPNGRWGAQIYE
Sbjct  33    NLSPPPPSNTLCRVGSGASAIVDPDGAGNTEAES-RKLPSSKYKGVVPQPNGRWGAQIYE  91

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             KHQRVWLGTFNEE+EAAR YDIAAQRFRG+DAVTNFKP+S      +   D EA FL+SH
Sbjct  92    KHQRVWLGTFNEEDEAARAYDIAAQRFRGKDAVTNFKPVSGGDGDDD---DGEAEFLNSH  148

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNINNMT-------TPRKPEADRSAKSRERLFEKAV  644
             SK+EIVDMLRKHTY DELEQS+R+  +           T          K+RE+LFEKAV
Sbjct  149   SKSEIVDMLRKHTYNDELEQSKRSRGVVRRRGGAAGAGTGNSISGACFVKAREQLFEKAV  208

Query  643   TPSDVGKLNRLVIPKQQAEKHFPLQ--NG--AVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             TPSDVGKLNRLVIPKQ AEKHFPLQ  NG  A  +KGVLLNFED  GKVWRFRYSYWNSS
Sbjct  209   TPSDVGKLNRLVIPKQHAEKHFPLQSVNGVSATAAKGVLLNFEDVGGKVWRFRYSYWNSS  268

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARN------GTGSPDISTV  314
             QSYVLTKGWSRFVKEK+LKAGD V FHRSTGP+KQL+IDWKARN      G   P +  V
Sbjct  269   QSYVLTKGWSRFVKEKNLKAGDTVCFHRSTGPDKQLYIDWKARNNSVNEVGLFGP-VGPV  327

Query  313   PVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRV  134
              V P+Q+ RLFGVNI K   S      + +  I     GKR RE  ME   LECSKK ++
Sbjct  328   -VEPIQMVRLFGVNILKLPGSEANNNNNASATIPGFCNGKR-RE--MELFSLECSKKPKI  383

Query  133   IDAL  122
             I AL
Sbjct  384   IGAL  387



>ref|XP_010923453.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Elaeis guineensis]
Length=367

 Score =   415 bits (1066),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/357 (62%), Positives = 248/357 (69%), Gaps = 30/357 (8%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             PESL R+GSGASV++D E GVEAES RKLPSS FKGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  22    PESLQRVGSGASVVLDPEVGVEAES-RKLPSSHFKGVVPQPNGRWGAQIYEKHQRVWLGT  80

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FNEE EAAR YD+AAQRFRGRDAVTNFKP SET D    DD  E  FL+SHSKAEIVDML
Sbjct  81    FNEESEAARAYDVAAQRFRGRDAVTNFKPFSETDD----DDAAELSFLASHSKAEIVDML  136

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPEADR---------------SAKSRERLFEKAVT  641
             RKHTY DE+ QS+RAF     +  R   A                     RE LF+KA+T
Sbjct  137   RKHTYHDEVRQSKRAFGAGKGSDRRSMPAGGYGGGLGLRFLAGSGGGGAQREHLFDKALT  196

Query  640   PSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVL  461
             PSDVGKLNRLVIPKQ AEKHFP+Q      KGVLLNFED+ GKVWRFRYSYWNSSQSYVL
Sbjct  197   PSDVGKLNRLVIPKQHAEKHFPIQIAGAAGKGVLLNFEDSCGKVWRFRYSYWNSSQSYVL  256

Query  460   TKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLF  281
             TKGWSRFVKEKSLKAGD+V+F RSTG +KQLFIDWK R   G  +       PVQ  RLF
Sbjct  257   TKGWSRFVKEKSLKAGDVVTFQRSTGQDKQLFIDWKPRAAGGCAE-----ARPVQGIRLF  311

Query  280   GVNISK----STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             GVN+ K    +            +++  CS  K IR +  + +P     K++  +AL
Sbjct  312   GVNLFKIPAVAVGGAGLDGNGGVDHVVGCS-RKGIRGMDHQLMPSPQQFKKQKTEAL  367



>ref|XP_010681667.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Beta vulgaris subsp. vulgaris]
Length=399

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 237/388 (61%), Positives = 268/388 (69%), Gaps = 61/388 (16%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             ++ L   A+ +  SLCRMGSG SVIID+ENG+EAES RKLPSS++KGVVPQPNGRWGAQI
Sbjct  34    SAPLPTKASATAGSLCRMGSGTSVIIDSENGIEAES-RKLPSSKYKGVVPQPNGRWGAQI  92

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAV---  818
             YEKHQRVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKPLS        +D+  A    
Sbjct  93    YEKHQRVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPLSS-------EDELGAAELR  145

Query  817   FLSSHSKAEIVDMLRKHTYTDELEQSRRAFN---INNMTTP--RKPEADRSAKS------  671
             FL+S SKAE+VDMLRKHTY DEL+QSRR F     NN          +D+S  S      
Sbjct  146   FLNSRSKAEVVDMLRKHTYLDELQQSRRNFKGDVCNNFGEKGLLHSSSDKSKLSGNNNEG  205

Query  670   ---RERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT------------------  554
                RE+LFEK VTPSDVGKLNRLVIPKQ AEKHFPLQ    T                  
Sbjct  206   GFGREQLFEKVVTPSDVGKLNRLVIPKQHAEKHFPLQGSNSTTTTTTTTSNTTNTLVGSG  265

Query  553   SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEK  374
             SKGVLLNFED N KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF RSTGP++
Sbjct  266   SKGVLLNFEDVNQKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFQRSTGPDR  325

Query  373   QLFIDWKARNGTGSPDISTVPVH---PVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCS  203
             QL+ID+K R    S  +   PV      Q+ RLFGV+I K    P+++A  T N      
Sbjct  326   QLYIDYKQR----SISVECTPVDVRAAGQMIRLFGVDICK---LPISVAEVTVN-----V  373

Query  202   GGKRIREVVMEFLPLE-CSKKQRVIDAL  122
              GKR+RE  ME L +E  SKKQ V+ AL
Sbjct  374   NGKRLRE--MELLAMESSSKKQMVVAAL  399



>ref|XP_009400502.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=363

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 250/340 (74%), Gaps = 22/340 (6%)
 Frame = -3

Query  1132  ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTF  953
             + L R+GSGASV+++ E  +EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF
Sbjct  31    KGLRRLGSGASVVLEPEISIEAES-RKLPSSQYKGVVPQPNGRWGAQIYEKHQRVWLGTF  89

Query  952   NEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             NEE+EAAR YD+AAQRFRGRDAVTNFKPL ET D    +D  E  FL+SHSKAEIVDMLR
Sbjct  90    NEEDEAARAYDVAAQRFRGRDAVTNFKPLVETRD----EDTAELSFLNSHSKAEIVDMLR  145

Query  772   KHTYTDELEQSRRAFNINNMTTPRKPEADR-------SAKSRERLFEKAVTPSDVGKLNR  614
             KHTY DEL+QS+R+   +     R+    R         + RE LF+KAVTPSDVGKLNR
Sbjct  146   KHTYLDELQQSKRSSGADK----RRNHPSRGGVTGWFGGEHREHLFDKAVTPSDVGKLNR  201

Query  613   LVIPKQQAEKHFPL-QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
             LVIPKQ AEKHFPL Q GA   KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  202   LVIPKQHAEKHFPLNQTGAAACKGVLLNFEDACGKVWRFRYSYWNSSQSYVLTKGWSRFV  261

Query  436   KEKSLKAGDIVSFHRSTGPEKQLFIDWKARN-GTGSPDISTVPVHPVQVFRLFGVNISKS  260
             KEK L+AGD+V+F RSTGPEKQLFI WK R  G  + D       PV+V RLFGVNI K 
Sbjct  262   KEKGLRAGDVVTFQRSTGPEKQLFIGWKTRTAGAHTADGVQATKPPVEVVRLFGVNIVK-  320

Query  259   TVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQ  140
                P A++ D ++        KR R++ +    LE  KKQ
Sbjct  321   --IPAAVSGDVSDRSGVGWAAKRTRDMDL-ISSLELFKKQ  357



>emb|CDX97996.1| BnaA06g07470D [Brassica napus]
Length=325

 Score =   407 bits (1046),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 248/343 (72%), Gaps = 40/343 (12%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             + + KS  +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  22    MTSAKSSVNLHRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  80

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK            DD E  FLSSHSKA
Sbjct  81    RVWLGTFNEEDEAARSYDVAVYRFRGRDAVTNFKEARL--------DDGEVEFLSSHSKA  132

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNR  614
             EIVDMLRKHTY++ELEQS+R  N N  T     EA         LFEKAVTPSDVGKLNR
Sbjct  133   EIVDMLRKHTYSEELEQSKRRRNGNGNTARTSAEA---------LFEKAVTPSDVGKLNR  183

Query  613   LVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVK  434
             LVIPK  AEKHFPL +  V+ KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVK
Sbjct  184   LVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVK  243

Query  433   EKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTV  254
             EK+L AGD+VSF RS G ++QL+I WK+R+G   PD+ T      +V RLFGVNIS  + 
Sbjct  244   EKNLLAGDVVSFSRSEGQDQQLYIGWKSRSG---PDVET-----GRVLRLFGVNISPES-  294

Query  253   SPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
                        + +   G KR+ +   E L L CSKKQR+  A
Sbjct  295   -----------SRTEVVGSKRVNDT--EMLSLVCSKKQRIFHA  324



>emb|CDY61361.1| BnaCnng37790D [Brassica napus]
Length=327

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 249/343 (73%), Gaps = 38/343 (11%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             + + KS  +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  22    MTSAKSSVNLHRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  80

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK            DD E  FLSSHSKA
Sbjct  81    RVWLGTFNEEDEAARSYDVAVYRFRGRDAVTNFKEARL--------DDGEVEFLSSHSKA  132

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNR  614
             EIVDMLRKHTY++ELEQS+R  N N  T        R+  S E LFEKAVTPSDVGKLNR
Sbjct  133   EIVDMLRKHTYSEELEQSKRRRNGNGNTA-------RTMTSAEALFEKAVTPSDVGKLNR  185

Query  613   LVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVK  434
             LVIPK  AEKHFPL +  V+ KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVK
Sbjct  186   LVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVK  245

Query  433   EKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTV  254
             EK+L AGD+VSF RS G ++QL+I WK+R+G   PD+ T      +V RLFGVNIS  + 
Sbjct  246   EKNLLAGDVVSFSRSEGQDQQLYIGWKSRSG---PDVET-----GRVLRLFGVNISPES-  296

Query  253   SPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
                        + +   G KR+ +   E L   CSKKQR+  A
Sbjct  297   -----------SRTEVVGSKRVNDT--EMLSSVCSKKQRIFHA  326



>gb|EPS68232.1| hypothetical protein M569_06539, partial [Genlisea aurea]
Length=330

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 218/323 (67%), Positives = 242/323 (75%), Gaps = 29/323 (9%)
 Frame = -3

Query  1072  EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGR  893
             E E  RKLPSS+FKGVVPQPNGRWG+QIYEKHQRVWLGTFNEEEEAAR YD AAQRFRGR
Sbjct  31    ETEESRKLPSSKFKGVVPQPNGRWGSQIYEKHQRVWLGTFNEEEEAARAYDTAAQRFRGR  90

Query  892   DAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRR-----AF  728
             DAVTNFKPLS         D+ E +FL+S SK EIVDMLRKHTY DELEQSR+      F
Sbjct  91    DAVTNFKPLSA--------DESEILFLNSRSKPEIVDMLRKHTYQDELEQSRKNSGGGGF  142

Query  727   NINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSK  548
               + +    +  AD     RE LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G+ T K
Sbjct  143   RGDFLAGGGRAAADH----REHLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSNT-K  197

Query  547   GVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQL  368
             GVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AGDIV+F RST P+KQL
Sbjct  198   GVLLNFEDMAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKDLRAGDIVTFQRSTAPDKQL  257

Query  367   FIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISK-STVSPMAMAMDTTNNISSCSGGKR  191
             +IDWK+RN   SP      V PVQV RLFGVNI +  T  P + A     +   C GGKR
Sbjct  258   YIDWKSRNDGLSP---AARVQPVQVVRLFGVNIFEVPTGGPTSAA--AVFDGGCCGGGKR  312

Query  190   IREVVMEFLPLECSKKQRVIDAL  122
             + E  MEF   +C+KKQR+I+AL
Sbjct  313   MTE--MEF---DCAKKQRIINAL  330



>ref|XP_010556384.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Tarenaya hassleriana]
Length=355

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 218/364 (60%), Positives = 255/364 (70%), Gaps = 38/364 (10%)
 Frame = -3

Query  1177  VAHASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWG  998
             V    A   PA KSPE  CR+GSG SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWG
Sbjct  16    VCTPPATRSPARKSPERFCRVGSGLSVVLDSENGVEFES-RKLPSSKYKGVVPQPNGRWG  74

Query  997   AQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAV  818
             AQIYEKHQRVWLGTF+EE+EAAR YD+AAQRFRGRDA+TNFK            DD E  
Sbjct  75    AQIYEKHQRVWLGTFSEEDEAARAYDVAAQRFRGRDAITNFKNARL--------DDAEVE  126

Query  817   FLSSHSKAEIVDMLRKHTYTDELEQSRRAFNI-------NNMTTPRKPEADRSAKSRE--  665
             FL++HSK+EIVDMLRKHTY +ELEQ++R           N     R  + +     +E  
Sbjct  127   FLNAHSKSEIVDMLRKHTYNEELEQNKRRLRSRYGNDERNENVKTRSGDGNDGVSGKEFR  186

Query  664   ---RLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRY  494
                 LFEK VTPSDVGKLNRLVIPK QAEKHFPL +  V++KGVLLNFED  GKVWRFRY
Sbjct  187   PAEALFEKTVTPSDVGKLNRLVIPKHQAEKHFPLPSCNVSAKGVLLNFEDITGKVWRFRY  246

Query  493   SYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTV  314
             SYWNSSQSYVLTKGWSRFVKEK L+AGD+V F RS G ++QL+I WKA +G+GS      
Sbjct  247   SYWNSSQSYVLTKGWSRFVKEKRLRAGDVVGFSRSNGHDQQLYIGWKAISGSGSDK----  302

Query  313   PVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGG-KRIREVVMEFLPLECSKKQR  137
                P +V RLFGVNISK          D  N+  +  GG KR+RE   E + L CSK+QR
Sbjct  303   --EPGRVVRLFGVNISKG---------DCLNDAVANGGGDKRVRE-AEEMISLGCSKRQR  350

Query  136   VIDA  125
             ++ A
Sbjct  351   ILVA  354



>ref|XP_006305243.1| hypothetical protein CARUB_v10009612mg [Capsella rubella]
 gb|EOA38141.1| hypothetical protein CARUB_v10009612mg [Capsella rubella]
Length=347

 Score =   407 bits (1046),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 216/343 (63%), Positives = 249/343 (73%), Gaps = 38/343 (11%)
 Frame = -3

Query  1129  SLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             +L RMGSG+SV++D+ENG+EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  34    NLYRMGSGSSVVLDSENGIEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  92

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EE+EAAR YD+A  RFRGRDAVTNFK      D R  DD+ E  FL+SHSK+EIVDMLRK
Sbjct  93    EEDEAARAYDVAVHRFRGRDAVTNFK------DVRMDDDEVE--FLNSHSKSEIVDMLRK  144

Query  769   HTYTDELEQSRRAFN-----INNMTTPRKPEADRSA---KSRERLFEKAVTPSDVGKLNR  614
             HTY +ELEQS+R  N     +  M T        S    +S E LFEKAVTPSDVGKLNR
Sbjct  145   HTYNEELEQSKRRRNGSGNTVRTMLTSGLSNDGASTTEFRSAEPLFEKAVTPSDVGKLNR  204

Query  613   LVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVK  434
             LVIPK  AEKHFPL + +V+ KGVLLNFED NGKVWRFRYSYWNSSQSYVLTKGWSRFVK
Sbjct  205   LVIPKHHAEKHFPLPSTSVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVK  264

Query  433   EKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTV  254
             EK+L+AGD+VSF RS G ++QL+I WK+R+G+         + P QV RLFGVNI     
Sbjct  265   EKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS--------DLEPGQVLRLFGVNI-----  311

Query  253   SPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             SP +   D   N  S +          E L L CSKKQR+  A
Sbjct  312   SPASSRNDVVGNKRSVND--------TEMLSLVCSKKQRIFHA  346



>ref|XP_009395563.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=359

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 215/329 (65%), Positives = 245/329 (74%), Gaps = 23/329 (7%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             P+SL R+GSGAS +ID E GVEAES RKLPSS +KGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  24    PKSLQRVGSGASDVIDPEVGVEAES-RKLPSSHYKGVVPQPNGRWGAQIYEKHQRVWLGT  82

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             FNEE EAA  YD+A QRFRGRDA+TNFKPL++  +G    D  E  FL SHSKAEIVDML
Sbjct  83    FNEEAEAACAYDVAVQRFRGRDAITNFKPLNDADNG----DAAELSFLDSHSKAEIVDML  138

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPEADRSA--------KSRERLFEKAVTPSDVGKL  620
             RKHTY DEL++SR +F +++  T     A RSA          R+ LF+KAVTPSDVGKL
Sbjct  139   RKHTYRDELQKSRLSFCLDSKKT-----APRSAPVTGLLVGAQRQHLFDKAVTPSDVGKL  193

Query  619   NRLVIPKQQAEKHFPLQN---GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGW  449
             NRLVIPKQ AEKHFPLQ     A   KGV+LNFED  GKVWRFRYSYWNSSQSYVLTKGW
Sbjct  194   NRLVIPKQHAEKHFPLQKTGAAAAAGKGVMLNFEDAYGKVWRFRYSYWNSSQSYVLTKGW  253

Query  448   SRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             SRFVKEK L+AGD+++FHRST PEKQLFID  AR G GS  ++     PVQV RLFG NI
Sbjct  254   SRFVKEKGLEAGDVITFHRSTDPEKQLFIDSTARAGRGSA-VAPTQRPPVQVVRLFGFNI  312

Query  268   SKSTVSPMAMAMDTTNNISSCSGGKRIRE  182
              ++  +P+        N +SC  GKR R+
Sbjct  313   VRNPAAPVG-GDGVDGNAASCETGKRNRD  340



>ref|XP_006417140.1| hypothetical protein EUTSA_v10010019mg [Eutrema salsugineum]
 gb|ESQ35493.1| hypothetical protein EUTSA_v10010019mg [Eutrema salsugineum]
Length=340

 Score =   406 bits (1044),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 254/357 (71%), Gaps = 40/357 (11%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
              S    PA KS  +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQI
Sbjct  14    GSICETPAKKSSVNLYRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQI  72

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLS  809
             YEKHQRVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK      D R   DD E  FL+
Sbjct  73    YEKHQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFK------DARL--DDGEIDFLN  124

Query  808   SHSKAEIVDMLRKHTYTDELEQSRRAFNIN------NMTTPRKPEADRSA---KSRERLF  656
             SHSK+EIVDMLRKHTY +ELEQS+R  N N      +MT     +   S    +S E LF
Sbjct  125   SHSKSEIVDMLRKHTYKEELEQSKRRRNGNGNTVRTSMTAALDNDDGVSTMEFRSAEPLF  184

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             EKAVTPSDVGKLNRLVIPK  AEKHFPL +  V+ KGVLLNFED  GKVWRFRYSYWNSS
Sbjct  185   EKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVTGKVWRFRYSYWNSS  244

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+ S           +
Sbjct  245   QSYVLTKGWSRFVKEKNLRAGDVVSFSRSDGQDQQLYIGWKSRSGSDS--------ETGR  296

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             V RLFGVNI     SP +   D         G KR+ +   E L L CSKKQR+  A
Sbjct  297   VLRLFGVNI-----SPESSRNDVV-------GSKRVNDT--EMLSLVCSKKQRIFHA  339



>emb|CDX84999.1| BnaC05g20560D [Brassica napus]
Length=354

 Score =   407 bits (1045),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 255/349 (73%), Gaps = 48/349 (14%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D+ENGVE ES RKLPSS+FKGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  40    LYRMGSGGSSVVLDSENGVETES-RKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  98

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  S   DG     D E+ FL +HSKAEIVDMLRK
Sbjct  99    EEEEAAASYDIAARRFRGRDAVTNFK--SPAIDG----TDAESAFLEAHSKAEIVDMLRK  152

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQA  590
             HTY DEL+QS+R F   N             ++RE LFEKAVTPSDVGKLNRLVIPKQ A
Sbjct  153   HTYADELQQSKRKFLDGN-----------GKRAREVLFEKAVTPSDVGKLNRLVIPKQHA  201

Query  589   EKHFPLQN-------GAVT---SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             EKHFPL          A+T   +KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  202   EKHFPLPAMTTATVVAAMTPSPTKGVLINLEDRMGKVWRFRYSYWNSSQSYVLTKGWSRF  261

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISK  263
             VKEK+L+AGD+V F RSTGP++QL+IDWK ++GT         + PVQ V RLFGVNI  
Sbjct  262   VKEKNLRAGDVVCFERSTGPDRQLYIDWKVQSGTEE-------ITPVQSVVRLFGVNIFN  314

Query  262   STVS--PMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             +T +  P  +A++       C G KR REV  +   L CSKKQ +I+AL
Sbjct  315   ATTNAKPNDVAVE-------CGGKKRSREV--DLFALGCSKKQTMINAL  354



>dbj|BAJ34161.1| unnamed protein product [Thellungiella halophila]
Length=340

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 252/357 (71%), Gaps = 40/357 (11%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
              S    PA KS  +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQI
Sbjct  14    GSICEAPAKKSSVNLYRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQI  72

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLS  809
             YEKHQRVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK      D R   DD E  FL+
Sbjct  73    YEKHQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFK------DARL--DDGEIDFLN  124

Query  808   SHSKAEIVDMLRKHTYTDELEQS--RRAFNINNMTTPRKPEADRSA-------KSRERLF  656
             SHSK+EIVDMLRKHTY +ELEQS  RR  N N + T      D          +S E LF
Sbjct  125   SHSKSEIVDMLRKHTYKEELEQSKRRRNGNGNTVRTSMTAALDNDDGVSTMEFRSAEPLF  184

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             EKAVTPSDVGKLNRLVIPK  AEKHFPL +  V+ KGVLLNFED  GKVWRFRYSYWNSS
Sbjct  185   EKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVTGKVWRFRYSYWNSS  244

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+ S           +
Sbjct  245   QSYVLTKGWSRFVKEKNLRAGDVVSFSRSDGQDQQLYIGWKSRSGSDS--------ETGR  296

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             V RLFGVNI     SP +   D         G KR+ +   E L L CSKKQR+  A
Sbjct  297   VLRLFGVNI-----SPESSRNDVV-------GSKRVNDT--EMLSLVCSKKQRIFHA  339



>ref|XP_006391089.1| hypothetical protein EUTSA_v10019566mg [Eutrema salsugineum]
 gb|ESQ28375.1| hypothetical protein EUTSA_v10019566mg [Eutrema salsugineum]
Length=350

 Score =   406 bits (1044),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 260/342 (76%), Gaps = 34/342 (10%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  36    LYRMGSGGSSVVLDSENGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  94

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFK-PLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             EEEEAAR YDIAA++FRGRDAV NFK  LSE       DD+ E  FL +HSKAEIVDMLR
Sbjct  95    EEEEAARSYDIAARKFRGRDAVINFKKSLSE-------DDNGELAFLETHSKAEIVDMLR  147

Query  772   KHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQ  593
             KHT+ DELEQ+ +   ++N   P   + D  +++RE LFEKAVTPSDVGKLNRLVIPKQ 
Sbjct  148   KHTFADELEQNNKRRFLSNGKRP--LQNDTVSRNREVLFEKAVTPSDVGKLNRLVIPKQH  205

Query  592   AEKHFPLQNGAV----TSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
             AEKHFPL +        +KGVL+NFED NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+
Sbjct  206   AEKHFPLPSPLGPLPLVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKN  265

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISKSTVSP  248
             L+AGD+V+F RSTGP++QL+IDWK R+G+ +        +PVQ V RLFGV+I   T + 
Sbjct  266   LRAGDVVTFERSTGPDRQLYIDWKIRSGSSN--------NPVQVVVRLFGVDIFNVTNAK  317

Query  247   MAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                    TN++ +  GGKR R+V M    L CSKKQ +I+ L
Sbjct  318   -------TNDVVAACGGKRSRDVDM--FALRCSKKQAIINVL  350



>ref|XP_009148531.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Brassica rapa]
Length=341

 Score =   405 bits (1041),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 218/351 (62%), Positives = 252/351 (72%), Gaps = 40/351 (11%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             + + KS  +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  22    MTSAKSSVNLHRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  80

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK            DD E  FLSSHSKA
Sbjct  81    RVWLGTFNEEDEAARSYDVAVYRFRGRDAVTNFKEARL--------DDGEVEFLSSHSKA  132

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA--------KSRERLFEKAVTP  638
             EIVDMLRKHTY++ELEQS+R  N  N  T R   +  +         +S E LFEKAVTP
Sbjct  133   EIVDMLRKHTYSEELEQSKRRRN-GNGNTARTLTSSLNGDGVSTTEFRSAEALFEKAVTP  191

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             SDVGKLNRLVIPK  AEKHFPL +  V+ KGVLLNFED  GKVWRFRYSYWNSSQSYVLT
Sbjct  192   SDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVTGKVWRFRYSYWNSSQSYVLT  251

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFG  278
             KGWSRFVKEK+L AGD+VSF RS G ++QL+I WK+R+G   PD+ T      +V RLFG
Sbjct  252   KGWSRFVKEKNLLAGDVVSFSRSEGQDQQLYIGWKSRSG---PDVET-----GRVLRLFG  303

Query  277   VNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             VNIS  +            + +   G KR+ +   E L L CSKKQR+  A
Sbjct  304   VNISPES------------SRTEVVGSKRVNDT--EMLSLVCSKKQRIFHA  340



>ref|XP_009336653.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Pyrus x bretschneideri]
Length=380

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 251/349 (72%), Gaps = 37/349 (11%)
 Frame = -3

Query  1078  GVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFR  899
             GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFNEE+EAAR YD+AAQRFR
Sbjct  39    GVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAAQRFR  97

Query  898   GRDAVTNFKPLSE--TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFN  725
             GRDAVTNFKP S    +     +DD EA FLSSHSK+EIVDMLRKHTY DELEQS+R   
Sbjct  98    GRDAVTNFKPPSAEPISSDDEENDDVEAAFLSSHSKSEIVDMLRKHTYNDELEQSKR---  154

Query  724   INNMTTPRKPEAD-----------RSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHF  578
              NN    ++   +           R  K+RE+LFEKAVTPSDVGKLNRLVIPKQ AEKHF
Sbjct  155   -NNCAYGKRSRTNGPLGLFGTDNSRVPKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHF  213

Query  577   PLQNGAVTS---------KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
             PLQ+G+  +         KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+
Sbjct  214   PLQSGSAATVTVSASSACKGVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKN  273

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDI---STVPVHPVQVFRLFGVNISK---  263
             L AGDIVSF RSTGP+KQL+IDWKAR    + +    S V V P+ + RLFGVNI K   
Sbjct  274   LMAGDIVSFQRSTGPDKQLYIDWKARMSVNNNNNNGSSPVQVGPIPMVRLFGVNIFKIPG  333

Query  262   STVSPMAMAMDTTNNISSCSG--GKRIREVVMEFLPLECSKKQRVIDAL  122
             S+ +    A         C+   GKR+RE  ME L LE  KK R+I AL
Sbjct  334   SSGAGSVDAAAAAAIGGGCNNNIGKRMRE--MELLELEFGKKPRIIGAL  380



>ref|XP_006415886.1| hypothetical protein EUTSA_v10007983mg [Eutrema salsugineum]
 gb|ESQ34239.1| hypothetical protein EUTSA_v10007983mg [Eutrema salsugineum]
Length=367

 Score =   404 bits (1038),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 224/355 (63%), Positives = 252/355 (71%), Gaps = 45/355 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D++NGVE ES RKLPSS+FKGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  38    LYRMGSGGSSVVLDSDNGVETES-RKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  96

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  +   DG    DD E+ FL SHSKAEIVDMLRK
Sbjct  97    EEEEAASSYDIAARRFRGRDAVTNFKTPAIDNDG----DDAESAFLESHSKAEIVDMLRK  152

Query  769   HTYTDELEQSRRAFNINN-----------MTTPRKPEADRSAKSRERLFEKAVTPSDVGK  623
             HTY DEL+QS+R F   N           MT+P     D   + RE LFEK VTPSDVGK
Sbjct  153   HTYADELQQSKRRFLDGNGNGKRCESTTIMTSPHG--NDGVLRPREVLFEKTVTPSDVGK  210

Query  622   LNRLVIPKQQAEKHFPL--------QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSY  467
             LNRLVIPKQ AEKHFPL              +KGVL+N ED  GKVWRFRYSYWNSSQSY
Sbjct  211   LNRLVIPKQHAEKHFPLPAMTTATATTNPSPTKGVLINLEDRAGKVWRFRYSYWNSSQSY  270

Query  466   VLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFR  287
             VLTKGWSRFVKEK+L+AGD V F RSTGP++QL+IDWK R+GT   ++ + PV    V R
Sbjct  271   VLTKGWSRFVKEKNLRAGDAVCFERSTGPDRQLYIDWKVRSGT---ELISTPVQ--TVVR  325

Query  286   LFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             LFGVNI K    P  +A         C G KR REV  +   L CSKKQ +I+AL
Sbjct  326   LFGVNIFK----PNDVA-------GECGGKKRSREV--DLFALGCSKKQAIINAL  367



>ref|XP_002887208.1| AP2 domain-containing protein RAP2.8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63467.1| AP2 domain-containing protein RAP2.8 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   403 bits (1036),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 224/358 (63%), Positives = 261/358 (73%), Gaps = 42/358 (12%)
 Frame = -3

Query  1147  ATKSPES-------LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQ  992
             AT SP S       L RMGSG +SV++D ENG+E ES RKLPSS++KGVVPQPNGRWGAQ
Sbjct  21    ATLSPPSHPAAALRLHRMGSGGSSVVLDPENGLETES-RKLPSSKYKGVVPQPNGRWGAQ  79

Query  991   IYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFL  812
             IYEKHQRVWLGTFNE+EEAAR YDIAA+RFRGRDAV NFK + E         D +  FL
Sbjct  80    IYEKHQRVWLGTFNEQEEAARSYDIAARRFRGRDAVVNFKNVLE---------DGDLAFL  130

Query  811   SSHSKAEIVDMLRKHTYTDELEQS--RRAFNINNMTTPRK----PEADRSAKSRERLFEK  650
              +HSKAEIVDMLRKHTY DELEQ+  RR F   +    R      + D   K+RE LFEK
Sbjct  131   EAHSKAEIVDMLRKHTYADELEQNNKRRLFLSVDANGKRNGSSTTQNDNVLKTREVLFEK  190

Query  649   AVTPSDVGKLNRLVIPKQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             AVTPSDVGKLNRLVIPKQ AEKHFPL + +   +KGVL+NFED NGKVWRFRYSYWNSSQ
Sbjct  191   AVTPSDVGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWRFRYSYWNSSQ  250

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK+L+AGD+V+F RSTG ++QL+IDWKAR+G         PVH   V
Sbjct  251   SYVLTKGWSRFVKEKNLQAGDVVTFERSTGLDRQLYIDWKARSGPRED-----PVH--VV  303

Query  292   FRLFGVNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              RLFGV+I + +TV P        N++ +  GGKR R+ V +   L CSKKQ +I+AL
Sbjct  304   VRLFGVDIFNATTVKP--------NDVVAVCGGKRSRD-VDDMFALRCSKKQAIINAL  352



>ref|XP_002889996.1| hypothetical protein ARALYDRAFT_888685 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66255.1| hypothetical protein ARALYDRAFT_888685 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 221/351 (63%), Positives = 255/351 (73%), Gaps = 40/351 (11%)
 Frame = -3

Query  1150  PATKSP-ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             PA KS   +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  24    PAKKSSVGNLYRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  82

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK      D R  +D+ E  FL+SHSK+
Sbjct  83    RVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFK------DVRMDEDEVE--FLNSHSKS  134

Query  793   EIVDMLRKHTYTDELEQSRRAFNIN-----NMTTPRKPEADRSA---KSRERLFEKAVTP  638
             EIVDMLRKHTY +EL+QS+R  N N      M T        S    +S E LFEKAVTP
Sbjct  135   EIVDMLRKHTYNEELDQSKRRRNGNGNMVRTMLTSGLSNDGVSTTEFRSAEALFEKAVTP  194

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             SDVGKLNRLVIPK  AEKHFPL +  V+ KGVLLNFED NGKVWRFRYSYWNSSQSYVLT
Sbjct  195   SDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLT  254

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFG  278
             KGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+   D+ T      +V RLFG
Sbjct  255   KGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS---DLET-----GRVLRLFG  306

Query  277   VNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             VNI     SP +   D         G KR+ +   E L L CSKKQR+  A
Sbjct  307   VNI-----SPESSRNDVV-------GNKRVNDT--EMLSLVCSKKQRIFHA  343



>gb|AES97413.2| AP2/ERF and B3 domain transcription factor [Medicago truncatula]
Length=378

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 218/355 (61%), Positives = 252/355 (71%), Gaps = 29/355 (8%)
 Frame = -3

Query  1129  SLCRMGSGASVIIDAE-NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTF  953
             SLCR+GSGAS ++D++ +GV     RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF
Sbjct  34    SLCRVGSGASAVVDSDGSGVGEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTF  93

Query  952   NEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             N+E+EAA+ YD+AAQRFRG+DAVTNFKPLS+     + +DD E  FL+SHSK+EIVDMLR
Sbjct  94    NQEDEAAKAYDVAAQRFRGKDAVTNFKPLSD-----HNNDDMELEFLNSHSKSEIVDMLR  148

Query  772   KHTYTDELEQS--------RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLN  617
             KHTY DELEQS        RR+   ++         +   K+RE LFEK VTPSDVGKLN
Sbjct  149   KHTYNDELEQSKRSHGFVSRRSHGCSDSVNFASSAYNTDKKAREALFEKVVTPSDVGKLN  208

Query  616   RLVIPKQQAEKHFPLQ-------NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             RLVIPKQ AEKHFPLQ       + +   KGVLLNFED  GKVWRFRYSYWNSSQSYVLT
Sbjct  209   RLVIPKQHAEKHFPLQKADCVQGSASAAGKGVLLNFEDIGGKVWRFRYSYWNSSQSYVLT  268

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR---NGTGSPDISTVPVHPVQVFR  287
             KGWSRFVKEK+LKAGD V F RSTGPEKQLFIDWKAR   N  G        V PVQ+ R
Sbjct  269   KGWSRFVKEKNLKAGDTVCFQRSTGPEKQLFIDWKARKNVNEVGLFVPVGPVVEPVQMVR  328

Query  286   LFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             LFGVNI K    P +      N I+    GKR +E+ M     +  KK ++I AL
Sbjct  329   LFGVNILKQL--PGSDVNSNGNVIAGFCNGKR-KELNM--FTFDSCKKPKIIGAL  378



>ref|XP_010458777.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Camelina sativa]
Length=347

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 254/353 (72%), Gaps = 41/353 (12%)
 Frame = -3

Query  1150  PATKSP---ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             PA KS     +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  24    PAKKSSVGNNNLYRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  82

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK ++         D+ E  FL+SHS
Sbjct  83    HQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFKDVTL--------DEEEVEFLNSHS  134

Query  799   KAEIVDMLRKHTYTDELEQS--RRAFNINNMTTPRKPEADRSA------KSRERLFEKAV  644
             K+EIVDMLRKHTY +ELEQS  RR+ N N + T                +S E LFEKAV
Sbjct  135   KSEIVDMLRKHTYNEELEQSKRRRSGNGNTVRTMLTSGLSNDGVSTTEFRSAEPLFEKAV  194

Query  643   TPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYV  464
             TPSDVGKLNRLVIPK  AEKHFPL + +V+ KGVLLNFED NGKVWRFRYSYWNSSQSYV
Sbjct  195   TPSDVGKLNRLVIPKHHAEKHFPLPSSSVSMKGVLLNFEDVNGKVWRFRYSYWNSSQSYV  254

Query  463   LTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRL  284
             LTKGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R        S+  +   +V RL
Sbjct  255   LTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSR--------SSSELEAGRVLRL  306

Query  283   FGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             FGVNIS         A  + N++    G KR+ +   E L L CSKKQR+  A
Sbjct  307   FGVNISP--------AGSSRNDV---VGNKRVNDT--EMLSLVCSKKQRIFHA  346



>ref|XP_010476321.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Camelina sativa]
Length=348

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/354 (61%), Positives = 255/354 (72%), Gaps = 42/354 (12%)
 Frame = -3

Query  1150  PATKSP----ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYE  983
             PA KS      +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYE
Sbjct  24    PAKKSSVGNNYNLYRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYE  82

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             KHQRVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK ++         D+ E  FL+SH
Sbjct  83    KHQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFKDVTL--------DEDEVEFLNSH  134

Query  802   SKAEIVDMLRKHTYTDELEQS--RRAFNINNMTTPRKPEADRSA------KSRERLFEKA  647
             SK+EIVDMLRKHTY +ELEQS  RR+ N N + T                +S E LFEKA
Sbjct  135   SKSEIVDMLRKHTYNEELEQSKRRRSGNGNTVRTMLTSGLSNDGVSTTEFRSAEPLFEKA  194

Query  646   VTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSY  467
             VTPSDVGKLNRLVIPK  AEKHFPL + +V+ KGVLLNFED NGKVWRFRYSYWNSSQSY
Sbjct  195   VTPSDVGKLNRLVIPKHHAEKHFPLPSSSVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSY  254

Query  466   VLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFR  287
             VLTKGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+         +   +V R
Sbjct  255   VLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS--------ELEAGRVLR  306

Query  286   LFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             LFGVNIS         A  + N++    G KR+ +   E L L CSKKQR+  A
Sbjct  307   LFGVNISP--------AGSSRNDV---VGNKRVNDT--EMLSLVCSKKQRIFHA  347



>ref|XP_008799316.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Phoenix dactylifera]
Length=349

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 249/344 (72%), Gaps = 15/344 (4%)
 Frame = -3

Query  1144  TKSPESLCRMGSGA-SVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             T +P +L RMGSGA SV++D   E GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  18    TPAPATLHRMGSGACSVVLDPTPETGVEAES-RKLPSSQYKGVVPQPNGRWGAQIYEKHQ  76

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTF EE +AAR YD+AAQRFRGRDAVTNF PLSE  D    D   E  FL++HSKA
Sbjct  77    RVWLGTFPEEADAARAYDVAAQRFRGRDAVTNFTPLSENDD----DGAAELAFLAAHSKA  132

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNR  614
             EIVDMLRKHT+ DEL QS+RA   +     ++     S   R+ LF+K VTPSDVGKLNR
Sbjct  133   EIVDMLRKHTFCDELRQSKRAGKASGSIVGKRSPRSLSVSDRDILFDKVVTPSDVGKLNR  192

Query  613   LVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVK  434
             LVIPKQ AEKHFP++ G+  S G+LLNFED +GKVWRFRYSYWNSSQSYVLTKGWSRFVK
Sbjct  193   LVIPKQHAEKHFPMEIGS-GSAGMLLNFEDVSGKVWRFRYSYWNSSQSYVLTKGWSRFVK  251

Query  433   EKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTV  254
             EKSLKAGD+V+F RS GPEKQL+IDWK R    +   +  PV  VQV RLFGVNI ++ V
Sbjct  252   EKSLKAGDVVTFWRSRGPEKQLYIDWKPREAAAAAAFAGRPVAHVQVVRLFGVNIFRTPV  311

Query  253   SPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                A               KR+RE  ME  P E   K++ I AL
Sbjct  312   GCGAAGGGNDGGAEG----KRVRE--MELFPPEQFLKKQCIGAL  349



>ref|XP_010495155.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Camelina sativa]
Length=347

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 216/351 (62%), Positives = 254/351 (72%), Gaps = 41/351 (12%)
 Frame = -3

Query  1150  PATKSP---ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             PA KS     +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  24    PAKKSSVGNNNLYRMGSGSSVLLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  82

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK ++         D+ E  FL+SHS
Sbjct  83    HQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFKDVTM--------DEDEVEFLNSHS  134

Query  799   KAEIVDMLRKHTYTDELEQS--RRAFNINNMTTPRKPEADRSA------KSRERLFEKAV  644
             K+EIVDMLRKHTY +ELEQS  RR+ N N + T                +S E LFEKAV
Sbjct  135   KSEIVDMLRKHTYNEELEQSKRRRSGNGNTVRTMLTSGLSNDGVSTTEFRSAEPLFEKAV  194

Query  643   TPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYV  464
             TPSDVGKLNRLVIPK  AEKHFPL + +V+ KGVLLNFED NGKVWRFRYSYWNSSQSYV
Sbjct  195   TPSDVGKLNRLVIPKHHAEKHFPLPSSSVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYV  254

Query  463   LTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRL  284
             LTKGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+         +   +V RL
Sbjct  255   LTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS--------ELEAGRVLRL  306

Query  283   FGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVI  131
             FGVNIS         A  + N++    G KR+ +   E L L CSKKQR+ 
Sbjct  307   FGVNISP--------AGSSRNDV---VGNKRVNDT--EMLSLVCSKKQRIF  344



>ref|XP_010916479.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Elaeis guineensis]
Length=349

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 220/338 (65%), Positives = 250/338 (74%), Gaps = 16/338 (5%)
 Frame = -3

Query  1126  LCRMGSGA-SVIID--AENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             L RMGSGA SV++D   E+GVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGT
Sbjct  25    LYRMGSGACSVVLDPTTESGVEAES-RKLPSSQYKGVVPQPNGRWGAQIYEKHQRVWLGT  83

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F +E +AAR YD+AAQRFRGRDAVTNF PLSE  D    D   E  FL++HSKAEIVDML
Sbjct  84    FADEADAARAYDVAAQRFRGRDAVTNFTPLSENDD----DGAAELGFLAAHSKAEIVDML  139

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQ  596
             RKHTY DEL QS+RA N +     ++     S   RE LF+K VTPSDVGKLNRLVIPKQ
Sbjct  140   RKHTYCDELRQSKRAGNASGSIVGKRSPPSSSVSDREILFDKVVTPSDVGKLNRLVIPKQ  199

Query  595   QAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKA  416
              AEK+FPL+ G+  S G+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKA
Sbjct  200   HAEKNFPLKIGS-GSAGMLLNFEDVIGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKA  258

Query  415   GDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMA  236
             GD+VSF RS GPEKQL+IDWK R    +   +  PV  VQV RLFGVNI ++ V   A A
Sbjct  259   GDVVSFWRSRGPEKQLYIDWKPRA-AAAAAFAVRPVGHVQVVRLFGVNIFRTPVGCGAAA  317

Query  235   MDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              +   +      GKR+RE  ME  P E   K++ I AL
Sbjct  318   GNGCGDRE----GKRVRE--MELFPPEQFVKKQCIRAL  349



>ref|XP_007227469.1| hypothetical protein PRUPE_ppa006243mg [Prunus persica]
 gb|EMJ28668.1| hypothetical protein PRUPE_ppa006243mg [Prunus persica]
Length=421

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 238/389 (61%), Positives = 267/389 (69%), Gaps = 51/389 (13%)
 Frame = -3

Query  1147  ATKSP--ESLCRMGSGAS-VIIDAENGVEAESG-----RKLPSSRFKGVVPQPNGRWGAQ  992
             A  SP  +SLCR+GSGAS VI+D+E       G     RKLPSS++KGVVPQPNGRWGAQ
Sbjct  37    AKSSPHADSLCRLGSGASSVILDSEISSGGGGGIEAESRKLPSSKYKGVVPQPNGRWGAQ  96

Query  991   IYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKP--LSETTDGRNGDDDYEAV  818
             IYEKHQRVWLGTFNEE+EAA+ YD+AAQRFRGRDAVTNFKP      TD  +  DD EA 
Sbjct  97    IYEKHQRVWLGTFNEEDEAAKAYDVAAQRFRGRDAVTNFKPSPTGTGTDDDDESDDVEAA  156

Query  817   FLSSHSKAEIVDMLRKHTYTDELEQSRRA----FNINNMTT----PRKP-EADRSAKSRE  665
             FL++HSK+EIVDMLRKHTY DELEQS+R      + N        P  P  +DR  K+RE
Sbjct  157   FLNTHSKSEIVDMLRKHTYNDELEQSKRNNYGFLDANGKRARAHGPLGPFGSDRVPKARE  216

Query  664   RLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNG-------------AVTSKGVLLNFED  524
             +LFEKAVTPSDVGKLNRLVIPKQ AEKHFPLQ+G                 KGVLLNFED
Sbjct  217   QLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGNNFNNHTSTSTSGGSACKGVLLNFED  276

Query  523   TNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR-  347
               GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+LKAGDIVSF RSTG +KQL+IDWK R 
Sbjct  277   VGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGQDKQLYIDWKPRM  336

Query  346   ----NGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMD----------TTNNISS  209
                 N       + VPV  VQ+ RLFGVNI K   S     +D            NNI++
Sbjct  337   NVNNNNNSGVGSNPVPVQQVQMVRLFGVNIFKIPGSGGGAVVDAATAAIGGGSCNNNINN  396

Query  208   CSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                GKR+RE  ME L LE SKK R+I AL
Sbjct  397   V--GKRMRE--MELLELEFSKKPRIIGAL  421



>ref|NP_172784.1| AP2/ERF and B3 domain-containing transcription factor RAV1 [Arabidopsis 
thaliana]
 sp|Q9ZWM9.1|RAV1_ARATH RecName: Full=AP2/ERF and B3 domain-containing transcription 
factor RAV1; AltName: Full=Ethylene-responsive transcription 
factor RAV1; AltName: Full=Protein RELATED TO ABI3/VP1 1 [Arabidopsis 
thaliana]
 gb|AAG09554.1|AC011810_13 DNA binding protein RAV1 [Arabidopsis thaliana]
 dbj|BAA34250.1| RAV1 [Arabidopsis thaliana]
 gb|AAL36211.1| putative DNA-binding protein RAV1 [Arabidopsis thaliana]
 gb|AAM14230.1| putative DNA-binding protein RAV1 [Arabidopsis thaliana]
 gb|AEE28991.1| AP2/ERF and B3 domain-containing transcription factor RAV1 [Arabidopsis 
thaliana]
Length=344

 Score =   400 bits (1029),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 217/351 (62%), Positives = 251/351 (72%), Gaps = 40/351 (11%)
 Frame = -3

Query  1150  PATKSP-ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             PA KS   +L RMGSG+SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  24    PAKKSSVGNLYRMGSGSSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  82

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEE+EAAR YD+A  RFR RDAVTNFK +          D+ E  FL+SHSK+
Sbjct  83    RVWLGTFNEEDEAARAYDVAVHRFRRRDAVTNFKDVKM--------DEDEVDFLNSHSKS  134

Query  793   EIVDMLRKHTYTDELEQSRRAFNIN-NMT-------TPRKPEADRSAKSRERLFEKAVTP  638
             EIVDMLRKHTY +ELEQS+R  N N NMT             +    +S E LFEKAVTP
Sbjct  135   EIVDMLRKHTYNEELEQSKRRRNGNGNMTRTLLTSGLSNDGVSTTGFRSAEALFEKAVTP  194

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             SDVGKLNRLVIPK  AEKHFPL +  V+ KGVLLNFED NGKVWRFRYSYWNSSQSYVLT
Sbjct  195   SDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLT  254

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFG  278
             KGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+         +   +V RLFG
Sbjct  255   KGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS--------DLDAGRVLRLFG  306

Query  277   VNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
             VNI     SP +   D         G KR+ +   E L L CSKKQR+  A
Sbjct  307   VNI-----SPESSRNDVV-------GNKRVNDT--EMLSLVCSKKQRIFHA  343



>ref|XP_010551303.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Tarenaya hassleriana]
Length=366

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 256/357 (72%), Gaps = 38/357 (11%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAEN--GVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
             PA K    L RMGSG SV+ D++N  GVE ES RKLPSS++KGVVPQPNGRWGAQIYEKH
Sbjct  34    PAVK----LYRMGSGGSVVSDSDNVIGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKH  88

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDG-RNGDDDYEAVFLSSHS  800
              RVWLGTFNEE EAAR YDIAA+RFRGRDAVTNFK  S   DG R+   D E+ FL +HS
Sbjct  89    HRVWLGTFNEEAEAARAYDIAARRFRGRDAVTNFK--SPAADGERDCQSDAESAFLEAHS  146

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEA-----DRSAKSRERLFEKAVTPS  635
             KAEIVDMLRKHTY +ELEQS+R F+++ +             D   K+RE LFEKAVTPS
Sbjct  147   KAEIVDMLRKHTYEEELEQSKRRFHLSGVDGDGNRNGTGQNDDAGKKTREVLFEKAVTPS  206

Query  634   DVGKLNRLVIPKQQAEKHFPL------QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             DVGKLNRLVIPKQ AEKHFPL       NG  ++KGVL+NFED  GKVWRFRYSYWNSSQ
Sbjct  207   DVGKLNRLVIPKQHAEKHFPLPTSSSNGNGTSSTKGVLMNFEDVTGKVWRFRYSYWNSSQ  266

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK+L+AGD+VSF RSTGP++QL+ID K R        S    +PVQV
Sbjct  267   SYVLTKGWSRFVKEKNLRAGDVVSFERSTGPDRQLYIDCKIR--------SEPEKNPVQV  318

Query  292   FRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              RLFGV+I  +   P        N++    GGKR R+   +   L CSKKQ +I+AL
Sbjct  319   VRLFGVDILSAPTPP-------PNDVVPVCGGKRSRD--RDLFTLGCSKKQMIINAL  366



>emb|CDY24391.1| BnaCnng04580D [Brassica napus]
Length=338

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 242/340 (71%), Gaps = 37/340 (11%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D ENGVE ES RKLPSS+FKGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  31    LYRMGSGGSSVVLDLENGVETESSRKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  90

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  S          D E+ FL +HSKAEIVDMLRK
Sbjct  91    EEEEAAASYDIAARRFRGRDAVTNFKSPS---------SDAESAFLEAHSKAEIVDMLRK  141

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEADRSAKSR--ERLFEKAVTPSDVGKLNRLVIPKQ  596
             HTY DEL QS R F           + D + K R  E LFEKAVTPSDVGKLNRLVIPKQ
Sbjct  142   HTYADELRQSERKF----------LDGDGNGKKRREEVLFEKAVTPSDVGKLNRLVIPKQ  191

Query  595   QAEKHFPLQNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSL  422
              AEKHFPL      S  KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+L
Sbjct  192   HAEKHFPLPVSVTPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNL  251

Query  421   KAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMA  242
             +AGD+V F RS+GP++QL+IDWK R+G       T  V    V RLFGVNI  +T +   
Sbjct  252   RAGDVVCFERSSGPDQQLYIDWKVRSGIE----KTTSVQ--TVVRLFGVNIFNATTN---  302

Query  241   MAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                +T + +   S  KR REV  +   L CSKKQ +I+ L
Sbjct  303   --ANTNDAVGESSSKKRSREV--DLFALGCSKKQAIINVL  338



>ref|XP_003614455.1| AP2 domain-containing transcription factor [Medicago truncatula]
Length=412

 Score =   402 bits (1032),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/355 (61%), Positives = 251/355 (71%), Gaps = 29/355 (8%)
 Frame = -3

Query  1129  SLCRMGSGASVIIDAE-NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTF  953
             SLCR+GSGAS ++D++ +GV     RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF
Sbjct  34    SLCRVGSGASAVVDSDGSGVGEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTF  93

Query  952   NEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             N+E+EAA+ YD+AAQRFRG+DAVTNFKPLS+     + +DD E  FL+SHSK+EIVDMLR
Sbjct  94    NQEDEAAKAYDVAAQRFRGKDAVTNFKPLSD-----HNNDDMELEFLNSHSKSEIVDMLR  148

Query  772   KHTYTDELEQS--------RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLN  617
             KHTY DELEQS        RR+   ++         +   K+RE LFEK VTPSDVGKLN
Sbjct  149   KHTYNDELEQSKRSHGFVSRRSHGCSDSVNFASSAYNTDKKAREALFEKVVTPSDVGKLN  208

Query  616   RLVIPKQQAEKHFPLQ-------NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             RLVIPKQ AEKHFPLQ       + +   KGVLLNFED  GKVWRFRYSYWNSSQSYVLT
Sbjct  209   RLVIPKQHAEKHFPLQKADCVQGSASAAGKGVLLNFEDIGGKVWRFRYSYWNSSQSYVLT  268

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR---NGTGSPDISTVPVHPVQVFR  287
             KGWSRFVKEK+LKAGD V F RSTGPEKQLFIDWKAR   N  G        V PVQ+ R
Sbjct  269   KGWSRFVKEKNLKAGDTVCFQRSTGPEKQLFIDWKARKNVNEVGLFVPVGPVVEPVQMVR  328

Query  286   LFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             LFGVNI K    P +      N I+    GKR +E+ M     +  KK ++I A 
Sbjct  329   LFGVNILKQL--PGSDVNSNGNVIAGFCNGKR-KELNM--FTFDSCKKPKIIGAF  378



>ref|NP_564947.1| AP2-EREBP family, RAVE subfamily protein RAV2 [Arabidopsis thaliana]
 ref|NP_001185352.1| AP2-EREBP family, RAVE subfamily protein RAV2 [Arabidopsis thaliana]
 sp|P82280.1|RAV2_ARATH RecName: Full=AP2/ERF and B3 domain-containing transcription 
repressor RAV2; AltName: Full=Ethylene-responsive transcription 
factor RAV2; AltName: Full=Protein RELATED TO ABI3/VP1 2; 
AltName: Full=Protein RELATED TO APETALA2 8; AltName: Full=Protein 
TEMPRANILLO 2 [Arabidopsis thaliana]
 gb|AAG51586.1|AC011665_7 putative DNA-binding protein (RAV2-like) [Arabidopsis thaliana]
 gb|AAG52035.1|AC011914_5 RAV2; 17047-15989 [Arabidopsis thaliana]
 gb|AAK26022.1|AF360312_1 putative DNA-binding protein(RAV2 [Arabidopsis thaliana]
 dbj|BAA34251.1| RAV2 [Arabidopsis thaliana]
 gb|AAL07247.1| putative DNA-binding protein RAV2 [Arabidopsis thaliana]
 gb|AEE34847.1| AP2-EREBP family, RAVE subfamily protein RAV2 [Arabidopsis thaliana]
 gb|AEE34848.1| AP2-EREBP family, RAVE subfamily protein RAV2 [Arabidopsis thaliana]
Length=352

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 258/353 (73%), Gaps = 37/353 (10%)
 Frame = -3

Query  1150  PATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             P   +   L RMGSG +SV++D ENG+E ES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  27    PPPAAALRLYRMGSGGSSVVLDPENGLETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  85

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNE+EEAAR YDIAA RFRGRDAV NFK + E         D +  FL +HSKA
Sbjct  86    RVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKNVLE---------DGDLAFLEAHSKA  136

Query  793   EIVDMLRKHTYTDELEQS--RRAFNINNMTTPRK----PEADRSAKSRERLFEKAVTPSD  632
             EIVDMLRKHTY DELEQ+  R+ F   +    R      + D+  K+RE LFEKAVTPSD
Sbjct  137   EIVDMLRKHTYADELEQNNKRQLFLSVDANGKRNGSSTTQNDKVLKTREVLFEKAVTPSD  196

Query  631   VGKLNRLVIPKQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             VGKLNRLVIPKQ AEKHFPL + +   +KGVL+NFED NGKVWRFRYSYWNSSQSYVLTK
Sbjct  197   VGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTK  256

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFG  278
             GWSRFVKEK+L+AGD+V+F RSTG E+QL+IDWK R+G           +PVQ V RLFG
Sbjct  257   GWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWKVRSGPRE--------NPVQVVVRLFG  308

Query  277   VNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             V+I + +TV P        N++ +  GGKR R+ V +   L CSKKQ +I+AL
Sbjct  309   VDIFNVTTVKP--------NDVVAVCGGKRSRD-VDDMFALRCSKKQAIINAL  352



>gb|KFK41311.1| ap2 erf and b3 domain-containing transcription factor rav2 [Arabis 
alpina]
Length=345

 Score =   399 bits (1025),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 215/342 (63%), Positives = 253/342 (74%), Gaps = 37/342 (11%)
 Frame = -3

Query  1126  LCRMGS-GASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGS G+SV++D+EN VE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  34    LYRMGSDGSSVVLDSENCVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  92

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA++FRGRDAV NFK           DDD  A FL +HSKAEIVDMLRK
Sbjct  93    EEEEAAHSYDIAARKFRGRDAVVNFKT--------TLDDDVLA-FLEAHSKAEIVDMLRK  143

Query  769   HTYTDELEQS--RRAFNINNMTTPR-KPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPK  599
             HTY DEL+QS  RR  +++    P+   + D  +++RE LFEKAVTPSDVGKLNRLVIPK
Sbjct  144   HTYADELDQSNKRRILSVDVNGKPKVTSQNDSVSRTREVLFEKAVTPSDVGKLNRLVIPK  203

Query  598   QQAEKHFPL--QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
             Q AEKHFPL        +KGVL+NFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+
Sbjct  204   QHAEKHFPLPLSPSPSVTKGVLINFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKN  263

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISKSTVSP  248
             L+AGD+V+F RSTGP++QL+IDWK R+G  +        +PVQ V RLFGV+I  +    
Sbjct  264   LRAGDVVTFERSTGPDRQLYIDWKIRSGPSN--------NPVQVVVRLFGVDIFNA----  311

Query  247   MAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                     N++ +  GGKR R+V M    L CSKKQ +I+AL
Sbjct  312   ------KPNDVVAVCGGKRSRDVDM--FALRCSKKQAIINAL  345



>ref|XP_010470843.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Camelina sativa]
Length=354

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 220/354 (62%), Positives = 257/354 (73%), Gaps = 39/354 (11%)
 Frame = -3

Query  1150  PATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             P   +   L RMGSG +SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  29    PPLAAAFHLYRMGSGGSSVVLDSENGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  87

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNE+EEAAR YDIAA RFRGRDAV NFK L          DD +  FL +HSKA
Sbjct  88    RVWLGTFNEQEEAARSYDIAALRFRGRDAVVNFKTLL---------DDGDLAFLEAHSKA  138

Query  793   EIVDMLRKHTYTDELEQS--RRAFNINNMTTPRKPEA-----DRSAKSRERLFEKAVTPS  635
             EIVDMLRKHTY DELEQ+  RR F   +    R   +     D   K+RE LFEKAVTPS
Sbjct  139   EIVDMLRKHTYADELEQNNKRRLFLSVDANGKRNGSSSTVLNDNVLKTREVLFEKAVTPS  198

Query  634   DVGKLNRLVIPKQQAEKHFPLQNGAVT-SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             DVGKLNRLVIPKQ AEKHFPL + + + +KGVL+NFED NGKVWRFRYSYWNSSQSYVLT
Sbjct  199   DVGKLNRLVIPKQHAEKHFPLPSRSPSVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLT  258

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLF  281
             KGWSRFVKEK L+AGD+V+F RSTG ++QL+IDWK R+G           +PVQ V RLF
Sbjct  259   KGWSRFVKEKHLRAGDVVTFERSTGLDRQLYIDWKVRSGPRE--------NPVQVVVRLF  310

Query  280   GVNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             GV+I + +TV P        N++ +  GGKR R+  M    + CSKKQ +I+AL
Sbjct  311   GVDIFNVNTVKP--------NDVVAVCGGKRSRDADM--FGIRCSKKQTIINAL  354



>gb|KFK43591.1| ap2 erf and b3 domain-containing transcription factor rav2 [Arabis 
alpina]
Length=340

 Score =   397 bits (1021),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 214/346 (62%), Positives = 248/346 (72%), Gaps = 36/346 (10%)
 Frame = -3

Query  1141  KSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWL  962
             K P SL RMGSG SV++D+ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWL
Sbjct  23    KPPVSLYRMGSGTSVVLDSENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWL  81

Query  961   GTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVD  782
             GTFNEE+EAAR YD+A  RFRGRDAVTNFK +          D+ E  FL+SHSK+EIVD
Sbjct  82    GTFNEEDEAARAYDVAVHRFRGRDAVTNFKDVKL--------DEGEIEFLNSHSKSEIVD  133

Query  781   MLRKHTYTDELEQSRRAFNI-------NNMTTPRKPEADRSAKSRERLFEKAVTPSDVGK  623
             MLRKHTY +ELEQS+R  N           TT          +S E LFEKAVTPSDVGK
Sbjct  134   MLRKHTYNEELEQSKRRRNGNGNNVRNTTKTTALCNYETTEFRSAEPLFEKAVTPSDVGK  193

Query  622   LNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             LNRLVIPK  AEKHFPL +  V+ KGVLLNFED NGKVWRFRYSYWNSSQSYVLTKGWSR
Sbjct  194   LNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSR  253

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISK  263
             FVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+         + P +V RLFGV+IS 
Sbjct  254   FVKEKNLRAGDVVSFSRSDGQDQQLYIGWKSRSGSD--------LEPGRVLRLFGVDISP  305

Query  262   STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDA  125
                   ++  D         G KR+ + + E L L CSKKQR+  A
Sbjct  306   EK----SLRNDAV-------GNKRVNDSI-EMLSLVCSKKQRIFHA  339



>ref|XP_010477910.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Camelina sativa]
Length=363

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 218/351 (62%), Positives = 249/351 (71%), Gaps = 45/351 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D++NGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  42    LYRMGSGGSSVVLDSDNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  100

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  + T        D E+ FL +HSKAEIVDMLRK
Sbjct  101   EEEEAATSYDIAARRFRGRDAVTNFKSPTTT--------DAESAFLDAHSKAEIVDMLRK  152

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEA----DRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             HTY DELEQSRR F   N        A    D  +++RE LFEKAVTPSDVGKLNRLVIP
Sbjct  153   HTYADELEQSRRKFVNGNGNRCGSETAVSSNDAVSRAREVLFEKAVTPSDVGKLNRLVIP  212

Query  601   KQQAEKHFPLQNGAVT--------SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWS  446
             KQ AEKHFPL     T        +KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWS
Sbjct  213   KQHAEKHFPLPAMTTTAMGMSPSPAKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWS  272

Query  445   RFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI  269
             RFVKEK+L+AGD+V F RSTGP++QL+IDWK R+             PVQ V RLFGVNI
Sbjct  273   RFVKEKNLRAGDVVCFERSTGPDRQLYIDWKVRSS------------PVQTVVRLFGVNI  320

Query  268   SKSTVS--PMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                T +  P  +A++       C GGK+ R    +   L CSKKQ +I+ L
Sbjct  321   FNVTTTGNPNDVAVE-------CGGGKK-RSREDDLFSLGCSKKQTMINIL  363



>ref|XP_010460355.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like isoform X3 [Camelina sativa]
Length=359

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 219/350 (63%), Positives = 252/350 (72%), Gaps = 44/350 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D++NGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  39    LYRMGSGGSSVVLDSDNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  97

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  + T        D E+ FL +HSKAEIVDMLRK
Sbjct  98    EEEEAATSYDIAARRFRGRDAVTNFKSPTTT--------DAESAFLDAHSKAEIVDMLRK  149

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEA----DRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             HTY DELEQSRR F   N        A    D  +++RE LFEKAVTPSDVGKLNRLVIP
Sbjct  150   HTYADELEQSRRKFVNGNGNRCGSETAVSSNDAVSRAREVLFEKAVTPSDVGKLNRLVIP  209

Query  601   KQQAEKHFPL-----QNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             KQ AEKHFPL     + G   S  KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSR
Sbjct  210   KQHAEKHFPLPAMTTETGVSPSPAKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSR  269

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI-  269
             FVKEK+L+AGD+V F RSTGP++QL+IDWK R+             PVQ V RLFGVNI 
Sbjct  270   FVKEKNLRAGDVVCFERSTGPDRQLYIDWKVRSS------------PVQTVVRLFGVNIF  317

Query  268   SKSTVSPMAMAMDTTNNIS-SCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             + +T  P       +N+++  C GGK+ R    +   L CSKKQ +I+ L
Sbjct  318   NVTTTGP-------SNDVAVECGGGKK-RSREDDLFSLGCSKKQTMINIL  359



>ref|XP_010924129.1| PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and B3 domain-containing 
transcription repressor RAV2-like [Elaeis guineensis]
Length=371

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 213/345 (62%), Positives = 241/345 (70%), Gaps = 19/345 (6%)
 Frame = -3

Query  1132  ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTF  953
             + L R+GSGASV++D E  +EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF
Sbjct  37    QRLQRVGSGASVVLDPEVILEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTF  95

Query  952   NEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             NEE +AAR YD+AAQRFRGRDAVTNFKPLSET D    DD  E  FL SHSKAEIVDMLR
Sbjct  96    NEEAQAARAYDVAAQRFRGRDAVTNFKPLSETLD----DDAAELSFLRSHSKAEIVDMLR  151

Query  772   KHTYTDELEQSRRAFNINNMTTPRKPEADR-------SAKSRERLFEKAVTPSDVGKLNR  614
             KHTY DEL+Q +RAF       P    A             RE LF+KAVTPSDVGKLNR
Sbjct  152   KHTYHDELQQGKRAFRAARRNMPAAAAAGGWAFAGPPGGAQREHLFDKAVTPSDVGKLNR  211

Query  613   LVIPKQQAEKHFPLQNGAVTS-KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
             LVIPKQ AEKHFPL  G+ T+ KGVLL FED  GK+WRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  212   LVIPKQHAEKHFPLPTGSATACKGVLLGFEDACGKMWRFRYSYWNSSQSYVLTKGWSRFV  271

Query  436   KEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKST  257
             KEK L+AGD+V+F RSTGPEK+ FIDWK R   G            QV RLFGVNI K+ 
Sbjct  272   KEKRLQAGDVVTFQRSTGPEKRFFIDWKPRAIGGHAKDGL-----FQVVRLFGVNIVKAP  326

Query  256   VSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECS-KKQRVIDA  125
                +         +      K+    V +F+P     KKQ++ D+
Sbjct  327   AVAVGTGDGLDRGVGVVGWSKKGARDVDQFMPSPGYFKKQKIEDS  371



>ref|XP_006302450.1| hypothetical protein CARUB_v10020536mg [Capsella rubella]
 gb|EOA35348.1| hypothetical protein CARUB_v10020536mg [Capsella rubella]
Length=360

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 255/347 (73%), Gaps = 38/347 (11%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +S+++D +NGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  40    LYRMGSGGSSIVLDPDNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  98

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             E+EEAAR YDIAA RFRGRDAV NFK L E         D +  FL  HSKAEIVDMLRK
Sbjct  99    EQEEAARSYDIAALRFRGRDAVVNFKTLLE---------DGDLAFLEVHSKAEIVDMLRK  149

Query  769   HTYTDELEQS--RRAF-NINNMTTPRKPEA----DRSAKSRERLFEKAVTPSDVGKLNRL  611
             HTY DELEQ+  RR F +++   T R   +    D   K+RE LFEKAVTPSDVGKLNRL
Sbjct  150   HTYADELEQNNKRRLFVSLDANGTQRNGSSMVTNDNVLKTREVLFEKAVTPSDVGKLNRL  209

Query  610   VIPKQQAEKHFPLQNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
             VIPKQ AEKHFPL + + +S  KGVL+NFED NGKVWRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  210   VIPKQHAEKHFPLPSKSPSSVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFV  269

Query  436   KEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI-SK  263
             KEK+L+AGD+V+F RSTG ++QL+IDWK R+G            PVQ V RLFGV+I + 
Sbjct  270   KEKNLRAGDVVTFERSTGLDRQLYIDWKVRSGPRET--------PVQVVVRLFGVDIFNV  321

Query  262   STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             +TV P        N++ +  G KR R+   +   L CSKKQ +I+AL
Sbjct  322   NTVKP--------NDVVALCGRKRSRDDADDMFGLRCSKKQAIINAL  360



>gb|AAM63120.1| putative RAV2-like DNA-binding protein [Arabidopsis thaliana]
Length=352

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 218/353 (62%), Positives = 257/353 (73%), Gaps = 37/353 (10%)
 Frame = -3

Query  1150  PATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             P   +   L RMGSG +SV++D ENG+E ES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  27    PPPAAALRLYRMGSGGSSVVLDPENGLETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  85

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNE+EEAAR YDIAA RFRGRDAV NFK + E         D +  FL +HSKA
Sbjct  86    RVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKNVLE---------DGDLAFLEAHSKA  136

Query  793   EIVDMLRKHTYTDELEQS--RRAFNINNMTTPRK----PEADRSAKSRERLFEKAVTPSD  632
             EIVDMLRKHTY DELEQ+  R+ F   +    R      + D+  K+RE LFEKAVTPSD
Sbjct  137   EIVDMLRKHTYADELEQNNKRQLFLSVDANGKRNGSSTTQNDKVLKTREVLFEKAVTPSD  196

Query  631   VGKLNRLVIPKQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             VGKLNRLVIPKQ AEKHFPL + +   +KGVL+NFED NGKVWRFRYSYWNSSQSYVLTK
Sbjct  197   VGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTK  256

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFG  278
             GWSRFVKEK+L+AGD+V+F RSTG E+QL+IDWK R+G           +PVQ V RLFG
Sbjct  257   GWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWKVRSGPRE--------NPVQVVVRLFG  308

Query  277   VNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             V+I + +TV P        N++ +  GGKR R+ V +   L CS KQ +I+AL
Sbjct  309   VDIFNVTTVKP--------NDVVAVCGGKRSRD-VDDMFALRCSNKQAIINAL  352



>gb|AAC49774.1| AP2 domain containing protein RAP2.8 [Arabidopsis thaliana]
Length=334

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 218/353 (62%), Positives = 257/353 (73%), Gaps = 37/353 (10%)
 Frame = -3

Query  1150  PATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             P   +   L RMGSG +SV++D ENG+E ES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  9     PPPAAALRLYRMGSGGSSVVLDPENGLETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  67

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNE+EEAAR YDIAA RFRGRDAV NFK + E         D +  FL +HSKA
Sbjct  68    RVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKNVLE---------DGDLAFLEAHSKA  118

Query  793   EIVDMLRKHTYTDELEQS--RRAFNINNMTTPRK----PEADRSAKSRERLFEKAVTPSD  632
             EIVDMLRKHTY DELEQ+  R+ F   +    R      + D+  K+ E LFEKAVTPSD
Sbjct  119   EIVDMLRKHTYADELEQNNKRQLFLSVDANGKRNGSSTTQNDKVLKTCEVLFEKAVTPSD  178

Query  631   VGKLNRLVIPKQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             VGKLNRLVIPKQ AEKHFPL + +   +KGVL+NFED NGKVWRFRYSYWNSSQSYVLTK
Sbjct  179   VGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTK  238

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFG  278
             GWSRFVKEK+L+AGD+V+F RSTG E+QL+IDWK R+G           +PVQ V RLFG
Sbjct  239   GWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWKVRSGPRE--------NPVQVVVRLFG  290

Query  277   VNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             V+I + +TV P        N++ +  GGKR R+ V +   L CSKKQ +I+AL
Sbjct  291   VDIFNVTTVKP--------NDVVAVCGGKRSRD-VDDMFALRCSKKQAIINAL  334



>ref|XP_010460354.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like isoform X2 [Camelina sativa]
Length=360

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 219/350 (63%), Positives = 250/350 (71%), Gaps = 43/350 (12%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D++NGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  39    LYRMGSGGSSVVLDSDNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  97

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  + T        D E+ FL +HSKAEIVDMLRK
Sbjct  98    EEEEAATSYDIAARRFRGRDAVTNFKSPTTT--------DAESAFLDAHSKAEIVDMLRK  149

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEA----DRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             HTY DELEQSRR F   N        A    D  +++RE LFEKAVTPSDVGKLNRLVIP
Sbjct  150   HTYADELEQSRRKFVNGNGNRCGSETAVSSNDAVSRAREVLFEKAVTPSDVGKLNRLVIP  209

Query  601   KQQAEKHFPL-----QNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             KQ AEKHFPL     + G   S  KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSR
Sbjct  210   KQHAEKHFPLPAMTTETGVSPSPAKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSR  269

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI-  269
             FVKEK+L+AGD+V F RSTGP++QLFIDWK R+             PVQ V RLFGVNI 
Sbjct  270   FVKEKNLRAGDVVCFERSTGPDRQLFIDWKVRSS------------PVQTVVRLFGVNIF  317

Query  268   -SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                +T +P  +A++         GGK+ R    +   L CSKKQ +I+ L
Sbjct  318   NVATTGNPNDVAVE-------FGGGKKKRSRGDDLFSLGCSKKQTMINIL  360



>emb|CDY16133.1| BnaA09g28670D [Brassica napus]
Length=358

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 251/350 (72%), Gaps = 46/350 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D+ENGVE ES RKLPSS+FKGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  40    LYRMGSGGSSVVLDSENGVETES-RKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  98

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  S   DG     D E+ FL +HSKAEIVDMLRK
Sbjct  99    EEEEAAASYDIAARRFRGRDAVTNFK--SPALDG----TDAESAFLEAHSKAEIVDMLRK  152

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQA  590
             HTY DEL+QS+R F   + T       D  +++RE LFEKAVTPSDVGKLNRLVIPKQ A
Sbjct  153   HTYADELQQSKRKF--LDGTAAMSKGNDGVSRAREVLFEKAVTPSDVGKLNRLVIPKQHA  210

Query  589   EKHFPLQNGAVT----------SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             EKHFPL                +KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  211   EKHFPLPAMTTATVVTAMTPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRF  270

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISK  263
             VKEK+L+AGD+V F RSTGP++QL+IDWK              + PVQ V RLFGVNI  
Sbjct  271   VKEKNLRAGDVVCFERSTGPDRQLYIDWKE-------------ITPVQSVVRLFGVNIFN  317

Query  262   STVS--PMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQ-RVIDAL  122
             +T +  P  +A++       C G KR REV  +   L CSKKQ  +I+AL
Sbjct  318   ATTNAKPNDVAVE-------CGGKKRSREV--DLFALGCSKKQTMMINAL  358



>ref|XP_009115339.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Brassica rapa]
Length=372

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 253/356 (71%), Gaps = 44/356 (12%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D+ENGVE ES RKLPSS+FKGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  40    LYRMGSGGSSVVLDSENGVETES-RKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  98

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  S   DG     D E+ FL +HSKAEIVDMLRK
Sbjct  99    EEEEAAASYDIAARRFRGRDAVTNFK--SPALDG----TDAESAFLEAHSKAEIVDMLRK  152

Query  769   HTYTDELEQSRRAFNINN------MTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLV  608
             HTY DEL+QS+R F   N       T       D  +++RE LFEKAVTPSDVGKLNRLV
Sbjct  153   HTYADELQQSKRKFLDGNGKRCGSGTAAMSKGNDGVSRAREVLFEKAVTPSDVGKLNRLV  212

Query  607   IPKQQAEKHFPLQNGAVT----------SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             IPKQ AEKHFPL                +KGVL+N ED  GKVWRFRYSYWNSSQSYVLT
Sbjct  213   IPKQHAEKHFPLPAMTTATVVTAMTPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLT  272

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLF  281
             KGWSRFVKEK+L+AGD+V F RSTGP++QL+IDWK ++G          + PVQ V RLF
Sbjct  273   KGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIDWKVQSGKEE-------ITPVQSVVRLF  325

Query  280   GVNISKSTVS--PMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQ-RVIDAL  122
             GVNI   T +  P  +A++       C G KR REV  +   L CSKKQ  +I+AL
Sbjct  326   GVNIFNETTNAKPNDVAVE-------CGGKKRSREV--DLFALGCSKKQTMMINAL  372



>emb|CDY36099.1| BnaA08g19490D [Brassica napus]
Length=350

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 240/340 (71%), Gaps = 30/340 (9%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D ENGVE ES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  36    LYRMGSGGSSVVLDLENGVETESSRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  95

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFK-PLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             EEEEAA  YDIAA+RFRGRDAVTNFK P S          D E+ FL +HSKAE+VDMLR
Sbjct  96    EEEEAAASYDIAARRFRGRDAVTNFKSPAS----------DAESAFLEAHSKAEVVDMLR  145

Query  772   KHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQ  593
             KHTY DEL QS R        T    E D    SRE LFEK VTPSDVGKLNRLVIPKQ 
Sbjct  146   KHTYADELRQSERKKRCEFSKTTVTNEND--GVSREVLFEKTVTPSDVGKLNRLVIPKQH  203

Query  592   AEKHFPLQNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLK  419
             AEKHFPL      S  KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+L+
Sbjct  204   AEKHFPLPVTVTPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLR  263

Query  418   AGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISKSTVSPMA  242
             AGD+V F RS+GP++QL+IDWK R+G          + PVQ V RLFGVNI     +   
Sbjct  264   AGDVVCFERSSGPDRQLYIDWKVRSGIEK-------ITPVQNVVRLFGVNI----FNATT  312

Query  241   MAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                +T + +      KR REV  +   L CSKKQ +I+ L
Sbjct  313   TNANTNDVVGESGSKKRFREV--DLFALGCSKKQAIINVL  350



>gb|KFK35073.1| hypothetical protein AALP_AA5G231800 [Arabis alpina]
Length=333

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 213/345 (62%), Positives = 243/345 (70%), Gaps = 42/345 (12%)
 Frame = -3

Query  1138  SPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             SP SL RMGSG SV++D ENG+EAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG
Sbjct  25    SPASLYRMGSGTSVVLDPENGIEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  83

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TFNEEEEAAR YD+AA RFRGRDAV NF      TD     DD E  FL++H+K+EIVDM
Sbjct  84    TFNEEEEAARAYDVAAHRFRGRDAVKNF------TDSNGDYDDDEDSFLNAHAKSEIVDM  137

Query  778   LRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPK  599
             LRKHTY +ELEQ +R  N  N+            KS E LFEK VTPSDVGKLNRLVIPK
Sbjct  138   LRKHTYKEELEQRKRKRN-GNLKETAFITVLTGFKSAEYLFEKTVTPSDVGKLNRLVIPK  196

Query  598   QQAEKHF--PLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
              QAEKHF  PL N  V+ KG LLNFED NGK+WRFRYSYWNSSQSYVLTKGWSRFVKEK 
Sbjct  197   HQAEKHFPLPLANNNVSVKGTLLNFEDVNGKMWRFRYSYWNSSQSYVLTKGWSRFVKEKR  256

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNG----TGSPDISTVPVHPVQVFRLFGVNISKST  257
             L AGD++SF RS G ++QL+I  K+R+G    TG            +V RLFGV+IS   
Sbjct  257   LCAGDLISFKRSNGQDQQLYIGSKSRSGLDQVTG------------RVVRLFGVDIS---  301

Query  256   VSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                   ++ + N ++       ++E   E L L C+KKQRV DAL
Sbjct  302   ------SVKSQNGVA-------VKEDTSEMLLLRCNKKQRVFDAL  333



>ref|XP_002890683.1| hypothetical protein ARALYDRAFT_890147 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66942.1| hypothetical protein ARALYDRAFT_890147 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 248/349 (71%), Gaps = 44/349 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  39    LYRMGSGGSSVVLDSENGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  97

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK      DG    ++ E+ FL +HSKAEIVDMLRK
Sbjct  98    EEEEAATSYDIAARRFRGRDAVTNFK---SQVDG----NEAESAFLDAHSKAEIVDMLRK  150

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEA-----DRSAKSRERLFEKAVTPSDVGKLNRLVI  605
             HTY DE EQS+R F +N        E      D   ++RE LFEK VTPSDVGKLNRLVI
Sbjct  151   HTYADEFEQSKRKF-VNGKGRHCGSETAMQGNDAVLRAREVLFEKTVTPSDVGKLNRLVI  209

Query  604   PKQQAEKHFPLQNGAVT-------SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWS  446
             PKQ AEKHFPL             +KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWS
Sbjct  210   PKQHAEKHFPLPATTTAMGMSPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWS  269

Query  445   RFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI  269
             RFVKEK+L+AGD+V F RSTGP++QL+IDWK R+             PVQ V RLFGVNI
Sbjct  270   RFVKEKNLRAGDVVCFERSTGPDRQLYIDWKVRSS------------PVQTVVRLFGVNI  317

Query  268   SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                      ++ +  N+++   GGKR REV  +   L CSKKQ +I+ L
Sbjct  318   -------FNVSNEKPNDVAVECGGKRSREV--DLFSLGCSKKQAIINVL  357



>ref|XP_009152116.1| PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and B3 domain-containing 
transcription factor ARF14 [Brassica rapa]
Length=344

 Score =   394 bits (1011),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 255/359 (71%), Gaps = 41/359 (11%)
 Frame = -3

Query  1171  HASALNLPATK----SPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGR  1004
             H  A   PAT     SP SL RMGSG+SV++D+ENGVEAES RKLPSSRFKGVVPQPNGR
Sbjct  18    HTPAKIPPATARKSPSPASLYRMGSGSSVVLDSENGVEAES-RKLPSSRFKGVVPQPNGR  76

Query  1003  WGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYE  824
             WGAQIYEKHQRVWLGTFNEEEEAAR YD+AA RFRGRDAVTNFK  ++TT G NGD   E
Sbjct  77    WGAQIYEKHQRVWLGTFNEEEEAARAYDVAAHRFRGRDAVTNFK--ADTTLG-NGD---E  130

Query  823   AVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA---KSRERLFE  653
               FL++HSKAEIVDMLRKHTY +ELEQ +R  +    T      A R A   K+ E LFE
Sbjct  131   VEFLNAHSKAEIVDMLRKHTYKEELEQRKRNLHGKGNTKETAFAAVRVATGFKTAETLFE  190

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQ-NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             KAVTPSD G+LNR VIPK QAEKHFPL  +G V+ +G LLNFED NGKVWRFRYSYWNSS
Sbjct  191   KAVTPSDAGELNRXVIPKHQAEKHFPLPLSGDVSVRGTLLNFEDVNGKVWRFRYSYWNSS  250

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK L AGD++SF RS G ++QL+I WK+++ +   D  T  V    
Sbjct  251   QSYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWKSKSES---DQDTGRV----  303

Query  295   VFRLFGVNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             V RLFGV+I S  + S + M  +T                  E L L C+KKQR++  +
Sbjct  304   VVRLFGVDITSLKSQSDVVMKEET------------------EMLSLRCNKKQRLVTTI  344



>ref|XP_007143801.1| hypothetical protein PHAVU_007G102800g [Phaseolus vulgaris]
 gb|ESW15795.1| hypothetical protein PHAVU_007G102800g [Phaseolus vulgaris]
Length=361

 Score =   394 bits (1011),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 253/367 (69%), Gaps = 43/367 (12%)
 Frame = -3

Query  1159  LNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             L+LP  +SP  L R+GSG  V  DA +G EAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  17    LSLPPNQSPPPLIRVGSGG-VDPDAVSG-EAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  73

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTFNEE+EAAR YDIAAQRFRGRDAVTNFKPL+         DD E+ FL+SHS
Sbjct  74    HQRVWLGTFNEEDEAARAYDIAAQRFRGRDAVTNFKPLA------GAGDDAESEFLNSHS  127

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKL  620
             K+EIVDMLRKHTY DEL+QS R              A    ++RE+LFEK VTPSDVGKL
Sbjct  128   KSEIVDMLRKHTYDDELQQSTRCGRRRRAAEAASSGA-FDPQAREQLFEKTVTPSDVGKL  186

Query  619   NRLVIPKQQAEKHFPLQNG----------AVTSKGVLLNFEDTNGKVWRFRYSYWNSSQS  470
             NRLVIPKQ AEKHFPL  G          A  +KGVLLNFED  GKVWRFRYSYWNSSQS
Sbjct  187   NRLVIPKQHAEKHFPLSTGSGSGVSLCTAAAAAKGVLLNFEDVGGKVWRFRYSYWNSSQS  246

Query  469   YVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIST-------VP  311
             YVLTKGWSRFVKE +L+AGD V F +STGP++QL+ID KAR+  G  +++        VP
Sbjct  247   YVLTKGWSRFVKENNLRAGDAVRFFKSTGPDRQLYIDCKARSSGGICELNNNNAGGLFVP  306

Query  310   VHP----VQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKK  143
             V P    VQ+ RLFGVN+ K         +  ++ +     GKR     ME    ECSKK
Sbjct  307   VGPVVEQVQMVRLFGVNLLK---------LPGSDGVRVGYEGKRKE---MELFAFECSKK  354

Query  142   QRVIDAL  122
              +VI AL
Sbjct  355   LKVIGAL  361



>ref|XP_006395630.1| hypothetical protein EUTSA_v10004508mg [Eutrema salsugineum]
 gb|ESQ32916.1| hypothetical protein EUTSA_v10004508mg [Eutrema salsugineum]
Length=345

 Score =   393 bits (1009),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 249/340 (73%), Gaps = 41/340 (12%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  947
             L RMGSG+SV++D++NGVEAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNE
Sbjct  38    LHRMGSGSSVVLDSDNGVEAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  96

Query  946   EEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKH  767
             E+EAAR YD+AA RFRGRDAVTNF   +ET    NGD D E  FL++HSK+EIVDMLRKH
Sbjct  97    EDEAARAYDVAAYRFRGRDAVTNF--TAET----NGDKD-EVDFLNAHSKSEIVDMLRKH  149

Query  766   TYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKAVTPSDVGKLNRLVIPK  599
             TY +ELEQ +R  + N     RK  A  +A    KS E LFEKAVTPSDVGKLNRLVIPK
Sbjct  150   TYKEELEQRKRNRDGNG---KRKETAFVTAVTGFKSAESLFEKAVTPSDVGKLNRLVIPK  206

Query  598   QQAEKHFPL-QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSL  422
              QAEKHFPL   G V+ KG LLNFED NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L
Sbjct  207   HQAEKHFPLPLAGDVSVKGTLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKRL  266

Query  421   KAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMA  242
              AGD++SF RS G ++QL+I W++++G+   D  T  V    V RLFGV+ISKS  + + 
Sbjct  267   CAGDLISFRRSNGQDRQLYIGWESKSGS---DQDTGRV----VMRLFGVDISKSLNNAV-  318

Query  241   MAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                              ++E   E L L C KK+RV DA 
Sbjct  319   -----------------VKEEETEMLSLRCYKKRRVFDAF  341



>ref|XP_010499095.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Camelina sativa]
Length=362

 Score =   393 bits (1010),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 218/358 (61%), Positives = 253/358 (71%), Gaps = 44/358 (12%)
 Frame = -3

Query  1159  LNLPATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYE  983
             L+ P   +   L RMGSG +SV++D++NGVE ES RKLPSS++KGVVPQPNGRWGAQIYE
Sbjct  29    LSSPPPSTTTRLYRMGSGGSSVVLDSDNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYE  87

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             KHQRVWLGTFNEEEEAA  YDIAA+RFRGRDAVTNFK  + T        D E+ FL +H
Sbjct  88    KHQRVWLGTFNEEEEAATSYDIAARRFRGRDAVTNFKSPTTT--------DAESAFLDAH  139

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEA----DRSAKSRERLFEKAVTPS  635
             SKAEIVDMLRKHTY DELEQSRR F   N        A    D  +++RE LFEKAVTPS
Sbjct  140   SKAEIVDMLRKHTYADELEQSRRKFVNGNGNRCGSETAVSSNDAVSRAREVLFEKAVTPS  199

Query  634   DVGKLNRLVIPKQQAEKHFPL-----QNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSS  476
             DVGKLNRLVIPKQ AEKHFPL     + G   S  KGVL+N ED  GKVWRFRYSYWNSS
Sbjct  200   DVGKLNRLVIPKQHAEKHFPLPAMTTETGVSPSPAKGVLINLEDRTGKVWRFRYSYWNSS  259

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK+L+AGD+V F RSTGP++QL+IDWK R+             PVQ
Sbjct  260   QSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIDWKVRSS------------PVQ  307

Query  295   -VFRLFGVNI-SKSTVSPMAMAMDTTNNIS-SCSGGKRIREVVMEFLPLECSKKQRVI  131
              V RLFGVNI + +T  P       +N+++  C GGK+ R    +   L C KKQ ++
Sbjct  308   TVVRLFGVNIFNVTTTGP-------SNDVAVECGGGKK-RSREDDLFSLGCPKKQTMM  357



>ref|XP_010415512.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2 [Camelina sativa]
Length=354

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 252/352 (72%), Gaps = 35/352 (10%)
 Frame = -3

Query  1150  PATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             P+  +   L RMGSG +SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  29    PSQAAAFHLYRMGSGGSSVVLDSENGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  87

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNE+EEAAR YDIAA RFRGRDAV NFK L          DD +  FL +HSKA
Sbjct  88    RVWLGTFNEQEEAARSYDIAALRFRGRDAVVNFKTLL---------DDGDLAFLEAHSKA  138

Query  793   EIVDMLRKHTYTDELEQS--RRAFNINNMTTPRKPEA----DRSAKSRERLFEKAVTPSD  632
             EIVDM+RKHTY DELEQ+  RR     +    R   +    D   K+RE LFEKAVTPSD
Sbjct  139   EIVDMVRKHTYADELEQNNKRRLLLSVDANGKRNGSSTVLNDNVLKTREVLFEKAVTPSD  198

Query  631   VGKLNRLVIPKQQAEKHFPL-QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             VGKLNRLVIPKQ AEKHFPL       +KGVL+NFED NGKVWRFRYSYWNSSQSYVLTK
Sbjct  199   VGKLNRLVIPKQHAEKHFPLPSRSPSVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTK  258

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GWSRFVKEK L+AGD+V+F RSTG ++QL+IDWK R+G   P  + V V    V RLFGV
Sbjct  259   GWSRFVKEKHLRAGDVVTFERSTGLDRQLYIDWKVRSG---PRENPVKV----VVRLFGV  311

Query  274   NI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             +I   +TV P        N++ +  G KR R+   +   L CSKKQ +I+AL
Sbjct  312   DIFDVNTVKP--------NDVVAVCGRKRSRD-ADDMFGLRCSKKQAIINAL  354



>ref|XP_010460353.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like isoform X1 [Camelina sativa]
Length=361

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 249/347 (72%), Gaps = 44/347 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D++NGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  39    LYRMGSGGSSVVLDSDNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  97

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIAA+RFRGRDAVTNFK  + T        D E+ FL +HSKAEIVDMLRK
Sbjct  98    EEEEAATSYDIAARRFRGRDAVTNFKSPTTT--------DAESAFLDAHSKAEIVDMLRK  149

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEA----DRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             HTY DELEQSRR F   N        A    D  +++RE LFEKAVTPSDVGKLNRLVIP
Sbjct  150   HTYADELEQSRRKFVNGNGNRCGSETAVSSNDAVSRAREVLFEKAVTPSDVGKLNRLVIP  209

Query  601   KQQAEKHFPL-----QNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             KQ AEKHFPL     + G   S  KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSR
Sbjct  210   KQHAEKHFPLPAMTTETGVSPSPAKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSR  269

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI-  269
             FVKEK+L+AGD+V F RSTGP++QL+IDWK R+             PVQ V RLFGVNI 
Sbjct  270   FVKEKNLRAGDVVCFERSTGPDRQLYIDWKVRSS------------PVQTVVRLFGVNIF  317

Query  268   SKSTVSPMAMAMDTTNNIS-SCSGGKRIREVVMEFLPLECSKKQRVI  131
             + +T  P       +N+++  C GGK+ R    +   L C KKQ ++
Sbjct  318   NVTTTGP-------SNDVAVECGGGKK-RSREDDLFSLGCPKKQTMM  356



>ref|XP_009118012.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Brassica rapa]
Length=340

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 217/348 (62%), Positives = 251/348 (72%), Gaps = 36/348 (10%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQR  971
             PA K+  +L RMGSG+SV++DAENG EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQR
Sbjct  24    PA-KTSVNLHRMGSGSSVVLDAENGAEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQR  81

Query  970   VWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAE  791
             VWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK      D R   DD E  FL++HSK+E
Sbjct  82    VWLGTFNEEDEAARSYDVAVHRFRGRDAVTNFK------DARL--DDGEVEFLNTHSKSE  133

Query  790   IVDMLRKHTYTDELEQSRR----AFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGK  623
             IVDMLRKHTY++ELEQS+R    + N    TT     +    +S   LFEKAVTPSDVGK
Sbjct  134   IVDMLRKHTYSEELEQSKRRRNGSGNAVRSTTQNDGVSTTEFRSAVSLFEKAVTPSDVGK  193

Query  622   LNRLVIPKQQAEKHFPLQ-NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWS  446
             LNRLVIPK  AEK+FPL  +  V+ KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWS
Sbjct  194   LNRLVIPKHHAEKYFPLPPSSNVSVKGVLLNFEDVAGKVWRFRYSYWNSSQSYVLTKGWS  253

Query  445   RFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNIS  266
             RFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+   D+ T      +V RLFGVNI 
Sbjct  254   RFVKEKNLRAGDVVSFSRSDGQDQQLYIGWKSRSGS---DVET-----GRVLRLFGVNI-  304

Query  265   KSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                 SP     D         G KR+     E L L CSKKQR+  AL
Sbjct  305   ----SPAGSRNDVV-------GNKRVVNDT-EMLSLVCSKKQRIFHAL  340



>ref|XP_010511905.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Camelina sativa]
Length=358

 Score =   391 bits (1005),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 252/349 (72%), Gaps = 41/349 (12%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  37    LYRMGSGGSSVVLDLENGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  95

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             E+EEAAR YDIAA RFRGRDAV NFK L E         D +  FL +HSKAEIVDMLRK
Sbjct  96    EQEEAARSYDIAALRFRGRDAVVNFKTLLE---------DGDLAFLEAHSKAEIVDMLRK  146

Query  769   HTYTDELEQSRR-----AFNINNMTTPRKPEA-DRSAKSRERLFEKAVTPSDVGKLNRLV  608
             HTY DELEQ+ +     +F+ N           D   ++RE LFEKAVTPSDVGKLNRLV
Sbjct  147   HTYVDELEQNNKRRLLLSFDANGKRNGSSTALNDNVLRTREVLFEKAVTPSDVGKLNRLV  206

Query  607   IPKQQAEKHFPLQNGAV-----TSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSR  443
             IPKQ AEKHFPL + +       +KGVL+NFED NGKVWRFRYSYWNSSQSYVLTKGWSR
Sbjct  207   IPKQHAEKHFPLPSRSPSRSPSVTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTKGWSR  266

Query  442   FVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI-  269
             FVKEK+L+AGD+V+F RSTG ++QL+IDWK R+G           +PVQ V RLFGV+I 
Sbjct  267   FVKEKNLRAGDVVTFQRSTGLDQQLYIDWKVRSGPRE--------NPVQVVVRLFGVDIF  318

Query  268   SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             + +TV P        N++ +  G KR R V  +   L CSKKQ +++AL
Sbjct  319   NVNTVKP--------NDVVAVCGRKRSR-VADDMFGLRCSKKQTIVNAL  358



>emb|CDY58354.1| BnaCnng33070D [Brassica napus]
Length=326

 Score =   390 bits (1002),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 218/345 (63%), Positives = 249/345 (72%), Gaps = 41/345 (12%)
 Frame = -3

Query  1153  LPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             +   K+  +L RMGSG+SV++DAENG EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQ
Sbjct  22    ITPAKTSVNLHRMGSGSSVVLDAENGAEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQ  80

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTFNEE+EAAR YD+A  RFRGRDAVTNFK      D R   DD E  FLSSHSK+
Sbjct  81    RVWLGTFNEEDEAARSYDVAVHRFRGRDAVTNFK------DARL--DDGEVEFLSSHSKS  132

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNR  614
              IVDMLRKHTY++ELEQS+R  N N         A RSA S   LFEKAVTPSDVGKLNR
Sbjct  133   GIVDMLRKHTYSEELEQSKRRRNGNG-------NAVRSAVS---LFEKAVTPSDVGKLNR  182

Query  613   LVIPKQQAEKHFPLQ-NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
             LVIPK  AEK+FPL  +  V+ KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  183   LVIPKHHAEKYFPLPPSSNVSVKGVLLNFEDVAGKVWRFRYSYWNSSQSYVLTKGWSRFV  242

Query  436   KEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKST  257
             KEK+L+AGD+VSF RS G ++QL+I WK+R+G+   D+ T      +V RLFGVN     
Sbjct  243   KEKNLRAGDVVSFSRSDGQDQQLYIGWKSRSGS---DVET-----GRVLRLFGVN-----  289

Query  256   VSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             VSP     D         G KR+     E L L CSKK+R+  AL
Sbjct  290   VSPAGSRNDVV-------GNKRVVNDT-EMLSLVCSKKRRIFHAL  326



>ref|XP_009109894.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Brassica rapa]
Length=359

 Score =   391 bits (1004),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 243/347 (70%), Gaps = 35/347 (10%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D ENGVE ES RKLPSSR KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  36    LYRMGSGGSSVVLDLENGVETESSRKLPSSRSKGVVPQPNGRWGAQIYEKHQRVWLGTFN  95

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFK-PLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             EEEEAA  YDIAA+RFRGRDAVTNFK P S          D E+ FL +HSKAE+VDMLR
Sbjct  96    EEEEAAASYDIAARRFRGRDAVTNFKSPAS----------DAESAFLEAHSKAEVVDMLR  145

Query  772   KHTYTDELEQSRRAFNINNMTTPRKPEADRS-------AKSRERLFEKAVTPSDVGKLNR  614
             KHTY DEL QS R F   +    ++ E  ++         SRE LFEK VTPSDVGKLNR
Sbjct  146   KHTYADELRQSERKFLDGDGNGRKRCEFSKTTVTNENDGVSREVLFEKTVTPSDVGKLNR  205

Query  613   LVIPKQQAEKHFPLQNGAVTS--KGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             LVIPKQ AEKHFPL      S  KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  206   LVIPKQHAEKHFPLPVTVTPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRF  265

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISK  263
             VKEK+L+AGD+V F RS+GP++QL+IDWK R+G          + PVQ V RLFGVNI  
Sbjct  266   VKEKNLRAGDVVCFERSSGPDRQLYIDWKVRSGIEK-------ITPVQNVVRLFGVNI--  316

Query  262   STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                +      +T + +      KR REV  +   L CSKKQ +I+ L
Sbjct  317   --FNATTTNANTNDVVGESGSKKRFREV--DLFALGCSKKQAIINVL  359



>ref|XP_002875273.1| hypothetical protein ARALYDRAFT_484335 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51532.1| hypothetical protein ARALYDRAFT_484335 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 248/352 (70%), Gaps = 44/352 (13%)
 Frame = -3

Query  1156  NLPATKS--PESLC-RMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIY  986
             ++PA KS  P SL  RMGSG SV++D+ENGVEAES RKLPSSRFKGVVPQPNGRWGAQIY
Sbjct  16    SVPARKSSSPASLLYRMGSGTSVVLDSENGVEAES-RKLPSSRFKGVVPQPNGRWGAQIY  74

Query  985   EKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSS  806
             EKHQRVWLGTFNEE+EAAR YD+AA RFRGRDAVTNFK   ETT      DD E  FL++
Sbjct  75    EKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFK---ETTF-----DDDEVDFLNA  126

Query  805   HSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKAVTP  638
             HSK+EIVDMLRKHTY +ELEQ +R  N N   T        +     K+ E LFEK VTP
Sbjct  127   HSKSEIVDMLRKHTYKEELEQRKRNRNGNGNKTTEFGSVTVAVITGFKTSELLFEKTVTP  186

Query  637   SDVGKLNRLVIPKQQAEKHFPL--QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYV  464
             SDVGKLNRLVIPK QAEKHFPL   N  V+ KG+LLNFED NGKVWRFRYSYWNSSQSYV
Sbjct  187   SDVGKLNRLVIPKHQAEKHFPLPLGNNNVSVKGILLNFEDVNGKVWRFRYSYWNSSQSYV  246

Query  463   LTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRL  284
             LTKGWSRFVKEK L AGD++SF RS G +++LFI WK++ G+GS           +V RL
Sbjct  247   LTKGWSRFVKEKRLCAGDLISFKRSNGQDQKLFIGWKSKFGSGSDQ------ETGRVVRL  300

Query  283   FGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECS-KKQRVI  131
             FGV+IS + V  +  A +                    F  L C+ KKQRV+
Sbjct  301   FGVDISLNDVVVLKEATEV-------------------FSSLRCNKKKQRVL  333



>emb|CDY72302.1| BnaAnng40580D [Brassica napus]
Length=326

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 216/341 (63%), Positives = 249/341 (73%), Gaps = 41/341 (12%)
 Frame = -3

Query  1141  KSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWL  962
             K+  +L RMGSG+SV++DAENG EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWL
Sbjct  26    KTSVNLHRMGSGSSVVLDAENGAEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWL  84

Query  961   GTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVD  782
             GTFNEE+EAAR YD+A  RFRGRDAVTNFK      D R   DD E  FL++HSK+EIVD
Sbjct  85    GTFNEEDEAARSYDVAVHRFRGRDAVTNFK------DARL--DDGEVEFLNTHSKSEIVD  136

Query  781   MLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             MLRKHTY++ELEQS+R  N +         A RSA S   LFEKAVTPSDVGKLNRLVIP
Sbjct  137   MLRKHTYSEELEQSKRRRNGSG-------NAFRSAVS---LFEKAVTPSDVGKLNRLVIP  186

Query  601   KQQAEKHFPLQ-NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
             K  AEK+FPL  +  V+ KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+
Sbjct  187   KHHAEKYFPLPPSSNVSVKGVLLNFEDVAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKN  246

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPM  245
             L+AGD+VSF RS G ++QL+I WK+R+G+   D+ T      +V RLFGVNI     SP 
Sbjct  247   LRAGDVVSFSRSDGQDQQLYIGWKSRSGS---DVET-----GRVLRLFGVNI-----SPA  293

Query  244   AMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                 D         G KR+     E L L CSKK+R+  AL
Sbjct  294   GSRNDVV-------GNKRVVNDT-EMLSLVCSKKRRIFHAL  326



>ref|NP_173927.1| AP2/ERF and B3 domain-containing transcription repressor TEM1 
[Arabidopsis thaliana]
 sp|Q9C6M5.1|RAVL1_ARATH RecName: Full=AP2/ERF and B3 domain-containing transcription 
repressor TEM1; AltName: Full=Protein TEMPRANILLO 1; AltName: 
Full=RAV1-like ethylene-responsive transcription factor TEM1 
[Arabidopsis thaliana]
 gb|AAG50808.1|AC079281_10 DNA-binding protein RAV2, putative [Arabidopsis thaliana]
 gb|AAM13889.1| putative DNA-binding protein RAV2 [Arabidopsis thaliana]
 gb|AAM67474.1| putative DNA-binding protein RAV2 [Arabidopsis thaliana]
 gb|AEE30642.1| AP2/ERF and B3 domain-containing transcription repressor TEM1 
[Arabidopsis thaliana]
Length=361

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 216/350 (62%), Positives = 245/350 (70%), Gaps = 45/350 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             L RMGSG +SV++D+ENGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  42    LYRMGSGGSSVVLDSENGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  100

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EEEEAA  YDIA +RFRGRDAVTNFK      DG    +D E+ FL +HSKAEIVDMLRK
Sbjct  101   EEEEAASSYDIAVRRFRGRDAVTNFK---SQVDG----NDAESAFLDAHSKAEIVDMLRK  153

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEA-----DRSAKSRERLFEKAVTPSDVGKLNRLVI  605
             HTY DE EQSRR F +N        E      D   ++RE LFEK VTPSDVGKLNRLVI
Sbjct  154   HTYADEFEQSRRKF-VNGDGKRSGLETATYGNDAVLRAREVLFEKTVTPSDVGKLNRLVI  212

Query  604   PKQQAEKHFPLQNGAVT-------SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWS  446
             PKQ AEKHFPL             +KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKGWS
Sbjct  213   PKQHAEKHFPLPAMTTAMGMNPSPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKGWS  272

Query  445   RFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNI  269
             RFVKEK+L+AGD+V F RSTGP++QL+I WK R+             PVQ V RLFGVNI
Sbjct  273   RFVKEKNLRAGDVVCFERSTGPDRQLYIHWKVRSS------------PVQTVVRLFGVNI  320

Query  268   -SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
              + S   P  +A++       C G KR RE   +   L CSKKQ +I+ L
Sbjct  321   FNVSNEKPNDVAVE-------CVGKKRSRE--DDLFSLGCSKKQAIINIL  361



>ref|XP_009409674.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os05g0549800-like 
[Musa acuminata subsp. malaccensis]
Length=329

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 229/308 (74%), Gaps = 14/308 (5%)
 Frame = -3

Query  1150  PATKSP--ESLCRMGSGASVIIDA--ENGVEAE--SGRKLPSSRFKGVVPQPNGRWGAQI  989
             P   SP  + + RMGSG SV+ D   E G+EAE  SGR+LPSSR+KGVVPQPNGRWGAQI
Sbjct  17    PEVPSPVADPIRRMGSGVSVVFDPTPEVGIEAEAESGRRLPSSRYKGVVPQPNGRWGAQI  76

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLS  809
             YE+HQRVWLGTF +E EAARVYD+AAQRFRGRDAVTNFKPLSE+ D    +D     FL+
Sbjct  77    YERHQRVWLGTFGDEAEAARVYDVAAQRFRGRDAVTNFKPLSESDD----EDSMVLFFLA  132

Query  808   SHSKAEIVDMLRKHTYTDELEQSRRAFNI-NNMTTPRKPEADRSAKSRERLFEKAVTPSD  632
             +HSKAEIVDMLRKHTY DEL+QS+R     + M   R+         RE LF+K VTPSD
Sbjct  133   AHSKAEIVDMLRKHTYHDELQQSKRFHAAGHGMGFGRRRMPSYYGSVRELLFDKVVTPSD  192

Query  631   VGKLNRLVIPKQQAEKHFPLQNG-AVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             VGKLNRLVIPKQ AEKHFPL+ G A   +GVLLNFED  GK+WRFRYSYWNSSQSYV+TK
Sbjct  193   VGKLNRLVIPKQHAEKHFPLKAGTAAACEGVLLNFEDATGKMWRFRYSYWNSSQSYVITK  252

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GW RFVKEKSLKAGD VSF RS GPEK LFID K R    S   +T PV P   FRLFGV
Sbjct  253   GWIRFVKEKSLKAGDTVSFWRSMGPEKHLFIDRKPRPENTS--CTTKPVRPAHAFRLFGV  310

Query  274   NISKSTVS  251
              IS+   S
Sbjct  311   TISELPAS  318



>ref|XP_006366067.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Solanum tuberosum]
Length=371

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 226/377 (60%), Positives = 252/377 (67%), Gaps = 56/377 (15%)
 Frame = -3

Query  1150  PATKSPESLCR-MGSGASVIIDAE--NGVEAESGRK------LPSSRFKGVVPQPNGRWG  998
             P+T  P    R MGSG SVI+DA+  NGVEAES         LPSS+FKGVVPQPNGRWG
Sbjct  17    PSTIFPAERPRQMGSGVSVILDADSTNGVEAESKNNTSNNNKLPSSKFKGVVPQPNGRWG  76

Query  997   AQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAV  818
             AQIYEKHQR+WLGTFN EEEAA+ YDIAAQRFRGRDAVTNFKPL    D     ++ E  
Sbjct  77    AQIYEKHQRIWLGTFNGEEEAAKAYDIAAQRFRGRDAVTNFKPL---FDKYCQTEEIEIS  133

Query  817   FLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNM--------------TTPRKPEADRS  680
             FL+S SK EIVDMLRKHTY DELE +++ +NINN               T         +
Sbjct  134   FLNSRSKVEIVDMLRKHTYNDELEHAKKVYNINNFEKNGRRTCHTNDIATFSLDANEKVA  193

Query  679   AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL---QNG-AVTSKGVLLNFEDTNGK  512
               +RE LFEKAVTPSDVGKLNRLVIPKQ AE++FPL    NG   TS G LLNFED NGK
Sbjct  194   NIARELLFEKAVTPSDVGKLNRLVIPKQHAERYFPLVAKVNGNGNTSNGELLNFEDMNGK  253

Query  511   VWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTG---PEKQLFIDWKARNG  341
             +WRFRYSYWNSSQSYVLTKGWSR+VKE  LKAGDIVSF RS G    +KQLFID K R  
Sbjct  254   MWRFRYSYWNSSQSYVLTKGWSRYVKENKLKAGDIVSFKRSFGVGVEDKQLFIDSKTR--  311

Query  340   TGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNI---SSCSGGKRIREVVME  170
                     +    V+V RLFGVNI K          D +NN+    + S GKR+RE  ME
Sbjct  312   -------IIRSEQVKVVRLFGVNICK--------VQDVSNNVVVEKNMSVGKRMRE--ME  354

Query  169   FLPLECSKKQRV-IDAL  122
              L  ECSKKQRV IDAL
Sbjct  355   LLAFECSKKQRVIIDAL  371



>ref|XP_003556265.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Glycine max]
Length=362

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 216/374 (58%), Positives = 262/374 (70%), Gaps = 50/374 (13%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGV---EAESGRKLPSSRFKGVVPQPNGRWG  998
             +++L++PA  SP  L  +GSGA+ ++  +      EAES RKLPSS++KGVVPQPNGRWG
Sbjct  14    SNSLSVPANLSPPPLSLVGSGATAVVYPDGCCVSGEAES-RKLPSSKYKGVVPQPNGRWG  72

Query  997   AQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAV  818
             AQIYEKHQRVWLGTFNEE+EAAR YDIAA RFRGRDAVTNFKPL+       G DD EA 
Sbjct  73    AQIYEKHQRVWLGTFNEEDEAARAYDIAAHRFRGRDAVTNFKPLA-------GADDAEAE  125

Query  817   FLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS------AKSRERLF  656
             FLS+HSK+EIVDMLRKHTY +EL+QS R          R+ +A+ +      AK+RE+LF
Sbjct  126   FLSTHSKSEIVDMLRKHTYDNELQQSTRGGR-------RRRDAETASSGAFDAKAREQLF  178

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQ---NGAV-------TSKGVLLNFEDTNGKVW  506
             EK VT SDVGKLNRLVIPKQ AEKHFPL     GA+        +KG+LLNFED  GKVW
Sbjct  179   EKTVTQSDVGKLNRLVIPKQHAEKHFPLSGSGGGALPCMAAAAGAKGMLLNFEDVGGKVW  238

Query  505   RFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPD  326
             RFRYSYWNSSQSYVLTKGWSRFVKEK+L+AGD V F +STG ++QL+ID KAR+G  + +
Sbjct  239   RFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDAVQFFKSTGLDRQLYIDCKARSGKVNNN  298

Query  325   IST--VP----VHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFL  164
              +   +P    V PVQ+ RLFGV++ K       + +  ++ I     GKR     ME  
Sbjct  299   AAGLFIPVGPVVEPVQMVRLFGVDLLK-------LPVPGSDGIGVGCDGKRKE---MELF  348

Query  163   PLECSKKQRVIDAL  122
               ECSKK +VI AL
Sbjct  349   AFECSKKLKVIGAL  362



>ref|XP_010926493.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Elaeis guineensis]
Length=338

 Score =   385 bits (990),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 198/296 (67%), Positives = 227/296 (77%), Gaps = 15/296 (5%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWL  962
             PE L RMGSG SV++D   + G+EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWL
Sbjct  21    PEPLRRMGSGGSVVLDPTPDIGLEAES-RKLPSSQYKGVVPQPNGRWGAQIYEKHQRVWL  79

Query  961   GTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVD  782
             GTF EE +AAR YD+AAQRFRGR+AVTNF PLSE  D    D   E  FL+ HSKAEIVD
Sbjct  80    GTFAEEADAARAYDVAAQRFRGREAVTNFTPLSENDD----DGAAELAFLADHSKAEIVD  135

Query  781   MLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             MLRKHTY DEL QS+RA   +  T  ++        +R+ LF KAVTPSDVGKLNRLVIP
Sbjct  136   MLRKHTYCDELRQSKRAGTTSGSTVGKRNPLSSLGLARDLLFSKAVTPSDVGKLNRLVIP  195

Query  601   KQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSL  422
             KQ AEKHFPL+ G+ T+ G+LLNFED +GK+WRFRYSYWNSSQSYVLTKGWSRFVKEKSL
Sbjct  196   KQHAEKHFPLKCGSGTT-GILLNFEDASGKIWRFRYSYWNSSQSYVLTKGWSRFVKEKSL  254

Query  421   KAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTV  254
             K GD+V F RS GPEKQL+IDW  R       ++   + P QV RLFGVNI ++ V
Sbjct  255   KPGDMVCFRRSRGPEKQLYIDWNPRG------VAADLIAP-QVVRLFGVNILRTPV  303



>emb|CDX81561.1| BnaC02g18650D [Brassica napus]
Length=343

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 254/353 (72%), Gaps = 35/353 (10%)
 Frame = -3

Query  1174  AHASALNLPATKSPESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWG  998
             A  SA  LP    P  L RMGSG S V++D++NGV+ +S RKL SS++KGVVPQPNGRWG
Sbjct  24    AKFSAPPLP----PLRLNRMGSGGSNVVLDSKNGVDIDS-RKLSSSKYKGVVPQPNGRWG  78

Query  997   AQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAV  818
             AQIY KHQRVWLGTF++EEEAA  YDIAA++FRGRDAV NFK    + D     D+ E  
Sbjct  79    AQIYVKHQRVWLGTFSDEEEAAHSYDIAARKFRGRDAVVNFKTFLASED-----DNGELC  133

Query  817   FLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTP  638
             FL +HSKAEIVDMLRKHTY DEL QS +    N  T     ++D  +++RE LFEK VTP
Sbjct  134   FLEAHSKAEIVDMLRKHTYADELAQSNKRNGANTNTI----QSDTVSRTREVLFEKVVTP  189

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             SDVGKLNRLVIPKQ AEKHFPL + +VT KGVL+NFED  GKVWRFRYSYWNSSQSYVLT
Sbjct  190   SDVGKLNRLVIPKQHAEKHFPLPSLSVT-KGVLINFEDVTGKVWRFRYSYWNSSQSYVLT  248

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLF  281
             KGWSRFVKEK+L+AGD+V+F RSTG ++QL+IDWK R+G           +PVQ V RLF
Sbjct  249   KGWSRFVKEKNLRAGDVVTFERSTGSDRQLYIDWK-RSGPSK--------NPVQVVVRLF  299

Query  280   GVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             GV+I   T      +   +N + +C GGKR R+V M    L CSKK  +I+ L
Sbjct  300   GVDIFNVT------STKPSNVVDAC-GGKRSRDVDM--FALRCSKKHAIINTL  343



>emb|CDX99755.1| BnaC02g35650D [Brassica napus]
Length=340

 Score =   383 bits (983),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 240/317 (76%), Gaps = 27/317 (9%)
 Frame = -3

Query  1138  SPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             SP SL RMGSG+SV++D++NGVEAES RKLPSS+FKGVVPQPNGRWGAQIYEKH+RVWLG
Sbjct  34    SPASLYRMGSGSSVVLDSQNGVEAES-RKLPSSKFKGVVPQPNGRWGAQIYEKHKRVWLG  92

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAV-FLSSHSKAEIVD  782
             TFNEEEEAARVYD+AA RFRG DAVTNFKP    T  RNG+ D + V FL++HSK EIVD
Sbjct  93    TFNEEEEAARVYDVAAHRFRGSDAVTNFKP---DTTFRNGEGDGDEVKFLNAHSKYEIVD  149

Query  781   MLRKHTYTDELEQSRR---AF-NINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNR  614
             MLRKHTY +ELEQ +R   AF N+  +T           K+ E LFEK VTPSDVGKLNR
Sbjct  150   MLRKHTYKEELEQRKRKQTAFANVTVVT---------GFKTAECLFEKTVTPSDVGKLNR  200

Query  613   LVIPKQQAEKHFPL-QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
             LVIPK QAEKHFPL   G V+ +G LLNFED NGKVWRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  201   LVIPKHQAEKHFPLPLTGDVSVRGTLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFV  260

Query  436   KEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI-SKS  260
             KEK L AGD++SF RS G ++QL+I WK++ G    D   V      V RLFGV+I S  
Sbjct  261   KEKRLCAGDLISFKRSNGQDQQLYIVWKSKAGL-EQDTGRV------VVRLFGVDIASVK  313

Query  259   TVSPMAMAMDTTNNISS  209
             + + + M  +T  ++SS
Sbjct  314   SRNDVVMKEETEMSLSS  330



>ref|XP_003591822.1| AP2/ERF and B3 domain-containing transcription repressor TEM1 
[Medicago truncatula]
 gb|AES62073.1| AP2/ERF and B3 domain transcription factor [Medicago truncatula]
Length=384

 Score =   384 bits (986),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 219/372 (59%), Positives = 253/372 (68%), Gaps = 54/372 (15%)
 Frame = -3

Query  1129  SLCRMGSGASVIIDAE-NGV--EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             SL R+GS AS ++D E  GV  EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLG
Sbjct  31    SLSRVGSAASSVVDPEIYGVSGEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLG  89

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TFNEE+EAAR YDIAA RFRG+DAVTN K L+      N  D+ E  FL+SHSK+EIVDM
Sbjct  90    TFNEEDEAARAYDIAALRFRGKDAVTNSKSLTGVG---NDADEGETEFLNSHSKSEIVDM  146

Query  778   LRKHTYTDELEQSRRAFNINNMTTPRKPEADRS-------AKSRERLFEKAVTPSDVGKL  620
             LRKHTY DEL+QS R  +++     R  E + +       AK+RE+LFEK VTPSDVGKL
Sbjct  147   LRKHTYDDELKQSMR--DMSGGRQRRNGELNGAVSRGACDAKAREQLFEKTVTPSDVGKL  204

Query  619   NRLVIPKQQAEKHFPLQNGAVT------------SKGVLLNFEDTNGKVWRFRYSYWNSS  476
             NRLVIPKQ AEKHFPL   AV             +KG+LLNFED  GKVWRFRYSYWNSS
Sbjct  205   NRLVIPKQHAEKHFPLNAVAVAVACDGVSTAAAAAKGLLLNFEDVGGKVWRFRYSYWNSS  264

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR-------------NGTG  335
             QSYVLTKGWSRFVKEK+L+AGD V F RSTGP++QL+ID KAR             N TG
Sbjct  265   QSYVLTKGWSRFVKEKNLRAGDAVRFFRSTGPDRQLYIDCKARSIGVVGGQVDNNNNNTG  324

Query  334   SPDISTVP-VHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPL  158
                I+  P V PVQ+ RLFGVN+ K         +  +  +     GKR     ME   L
Sbjct  325   GLFITVRPVVEPVQMVRLFGVNLLK---------LPGSEGVGGSCNGKRKE---MELFAL  372

Query  157   ECSKKQRVIDAL  122
             ECSKK ++I AL
Sbjct  373   ECSKKPKIIGAL  384



>ref|XP_009402997.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Musa acuminata subsp. malaccensis]
Length=353

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 224/301 (74%), Gaps = 7/301 (2%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  947
             L R+GSG SV++D E  +EA+  RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFNE
Sbjct  27    LLRLGSGTSVVLDPEVILEAKL-RKLPSSQYKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  85

Query  946   EEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKH  767
             E+EAAR YD+A QRFRGRDAVTN KPL  T    +G+D  E +FL+S SKAEIVDMLRKH
Sbjct  86    EDEAARAYDVAVQRFRGRDAVTNLKPLVVT----DGNDAAELLFLNSRSKAEIVDMLRKH  141

Query  766   TYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAE  587
             TY DEL+QSRR    +        E       RE LF+KAVTPSDVGKLNRLVIPKQ AE
Sbjct  142   TYYDELQQSRRNSGADRSKPCPSHEETFGRVYREHLFDKAVTPSDVGKLNRLVIPKQHAE  201

Query  586   KHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGD  410
             KHFPLQ  +    KG+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AGD
Sbjct  202   KHFPLQQTSDAACKGLLLNFEDACGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKELRAGD  261

Query  409   IVSFHRSTGPEKQLFIDWKARN-GTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAM  233
             +++F RSTGPE QLFI  + R+ G  +      P  PV+  RLFGVNI K  V+     M
Sbjct  262   VITFQRSTGPENQLFIGCRRRSVGRYAAAGVHAPTTPVEAVRLFGVNIVKIPVAVSGGVM  321

Query  232   D  230
             D
Sbjct  322   D  322



>ref|XP_010502448.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
ARF14-like [Camelina sativa]
Length=352

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 249/356 (70%), Gaps = 42/356 (12%)
 Frame = -3

Query  1159  LNLPATKSPES---LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             + +PA KSP     L RMGSG SV++D++NG+EAES RKLPSSRFKGVVPQPNGRWGAQI
Sbjct  21    IKIPARKSPSPAGLLYRMGSGTSVVLDSDNGLEAES-RKLPSSRFKGVVPQPNGRWGAQI  79

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETT--DGRNGDDDYEAVF  815
             YEKHQRVWLGTFNEEEEAAR YD+AA RFRGRDAVTNFK   ETT  +G +G D+ E  F
Sbjct  80    YEKHQRVWLGTFNEEEEAARAYDVAAHRFRGRDAVTNFK---ETTLVNGNDGGDEDEVDF  136

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKA  647
             L++HSK+EIVDMLRKHTY +ELEQ +R  N N   T        +     K+ + LFEK 
Sbjct  137   LNAHSKSEIVDMLRKHTYKEELEQRKRKRNGNGNKTMGFGSVTAAVITGFKTSKLLFEKT  196

Query  646   VTPSDVGKLNRLVIPKQQAEKHFPLQNGAV------TSKGVLLNFEDTNGKVWRFRYSYW  485
             VTPSDVGKLNRLVIPK QAEKHFPL  G V      + KG+LL+FED NGKVWRFRYSYW
Sbjct  197   VTPSDVGKLNRLVIPKHQAEKHFPLALGGVDNDNNGSVKGMLLSFEDVNGKVWRFRYSYW  256

Query  484   NSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVH  305
             NSSQSYVLTKGWSRFVKEK L AGD++ F RS G + +LFI WK+++G+ S   S     
Sbjct  257   NSSQSYVLTKGWSRFVKEKRLCAGDLICFRRSNGQDDKLFIGWKSKSGSESVSGSD----  312

Query  304   PVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQR  137
               +V RLFGV+I     +  A+A+    N                F+ L C+KK++
Sbjct  313   --RVVRLFGVDI---CFNDAAVAVKKEENDM--------------FVSLRCNKKKQ  349



>ref|XP_009127674.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2 [Brassica rapa]
 emb|CDY45849.1| BnaA02g14040D [Brassica napus]
Length=350

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 249/342 (73%), Gaps = 32/342 (9%)
 Frame = -3

Query  1135  PESLCRMGSGAS-VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             P  L RM SG S V++D++NGV+ +S RKL SS++KGVVPQPNGRWGAQIY KHQRVWLG
Sbjct  37    PLRLNRMRSGGSNVVLDSKNGVDIDS-RKLSSSKYKGVVPQPNGRWGAQIYVKHQRVWLG  95

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TF +EEEAA  YDIAA++FRGRDAV NFK    + D     D+ E  FL +HSKAEIVDM
Sbjct  96    TFCDEEEAAHSYDIAARKFRGRDAVVNFKTFLASED-----DNGELCFLEAHSKAEIVDM  150

Query  778   LRKHTYTDELEQS--RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVI  605
             LRKHTY DEL QS  R   N N  TT    ++   +++RE LFEK VTPSDVGKLNRLVI
Sbjct  151   LRKHTYADELAQSNKRSGANTNTNTT----QSHTVSRTREVLFEKVVTPSDVGKLNRLVI  206

Query  604   PKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
             PKQ AEK+FPL + +VT KGVL+NFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+
Sbjct  207   PKQHAEKYFPLPSLSVT-KGVLINFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKN  265

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGVNISKSTVSP  248
             L+AGD+V+F RSTG ++QL+IDWK R+G           +PVQ V RLFGV+I   T   
Sbjct  266   LRAGDVVTFERSTGSDRQLYIDWKIRSGPSK--------NPVQVVVRLFGVDIFNVT---  314

Query  247   MAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                +   +N + +C GGKR R+V M    L CSKK  +I+AL
Sbjct  315   ---SAKPSNVVDAC-GGKRSRDVDM--FALRCSKKHAIINAL  350



>ref|XP_009393568.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=341

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 241/308 (78%), Gaps = 12/308 (4%)
 Frame = -3

Query  1174  AHASALNLPATKSPESLCRMGSGASVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRW  1001
             +H++        + E+L RMGSG S ++D   E+G+EA S RKL SS++KGVVPQPNGRW
Sbjct  11    SHSARCQQTPPHAGEALQRMGSGVSAVLDPTPESGMEAVS-RKLSSSQYKGVVPQPNGRW  69

Query  1000  GAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEA  821
             GAQIYEKH+RVWLGTF +E EA+R YD+AAQRFRGRDA+TNFKPLSE+ D    D+ YE 
Sbjct  70    GAQIYEKHRRVWLGTFGDEAEASRAYDVAAQRFRGRDAITNFKPLSESDD----DEAYEL  125

Query  820   VFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRK-PEADRSAKSRERLFEKAV  644
              FL +HSKAEIVDMLRKHTY DEL+QS+RA     + + R  P   RSA  R  LF+K V
Sbjct  126   SFLVAHSKAEIVDMLRKHTYHDELQQSKRAQGGGRVVSRRTTPSYLRSA--RLMLFDKVV  183

Query  643   TPSDVGKLNRLVIPKQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSY  467
             TPSDVGKLNRLVIPKQ AEK+FPL++G+ V SKGVLLNFED  G+VWRFRYSYW+SSQS+
Sbjct  184   TPSDVGKLNRLVIPKQHAEKYFPLESGSSVASKGVLLNFEDAGGRVWRFRYSYWSSSQSF  243

Query  466   VLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVP-VHPVQVF  290
             VLTKGWSRFV+EK+LKAGD+V+F RSTGPEKQLFIDW+         ++  P V+P++V 
Sbjct  244   VLTKGWSRFVREKNLKAGDVVTFWRSTGPEKQLFIDWRTDVIASFRTMTPPPTVNPLRVV  303

Query  289   RLFGVNIS  266
             +LFGV+IS
Sbjct  304   KLFGVDIS  311



>ref|XP_009394443.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os05g0549800-like 
[Musa acuminata subsp. malaccensis]
Length=332

 Score =   379 bits (974),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 203/340 (60%), Positives = 242/340 (71%), Gaps = 32/340 (9%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQR  971
             P     +SL R+GSG S +ID E GVEAES RKLP S++KGVVPQPNGRWGAQIYEKHQR
Sbjct  17    PLVAGAKSLQRVGSGGSDVIDPEVGVEAES-RKLPPSQYKGVVPQPNGRWGAQIYEKHQR  75

Query  970   VWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAE  791
             VWLGTFN E EAAR YD+A QRFRGRDA+TN +PL++     N DD  E  FL SHSKAE
Sbjct  76    VWLGTFNREAEAARAYDVAVQRFRGRDAITNLRPLNDAD---NNDDAAELFFLGSHSKAE  132

Query  790   IVDMLRKHTYTDELEQSRRAFNINN--MTTPRKPEADRSAKSRERLFEKAVTPSDVGKLN  617
             IVDML+KHTY +EL+QS+R+F  +    T+P   ++    + R+ LF+KA+TPSDVGKLN
Sbjct  133   IVDMLKKHTYNEELQQSKRSFGADKKAATSPGDTKSPIGTQ-RQHLFDKAMTPSDVGKLN  191

Query  616   RLVIPKQQAEKHFP-LQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRF  440
             RLVIPK  AEKHFP ++ G   S+GVLL+FED++GKVWRFRYSYWNSSQSYVLTKGWSRF
Sbjct  192   RLVIPKHHAEKHFPVMEAGGAASRGVLLSFEDSSGKVWRFRYSYWNSSQSYVLTKGWSRF  251

Query  439   VKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKS  260
             VKEK L AGD+V+F RSTGP KQLFID K+               PVQ+FRLFGVNI ++
Sbjct  252   VKEKGLGAGDVVTFQRSTGPGKQLFIDSKS---------------PVQIFRLFGVNIVRT  296

Query  259   TVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQ  140
               +  A         + C  GKR R+ +      E  KKQ
Sbjct  297   PAAGSA---------ACCGTGKRTRDRMELASSQEMVKKQ  327



>ref|XP_010046598.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Eucalyptus grandis]
Length=326

 Score =   379 bits (974),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 223/293 (76%), Gaps = 14/293 (5%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             P+SLC +GSG  VI+D E  +EAES RK PSS++KGVVPQPNGRWGAQIY+  QRVW+GT
Sbjct  29    PQSLCHLGSGTGVILDCEGAIEAES-RKQPSSKYKGVVPQPNGRWGAQIYDSRQRVWIGT  87

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F++E+EAA  YDIAA+RFRGRDA+TNFK  S+T D      D EA FL+SHSK EIVDML
Sbjct  88    FSKEDEAALAYDIAAKRFRGRDAITNFKQRSDTEDC-----DLEAAFLNSHSKEEIVDML  142

Query  775   RKHTYTDELEQSRRA-FNINNMTTPRKPEA-DRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             RKH Y +ELEQS+R  FN N   +   P   DR+A +   LF+K VT SDVGKLNR VIP
Sbjct  143   RKHAYYNELEQSKRKYFNANGRHSGLDPSGPDRAAMACHLLFQKEVTQSDVGKLNRFVIP  202

Query  601   KQQAEKHFPLQN--GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEK  428
             KQ AEKHFPL+N     TSKGVLLNF D+ GKVWRFRYSYWNSS+SYVLT+GW+RFVKEK
Sbjct  203   KQHAEKHFPLRNRTSPTTSKGVLLNFIDSGGKVWRFRYSYWNSSRSYVLTRGWTRFVKEK  262

Query  427   SLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             SL+ GDIVSFHRS GPEKQL I    R+G         P+HPVQ+ RLFGV+I
Sbjct  263   SLRTGDIVSFHRSAGPEKQLHIKCMRRSGLSQAG----PIHPVQMVRLFGVDI  311



>ref|XP_004236999.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1 [Solanum lycopersicum]
 gb|ABY57634.1| RAV1 [Solanum lycopersicum]
Length=372

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 221/380 (58%), Positives = 252/380 (66%), Gaps = 61/380 (16%)
 Frame = -3

Query  1150  PATKSPESLCR-MGSGASVIIDAE--NGVEAES---------GRKLPSSRFKGVVPQPNG  1007
             P+T SP    R MGSG SV+ DA+  NGVEAES           KLPSS+FKGVVPQPNG
Sbjct  17    PSTISPAGSPRQMGSGVSVVTDADSTNGVEAESKNTTITNNNNNKLPSSKFKGVVPQPNG  76

Query  1006  RWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDY  827
             RWGAQIYEKHQR+WLGTFN EEEAAR YDIAAQRFRGRDAVTNFKPL +        ++ 
Sbjct  77    RWGAQIYEKHQRIWLGTFNGEEEAARAYDIAAQRFRGRDAVTNFKPLFDFQ-----TEEI  131

Query  826   EAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNIN--------------NMTTPRKPEA  689
             E  FL+S SK EIV+MLRKHTY DEL+ +++ +N N              N+ T      
Sbjct  132   EISFLNSRSKVEIVEMLRKHTYNDELQHAKKVYNNNTFEMNGRSTCHTNTNIATFSLDTN  191

Query  688   DRSAK-SRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----QNGAVTSKGVLLNFED  524
             ++ A  + E LFEK VTPSDVGKLNRLVIPKQ AE++FPL         TSKGVLLNFED
Sbjct  192   EKVANIASELLFEKVVTPSDVGKLNRLVIPKQHAERYFPLVAKVNKNDNTSKGVLLNFED  251

Query  523   TNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGP--EKQLFIDWKA  350
              NGK+WRFRYSYWNSSQSYVLTKGWSR+VKEK LKAGDIVSF R +G   E +L ID K 
Sbjct  252   MNGKMWRFRYSYWNSSQSYVLTKGWSRYVKEKKLKAGDIVSFKRCSGVEIEDKLLIDSKN  311

Query  349   RNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNI---SSCSGGKRIREV  179
             R   G           V++ RLFGVNI K          D +NN+    + S GKR+RE 
Sbjct  312   RIIRG---------EQVKMVRLFGVNICK--------VQDVSNNVVVEKNMSVGKRMRE-  353

Query  178   VMEFLPLECSKKQRV-IDAL  122
              ME L  ECSKKQRV IDAL
Sbjct  354   -MELLAFECSKKQRVIIDAL  372



>ref|NP_001237600.1| RAV-like DNA-binding protein [Glycine max]
 gb|AAZ66389.1| RAV-like DNA-binding protein [Glycine max]
Length=351

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 214/358 (60%), Positives = 244/358 (68%), Gaps = 55/358 (15%)
 Frame = -3

Query  1120  RMGSGASVIIDAENGV---EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFN  950
             R+GS AS ++D +      EAES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN
Sbjct  24    RVGSVASAVVDPDGCCVSGEAES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFN  82

Query  949   EEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRK  770
             EE+EAAR YDIAA RFRG DAVTNFKP + +       DD E+ FL+SHSK EIVDMLRK
Sbjct  83    EEDEAARAYDIAALRFRGPDAVTNFKPPAAS-------DDAESEFLNSHSKFEIVDMLRK  135

Query  769   HTYTDELEQSRRAFNINNMTTPRKPEADRS------AKSRERLFEKAVTPSDVGKLNRLV  608
             HTY DEL+QS R          R+ +AD +      AK+RE+LFEK VTPSDVGKLNRLV
Sbjct  136   HTYDDELQQSTRGGR-------RRLDADTASSGVFDAKAREQLFEKTVTPSDVGKLNRLV  188

Query  607   IPKQQAEKHFPLQN----------GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             IPKQ AEKHFPL            GA  +KG+LLNFED  GKVWRFRYSYWNSSQSYVLT
Sbjct  189   IPKQHAEKHFPLSGSGDESSPCVAGASAAKGMLLNFEDVGGKVWRFRYSYWNSSQSYVLT  248

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNG-----TGSPDISTVP-VHPVQ  296
             KGWSRFVKEK+L+AGD V F +STGP++QL+ID KAR+G      G   +   P V PVQ
Sbjct  249   KGWSRFVKEKNLRAGDAVQFFKSTGPDRQLYIDCKARSGEVNNNAGGLFVPIGPVVEPVQ  308

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             + RLFGVN+ K  V              S   GKR     ME    EC KK +VI AL
Sbjct  309   MVRLFGVNLLKLPVP------------GSDGVGKRKE---MELFAFECCKKLKVIGAL  351



>emb|CDY40973.1| BnaA02g27630D [Brassica napus]
Length=315

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 229/313 (73%), Gaps = 35/313 (11%)
 Frame = -3

Query  1171  HASALNLP-----ATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNG  1007
             H SA  +P        SP SL RMGSG+SV++D+ENGVEAES RKLPSS+FKGVVPQPNG
Sbjct  18    HTSAKIIPPPTTAKLSSPASLYRMGSGSSVVLDSENGVEAES-RKLPSSKFKGVVPQPNG  76

Query  1006  RWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDY  827
             RWGAQIYEKH+RVWLGTFNEEEEAARVYD+AA RFRG DAVTNFKP       RNGD + 
Sbjct  77    RWGAQIYEKHKRVWLGTFNEEEEAARVYDVAAHRFRGPDAVTNFKP---DATFRNGDGE-  132

Query  826   EAVFLSSHSKAEIVDMLRKHTYTDELEQSRR---AFNINNMTTPRKPEADRSAKSRERLF  656
             E  FL++HSK EIVDMLRKHTY +ELEQ +R   AF    + T          K+ E LF
Sbjct  133   EVEFLNAHSKYEIVDMLRKHTYKEELEQRKRKQTAFANVTVAT--------GFKTAECLF  184

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPL-QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNS  479
             EK VTPSDVGKLNRLVIPK QAEKHFPL   G V+ +G LLNFED NGKVWRFRYSYWNS
Sbjct  185   EKTVTPSDVGKLNRLVIPKHQAEKHFPLPLTGDVSVRGTLLNFEDVNGKVWRFRYSYWNS  244

Query  478   SQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKA--RNGTGSPDISTVPVH  305
             SQSYVLTKGWSRFVKEK L AGD++SF RS G ++QL+I WK+     TG          
Sbjct  245   SQSYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWKSGLEQDTGR---------  295

Query  304   PVQVFRLFGVNIS  266
                V RLFGV+I+
Sbjct  296   --VVVRLFGVDIA  306



>ref|XP_010046597.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Eucalyptus grandis]
Length=334

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 223/301 (74%), Gaps = 22/301 (7%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             P+SLC +GSG  VI+D E  +EAES RK PSS++KGVVPQPNGRWGAQIY+  QRVW+GT
Sbjct  29    PQSLCHLGSGTGVILDCEGAIEAES-RKQPSSKYKGVVPQPNGRWGAQIYDSRQRVWIGT  87

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F++E+EAA  YDIAA+RFRGRDA+TNFK  S+T D      D EA FL+SHSK EIVDML
Sbjct  88    FSKEDEAALAYDIAAKRFRGRDAITNFKQRSDTEDC-----DLEAAFLNSHSKEEIVDML  142

Query  775   RKHTYTDELEQ-SRRAFNINN--------MTTPRKPEA-DRSAKSRERLFEKAVTPSDVG  626
             RKH Y +ELEQ  R+ FN N         M   R P   DR+A +   LF+K VT SDVG
Sbjct  143   RKHAYYNELEQRKRKYFNANGSGNRVSMMMEAIRDPSGPDRAAMACHLLFQKEVTQSDVG  202

Query  625   KLNRLVIPKQQAEKHFPLQN--GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKG  452
             KLNR VIPKQ AEKHFPL+N     TSKGVLLNF D+ GKVWRFRYSYWNSS+SYVLT+G
Sbjct  203   KLNRFVIPKQHAEKHFPLRNRTSPTTSKGVLLNFIDSGGKVWRFRYSYWNSSRSYVLTRG  262

Query  451   WSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVN  272
             W+RFVKEKSL+ GDIVSFHRS GPEKQL I    R+G         P+HPVQ+ RLFGV+
Sbjct  263   WTRFVKEKSLRTGDIVSFHRSAGPEKQLHIKCMRRSGLSQAG----PIHPVQMVRLFGVD  318

Query  271   I  269
             I
Sbjct  319   I  319



>ref|XP_009381393.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=337

 Score =   375 bits (963),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 220/303 (73%), Gaps = 31/303 (10%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKH  977
              LPAT   E L R+GSGASV++D E G E+   RKLPSSR+KGVVPQPNGRWGAQIY+KH
Sbjct  24    TLPAT---EGLQRLGSGASVVLDPEVGAES---RKLPSSRYKGVVPQPNGRWGAQIYDKH  77

Query  976   QRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSK  797
             QRVWLGTFNEE+EAAR YD+AAQRFRGRDAVTNFKPL ET D     D  E  FL S SK
Sbjct  78    QRVWLGTFNEEDEAARAYDVAAQRFRGRDAVTNFKPLVETDD----VDAAELSFLVSRSK  133

Query  796   AEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS-----AKSRERLFEKAVTPSD  632
             AEIVDMLRKH Y DE+ QSR++       T   P    S        RE LF+KAVTPSD
Sbjct  134   AEIVDMLRKHIYHDEMRQSRQSSGAEGRRT--YPSRGGSMGWFGGPHREHLFDKAVTPSD  191

Query  631   VGKLNRLVIPKQQAEKHFPL-QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             VGKLNRLVIPKQ AEKHFP  Q GA   K VLLNFED  GKVWRFRYSYWNSSQSYVLTK
Sbjct  192   VGKLNRLVIPKQHAEKHFPQPQTGAAACKAVLLNFEDACGKVWRFRYSYWNSSQSYVLTK  251

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GW RFVKE+ L+AGD+V+FHRSTGPE+QLFI  K R               V+V RLFGV
Sbjct  252   GWRRFVKEEGLRAGDVVTFHRSTGPERQLFIGRKTRPA-------------VEVVRLFGV  298

Query  274   NIS  266
             NI+
Sbjct  299   NIA  301



>gb|ACI46678.1| DNA-binding protein [Galega orientalis]
Length=387

 Score =   377 bits (968),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 252/383 (66%), Gaps = 57/383 (15%)
 Frame = -3

Query  1153  LPATKSP---ESLCRMGSGASVIIDAE---NGVEAESGRKLPSSRFKGVVPQPNGRWGAQ  992
              PA  SP    +L R+GSGAS I D E      EAES RKLPSS++KGVVPQPNGRWGAQ
Sbjct  23    FPAKLSPPPTNTLSRVGSGASAIFDPEICAGSGEAES-RKLPSSKYKGVVPQPNGRWGAQ  81

Query  991   IYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFL  812
             IYEKHQRVWLGTFNEE+EAAR YDIAA RFRG+DAVTN K L+      N +D+ E  FL
Sbjct  82    IYEKHQRVWLGTFNEEDEAARAYDIAALRFRGKDAVTNSKTLAGAG---NDNDEAETEFL  138

Query  811   SSHSKAEIVDMLRKHTYTDELEQS-------RRAFNINNMTTPRKPEADRSAKSRERLFE  653
             +SHSK+EIVDMLRKHTY DEL QS       R+  N  +     +   D +A  RE+LFE
Sbjct  139   NSHSKSEIVDMLRKHTYDDELRQSMRDTCGGRQRRNGESSAAASRGACDSNA--REQLFE  196

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQN--------------GAVTSKGVLLNFEDTNG  515
             K VTPSDVGKLNRLVIPKQ AEKHFPL                    +KG+LLNFED  G
Sbjct  197   KTVTPSDVGKLNRLVIPKQHAEKHFPLGAVAAAVSVAVDGISPAVSAAKGLLLNFEDIGG  256

Query  514   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARN---  344
             KVWRFRYSYWNSSQSYVLTKGWSRFVKEK+L+AGD V F RSTGP++QL+ID KAR+   
Sbjct  257   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDAVQFCRSTGPDRQLYIDCKARSVSV  316

Query  343   -GTGSPDIST----VP----VHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKR  191
              G G  +  T    +P    V PVQ+ RLFGVN+ K         +  ++ +     GKR
Sbjct  317   VGVGIGNTYTDNLFIPVRPVVEPVQMVRLFGVNLLK---------LPGSDGVGGSCNGKR  367

Query  190   IREVVMEFLPLECSKKQRVIDAL  122
                  M+   LEC+KK ++I AL
Sbjct  368   KE---MDLFTLECTKKPKIIGAL  387



>ref|XP_009390239.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=338

 Score =   375 bits (962),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 231/298 (78%), Gaps = 16/298 (5%)
 Frame = -3

Query  1132  ESLCRMGSGASVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             E+L RMGSGASV++D     G EAES RKL SS++KGVVPQPNGRWGAQIYE+H RVWLG
Sbjct  25    EALQRMGSGASVVLDPILRGGTEAES-RKLTSSQYKGVVPQPNGRWGAQIYERHNRVWLG  83

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TF +E EAAR YD+AAQRFRGRDAVTNF+PLS++      DD  E  FL++HSKAEIVDM
Sbjct  84    TFGDEAEAARTYDVAAQRFRGRDAVTNFRPLSDSAY----DDAGELSFLAAHSKAEIVDM  139

Query  778   LRKHTYTDELEQSRRAFNIN-NMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIP  602
             LRKHTY DEL+QS+RAF    + T  R+     S  +RE L +K VTPSDVGKLNRLVIP
Sbjct  140   LRKHTYRDELQQSKRAFGAGRSATVGRRKTPGYSRSAREFLLDKVVTPSDVGKLNRLVIP  199

Query  601   KQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKS  425
             K  AEKHFP ++G+ +  KGVLLNFED +G+VWRFRYSYWNSSQSYVLTKGWSR+VKEK 
Sbjct  200   KHHAEKHFPSKSGSSLACKGVLLNFEDASGRVWRFRYSYWNSSQSYVLTKGWSRYVKEKG  259

Query  424   LKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVS  251
             LKAGD+VSF RSTGPEKQL+I+ +    TG+  ++  P  P  V RLFGVNIS+   S
Sbjct  260   LKAGDLVSFWRSTGPEKQLYINCR----TGA--VANNPYLP-SVIRLFGVNISELPAS  310



>ref|XP_010425223.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
ARF14-like [Camelina sativa]
Length=348

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 212/357 (59%), Positives = 250/357 (70%), Gaps = 43/357 (12%)
 Frame = -3

Query  1159  LNLPATKSPES---LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             + +PA KSP     L RMGSG SV++D++NG+EAES RKLPSSRFKGVVPQPNGRWGAQI
Sbjct  21    VKIPARKSPSPAGLLYRMGSGTSVVLDSDNGLEAES-RKLPSSRFKGVVPQPNGRWGAQI  79

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETT--DGRNGDDDYEAVF  815
             YEKHQRVWLGTFNEEEEAAR YD+AA RFRGRDAVTNFK   ETT  +G +G D+ E  F
Sbjct  80    YEKHQRVWLGTFNEEEEAARAYDVAAHRFRGRDAVTNFK---ETTLVNGNDGGDEDEVDF  136

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKA  647
             L++HSK+EIVDMLRKHTY +ELEQ +R  N N   T        +     K+ + LFEK 
Sbjct  137   LNAHSKSEIVDMLRKHTYKEELEQRKRKRNGNGNKTMGFGSVTAAVMTGFKTSKLLFEKT  196

Query  646   VTPSDVGKLNRLVIPKQQAEKHFPL-----QNGAVTSKGVLLNFEDTNGKVWRFRYSYWN  482
             VTPSDVGKLNRLVIPK QAEKHFPL      NG+V  KG+LL+FED NGKVWRFRYSYWN
Sbjct  197   VTPSDVGKLNRLVIPKHQAEKHFPLPLDGGNNGSV--KGMLLSFEDVNGKVWRFRYSYWN  254

Query  481   SSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHP  302
             SSQSYVLTKGWSRFVKEK L AGD++ F RS G + +LFI WK+ +G+GS   S      
Sbjct  255   SSQSYVLTKGWSRFVKEKRLCAGDLICFRRSNGQDDKLFIGWKSNSGSGSRSGSD-----  309

Query  301   VQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVI  131
              +V RLFGV+I  +  + +A                  +E     + L C+KKQR +
Sbjct  310   -RVVRLFGVDICFNDAAVVAK-----------------KEEKDMLVSLRCNKKQRAM  348



>gb|KFK44549.1| ap2 erf and b3 domain-containing transcription factor rav2 [Arabis 
alpina]
Length=347

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 242/351 (69%), Gaps = 44/351 (13%)
 Frame = -3

Query  1126  LCRMGSG-ASVIIDA-ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTF  953
             L RMGSG +SV++D  +NGVE ES RKLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF
Sbjct  25    LYRMGSGGSSVVLDTDQNGVETES-RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTF  83

Query  952   NEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR  773
             NEE+EAA  YDIAA++FRGRDAV NFK L          +D E+VFL +HSK+EIVDMLR
Sbjct  84    NEEQEAAESYDIAARKFRGRDAVINFKSLVR--------NDAESVFLDTHSKSEIVDMLR  135

Query  772   KHTYTDELEQSRRAFNINNMTTPRKPEADRSAKS-RERLFEKAVTPSDVGKLNRLVIPKQ  596
             KHTY DEL+QS+R F  N     +  E D   +  RE LF+K+VTPSDVGKLNRLVIPKQ
Sbjct  136   KHTYKDELQQSKRKFLDNGKL--KGNENDVVLRGVREFLFDKSVTPSDVGKLNRLVIPKQ  193

Query  595   QAEKHFPL------------QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKG  452
              AE+HFPL               A  +KGVL+N ED  GKVWRFRYSYWNSSQSYVLTKG
Sbjct  194   HAERHFPLPAFTTTETVTMTMTVASPTKGVLINLEDRTGKVWRFRYSYWNSSQSYVLTKG  253

Query  451   WSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ-VFRLFGV  275
             WSRFVKEK+L+AGD+V F RSTGP++QLFIDWK R+GT            VQ V RLFGV
Sbjct  254   WSRFVKEKNLRAGDLVCFERSTGPDRQLFIDWKVRSGT------------VQNVVRLFGV  301

Query  274   NISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             NI   T        D         GGK+      + L L CSKKQ +I+ L
Sbjct  302   NIYSDT-----KPNDVVEECGGGGGGKKRYRGGADLLALGCSKKQAIINVL  347



>ref|XP_009394714.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Musa acuminata subsp. malaccensis]
Length=348

 Score =   373 bits (957),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 243/352 (69%), Gaps = 36/352 (10%)
 Frame = -3

Query  1138  SPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             + +SL R+ SG S +ID E  VEAE  RKLPSS++KGVV QPNGRWGAQIYEKHQR+WLG
Sbjct  20    ASKSLQRVASGGSEVIDPEGCVEAEF-RKLPSSKYKGVVSQPNGRWGAQIYEKHQRIWLG  78

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TFNEE +AAR YD+A QRFRGRDAVTNFKPL++  D    +D  E  FL SH+K EIVDM
Sbjct  79    TFNEEAQAARAYDVAVQRFRGRDAVTNFKPLNDADD----EDAAELFFLDSHTKHEIVDM  134

Query  778   LRKHTYTDELEQSRRAFNINNMTTPRKPEADRS------------AKSRERLFEKAVTPS  635
             LRK TY +EL+QS+R+   +N    +K  A RS               R+ LF+KAVTPS
Sbjct  135   LRKRTYHNELQQSKRSIGADN----KKGIAGRSNAAVAGATDPLAGAQRQHLFDKAVTPS  190

Query  634   DVGKLNRLVIPKQQAEKHFPLQN-GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
             DVGKLNRLVIPKQ AEK+FP QN G   SKGVLL+FED  GK WRFRYSYWNSS SYVLT
Sbjct  191   DVGKLNRLVIPKQNAEKYFPPQNTGGAASKGVLLSFEDGCGKEWRFRYSYWNSSHSYVLT  250

Query  457   KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFG  278
             +GWSRFVKEK L+AGD+V+F RSTG +KQLFID KAR+G             VQV RLFG
Sbjct  251   RGWSRFVKEKRLEAGDVVTFQRSTGTDKQLFIDAKARSG-------------VQVLRLFG  297

Query  277   VNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
             VNI +   + +       +N   C+ GK+ R+ + E +  +   K++  +AL
Sbjct  298   VNIVRGPAAAIGEG-GVDDNAVFCTTGKKNRDHITELVSSQGMFKKQRTEAL  348



>ref|XP_009386126.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=357

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 212/333 (64%), Positives = 241/333 (72%), Gaps = 15/333 (5%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  947
             L R+GSG SV++D E GVEAES RKLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLGTFNE
Sbjct  31    LQRLGSGTSVVLDLEVGVEAES-RKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNE  89

Query  946   EEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKH  767
             E+EAAR YD+A QRFRGRDA+TNFKPL E       D   E  FL+SHSKAEIVDM+RKH
Sbjct  90    EDEAARAYDVAVQRFRGRDAITNFKPLVEVD---VNDAAEELSFLNSHSKAEIVDMIRKH  146

Query  766   TYTDELEQSRRAFNINNMTTPRKPEAD--RSAKSRERLFEKAVTPSDVGKLNRLVIPKQQ  593
             TY DEL QS R+   +    P     +  RS   RE LF+KAVTPSDVGKLNRLVIPKQ 
Sbjct  147   TYQDELHQSSRSARADRRHNPPHGATEEWRSGPHREHLFDKAVTPSDVGKLNRLVIPKQH  206

Query  592   AEKHFPLQN-GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKA  416
             AEKHFPLQ  GA   KGVLL+FED  GK+WRFRYSYW+SSQSYVLTKGWSRFVKEK L+A
Sbjct  207   AEKHFPLQQAGAAAFKGVLLSFEDACGKLWRFRYSYWSSSQSYVLTKGWSRFVKEKGLRA  266

Query  415   GDIVSFHRSTGPEKQLFIDWKARN-GTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAM  239
             GD+++  RST PEK LFID K R  G  +      P  PVQV RLFGV+I K    P+A+
Sbjct  267   GDVITIQRSTAPEKLLFIDRKTRALGRHAAAGVQAPRLPVQVVRLFGVDIVK---IPVAV  323

Query  238   AMDTTNNISSCSGGKRIREVVM----EFLPLEC  152
             A D T        GKR+R++ +    E L  +C
Sbjct  324   ASDVTEGNGVDWNGKRMRDMELISSRELLRKQC  356



>ref|XP_004496199.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Cicer arietinum]
Length=384

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 247/380 (65%), Gaps = 53/380 (14%)
 Frame = -3

Query  1153  LPATKSP---ESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYE  983
             +PA  SP    +L R+GSGAS      +G EAES RKLPSS+ KGVVPQPNGRWGAQIYE
Sbjct  22    IPAKLSPPPPSTLVRLGSGASAESCGVSG-EAES-RKLPSSKHKGVVPQPNGRWGAQIYE  79

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             KHQRVWLGTFNEE+EAAR YDIAA RFRG+DAVTNFK L   T   N  DD E  FL+SH
Sbjct  80    KHQRVWLGTFNEEDEAARAYDIAALRFRGKDAVTNFKNL---TGAGNDADDAETDFLNSH  136

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS-----AKSRERLFEKAVTP  638
             SK+EIVDMLRKHTY DEL QS R           + +A  S     AK+RE LF+K VTP
Sbjct  137   SKSEIVDMLRKHTYDDELRQSMRGTCGGRQRRNGELDAAASRGACDAKAREHLFDKTVTP  196

Query  637   SDVGKLNRLVIPKQQAEKHFPLQNGAVT--------------SKGVLLNFEDTNGKVWRF  500
             SDVGKLNRLVIPKQ AEKHFPL  G+V+              +KG+LLNFED  GKVWRF
Sbjct  197   SDVGKLNRLVIPKQHAEKHFPLGAGSVSVAVSVEGISPCVAAAKGLLLNFEDVGGKVWRF  256

Query  499   RYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIS  320
             RYSYWNSSQSYVLTKGWSRFVKEK+L+AGD V F RSTGP++QL+ID KAR+        
Sbjct  257   RYSYWNSSQSYVLTKGWSRFVKEKNLRAGDAVRFFRSTGPDRQLYIDCKARSNGVVGVGI  316

Query  319   TVPVHPV--------------QVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIRE  182
                 + +              Q+ RLFGVN+ K         +  ++ +     GKR   
Sbjct  317   GEVNNNICDLFVPVRPVVEPVQMVRLFGVNLLK---------LPGSDGVGGSCNGKRKE-  366

Query  181   VVMEFLPLECSKKQRVIDAL  122
               M+   LECSKK ++I AL
Sbjct  367   --MDLFALECSKKPKIIGAL  384



>ref|XP_006843763.1| hypothetical protein AMTR_s00007p00238950 [Amborella trichopoda]
 gb|ERN05438.1| hypothetical protein AMTR_s00007p00238950 [Amborella trichopoda]
Length=387

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 215/378 (57%), Positives = 243/378 (64%), Gaps = 48/378 (13%)
 Frame = -3

Query  1147  ATKSP------ESLCRMGSGASVIIDAENG----VEAESGRKLPSSRFKGVVPQPNGRWG  998
             A+KSP        L RMGSG S ++D E G    VEAES RKLPSSR+KGVVPQPNGRWG
Sbjct  22    ASKSPPPDDGASGLQRMGSGMSTVVDCEAGLGCIVEAES-RKLPSSRYKGVVPQPNGRWG  80

Query  997   AQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKP--LSETTDGRNGDD-DY  827
             AQIYEKHQRVWLGTFNEE EAAR YD AA +FRGRDAVTNFK    S  + G  GDD + 
Sbjct  81    AQIYEKHQRVWLGTFNEEAEAARAYDTAALKFRGRDAVTNFKSPRTSNHSHGNIGDDEEA  140

Query  826   EAVFLSSHSKAEIVDMLRKHTYTDELEQSR---RAFNINNMTTPRKPEADRSAKSRERLF  656
             EA+FL++HSK EIVDMLRKHTY DEL QS+   RA  ++  +     E    A +RE+LF
Sbjct  141   EALFLATHSKGEIVDMLRKHTYHDELRQSKRYCRAMPVSRASATMPAEGRAVAAAREQLF  200

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPLQ-----NGAVTSKGVLLNFEDTNGKVWRFRYS  491
             EKAVTPSDVGKLNRLVIPKQ AE+HFPL       G    KGVLL+FED+ GKVWRFRYS
Sbjct  201   EKAVTPSDVGKLNRLVIPKQHAERHFPLDIASSAAGGAGCKGVLLSFEDSTGKVWRFRYS  260

Query  490   YWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTG---SPDI-  323
             YWNSSQSYVLTKGWSRFVKEK LKAGD+V F R  G E+QL+IDW+ R        P   
Sbjct  261   YWNSSQSYVLTKGWSRFVKEKGLKAGDMVRFERGVGGEQQLYIDWRPRPAAAPLLPPQFI  320

Query  322   -----------STVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVV  176
                            VH   V RLFGVN+    V+           +  C   KR RE  
Sbjct  321   VWQPAAAAPSPLAAVVHQPNVVRLFGVNLMTPPVAA------PPQQVGFCL-MKRGRE--  371

Query  175   MEFLPLECSKKQRVIDAL  122
             MEF    C  K++ I  L
Sbjct  372   MEF--FTCDAKKQCIGTL  387



>ref|XP_010514193.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
ARF14-like [Camelina sativa]
Length=351

 Score =   370 bits (949),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 210/358 (59%), Positives = 249/358 (70%), Gaps = 42/358 (12%)
 Frame = -3

Query  1159  LNLPATKSPES---LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             + +PA KSP     L RMGSG SV++D++N +EAES RKLPSSRFKGVVPQPNGRWGAQI
Sbjct  21    VKIPARKSPSPAGLLYRMGSGTSVVLDSDNCLEAES-RKLPSSRFKGVVPQPNGRWGAQI  79

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETT--DGRNGDDDYEAVF  815
             YEKHQRVWLGTFNEEEEAAR YD+AA RFRGRDAVTNFK   ETT  +G +G D+ E  F
Sbjct  80    YEKHQRVWLGTFNEEEEAARAYDVAAHRFRGRDAVTNFK---ETTLLNGNDGGDEDEVDF  136

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKA  647
             L++HSK+EIVDMLRKHTY +ELEQ +R  N N   T        +     K+ + LFEK 
Sbjct  137   LNAHSKSEIVDMLRKHTYKEELEQRKRKRNGNGNKTTGFGSVTAAVITGFKTSKLLFEKT  196

Query  646   VTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTS------KGVLLNFEDTNGKVWRFRYSYW  485
             VTPSDVGKLNRLVIPK QAEKHFPL  G V +      KG+LL+FED NGKVWRFRYSYW
Sbjct  197   VTPSDVGKLNRLVIPKHQAEKHFPLPLGGVDNDNNGSVKGMLLSFEDVNGKVWRFRYSYW  256

Query  484   NSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVH  305
             NSSQSYVLTKGWSRFVKEK L AGD++ F RS G + +LFI WK+++G+GS   S     
Sbjct  257   NSSQSYVLTKGWSRFVKEKRLCAGDLICFRRSNGQDDKLFIGWKSKSGSGSGSGSD----  312

Query  304   PVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVI  131
               +V RLFGV+I  +  + +A                  +E     + L C+KKQR +
Sbjct  313   --RVVRLFGVDICFNDAAVVAK-----------------KEEKDMLVSLRCNKKQRAM  351



>ref|NP_189201.1| ethylene response DNA binding factor 3 [Arabidopsis thaliana]
 sp|Q9LS06.1|RAVL4_ARATH RecName: Full=AP2/ERF and B3 domain-containing transcription 
factor ARF14; AltName: Full=Protein AUXIN RESPONSE FACTOR 14; 
AltName: Full=RAV1-like ethylene-responsive transcription 
factor ARF14 [Arabidopsis thaliana]
 dbj|BAA95760.1| RAV1 DNA-binding protein-like [Arabidopsis thaliana]
 emb|CAD29641.1| putative auxin response factor 14 [Arabidopsis thaliana]
 dbj|BAF01276.1| AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEE77062.1| ethylene response DNA binding factor 3 [Arabidopsis thaliana]
Length=333

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/309 (64%), Positives = 228/309 (74%), Gaps = 29/309 (9%)
 Frame = -3

Query  1156  NLPATKS--PESLC-RMGSGASVIIDAENGVEAE---SGRKLPSSRFKGVVPQPNGRWGA  995
             ++PA KS  P SL  RMGSG SV++D+ENGVE E     RKLPSSRFKGVVPQPNGRWGA
Sbjct  16    SIPARKSSSPASLLYRMGSGTSVVLDSENGVEVEVEAESRKLPSSRFKGVVPQPNGRWGA  75

Query  994   QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
             QIYEKHQRVWLGTFNEE+EAAR YD+AA RFRGRDAVTNFK   +TT       + E  F
Sbjct  76    QIYEKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFK---DTT------FEEEVEF  126

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKA  647
             L++HSK+EIVDMLRKHTY +EL+Q +R  + N   T     A        K+ E LFEK 
Sbjct  127   LNAHSKSEIVDMLRKHTYKEELDQRKRNRDGNGKETTAFALASMVVMTGFKTAELLFEKT  186

Query  646   VTPSDVGKLNRLVIPKQQAEKHF--PLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             VTPSDVGKLNRLVIPK QAEKHF  PL N  V+ KG+LLNFED NGKVWRFRYSYWNSSQ
Sbjct  187   VTPSDVGKLNRLVIPKHQAEKHFPLPLGNNNVSVKGMLLNFEDVNGKVWRFRYSYWNSSQ  246

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK L AGD++SF RS   +++ FI WK+++G        + +   +V
Sbjct  247   SYVLTKGWSRFVKEKRLCAGDLISFKRSNDQDQKFFIGWKSKSG--------LDLETGRV  298

Query  292   FRLFGVNIS  266
              RLFGV+IS
Sbjct  299   MRLFGVDIS  307



>gb|AAM65499.1| AP2 domain transcription factor [Arabidopsis thaliana]
Length=333

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/309 (64%), Positives = 228/309 (74%), Gaps = 29/309 (9%)
 Frame = -3

Query  1156  NLPATKS--PESLC-RMGSGASVIIDAENGVEAE---SGRKLPSSRFKGVVPQPNGRWGA  995
             ++PA KS  P SL  RMGSG SV++D+ENGVE E     RKLPSSRFKGVVPQPNGRWGA
Sbjct  16    SIPARKSSSPASLLYRMGSGTSVVLDSENGVEVEVEAESRKLPSSRFKGVVPQPNGRWGA  75

Query  994   QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
             QIYEKHQRVWLGTFNEE+EAAR YD+AA RFRGRDAVTNFK   +TT       + E  F
Sbjct  76    QIYEKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFK---DTT------FEEEVEF  126

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA----KSRERLFEKA  647
             L++HSK+EIVDMLRKHTY +EL+Q +R  + N   T     A        K+ E LFEK 
Sbjct  127   LNAHSKSEIVDMLRKHTYKEELDQRKRNRDGNGKETTAFALASMVVMTGFKTAELLFEKT  186

Query  646   VTPSDVGKLNRLVIPKQQAEKHF--PLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             VTPSDVGKLNRLVIPK QAEKHF  PL N  V+ KG+LLNFED NGKVWRFRYSYWNSSQ
Sbjct  187   VTPSDVGKLNRLVIPKHQAEKHFPLPLGNNNVSVKGMLLNFEDVNGKVWRFRYSYWNSSQ  246

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK L AGD++SF RS   +++ FI WK+++G        + +   +V
Sbjct  247   SYVLTKGWSRFVKEKRLCAGDLISFKRSNDQDQKFFIGWKSKSG--------LDLETGRV  298

Query  292   FRLFGVNIS  266
              RLFGV+IS
Sbjct  299   MRLFGVDIS  307



>ref|XP_009418388.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 228/316 (72%), Gaps = 20/316 (6%)
 Frame = -3

Query  1102  SVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAR  929
             S I DA  E+G   ES RKLPSSR+KG VPQPNGRWGAQIYEKHQRVWLGTFN E EAAR
Sbjct  48    SSIGDAWGESGKRDES-RKLPSSRYKGAVPQPNGRWGAQIYEKHQRVWLGTFNTEAEAAR  106

Query  928   VYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDEL  749
              YD+A +RFRGRD VTNFKPL+E+ D    DD  E  F+ S SK EIVDMLR+H+Y  EL
Sbjct  107   AYDVAVRRFRGRDGVTNFKPLNESDD----DDAAELSFIGSRSKVEIVDMLRRHSYHHEL  162

Query  748   EQSRRAFNINNM-TTPRKPEADRSAKS------RERLFEKAVTPSDVGKLNRLVIPKQQA  590
             +QSRR+F  + M T P +  A   A        R+ LF+KAVT SDVGKLNRLVIPKQ A
Sbjct  163   QQSRRSFGADKMKTAPSRGAAVAGATESPVGAKRQHLFDKAVTLSDVGKLNRLVIPKQHA  222

Query  589   EKHFPLQN-GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAG  413
             EKH+PLQ  G   S G+LLNFED  G+VWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AG
Sbjct  223   EKHWPLQEAGGGPSNGMLLNFEDACGRVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLEAG  282

Query  412   DIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAM  233
             D+VSF RSTGPEKQLFID KAR G G   +  +P  PVQ FRLFGVNI+++     A   
Sbjct  283   DVVSFQRSTGPEKQLFIDSKARAGRGHTAVP-MPRPPVQHFRLFGVNIARNP----ATHR  337

Query  232   DTTNNISSCSGGKRIR  185
             D    ISS    KR R
Sbjct  338   DDMEFISSQDMFKRQR  353



>ref|XP_004151060.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Cucumis sativus]
Length=317

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/272 (68%), Positives = 214/272 (79%), Gaps = 20/272 (7%)
 Frame = -3

Query  1072  EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGR  893
             EAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEE +AA+ YDIAA RFRGR
Sbjct  34    EAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEENDAAKAYDIAALRFRGR  92

Query  892   DAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRR----AFN  725
             DAVTNFKP    +   + D+  EA FL+SHSK EIVDMLRKHTY +EL+QS+R    A  
Sbjct  93    DAVTNFKP----SLNHDHDNALEADFLNSHSKLEIVDMLRKHTYNEELQQSKRQQRGAMA  148

Query  724   INNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG  545
             +++ + P  P +D    +RE LFEK VTPSDVGKLNRLVIPKQ AEK+FP++ G V+ KG
Sbjct  149   VDSGSFPHYPGSD---SNREVLFEKTVTPSDVGKLNRLVIPKQHAEKNFPMEEGVVSGKG  205

Query  544   VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLF  365
             +LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVK+ +L+AGD+V F RSTGP+KQL+
Sbjct  206   MLLNFEDMGGKVWRFRYSYWNSSQSYVLTKGWSRFVKDNTLRAGDVVRFLRSTGPDKQLY  265

Query  364   IDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             I         +P IS   ++PV V +LFGVNI
Sbjct  266   IH-------ANP-ISAPGINPVHVVKLFGVNI  289



>ref|XP_004170315.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like, partial [Cucumis sativus]
Length=311

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 185/277 (67%), Positives = 216/277 (78%), Gaps = 20/277 (7%)
 Frame = -3

Query  1072  EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGR  893
             EAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEE +AA+ YDIAA RFRGR
Sbjct  28    EAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEENDAAKAYDIAALRFRGR  86

Query  892   DAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRR----AFN  725
             DAVTNFKP    +   + D+  EA FL+SHSK EIVDMLRKHTY +EL+QS+R    A  
Sbjct  87    DAVTNFKP----SLNHDHDNALEADFLNSHSKLEIVDMLRKHTYNEELQQSKRQQRGAMA  142

Query  724   INNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG  545
             +++ + P  P +D    +RE LFEK VTPSDVGKLNRLVIPKQ AEK+FP++ G V+ KG
Sbjct  143   VDSGSFPHYPGSD---SNREVLFEKTVTPSDVGKLNRLVIPKQHAEKNFPMEEGVVSGKG  199

Query  544   VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLF  365
             +LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVK+ +L+AGD+V F RSTGP+KQL+
Sbjct  200   MLLNFEDMGGKVWRFRYSYWNSSQSYVLTKGWSRFVKDNTLRAGDVVRFLRSTGPDKQLY  259

Query  364   IDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTV  254
             I         +P IS   ++PV V +LFGVNI +  V
Sbjct  260   IH-------ANP-ISAPGINPVHVVKLFGVNILQLPV  288



>ref|XP_010040940.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Eucalyptus grandis]
 gb|KCW44763.1| hypothetical protein EUGRSUZ_L01673 [Eucalyptus grandis]
Length=337

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 217/302 (72%), Gaps = 25/302 (8%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             P+SLCR+GSG SV +D E G++AES RKL  S++KGVVPQPNGRWGAQIYEKHQRVW+GT
Sbjct  33    PQSLCRLGSGTSVTLDCEGGIKAES-RKLNPSKYKGVVPQPNGRWGAQIYEKHQRVWIGT  91

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F+EE+EAA  YDIAA+ FRG+ AVTNF   S T D      D EA FL SHSKAEIVDML
Sbjct  92    FSEEDEAAMAYDIAAKCFRGQAAVTNFNQRSNTED-----YDLEAAFLISHSKAEIVDML  146

Query  775   RKHTYTDELEQSRRAF-NINN----------MTTPRKPEADRSAKSRERLFEKAVTPSDV  629
             R+H Y +ELEQ +R + N N           +  P  P   R+A +   LF+K V  SDV
Sbjct  147   REHAYYEELEQCKRKYVNANGDGKRVSMTEVLGDPSGP--GRAAAACHLLFQKEVMQSDV  204

Query  628   GKLNRLVIPKQQAEKHFPLQN--GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             G LNR VIPKQ AEKHFPL N     TSKG LL F D+ GKVWRFRY YWNSS+SYVLT+
Sbjct  205   GNLNRFVIPKQHAEKHFPLHNRSSPTTSKGTLLTFIDSGGKVWRFRYLYWNSSRSYVLTR  264

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GWSRFVKEKSL+AGDI+SFHRS GPEKQL I++  R+G         PVHPVQ  RLFGV
Sbjct  265   GWSRFVKEKSLRAGDIISFHRSAGPEKQLHINYMRRSGLS----QARPVHPVQKVRLFGV  320

Query  274   NI  269
             +I
Sbjct  321   DI  322



>ref|XP_002279732.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Vitis vinifera]
Length=284

 Score =   355 bits (912),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 215/284 (76%), Gaps = 10/284 (4%)
 Frame = -3

Query  1120  RMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEE  941
             R+G G S I D+ENGV A   RKL SS++KGVVPQPNGRWGAQIYEKH+R+WLGTFNEE 
Sbjct  7     RVG-GTSGISDSENGVGAVYLRKLTSSKYKGVVPQPNGRWGAQIYEKHRRIWLGTFNEEG  65

Query  940   EAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTY  761
             EAA+ YD+AA+RFRG  A+TNF        G+   DD E  FL+SHSKAEIVDMLRKHTY
Sbjct  66    EAAKAYDVAARRFRGHAALTNF-----MVSGKGIQDDIETTFLNSHSKAEIVDMLRKHTY  120

Query  760   TDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKH  581
              DELEQS   +  +  +     E+  S   R +LF+KAVTPSDVGKLNR+VIPKQ AEKH
Sbjct  121   NDELEQSAHNYG-SKESGADVMESKPSVCERVQLFDKAVTPSDVGKLNRMVIPKQHAEKH  179

Query  580   FPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVS  401
              PLQ  A +SKG LLNFED  GK+WRFRYS+WNSSQSYVLTKGW RFVKEK+LKAGDIVS
Sbjct  180   LPLQL-ASSSKGGLLNFEDNGGKIWRFRYSFWNSSQSYVLTKGWRRFVKEKNLKAGDIVS  238

Query  400   FHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             FHRSTG +K+LFI+W+ R+ +  P  S   V   Q+ RLFGVN+
Sbjct  239   FHRSTGSDKRLFIEWEQRDSSRKP--SMKQVESGQMVRLFGVNL  280



>ref|XP_006292936.1| hypothetical protein CARUB_v10019207mg [Capsella rubella]
 gb|EOA25834.1| hypothetical protein CARUB_v10019207mg [Capsella rubella]
Length=681

 Score =   369 bits (946),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 242/341 (71%), Gaps = 23/341 (7%)
 Frame = -3

Query  1165  SALNLPATKSPES---LCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGA  995
             + + +PA KSP     L RMGSG SV++D+ENG+EAES RKLPSSRFKGVVPQPNGRWGA
Sbjct  16    TPVKIPAKKSPSPAGLLYRMGSGTSVVLDSENGLEAES-RKLPSSRFKGVVPQPNGRWGA  74

Query  994   QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
             QIYEKHQRVWLGTFNEE+EAAR YD+AA RFRGRDAVTNFK           DDD E  F
Sbjct  75    QIYEKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFKEAKV-------DDDEEVEF  127

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRA-FNINNMTT---PRKPEADRSAKSRERLFEKA  647
             L+ HSK+EIVDMLRKHTY +ELEQ +R  +   N TT             K+   LFEK 
Sbjct  128   LNDHSKSEIVDMLRKHTYNEELEQRKRKRYGNGNKTTGFGSVTVAVITGFKTSGLLFEKT  187

Query  646   VTPSDVGKLNRLVIPKQQAEKHFPLQNGA---VTSKGVLLNFEDTNGKVWRFRYSYWNSS  476
             VTPSDVGKLNRLVIPK QAEKHFPL  G    V+ KG+LLNFED NGKVWRFRYSYWNSS
Sbjct  188   VTPSDVGKLNRLVIPKHQAEKHFPLSGGDESNVSVKGMLLNFEDVNGKVWRFRYSYWNSS  247

Query  475   QSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ  296
             QSYVLTKGWSRFVKEK L AGD + F RS G + +L+I WK+++G+GS           +
Sbjct  248   QSYVLTKGWSRFVKEKRLCAGDSICFKRSNGQDHKLYIGWKSKSGSGSGSDQDTG----R  303

Query  295   VFRLFGVNISKSTVSPMAMAMDTTNNIS-SCSGGKRIREVV  176
             + RLFGV+I  S  + + +  +   ++S  C+  K+ R+++
Sbjct  304   IVRLFGVDICFSDTAGLVVKEEAEMSMSLKCNNHKKQRKII  344



>ref|XP_008465773.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Cucumis melo]
Length=321

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 184/275 (67%), Positives = 208/275 (76%), Gaps = 22/275 (8%)
 Frame = -3

Query  1072  EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGR  893
             EAES RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEE +AA+ YDIAA RFRGR
Sbjct  34    EAES-RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEENDAAKAYDIAALRFRGR  92

Query  892   DAVTNFKPLSETTDGRNGDDDY--EAVFLSSHSKAEIVDMLRKHTYTDELEQSRR----A  731
             DAVTNFKP        N D D+  EA FL+SHSK EIVDMLRKHTY +EL+QS+R    A
Sbjct  93    DAVTNFKP------SLNHDHDHALEADFLNSHSKLEIVDMLRKHTYNEELQQSKRHQRGA  146

Query  730   FNINNMTTPR-KPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT  554
               +++ + P        S   RE LFEK VTPSDVGKLNRLVIPKQ AEK+FP++ G V+
Sbjct  147   MAVDSGSFPHYSGSGSGSDSKREVLFEKTVTPSDVGKLNRLVIPKQHAEKNFPMEEGVVS  206

Query  553   SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEK  374
              KG+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVK+ +L+AGD+V F RSTGP+K
Sbjct  207   GKGMLLNFEDMGGKVWRFRYSYWNSSQSYVLTKGWSRFVKDNTLRAGDVVRFLRSTGPDK  266

Query  373   QLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             QL+I     N  G        + PV V +LFGVNI
Sbjct  267   QLYIHANPINAPG--------IKPVHVVKLFGVNI  293



>ref|XP_009381733.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like 
[Musa acuminata subsp. malaccensis]
Length=323

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 202/343 (59%), Positives = 237/343 (69%), Gaps = 50/343 (15%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAE---NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             L R+GSG SV++D      G+EAES RKL SS +KGVVPQPNGR+G+QIYE+HQRVWLG 
Sbjct  23    LQRIGSGVSVVLDPSAEGGGIEAES-RKLSSSWYKGVVPQPNGRYGSQIYERHQRVWLGN  81

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F +E EAAR YD+AAQ FRG DAVTNFKPL+E+ D    ++  E  FL +HS+AEIVDML
Sbjct  82    FGDEAEAARAYDVAAQWFRGCDAVTNFKPLTESND----EEAAELSFLVAHSEAEIVDML  137

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQ  596
             RKHTY DEL+QS++                RSA  RE LF+K VTPSDVGKLNRLVIPKQ
Sbjct  138   RKHTYHDELQQSKQTL--------------RSA--REILFDKVVTPSDVGKLNRLVIPKQ  181

Query  595   QAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLK  419
              AEKHFPL++G+ V   GVLLNFED  GK+WRFRYSYWNSS+SYV+TKGWSRFVKEKSLK
Sbjct  182   HAEKHFPLKSGSSVARNGVLLNFEDAAGKMWRFRYSYWNSSRSYVVTKGWSRFVKEKSLK  241

Query  418   AGDIVSFHRSTGPEKQLFIDWK----ARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVS  251
             AGD+VSF RSTGPEKQL IDWK    A N    P I      P+ V +LFGV+IS     
Sbjct  242   AGDLVSFWRSTGPEKQLCIDWKTSPVACNRAVPPSI-----RPLPVVKLFGVDISGVP--  294

Query  250   PMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                         +S   GKR RE  ME  P     K++ ++AL
Sbjct  295   ------------ASGDDGKRGRE--MELFPPPQFFKKQFVEAL  323



>ref|XP_008782355.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Phoenix dactylifera]
Length=316

 Score =   353 bits (906),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 220/287 (77%), Gaps = 12/287 (4%)
 Frame = -3

Query  1105  ASVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAA  932
              SV++D   + G E ES RKLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLGTF EE +AA
Sbjct  2     GSVVLDPTPDMGFETES-RKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFAEEADAA  60

Query  931   RVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDE  752
             R YD AAQRFRGR+AVTNF PLSE  D    D   E  FL+SHSKAEIVDM+RKHTY DE
Sbjct  61    RAYDAAAQRFRGREAVTNFTPLSENDD----DGAAELAFLASHSKAEIVDMMRKHTYCDE  116

Query  751   LEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL  572
             L QS+RA   +  T  ++        +R+ LF K VTPSDVGKLNRLVIPKQ AEKHFPL
Sbjct  117   LRQSKRAGKASRGTVGKRNPPSSLGLARDLLFSKPVTPSDVGKLNRLVIPKQHAEKHFPL  176

Query  571   QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR  392
             + G+ T+ G+LLNFED +GK+WRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGD+V F R
Sbjct  177   KFGSATT-GMLLNFEDVSGKIWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDVVGFWR  235

Query  391   STGPEKQLFIDWKARNGTGSPDISTVP-VHPVQVFRLFGVNISKSTV  254
             S GPE+QL+IDWK R   G    +TVP    +QV RLFGVNI ++ V
Sbjct  236   SRGPERQLYIDWKPR---GVAADATVPRAGHLQVVRLFGVNIFRTPV  279



>ref|XP_004961326.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os05g0549800-like 
[Setaria italica]
Length=381

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 207/362 (57%), Positives = 241/362 (67%), Gaps = 40/362 (11%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR---------------KLPSSRFKGVVPQPNGRWGA  995
             L R+GSGAS ++DA E G EA+SG                KLPSS++KGVVPQPNGRWGA
Sbjct  32    LQRVGSGASAVMDAAEPGAEADSGGAARAGGGGGGAAVGGKLPSSKYKGVVPQPNGRWGA  91

Query  994   QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
             QIYE+HQRVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+    + +   E  F
Sbjct  92    QIYERHQRVWLGTFTGESEAARAYDVAAQRFRGRDAVTNFRPLAES----DPEAAAELRF  147

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAF------NINNMTTPRKPEADRSAKSRERLFE  653
             L+S SKAE+VDMLRKHTY +EL Q+RRAF                  A  +A +RE LF+
Sbjct  148   LASRSKAEVVDMLRKHTYLEELAQNRRAFAAASPSPPPKNNPSSPAAASSAAAAREHLFD  207

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQ---NGAVT--SKGVLLNFEDTNGKVWRFRYSY  488
             K VTPSDVGKLNRLVIPKQ AEKHFPLQ     AVT   KGVLLNFED  GKVWRFRYSY
Sbjct  208   KTVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAAAVTGECKGVLLNFEDAAGKVWRFRYSY  267

Query  487   WNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPV  308
             WNSSQSYVLTKGWSRFVKEK L AGD V F+RS G  KQLFID K R  T +   +T P 
Sbjct  268   WNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAG--KQLFIDCKVRPKTTA---ATTP-  321

Query  307   HPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVID  128
              PV+  RLFGV++   T +  A A+     + + +  KR R+ +    P    KKQ +  
Sbjct  322   PPVKAVRLFGVDL--LTAARPAAALPKQEEMVAVT-NKRARDAIAASTPHMVFKKQCIDF  378

Query  127   AL  122
             AL
Sbjct  379   AL  380



>gb|AGB07590.1| ethylene-responsive transcription factor 7 [Artemisia annua]
Length=285

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 199/244 (82%), Gaps = 11/244 (5%)
 Frame = -3

Query  1117  MGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEE  938
             +GSG S+++D E G+EAES RKLPSS+FKGVVPQPNGRWGAQIYEKHQRVWLGTFNEE E
Sbjct  29    IGSGGSMVLDMEGGLEAES-RKLPSSKFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEHE  87

Query  937   AARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYT  758
             AA+ YD A QRFRGRDAVTNFK LS      N +   EA FL+SHSKAEIVDMLRKHTY 
Sbjct  88    AAKAYDTAVQRFRGRDAVTNFKQLSLD----NEEASLEASFLNSHSKAEIVDMLRKHTYN  143

Query  757   DELEQSRRAFNINNMTTPRKP---EADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAE  587
             DE EQS+R+ ++   T+P         +   +RE+LFEK VTPSDVGKLNRLVIPKQ AE
Sbjct  144   DEFEQSKRSCSLK--TSPFSDGFRSGHQLVNAREQLFEKTVTPSDVGKLNRLVIPKQHAE  201

Query  586   KHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDI  407
             KHFPLQ+G+ TSKGVLL+FED   KVWRFRYSYWNSSQSYVLTKGWSRFVKEK+LKAGDI
Sbjct  202   KHFPLQSGS-TSKGVLLHFEDVGMKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDI  260

Query  406   VSFH  395
             VSF 
Sbjct  261   VSFQ  264



>ref|XP_009403983.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=345

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 237/347 (68%), Gaps = 38/347 (11%)
 Frame = -3

Query  1132  ESLCRMGSGASVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLG  959
             E L RMGSG SV++D   E G++AES RKLPSSR+KGVVPQ NGRWGAQIYE+ +RVWLG
Sbjct  27    EVLQRMGSGVSVVLDPTPEGGMKAES-RKLPSSRYKGVVPQLNGRWGAQIYERTRRVWLG  85

Query  958   TFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDM  779
             TF++E EAAR YD+AAQRFRG+DA TNF PLSET D    D+  E  FL +HSKAEIVDM
Sbjct  86    TFSDEAEAARAYDVAAQRFRGQDATTNFHPLSETHD----DEAAELTFLLAHSKAEIVDM  141

Query  778   LRKHTYTDELEQSRRAFNINNMTTP---RKPEADRSAKSRERLFEKAVTPSDVGKLNRLV  608
             LRKHTY +ELEQS+R             R P   RS   R+ LFEK VTPSDVGKLNRLV
Sbjct  142   LRKHTYGEELEQSKRDARDGRGAIAGKRRTPNDLRSV--RDLLFEKVVTPSDVGKLNRLV  199

Query  607   IPKQQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKE  431
             IPK  AEKHFP ++ + +  KGVL N+ED  GKVWRFRYSYW SSQSYVLTKGWSRFVKE
Sbjct  200   IPKHHAEKHFPSKSSSSMACKGVLFNYEDAGGKVWRFRYSYWKSSQSYVLTKGWSRFVKE  259

Query  430   KSLKAGDIVSFHRSTGPEKQLFIDWKAR----NGTGSPDISTVPVHPVQVFRLFGVNISK  263
             K+LKAGD+VSF RSTGPEK+++ID +A     + +  P I  +P     V +LFGV+IS+
Sbjct  260   KNLKAGDVVSFWRSTGPEKRMYIDRRAGGVVCDRSAPPAIGQLP-----VVKLFGVDISE  314

Query  262   STVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                                SGG   R   ME  P     +++ I+AL
Sbjct  315   LP----------------ASGGDAKRGREMELFPPSQFFERQFIEAL  345



>ref|XP_009413643.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Musa acuminata subsp. malaccensis]
Length=332

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 225/293 (77%), Gaps = 12/293 (4%)
 Frame = -3

Query  1129  SLCRMGSGASVIIDA--ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             +L R+GSG S++ID   E G+EAES RKL S R+KGVVPQPNGRWGAQIYE+HQRVWLGT
Sbjct  27    ALQRLGSGVSLVIDPAPEGGIEAES-RKLASYRYKGVVPQPNGRWGAQIYERHQRVWLGT  85

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F +E +AAR YD+AAQRFRGRDAVTNF PLSE+ D   G    E  FL +HSKAEIVDML
Sbjct  86    FGDEADAARAYDVAAQRFRGRDAVTNFNPLSESDDEEAG----ELSFLETHSKAEIVDML  141

Query  775   RKHTYTDELEQSRRAFNINNMTTPR-KPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPK  599
             RKHTY DEL+QS+R++        R  P   RS  SR  LF+K+VTPSDV KLNRLVIPK
Sbjct  142   RKHTYRDELQQSKRSYEAGGFAGKRTTPGYLRS--SRVILFDKSVTPSDVSKLNRLVIPK  199

Query  598   QQAEKHFPLQNGA-VTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSL  422
             Q AEKHFPL++ + +  KGVLLN ED  GKVWRFRYSYW+SSQSYVLTKGWSRFVKEK+L
Sbjct  200   QHAEKHFPLKSSSGMACKGVLLNVEDAGGKVWRFRYSYWSSSQSYVLTKGWSRFVKEKNL  259

Query  421   KAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISK  263
             KA D+VSF RSTGPEKQL+IDW+      S    T  + P+ V +LFGVNIS+
Sbjct  260   KARDVVSFWRSTGPEKQLYIDWRT-EAVASNRTMTPAIRPLPVVKLFGVNISE  311



>ref|XP_002440193.1| hypothetical protein SORBIDRAFT_09g027530 [Sorghum bicolor]
 gb|EES18623.1| hypothetical protein SORBIDRAFT_09g027530 [Sorghum bicolor]
Length=406

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/367 (54%), Positives = 232/367 (63%), Gaps = 55/367 (15%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR-----------------KLPSSRFKGVVPQPNGRW  1001
             L R+GSGAS ++DA E G EA+SG                  KLPSS++KGVVPQPNGRW
Sbjct  35    LQRVGSGASAVMDAAEPGAEADSGSGGAGRATGGCGVVSGNGKLPSSKYKGVVPQPNGRW  94

Query  1000  GAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEA  821
             GAQIYE+HQRVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+    + +   E 
Sbjct  95    GAQIYERHQRVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLAES----DPEAAVEL  150

Query  820   VFLSSHSKAEIVDMLRKHTYTDELEQSRRAF-------------NINNMTTPRKPEADRS  680
              FL+S +KAE+VDMLRKHTY +EL Q+RRAF             N N   +   P A   
Sbjct  151   RFLASRTKAEVVDMLRKHTYGEELAQNRRAFAAASPAASPPPAKNNNPAASSSSPTA---  207

Query  679   AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ-------NGAVTSKGVLLNFEDT  521
               +RE LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ             KGVLLNFED 
Sbjct  208   VTAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAAAAVVGGECKGVLLNFEDA  267

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNG  341
              GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD V F+RS G ++Q FID K R  
Sbjct  268   TGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAGGKQQFFIDCKLRPK  327

Query  340   TGSPDIS-------TVPVHPVQVFRLFGVN-ISKSTVSPMAMAMDTTNNISSCSGGKRIR  185
             T +   S       T    PV+  RLFGV+ ++     P  +A      I+  +  KR R
Sbjct  328   TTTTAASFVNATTTTAAPSPVKAVRLFGVDLLTTPRPGPAVVAAPEQEEIAMAN--KRAR  385

Query  184   EVVMEFL  164
             + +   L
Sbjct  386   DAIARVL  392



>gb|EPS59202.1| hypothetical protein M569_15607 [Genlisea aurea]
Length=326

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 232/330 (70%), Gaps = 35/330 (11%)
 Frame = -3

Query  1081  NGVEAE-SGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQR  905
             N VE+E   RKLPSSRFKGVVPQPNGRWGAQIYEKH RVWLGTFN+EE+AAR YD AAQR
Sbjct  22    NLVESEIESRKLPSSRFKGVVPQPNGRWGAQIYEKHHRVWLGTFNDEEDAARAYDAAAQR  81

Query  904   FRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR----  737
             FRGRDAVTNFK  +         D+ E  FL+SHSKAEIVDMLRKHTY DELEQ R    
Sbjct  82    FRGRDAVTNFKAPA--------IDESEVAFLNSHSKAEIVDMLRKHTYYDELEQCRKKCD  133

Query  736   ---RAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN  566
                +AF   ++       +DR    RE LFEKAVTPSDVGKLNRLVIPKQ AE+HFP Q+
Sbjct  134   GAGKAFG-GDVLAGTGVSSDR----REHLFEKAVTPSDVGKLNRLVIPKQHAERHFPKQS  188

Query  565   GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST  386
             G+  +KGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AGDI+ F RST
Sbjct  189   GS-NAKGVLLNFEDVCGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKELRAGDIIIFRRST  247

Query  385   GPEK--QLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNIS  212
             G +   QL+IDWK+R+     D     V P  V RLFGVNI+    S  A A D      
Sbjct  248   GADAPPQLYIDWKSRSHAAGHDGRIGGVAP--VVRLFGVNIN----SAAAAAFDGGCCCG  301

Query  211   SCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                  KRIRE+  + L  +  KKQR+I+AL
Sbjct  302   GG---KRIREI--DILGFDRCKKQRIINAL  326



>dbj|BAK03139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 198/368 (54%), Positives = 238/368 (65%), Gaps = 38/368 (10%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGASVIIDA-ENGVEAESGR--KLPSSRFKGVVPQPNGRWGAQIYEK  980
             PA  + + L R+GSGAS ++DA E G EA+SGR  +LPSS++KGVVPQPNGRWGAQIYE+
Sbjct  26    PAAPATKPLQRVGSGASAVMDAPEPGAEADSGRGGRLPSSKYKGVVPQPNGRWGAQIYER  85

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTF  E EA R YD AAQRFRGRDAVTNF+PL+E+    + DD  E  FL++ S
Sbjct  86    HQRVWLGTFTGEAEAGRAYDAAAQRFRGRDAVTNFRPLAES----DPDDAAELRFLAARS  141

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKS-------RERLFEKAVT  641
             KAE+VDMLRKH Y DEL Q +RAF     ++P    +  ++ +       RE LF+K VT
Sbjct  142   KAEVVDMLRKHIYPDELAQHKRAFFFAAASSPTSSSSPLASPAPSAAAARREHLFDKTVT  201

Query  640   PSDVGKLNRLVIPKQQAEKHFPLQNGAVTS------KGVLLNFEDTNGKVWRFRYSYWNS  479
             PSDVGKLNRLVIPKQ AEKHFPLQ  + ++      KGVLLNF+D  GKVWRFRYSYWNS
Sbjct  202   PSDVGKLNRLVIPKQHAEKHFPLQLPSASAAVPGECKGVLLNFDDATGKVWRFRYSYWNS  261

Query  478   SQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR----------NGTGSP  329
             SQSYVLTKGWSRFVKEK L AGD V F+R+     QLFID K R          N   +P
Sbjct  262   SQSYVLTKGWSRFVKEKGLHAGDAVEFYRAASGNNQLFIDCKLRSKSTTTTTSVNSEAAP  321

Query  328   DISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREV-VMEFLPLEC  152
               S  PV   +  RLFGV++    ++P A       +       KR  E  V    P   
Sbjct  322   --SPAPV--TRTVRLFGVDL---LIAPAARHAHEHEDYGMAKTNKRTMEASVAAPTPAHA  374

Query  151   SKKQRVID  128
               K+R +D
Sbjct  375   VWKKRCVD  382



>ref|XP_007033326.1| AP2 domain class transcription factor, putative [Theobroma cacao]
 gb|EOY04252.1| AP2 domain class transcription factor, putative [Theobroma cacao]
Length=316

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 219/315 (70%), Gaps = 23/315 (7%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQI  989
             A+  + PA K PE+ C+          +E  +EA   +K PSS+FKGVV QPNGRWGAQI
Sbjct  2     ATYSSFPARKFPENSCQ---------SSERSIEAAGPQKQPSSKFKGVVSQPNGRWGAQI  52

Query  988   YEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLS  809
             YEKHQRVWLGTFNEEEEAA+ YDIAA RFRG++A TNFKP   TTD    +DD+E  FL 
Sbjct  53    YEKHQRVWLGTFNEEEEAAKAYDIAALRFRGQNAFTNFKPSIHTTD----EDDFEQFFLV  108

Query  808   SHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRK-------PEADRSAKSRERLFEK  650
             SHSK EIVDM+RKHTYT+ELE S+  +  ++     K       P  D    +RE LFEK
Sbjct  109   SHSKEEIVDMIRKHTYTNELEHSKYNYACHDTRKGIKGNGFSSLPGFDPFEGAREYLFEK  168

Query  649   AVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQS  470
               TPSDVGKLNR+VIPKQ A+K+FPLQ+G + SKGVLLNFED  G+VWRFRY YW SSQS
Sbjct  169   VATPSDVGKLNRIVIPKQHADKYFPLQSG-IVSKGVLLNFEDNMGQVWRFRYCYWKSSQS  227

Query  469   YVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDIS--TVPVHPVQ  296
             YVLTK W+RFVKEK LKAGD VSF RS GP  +LFI  KA N +   ++    VP     
Sbjct  228   YVLTKDWTRFVKEKKLKAGDAVSFWRSVGPNTKLFIGHKAGNVSNLEELPNRVVPRENSG  287

Query  295   VFRLFGVNISKSTVS  251
             V RLFGVNI ++ ++
Sbjct  288   VIRLFGVNILETNMA  302



>ref|NP_001043946.1| Os01g0693400 [Oryza sativa Japonica Group]
 sp|Q8RZX9.1|Y1934_ORYSJ RecName: Full=AP2/ERF and B3 domain-containing protein Os01g0693400 
[Oryza sativa Japonica Group]
 dbj|BAB84620.1| DNA-binding protein RAV1-like [Oryza sativa Japonica Group]
 dbj|BAF05860.1| Os01g0693400 [Oryza sativa Japonica Group]
 dbj|BAH01166.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   349 bits (895),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 224/327 (69%), Gaps = 48/327 (15%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR-----------------KLPSSRFKGVVPQPNGRW  1001
             L RMGSGAS ++DA E G EA+SG                  KLPSS+FKGVVPQPNGRW
Sbjct  34    LERMGSGASAVVDAAEPGAEADSGSGGRVCGGGGGGAGGAGGKLPSSKFKGVVPQPNGRW  93

Query  1000  GAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEA  821
             GAQIYE+HQRVWLGTF  E++AAR YD+AAQRFRGRDAVTNF+PL+E           E 
Sbjct  94    GAQIYERHQRVWLGTFAGEDDAARAYDVAAQRFRGRDAVTNFRPLAEADPDAA----AEL  149

Query  820   VFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNIN--------------NMTTPRKPEADR  683
              FL++ SKAE+VDMLRKHTY DEL QS+R F  +              ++++PR P A  
Sbjct  150   RFLATRSKAEVVDMLRKHTYFDELAQSKRTFAASTPSAATTTASLSNGHLSSPRSPFA--  207

Query  682   SAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNGKV  509
              A +R+ LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLNFED  GKV
Sbjct  208   PAAARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAAGKV  267

Query  508   WRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR---STGPEKQLFIDWKARNGT  338
             WRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD+V F+R   S G + +LFID K    T
Sbjct  268   WRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDVVGFYRSAASAGDDGKLFIDCKLVRST  327

Query  337   G----SPDISTVPVHPVQVFRLFGVNI  269
             G    SP     P  PV+  RLFGV++
Sbjct  328   GAALASPADQPAP-SPVKAVRLFGVDL  353



>tpg|DAA58010.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=389

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 223/327 (68%), Gaps = 33/327 (10%)
 Frame = -3

Query  1162  ALNLPATKSPESLCRMGSGASVIIDA-ENGVEAESGR---------KLPSSRFKGVVPQP  1013
             AL + A  S   L RMGSGAS ++DA E G EA+SG          KLPSSR+KGVVPQP
Sbjct  26    ALAVFAAASGTPLERMGSGASAVVDAAEPGAEADSGSGAAAVSVGGKLPSSRYKGVVPQP  85

Query  1012  NGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD  833
             NGRWGAQIYE+HQRVWLGTF  E +AAR YD+AAQRFRGRDAVTNF+PL++       D 
Sbjct  86    NGRWGAQIYERHQRVWLGTFAGEADAARAYDVAAQRFRGRDAVTNFRPLADADP----DA  141

Query  832   DYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNI-------------NNMTTPRKPE  692
               E  FL+S SKAE+VDMLRKHTY DEL Q++RAF               N  +      
Sbjct  142   AAELRFLASRSKAEVVDMLRKHTYFDELAQNKRAFAAASASAATASSLANNPSSYASLSP  201

Query  691   ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTN  518
             A  +A +RE LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLN ED  
Sbjct  202   ATATAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNLEDAA  261

Query  517   GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS-TGPEKQLFIDWKARNG  341
             GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AGD+V F+RS  G + +LFID K R  
Sbjct  262   GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLQAGDVVGFYRSAAGADTKLFIDCKLRPN  321

Query  340   TGSPDISTVPVHPVQV---FRLFGVNI  269
             +     +  P  P  V    RLFGV++
Sbjct  322   SVVVASTAGPSPPAPVAKAVRLFGVDL  348



>gb|AIB05361.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=389

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 223/327 (68%), Gaps = 33/327 (10%)
 Frame = -3

Query  1162  ALNLPATKSPESLCRMGSGASVIIDA-ENGVEAESGR---------KLPSSRFKGVVPQP  1013
             AL + A  S   L RMGSGAS ++DA E G EA+SG          KLPSSR+KGVVPQP
Sbjct  26    ALAVFAAASGTPLERMGSGASAVVDAAEPGAEADSGSGATAVSVGGKLPSSRYKGVVPQP  85

Query  1012  NGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD  833
             NGRWGAQIYE+HQRVWLGTF  E +AAR YD+AAQRFRGRDAVTNF+PL++       D 
Sbjct  86    NGRWGAQIYERHQRVWLGTFAGEADAARAYDVAAQRFRGRDAVTNFRPLADADP----DA  141

Query  832   DYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNI-------------NNMTTPRKPE  692
               E  FL+S SKAE+VDMLRKHTY DEL Q++RAF               N  +      
Sbjct  142   AAELRFLASRSKAEVVDMLRKHTYFDELAQNKRAFAAASASAATASSLANNPSSYASLSP  201

Query  691   ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTN  518
             A  +A +RE LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLN ED  
Sbjct  202   ATATAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNLEDAA  261

Query  517   GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS-TGPEKQLFIDWKARNG  341
             GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AGD+V F+RS  G + +LFID K R  
Sbjct  262   GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLQAGDVVGFYRSAAGADTKLFIDCKLRPN  321

Query  340   TGSPDISTVPVHPVQV---FRLFGVNI  269
             +     +  P  P  V    RLFGV++
Sbjct  322   SVVVASTAGPSPPAPVAKAVRLFGVDL  348



>ref|XP_010536332.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like, partial [Tarenaya hassleriana]
Length=302

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 210/281 (75%), Gaps = 28/281 (10%)
 Frame = -3

Query  1168  ASALNLPATKSPESLCRMGSGASVIIDAEN--GVEAESGRKLPSSRFKGVVPQPNGRWGA  995
             A  L+ PA +    L RM SG SV+ D++N  GVE ES RKLPSS++KGVVPQPNGRWGA
Sbjct  31    AKLLSHPAVR----LYRMVSGGSVVSDSDNVNGVETES-RKLPSSKYKGVVPQPNGRWGA  85

Query  994   QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
             QIY+KHQRVWLGTFN E EAAR YD+AA+RFRG +AVTNFK      DG  G +  E+ F
Sbjct  86    QIYQKHQRVWLGTFNNESEAARAYDVAARRFRGHNAVTNFK--YPANDG--GQNVTESAF  141

Query  814   LSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA-------KSRERLF  656
             L +HSKAEIVDMLRKHTY DELEQS+R F+++ +    K    R A       K+RE LF
Sbjct  142   LEAHSKAEIVDMLRKHTYEDELEQSKRRFHLSVVDGNGKRYKTREAQNDAVGGKTREMLF  201

Query  655   EKAVTPSDVGKLNRLVIPKQQAEKHFPL----QNGAVT------SKGVLLNFEDTNGKVW  506
             EKAVTPSDVGKLNRLVIPK  AEKHFPL     NG  T      +KG+L+NFED  GKVW
Sbjct  202   EKAVTPSDVGKLNRLVIPKPHAEKHFPLPTTTDNGNETASPSPSTKGMLMNFEDLTGKVW  261

Query  505   RFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTG  383
             RFRYSYWNSSQSYVLTKGWSRFVKEK+L+AGD+VSF RSTG
Sbjct  262   RFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFERSTG  302



>emb|CDX83547.1| BnaC07g22870D [Brassica napus]
Length=324

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 230/354 (65%), Gaps = 62/354 (18%)
 Frame = -3

Query  1171  HASALNLPAT----KSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGR  1004
             H  A   PAT     SP SL RMGSG+SV++D+ENGVEAES RKLPSSRFKGVVPQPNGR
Sbjct  18    HTPAKIPPATARKSSSPASLYRMGSGSSVVLDSENGVEAES-RKLPSSRFKGVVPQPNGR  76

Query  1003  WGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYE  824
             WGAQIYEKHQRVWLGTFNEE+EAAR YD+AA RFRGRDAVTNFK    T D  NGD   E
Sbjct  77    WGAQIYEKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFKA-DTTLD--NGD---E  130

Query  823   AVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA---KSRERLFE  653
               FL++HSKAEIVDMLRKHTY +ELEQ +R  +    T      A R A   K+ E LFE
Sbjct  131   IEFLNAHSKAEIVDMLRKHTYREELEQMKRNLHGKGNTKETAFAAVRIATGFKTAETLFE  190

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             KAVTP D                        V+ +  LLNFED NGKVWRFRYSYWNSSQ
Sbjct  191   KAVTPRD------------------------VSVRLTLLNFEDVNGKVWRFRYSYWNSSQ  226

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK L AGD++SF RS G ++QL+I WK++      D  T  V    V
Sbjct  227   SYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWKSK---CESDQDTGRV----V  279

Query  292   FRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVI  131
              RLFGV+I+         ++ + N++        + +   E L L C+KKQR++
Sbjct  280   VRLFGVDIT---------SLKSQNDL--------VMKEETEMLSLRCNKKQRLL  316



>ref|NP_001151105.1| DNA-binding protein RAV1 [Zea mays]
 gb|ACG41637.1| DNA-binding protein RAV1 [Zea mays]
Length=395

 Score =   340 bits (873),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 223/328 (68%), Gaps = 34/328 (10%)
 Frame = -3

Query  1162  ALNLPATKSPESLCRMGSGASVIIDA-ENGVEAESGR---------KLPSSRFKGVVPQP  1013
             AL + A  S   L RMGSGAS ++DA E G EA+SG          KLPSSR+KGVVPQP
Sbjct  28    ALAVFAAASGTPLERMGSGASAVVDAAEPGAEADSGSGAAAVSVGGKLPSSRYKGVVPQP  87

Query  1012  NGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDD  833
             NGRWGAQIYE+HQRVWLGTF  E +AAR YD+AAQRFRGRDAVTNF+PL++         
Sbjct  88    NGRWGAQIYERHQRVWLGTFAGEADAARAYDVAAQRFRGRDAVTNFRPLADADPDAA---  144

Query  832   DYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKS------  671
               E  FL+S SKAE+VDMLRKHTY DEL Q++RAF   +  T      + S+ +      
Sbjct  145   -AELRFLASRSKAEVVDMLRKHTYFDELAQNKRAFAAASAATASSLANNPSSYASLSPAT  203

Query  670   --------RERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDT  521
                     RE LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLN ED 
Sbjct  204   ATAAAAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNLEDA  263

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS-TGPEKQLFIDWKARN  344
              GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AGD+V F+RS  G + +LFID K R 
Sbjct  264   AGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLQAGDVVGFYRSAAGADTKLFIDCKLRP  323

Query  343   GT--GSPDISTVPVHPV-QVFRLFGVNI  269
              +   +      P  PV +  RLFGV++
Sbjct  324   NSVVAASTAGPSPRAPVAKAVRLFGVDL  351



>dbj|BAK00882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 231/363 (64%), Gaps = 53/363 (15%)
 Frame = -3

Query  1120  RMGSGASVIIDA-ENGVEAESGR----KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             R+GSGAS ++DA E G EA+SG     KLPSSR+KGVVPQPNGRWGAQIYE+HQRVWLGT
Sbjct  40    RVGSGASAVLDAAEPGSEADSGGGRAGKLPSSRYKGVVPQPNGRWGAQIYERHQRVWLGT  99

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F  E +AAR YD+AAQRFRGRDAVTNF+PL++           E  FL++ SKAE+VDML
Sbjct  100   FPGEADAARAYDVAAQRFRGRDAVTNFRPLADADPDAA----AELRFLAARSKAEVVDML  155

Query  775   RKHTYTDELEQSRR-------------AFNINNMTTPRKPEADRSAKSRERLFEKAVTPS  635
             RKHTY DEL QS+R             + +     +P  P     A  RE LF+K VTPS
Sbjct  156   RKHTYFDELAQSKRAFAASAALSAPTTSGDAGGSASPPSP-----AAVREHLFDKTVTPS  210

Query  634   DVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVL  461
             DVGKLNRLVIPKQ AEKHFPLQ   G   SKG+LLNFED  GKVWRFRYSYWNSSQSYVL
Sbjct  211   DVGKLNRLVIPKQNAEKHFPLQLPAGGGESKGLLLNFEDDAGKVWRFRYSYWNSSQSYVL  270

Query  460   TKGWSRFVKEKSLKAGDIVSFHRS----TGPEKQLFIDWKARNGTGSP------DISTVP  311
             TKGWSRFVKEK L AGD+V F+RS    T  + + FID + R  T +       D S+ P
Sbjct  271   TKGWSRFVKEKGLGAGDVVGFYRSAAGRTDEDSKFFIDCRLRPNTNTAAEADPVDQSSAP  330

Query  310   VHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVI  131
                 +  RLFGV++  +    M              G KR R++V    P    KKQ + 
Sbjct  331   AQ--KAVRLFGVDLLAAPEQGMP------------GGCKRARDLVKPPPPKVAFKKQCIE  376

Query  130   DAL  122
              AL
Sbjct  377   LAL  379



>gb|KCW75689.1| hypothetical protein EUGRSUZ_D00053 [Eucalyptus grandis]
Length=327

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 208/302 (69%), Gaps = 35/302 (12%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             P+SLCR+GSG SV +D E G++AES RKL  S++KGVVPQPNGRWGAQIYEKHQRVW+GT
Sbjct  33    PQSLCRLGSGTSVTLDCEGGIKAES-RKLNPSKYKGVVPQPNGRWGAQIYEKHQRVWIGT  91

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F+EE+EAA  YDIAA+RFRG++AVTNF                ++ F     +AEIVDML
Sbjct  92    FSEEDEAAMAYDIAAKRFRGQEAVTNFN---------------QSRFPDFSFQAEIVDML  136

Query  775   RKHTYTDELEQSRRAF-NINN----------MTTPRKPEADRSAKSRERLFEKAVTPSDV  629
             RKH Y +ELEQ +R + N N           +  P  P   R+  +   LF+K VT SDV
Sbjct  137   RKHVYYEELEQCKRKYVNANGDGKRMSMTEALGDPSGP--GRAVAACHLLFQKEVTRSDV  194

Query  628   GKLNRLVIPKQQAEKHFPLQN--GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             GKLNR VIPKQ AEKHFPL N     T KG LLNF D  GKVWRFRY YWNSS SYVLT 
Sbjct  195   GKLNRFVIPKQHAEKHFPLHNRSSPTTPKGTLLNFIDGGGKVWRFRYLYWNSSHSYVLTL  254

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GWSRFVKEKSL+AGDI+SFH+S GPEKQ  I++  R+G         PVHPVQ  RLFGV
Sbjct  255   GWSRFVKEKSLRAGDIISFHQSAGPEKQFHINYMRRSGLS----QARPVHPVQKVRLFGV  310

Query  274   NI  269
             +I
Sbjct  311   DI  312



>ref|NP_001141742.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|ACF86967.1| unknown [Zea mays]
 gb|AFW79018.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=406

 Score =   339 bits (869),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 192/339 (57%), Positives = 221/339 (65%), Gaps = 47/339 (14%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR----------KLPSSRFKGVVPQPNGRWGAQIYEK  980
             L R+GSG S ++DA E G EA+SG           KLPSS++KGVVPQPNGRWGAQIYE+
Sbjct  33    LQRVGSGTSAVMDAAEPGAEADSGGAGRAPGGVSGKLPSSKYKGVVPQPNGRWGAQIYER  92

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+      +   E  FL+S S
Sbjct  93    HQRVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLAESEP----EAAVELRFLASRS  148

Query  799   KAEIVDMLRKHTYTDELEQSRRAF----------NINNMTTPRKPEADRSAKSRERLFEK  650
             KAE+VDMLRKHTY +EL  +RRAF            NN   P    +   A +RE LF+K
Sbjct  149   KAEVVDMLRKHTYGEELAHNRRAFAAASPAASPPPENNRRPPAASSSSSPAAAREHLFDK  208

Query  649   AVTPSDVGKLNRLVIPKQQAEKHFPLQ---------NGAVTSKGVLLNFEDTNGKVWRFR  497
              VTPSDVGKLNRLVIPKQ AEKHFPLQ               KGVLLNFED  GK WRFR
Sbjct  209   TVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAAAAGVGSGGECKGVLLNFEDAAGKAWRFR  268

Query  496   YSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR----------  347
             YSYWNSSQSYVLTKGWSRFVKEK L AGD V F+RS G ++QLFID K R          
Sbjct  269   YSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAGGKQQLFIDCKLRPNKTTTTAAA  328

Query  346   --NGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMA  236
               N       +  P+  V+  RLFGV++  +T  P A+A
Sbjct  329   FVNVNAMTTTAAPPLAAVKAVRLFGVDL-LTTPRPAAVA  366



>ref|XP_006430818.1| hypothetical protein CICLE_v10012300mg [Citrus clementina]
 gb|ESR44058.1| hypothetical protein CICLE_v10012300mg [Citrus clementina]
Length=305

 Score =   335 bits (859),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 214/287 (75%), Gaps = 22/287 (8%)
 Frame = -3

Query  1087  AENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQ  908
             +ENG++AES +KLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF EEEEAARVYD AA 
Sbjct  17    SENGIDAES-KKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFIEEEEAARVYDTAAL  75

Query  907   RFRGRDAVTNFKPLSETTDGRNGDDDY-EAVFLSSHSKAEIVDMLRKHTYTDELEQSRRA  731
             RFRG++A+TNF+   ET D    +DDY E +FLSSHSKAEIVDMLRKHTY  ELEQS++ 
Sbjct  76    RFRGQNAITNFRTSLETDD----EDDYMEKIFLSSHSKAEIVDMLRKHTYKHELEQSKQN  131

Query  730   FNINNMTTPRKPE--ADRSAKSR------ERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP  575
             +    ++        +D    +       E LFEK +TPSDVGKLNR+VIPKQQAEKHF 
Sbjct  132   YACVGISCYNNSSGFSDLFGSNCFQETPVEFLFEKVLTPSDVGKLNRMVIPKQQAEKHFA  191

Query  574   LQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
             L +  + SKGVLLNFED+  KVWR RY YW+SSQSYVLTKGWSRFVKEK +KAGD VSF 
Sbjct  192   L-SSEIASKGVLLNFEDSTQKVWRLRYCYWSSSQSYVLTKGWSRFVKEKGVKAGDTVSFW  250

Query  394   RS-TGPEKQLFIDWKAR---NGTGSPDI-STVPVHPVQVFRLFGVNI  269
             RS  G   +LFID K +   NG+G  ++ S VP   + V RLFGVNI
Sbjct  251   RSIVGSNSKLFIDCKLQQNGNGSGFEEMQSQVP--NIGVVRLFGVNI  295



>ref|NP_001056237.1| Os05g0549800 [Oryza sativa Japonica Group]
 sp|Q6L4H4.1|Y5498_ORYSJ RecName: Full=AP2/ERF and B3 domain-containing protein Os05g0549800 
[Oryza sativa Japonica Group]
 gb|AAT39261.1| putative AP2 domain protein [Oryza sativa Japonica Group]
 dbj|BAF18151.1| Os05g0549800 [Oryza sativa Japonica Group]
Length=394

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 206/288 (72%), Gaps = 32/288 (11%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR--------KLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             L R+GSGAS ++DA E G EA+SG         KLPSS++KGVVPQPNGRWGAQIYE+HQ
Sbjct  30    LQRVGSGASAVMDAAEPGAEADSGGERRGGGGGKLPSSKYKGVVPQPNGRWGAQIYERHQ  89

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+    + +   E  FL+S SKA
Sbjct  90    RVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLAES----DPEAAVELRFLASRSKA  145

Query  793   EIVDMLRKHTYTDELEQSRRAFNINNMTTPR--KPEADRSAKSRERLFEKAVTPSDVGKL  620
             E+VDMLRKHTY +EL Q++RAF   +   P+        S+ +RE LF+K VTPSDVGKL
Sbjct  146   EVVDMLRKHTYLEELTQNKRAFAAISPPPPKHPASSPTSSSAAREHLFDKTVTPSDVGKL  205

Query  619   NRLVIPKQQAEKHFPLQNGAVTS-----------------KGVLLNFEDTNGKVWRFRYS  491
             NRLVIPKQ AEKHFPLQ    T+                 KGVLLNFED  GKVW+FRYS
Sbjct  206   NRLVIPKQHAEKHFPLQLPPPTTTSSVAAAADAAAGGGDCKGVLLNFEDAAGKVWKFRYS  265

Query  490   YWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR  347
             YWNSSQSYVLTKGWSRFVKEK L AGD V F+R+ G   QLFID K R
Sbjct  266   YWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRAAGKNAQLFIDCKVR  313



>ref|XP_006482296.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Citrus sinensis]
 gb|KDO58941.1| hypothetical protein CISIN_1g021945mg [Citrus sinensis]
Length=305

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 214/287 (75%), Gaps = 22/287 (8%)
 Frame = -3

Query  1087  AENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQ  908
             +ENG++AES +KLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTF EEEEAARVYD AA 
Sbjct  17    SENGIDAES-KKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFIEEEEAARVYDTAAL  75

Query  907   RFRGRDAVTNFKPLSETTDGRNGDDDY-EAVFLSSHSKAEIVDMLRKHTYTDELEQSRRA  731
             RFRG++A+TNF+   ET D    +DDY E +FLSSHSKAEIVDMLRKHTY  ELEQS++ 
Sbjct  76    RFRGQNAITNFRTSLETDD----EDDYMEKIFLSSHSKAEIVDMLRKHTYKHELEQSKQN  131

Query  730   FNINNMTTPRKPE--ADRSAKSR------ERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP  575
             +    ++        +D    +       E LFEK +TPSDVGKLNR+VIPKQQAEKHF 
Sbjct  132   YACVGISCYNNSSGFSDLFGSNCFQETPVEFLFEKVLTPSDVGKLNRMVIPKQQAEKHFA  191

Query  574   LQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
             L +  + SKG+LLNFED+  KVWR RY YW+SSQSYVLTKGWSRFVKEK +KAGD VSF 
Sbjct  192   L-SSEIASKGLLLNFEDSTQKVWRLRYCYWSSSQSYVLTKGWSRFVKEKGVKAGDTVSFW  250

Query  394   RS-TGPEKQLFIDWKAR---NGTGSPDI-STVPVHPVQVFRLFGVNI  269
             RS  G   +LFID K +   NG+G  ++ S VP   + V RLFGVNI
Sbjct  251   RSNVGSNSKLFIDCKLQQNGNGSGFEEMQSQVP--NIGVVRLFGVNI  295



>ref|XP_003569603.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like 
[Brachypodium distachyon]
Length=403

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 196/333 (59%), Positives = 227/333 (68%), Gaps = 48/333 (14%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR----------KLPSSRFKGVVPQPNGRWGAQIYEK  980
             L RMGSGAS ++DA E G EA+SGR          KLPSS++KGVVPQPNGRWGAQIYE+
Sbjct  34    LERMGSGASAVLDAAEPGAEADSGRVVQQGAGVGGKLPSSKYKGVVPQPNGRWGAQIYER  93

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTF  E +AAR YD+AAQRFRGRDAVTNF+PLSE++   +  D  E  FL+S S
Sbjct  94    HQRVWLGTFAGEADAARAYDVAAQRFRGRDAVTNFRPLSESSP--DPADAAELRFLASRS  151

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNINNMTTP---RKPEADRSAKS-------------R  668
             KAE+VDMLRKHTY DEL QSRRAF     + P    +     S+ S             R
Sbjct  152   KAEVVDMLRKHTYFDELAQSRRAFAAAAASVPTIASRHNGQHSSPSPFPAAAAAAAAAAR  211

Query  667   ERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--------NGAVTSKGVLLNFEDTNGK  512
             E LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ         G  + KG+LLNFED  GK
Sbjct  212   EHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAAAAGGGGESCKGLLLNFEDAGGK  271

Query  511   VWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST---GPEKQLFIDWKAR--  347
             VWRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD+V F+RS    G + +LFID K R  
Sbjct  272   VWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDVVGFYRSVAGAGEDSKLFIDCKLRPN  331

Query  346   --NGTGSPDISTVPVH---PV-QVFRLFGVNIS  266
               N   +   + +PV    PV +  RLFGV+++
Sbjct  332   STNTAAAAVFTDLPVDQSAPVAKPVRLFGVDLT  364



>emb|CDY13581.1| BnaA06g33420D [Brassica napus]
Length=665

 Score =   343 bits (880),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 202/354 (57%), Positives = 232/354 (66%), Gaps = 64/354 (18%)
 Frame = -3

Query  1171  HASALNLPATK----SPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGR  1004
             H  A   PAT     SP SL RMGSG+SV++D+ENGVEAES RKLPSSRFKGVVPQPNGR
Sbjct  18    HTPAKIPPATARKSPSPASLYRMGSGSSVVLDSENGVEAES-RKLPSSRFKGVVPQPNGR  76

Query  1003  WGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYE  824
             WGAQIYEKHQRVWLGTFNEEEEAAR YD+AA RFRGRDAVTNFK  ++TT G NGD   E
Sbjct  77    WGAQIYEKHQRVWLGTFNEEEEAARAYDVAAHRFRGRDAVTNFK--ADTTLG-NGD---E  130

Query  823   AVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA---KSRERLFE  653
               FL++HSKAEIVDMLRKHTY +ELEQ +R  +    T      A R A   K+ E LFE
Sbjct  131   VEFLNAHSKAEIVDMLRKHTYKEELEQRKRNLHGKGNTKETAFAAVRVATGFKTAETLFE  190

Query  652   KAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQ  473
             KAVTP D                        V+ +G LLNFED NGKVWRFRYSYWNSSQ
Sbjct  191   KAVTPRD------------------------VSVRGTLLNFEDVNGKVWRFRYSYWNSSQ  226

Query  472   SYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQV  293
             SYVLTKGWSRFVKEK L AGD++SF RS G ++QL+I WK+++ +   D   V      V
Sbjct  227   SYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWKSKSESDQ-DTGRV------V  279

Query  292   FRLFGVNI-SKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRV  134
              RLFGV+I S  + S + M  +T                  E L L C+KKQR+
Sbjct  280   VRLFGVDITSLKSQSDVVMKEET------------------EMLSLRCNKKQRL  315



>gb|EAY98921.1| hypothetical protein OsI_20876 [Oryza sativa Indica Group]
Length=394

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 203/288 (70%), Gaps = 32/288 (11%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR--------KLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             L R+GSGAS ++DA E G EA+SG         KLPSS++KGVVPQPNGRWGAQIYE+HQ
Sbjct  30    LQRVGSGASAVMDAAEPGAEADSGGERRGGGGGKLPSSKYKGVVPQPNGRWGAQIYERHQ  89

Query  973   RVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKA  794
             RVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+    + +   E  FL+S SKA
Sbjct  90    RVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLAES----DPEAAVELRFLASRSKA  145

Query  793   EIVDMLRKHTYTDELEQSRRAFNI--NNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKL  620
             E+VDMLRKHTY +EL Q++RAF                 SA +RE LF+K VTPSDVGKL
Sbjct  146   EVVDMLRKHTYLEELTQNKRAFAAISPPPPKHPASSPPSSAAAREHLFDKTVTPSDVGKL  205

Query  619   NRLVIPKQQAEKHFPLQNGAVTS-----------------KGVLLNFEDTNGKVWRFRYS  491
             NRLVIPKQ AEKHFPLQ    T+                 KGVLLNFED  GKVW+FRYS
Sbjct  206   NRLVIPKQHAEKHFPLQLPPPTTTSSVAAAADAAAGGGECKGVLLNFEDAAGKVWKFRYS  265

Query  490   YWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR  347
             YWNSSQSYVLTKGWSRFVK+K L AGD V F+R+ G   QLFID K R
Sbjct  266   YWNSSQSYVLTKGWSRFVKDKGLHAGDAVGFYRAAGKNAQLFIDCKVR  313



>ref|XP_008656006.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os05g0549800-like 
[Zea mays]
 gb|AFW81001.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB04738.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=375

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 236/355 (66%), Gaps = 38/355 (11%)
 Frame = -3

Query  1126  LCRMGS-GASVIIDA-ENGVEAES----------GRKLPSSRFKGVVPQPNGRWGAQIYE  983
             L R+GS GAS ++DA E G EA+S          G KLPSS++KGVVPQPNGRWGAQIYE
Sbjct  36    LQRVGSSGASAVMDAAEPGAEADSDGARRAPGGVGGKLPSSKYKGVVPQPNGRWGAQIYE  95

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             +HQRVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+    + D   E  FL+S 
Sbjct  96    RHQRVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLAESD--LDPDAAAELRFLASR  153

Query  802   SKAEIVDMLRKHTYTDELEQSRR--AFNINNMTTPRKPEADRS--AKSRERLFEKAVTPS  635
             SKAE+VDMLRKHTY +EL Q+RR  A    ++ +P+ P A  +  A +RE LF+K VTPS
Sbjct  154   SKAEVVDMLRKHTYGEELAQNRRAFAAAAASLASPQLPPAKNTSPAAAREHLFDKTVTPS  213

Query  634   DVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTK  455
             DVGKLNRLVIPKQ AE+HFPL+      +  +L+FED  GK WRFRYSYWNSSQSYVLTK
Sbjct  214   DVGKLNRLVIPKQHAERHFPLRR-VQGGRAPILSFEDAAGKAWRFRYSYWNSSQSYVLTK  272

Query  454   GWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGV  275
             GWSRFVKEK L AGD V F+RS    +QLFID K R                +  RLFGV
Sbjct  273   GWSRFVKEKGLHAGDAVGFYRSAAAGRQLFIDCKLRP---------------KAVRLFGV  317

Query  274   N-ISKSTVSPMAMAM-DTTNNISSCSGGKRIRE-VVMEFLPLECS-KKQRVIDAL  122
             + +++   S  A+A  +      + S  KR R+ +     P+  + KKQRV  AL
Sbjct  318   DLLTEPPRSAAAVAQPEPEQEEIAVSKNKRARDAIAASATPVHIAFKKQRVDVAL  372



>ref|XP_007216476.1| hypothetical protein PRUPE_ppa026046mg, partial [Prunus persica]
 gb|EMJ17675.1| hypothetical protein PRUPE_ppa026046mg, partial [Prunus persica]
Length=315

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 205/296 (69%), Gaps = 25/296 (8%)
 Frame = -3

Query  1084  ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQR  905
             E+  EA +  KLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLGTFN EEEAA+ YDIA+ +
Sbjct  7     ESTSEAANSNKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNAEEEAAKAYDIASIK  66

Query  904   FRGRDAVTNFKP--LSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR-R  734
             FRG + +TNF    L    DG     D+E +FL SHSKAEIVDMLRKH+YT+ELE  + +
Sbjct  67    FRGLETITNFNQNQLKPYMDG-----DHETLFLQSHSKAEIVDMLRKHSYTNELEMYKLK  121

Query  733   AFNINNMTTPRK------PEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL  572
              FN  +    RK         +     RE LFEK  TPSDVG+LNR+VIPKQ AEKHFPL
Sbjct  122   LFNAGDDDAARKRIKCHVNLMEGYDHQREWLFEKVATPSDVGRLNRMVIPKQHAEKHFPL  181

Query  571   QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR  392
                    KGVLLNFED  GKVWR RY YW+SSQSYVLTKGW+RFVKEK LKAGD+V F R
Sbjct  182   HLSEELCKGVLLNFEDREGKVWRLRYCYWSSSQSYVLTKGWTRFVKEKKLKAGDVVRFER  241

Query  391   STGPEKQLFIDWKARN--GTGSPDIST-----VPVHPVQ----VFRLFGVNISKST  257
             S G EK++FID + RN   +G  D+++      P+  VQ    V RLFGVNI ++ 
Sbjct  242   SRGEEKKMFIDCRPRNVEVSGLGDMASRVEVEEPLSRVQEDDGVVRLFGVNIVETC  297



>ref|XP_009371009.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Pyrus x bretschneideri]
 ref|XP_009349279.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Pyrus x bretschneideri]
Length=321

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 198/302 (66%), Gaps = 28/302 (9%)
 Frame = -3

Query  1087  AENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQ  908
             + NGV+  S  KLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAA+ YDIA  
Sbjct  15    SNNGVKDASSNKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKTYDIALL  74

Query  907   RFRGRDAVTNF-----KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQ  743
             +FRG DA+TNF     KP  E        D  EA+FL SHSKAEIVDMLRKH+Y +ELE 
Sbjct  75    KFRGLDAITNFCQSQIKPYIE--------DGNEAIFLESHSKAEIVDMLRKHSYVNELEM  126

Query  742   SR-RAFNINNMTTPRKPEADR-----SAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKH  581
              + +  N       RK          +   RE LFEK  TPSDVG+LNR+VIPKQQAEKH
Sbjct  127   YKHKLLNAGVRDGGRKRSKCHVDPIDACYERELLFEKVATPSDVGRLNRMVIPKQQAEKH  186

Query  580   FPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVS  401
             F +       KGVLLNFED  G VWRFRY YW+SSQSYVLTKGW+RFVKEK LKAGD+V 
Sbjct  187   FQVHQSVELCKGVLLNFEDEEGNVWRFRYCYWSSSQSYVLTKGWTRFVKEKKLKAGDVVR  246

Query  400   FHRSTGPEKQLFIDWKARN---------GTGSPDISTVPVHPVQVFRLFGVNISKSTVSP  248
             F RS   +K+LFI+ + RN           G     +  V    V RLFGVNI K+  S 
Sbjct  247   FQRSVREDKKLFIECRPRNVDSLGFREMPAGRVAEPSAAVQDDGVVRLFGVNIMKTCKSC  306

Query  247   MA  242
             + 
Sbjct  307   IV  308



>emb|CAN61373.1| hypothetical protein VITISV_034843 [Vitis vinifera]
Length=246

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 188/243 (77%), Gaps = 8/243 (3%)
 Frame = -3

Query  1120  RMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEE  941
             R+G G S I D+ENGV A   RKL SS++KGVVPQPNGRWGAQIYEKH+R+WLGTFNEE 
Sbjct  7     RVG-GTSGISDSENGVGAVYLRKLTSSKYKGVVPQPNGRWGAQIYEKHRRIWLGTFNEEG  65

Query  940   EAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTY  761
             EAA+ YD+AA+RFRG  A+TNF        G+   DD E  FL+SHSKAEIVDMLRKHTY
Sbjct  66    EAAKAYDVAARRFRGHAALTNF-----MVSGKGIQDDIETTFLNSHSKAEIVDMLRKHTY  120

Query  760   TDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKH  581
              DELEQS   +  +  +     E+  S   R +LF+KAVTPSDVGKLNR+VIPKQ AEKH
Sbjct  121   NDELEQSAHNYG-SKESGADVMESKPSVCERVQLFDKAVTPSDVGKLNRMVIPKQHAEKH  179

Query  580   FPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVS  401
              PLQ  A +SKG LLNFED  GK+WRFRYS+WNSSQSYVLTKGW RFVKEK+LKAGDIVS
Sbjct  180   LPLQL-ASSSKGGLLNFEDNGGKIWRFRYSFWNSSQSYVLTKGWRRFVKEKNLKAGDIVS  238

Query  400   FHR  392
             FHR
Sbjct  239   FHR  241



>ref|XP_004969625.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like 
[Setaria italica]
Length=398

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 234/373 (63%), Gaps = 49/373 (13%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAEN---------------GVEAESGRKLPSSRFKGVVPQPNGRWGAQ  992
             L RMGSGAS ++DA                 G     G KLPSSR+KGVVPQPNGRWGAQ
Sbjct  36    LERMGSGASAVVDAAEPGAEADSAAAAAAGAGAGVGVGGKLPSSRYKGVVPQPNGRWGAQ  95

Query  991   IYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFL  812
             IYE+HQRVWLGTF  E +AAR YD+AAQRFRGRDAVTNF+PL++           E  FL
Sbjct  96    IYERHQRVWLGTFAGETDAARAYDVAAQRFRGRDAVTNFRPLADADPDAA----AELRFL  151

Query  811   SSHSKAEIVDMLRKHTYTDELEQSRRAFN-----------INNMTTPRKPEADRSAKSRE  665
              S SKAE+VDMLRKHTY DEL Q++RAF             N  ++P    A  +A +RE
Sbjct  152   VSRSKAEVVDMLRKHTYFDELAQNKRAFAAAASAPTTSALANAHSSPSPSPAAAAAAARE  211

Query  664   RLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNGKVWRFRYS  491
              LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLNFED  GKVWRFRYS
Sbjct  212   HLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAGGKVWRFRYS  271

Query  490   YWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS---TGPEKQLFIDWKAR-NG----TG  335
             YWNSSQSYVLTKGWSRFVKEK L+AGD+V F+RS    G + +LFI  + R NG      
Sbjct  272   YWNSSQSYVLTKGWSRFVKEKGLQAGDVVGFYRSAAAAGADSKLFIACRLRPNGDVAALT  331

Query  334   SPDISTVPVH-PV-QVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVMEFLP  161
             SP +   P   PV +  RLFGV++  +                + +G KR R++    LP
Sbjct  332   SPVVEVEPSSAPVAKAVRLFGVDLLSAP-----AQAPAAAPAEAMAGCKRARDLAA--LP  384

Query  160   LECSKKQRVIDAL  122
                 KKQ V  AL
Sbjct  385   QAAFKKQLVELAL  397



>ref|XP_008230383.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Prunus mume]
Length=314

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 203/296 (69%), Gaps = 25/296 (8%)
 Frame = -3

Query  1084  ENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQR  905
             E+  EA +  KLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLGTFN EEEAA+ YDIA+ R
Sbjct  6     ESTSEAANSNKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNAEEEAAKAYDIASIR  65

Query  904   FRGRDAVTNFKP--LSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR-R  734
             FRG + +TNF    L    DG     D E +FL SHSKAEIVDMLRKH+YT+ELE  + +
Sbjct  66    FRGLETITNFNQNQLKPYMDG-----DSETLFLQSHSKAEIVDMLRKHSYTNELEMYKLK  120

Query  733   AFNINNMTTPRK------PEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL  572
              FN  +    RK         +     RE LFEK  TPSDVG+LNR+VIPKQ AEKHFP 
Sbjct  121   LFNAGDDDAARKRIKCHVNLMEGYDHQREWLFEKVATPSDVGRLNRMVIPKQHAEKHFPS  180

Query  571   QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR  392
                    KGVLLNFED  GKVWR RY YW+SSQSYVLTKGW+RFVKEK LKAGD+V F R
Sbjct  181   HLSEELCKGVLLNFEDGEGKVWRLRYCYWSSSQSYVLTKGWTRFVKEKKLKAGDVVRFER  240

Query  391   STGPEKQLFIDWKARN--GTGSPDIST-----VPVHPVQ----VFRLFGVNISKST  257
             S G EK++FID + RN   +G  ++++      P+  VQ    V RLFGVNI ++ 
Sbjct  241   SRGEEKKMFIDCRPRNVEVSGLGEMASRVEVEEPLSRVQEDDGVVRLFGVNIVETC  296



>ref|XP_008341862.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Malus domestica]
Length=321

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 198/301 (66%), Gaps = 30/301 (10%)
 Frame = -3

Query  1081  NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRF  902
             NGV+  S  KLPSSR+KGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAA+ YDIA  +F
Sbjct  17    NGVKDASSNKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKTYDIALLKF  76

Query  901   RGRDAVTNF-----KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR  737
             RG  A+TNF     KP  E        D  EA+FL SHSKAEIVDMLRKH+Y +ELE  +
Sbjct  77    RGLAAITNFCQSQIKPYIE--------DGNEAIFLESHSKAEIVDMLRKHSYVNELEMYK  128

Query  736   -RAFNINNMTTPRK-----PEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP  575
              +  N       RK      +   +   RE LFEK  TPSDVG+LNR+VIPKQQAEKHF 
Sbjct  129   HKLLNAGVRGGGRKRSKCHVDPTDACYERELLFEKVATPSDVGRLNRMVIPKQQAEKHFQ  188

Query  574   LQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
             +       KGVLLNFED  G VWRFRY YW+SSQSYVLTKGW+RFVKEK LKAGD++ F 
Sbjct  189   VHESVELCKGVLLNFEDEEGNVWRFRYCYWSSSQSYVLTKGWTRFVKEKKLKAGDVLRFQ  248

Query  394   RSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQ----------VFRLFGVNISKSTVSPM  245
             RS   +K+LFI+ + RN   S     +P   V           V RLFGVNI K+  S +
Sbjct  249   RSVREDKKLFIECRPRN-VDSLRFREIPAGRVAEPLAAVQDDGVVRLFGVNIMKTCNSCI  307

Query  244   A  242
              
Sbjct  308   V  308



>ref|XP_002458352.1| hypothetical protein SORBIDRAFT_03g031860 [Sorghum bicolor]
 gb|EES03472.1| hypothetical protein SORBIDRAFT_03g031860 [Sorghum bicolor]
Length=413

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 210/335 (63%), Gaps = 53/335 (16%)
 Frame = -3

Query  1126  LCRMGSGASVIIDAEN------------GVEAESGRKLPSSRFKGVVPQPNGRWGAQIYE  983
             L RMGSGAS ++DA                    G KLPSSR+KGVVPQPNGRWGAQIYE
Sbjct  40    LERMGSGASAVLDAAEPGAEADSAAAAAPGAVGVGGKLPSSRYKGVVPQPNGRWGAQIYE  99

Query  982   KHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSH  803
             +HQRVWLGTF  E +AAR YD+AAQRFRGRDAVTNF+PL++           E  FL+S 
Sbjct  100   RHQRVWLGTFAGEADAARAYDVAAQRFRGRDAVTNFRPLADADPDAA----AELRFLASR  155

Query  802   SKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS------------------A  677
             SKAE+VDMLRKHTY DEL Q++RAF               +                  A
Sbjct  156   SKAEVVDMLRKHTYFDELAQNKRAFAAAAAAAASSAATTTASSLANNNNNHSSLASPSPA  215

Query  676   KSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNGKVWR  503
              +RE LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLN ED  GKVWR
Sbjct  216   TAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNLEDAAGKVWR  275

Query  502   FRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST----GPEKQLFIDWKAR-NGT  338
             FRYSYWNSSQSYVLTKGWSRFVKEK L+AGD+V F+RS+    G + +LFID K R N  
Sbjct  276   FRYSYWNSSQSYVLTKGWSRFVKEKGLQAGDVVGFYRSSAVGAGADTKLFIDCKLRPNSV  335

Query  337   GSPDISTVPV------------HPVQVFRLFGVNI  269
              +   +T P                +  RLFGV++
Sbjct  336   ATASTTTGPAVGSSPPAPAPAPVATKAVRLFGVDL  370



>ref|XP_002979064.1| hypothetical protein SELMODRAFT_110104, partial [Selaginella 
moellendorffii]
 gb|EFJ20021.1| hypothetical protein SELMODRAFT_110104, partial [Selaginella 
moellendorffii]
Length=261

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 189/252 (75%), Gaps = 21/252 (8%)
 Frame = -3

Query  1075  VEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRG  896
             + +ESG KLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN+EEEAAR YD AA +FRG
Sbjct  19    LSSESG-KLPSSQYKGVVPQPNGRWGAQIYEKHQRVWLGTFNKEEEAARAYDRAAIKFRG  77

Query  895   RDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR-----RA  731
             RDA+TNF+P+         D D EA FL  HSK ++VDMLR+HTY +EL+QSR     RA
Sbjct  78    RDAMTNFRPVH--------DSDPEASFLRLHSKEQVVDMLRRHTYDEELDQSRKITHARA  129

Query  730   FNINN----MTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNG  563
               I++        +      SA  RE LF+KAVTPSDVGKLNRLVIPKQ AE+ FPL   
Sbjct  130   MMIHHPASAAPPAKPSATAASAVHREHLFDKAVTPSDVGKLNRLVIPKQHAERCFPLDLS  189

Query  562   AVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTG  383
             A   KG+LL+FED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L AGDIV+F R  G
Sbjct  190   A-NEKGLLLSFEDITGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKKLDAGDIVTFER--G  246

Query  382   PEKQLFIDWKAR  347
             P ++L+I W+ R
Sbjct  247   PGQELYISWRRR  258



>ref|XP_001763731.1| predicted protein [Physcomitrella patens]
 gb|EDQ71373.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/264 (60%), Positives = 192/264 (73%), Gaps = 19/264 (7%)
 Frame = -3

Query  1111  SGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAA  932
             SG+S     ++ V  +S  KLPSS+F+GVVPQ NGRWGAQIYEKHQR+WLGTFN EEEAA
Sbjct  14    SGSSDSDYGDDRVREQSNSKLPSSQFRGVVPQSNGRWGAQIYEKHQRIWLGTFNTEEEAA  73

Query  931   RVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDE  752
             R YD AA +FRGRDA+TNF+P++        D DYE+ FL SHSK +IV+MLR+HTY +E
Sbjct  74    RAYDRAAIKFRGRDAMTNFRPVT--------DSDYESEFLRSHSKEQIVEMLRRHTYDEE  125

Query  751   LEQSRRAFNINNMTTPRKPEA--------DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQ  596
             L+Q ++ FN++      +              A +RE LF+KAVTPSDVGKLNRLVIPKQ
Sbjct  126   LDQCKKVFNMDVAANAVRARRRALEINTLKECAPTREHLFDKAVTPSDVGKLNRLVIPKQ  185

Query  595   QAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKA  416
              AE+ FPL   A  S G  L+FED +GK WRFRYSYWNSSQSYVLTKGWSRFVKEK L A
Sbjct  186   HAERCFPLDLSA-NSPGQTLSFEDVSGKHWRFRYSYWNSSQSYVLTKGWSRFVKEKKLDA  244

Query  415   GDIVSFHRSTGPEKQLFIDWKARN  344
             GDIVSF R  GP ++L+ID++ + 
Sbjct  245   GDIVSFER--GPSQELYIDFRRKQ  266



>gb|EPS58447.1| hypothetical protein M569_16368, partial [Genlisea aurea]
Length=243

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 174/269 (65%), Positives = 194/269 (72%), Gaps = 31/269 (12%)
 Frame = -3

Query  1063  SGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAV  884
             + +KLPSSRFKGVVPQPNGRWGAQIYEKH RVWLGTFNEEE AAR YD AA RFRG DAV
Sbjct  2     ASKKLPSSRFKGVVPQPNGRWGAQIYEKHHRVWLGTFNEEESAARAYDAAAIRFRGGDAV  61

Query  883   TNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTP  704
             TNF+      DG    DD E+ FL+SHSK+EIVDMLRKHTY +ELEQSRR    + M   
Sbjct  62    TNFR------DG--AADDAESRFLNSHSKSEIVDMLRKHTYEEELEQSRRG-GGSEMMIR  112

Query  703   RKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP----LQNGAVTSKGVLL  536
             R P   R    RE LFEK VTPSDVGKLNRLVIPKQQAEK+ P    L   A   + +LL
Sbjct  113   RVPAELR----REYLFEKIVTPSDVGKLNRLVIPKQQAEKYLPFRFRLGEAAGFCRLMLL  168

Query  535   NFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDW  356
             N ED+ GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSL+AGD ++F+RS  P+ +L+ID 
Sbjct  169   NMEDSQGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLRAGDTITFYRSGQPDNRLYID-  227

Query  355   KARNGTGSPDISTVPVHPVQVFRLFGVNI  269
                            VH VQ  RLFGVN+
Sbjct  228   -------------CGVHRVQPVRLFGVNL  243



>ref|XP_002991538.1| hypothetical protein SELMODRAFT_133669, partial [Selaginella 
moellendorffii]
 gb|EFJ07460.1| hypothetical protein SELMODRAFT_133669, partial [Selaginella 
moellendorffii]
Length=262

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 187/253 (74%), Gaps = 22/253 (9%)
 Frame = -3

Query  1075  VEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRG  896
             + +ESG KLPSS++KGVVPQPNGRWGAQIYEKHQRVWLGTFN+EEEAAR YD AA +FRG
Sbjct  19    LSSESG-KLPSSQYKGVVPQPNGRWGAQIYEKHQRVWLGTFNKEEEAARAYDRAAIKFRG  77

Query  895   RDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINN  716
             RDA+TNF+P+         D D EA FL  HSK ++VDMLR+HTY +EL+QSR+  +   
Sbjct  78    RDAMTNFRPVH--------DSDPEASFLRLHSKEQVVDMLRRHTYDEELDQSRKITHARA  129

Query  715   MTTPRKPEADRS----------AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN  566
             +       A  S          A  RE LF+KAVTPSDVGKLNRLVIPKQ AE+ FPL  
Sbjct  130   VAAAAAEAAAASIAIPSATAARAVHREHLFDKAVTPSDVGKLNRLVIPKQHAERCFPLDL  189

Query  565   GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST  386
              A   KG+LL+FED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L AGDIV+F R  
Sbjct  190   SA-NEKGLLLSFEDITGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKKLDAGDIVTFER--  246

Query  385   GPEKQLFIDWKAR  347
             GP ++L+I W+ R
Sbjct  247   GPGQELYISWRRR  259



>ref|XP_001771261.1| predicted protein [Physcomitrella patens]
 gb|EDQ63972.1| predicted protein [Physcomitrella patens]
Length=227

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 180/238 (76%), Gaps = 17/238 (7%)
 Frame = -3

Query  1054  KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNF  875
             KLPSS+F+GVVPQ NGRWGAQIYEKHQR+WLGTFN EEEAAR YD AA +FRGRDA+TNF
Sbjct  1     KLPSSQFRGVVPQSNGRWGAQIYEKHQRIWLGTFNTEEEAARAYDTAAIKFRGRDAMTNF  60

Query  874   KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKP  695
             +P++        D +YE+ FL S SK +IV+MLR+HTY +EL+Q ++ FN++    P  P
Sbjct  61    RPVT--------DSEYESEFLRSFSKEQIVEMLRRHTYDEELDQCKKVFNMDAAANPVTP  112

Query  694   ------EADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLN  533
                   E   S+ +RE LF+KAVTPSDVGKLNRLVIPKQ AE+ FPL   A  S G  L+
Sbjct  113   PNLPRDEPRESSPTREHLFDKAVTPSDVGKLNRLVIPKQHAERCFPLDLSA-NSPGQTLS  171

Query  532   FEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFID  359
             FED +GK WRFRYSYWNSSQSYVLTKGWSRFVKEK L AGDIVSF R  G   +L+ID
Sbjct  172   FEDVSGKHWRFRYSYWNSSQSYVLTKGWSRFVKEKKLDAGDIVSFER--GRNHELYID  227



>ref|XP_009371008.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Pyrus x bretschneideri]
 ref|XP_009349280.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Pyrus x bretschneideri]
Length=303

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 190/293 (65%), Gaps = 28/293 (10%)
 Frame = -3

Query  1081  NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRF  902
             NG    S  KLPSSR+KGVVPQ NGRWGAQIYEK  RVWLGTFNEEEEAA+ Y+IA  +F
Sbjct  18    NGANGASSNKLPSSRYKGVVPQSNGRWGAQIYEKSHRVWLGTFNEEEEAAKTYNIALLKF  77

Query  901   RGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFN-  725
             RG DA+T+F   S +     G D  EA+FL  HSKAEIVDMLRKH+Y +ELE  +   + 
Sbjct  78    RGLDAITHF---SRSQMKPYGPDVTEALFLEYHSKAEIVDMLRKHSYANELEMYKHKLHN  134

Query  724   --------INNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ  569
                         T       D  ++ RE LFEK  TPSDVG+LNR+VIPKQ AEKHF + 
Sbjct  135   GGALGLDDGGKRTKCYLDLMDTCSRDRELLFEKVATPSDVGRLNRMVIPKQHAEKHFEVH  194

Query  568   NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS  389
                   KGVLL FED  GKVWRF Y YW+SSQSYVL+KGW RFVKEK LKAGD+V F +S
Sbjct  195   LSVGFGKGVLLKFEDELGKVWRFGYCYWSSSQSYVLSKGWIRFVKEKKLKAGDVVRFQKS  254

Query  388   TGPEKQLFIDWKARNGTGSPDISTV---------PVHPVQ---VFRLFGVNIS  266
              G +K+LFI+ + R      D+S +         P+  VQ   V RLFGVNIS
Sbjct  255   VGEDKKLFIECRPRK----VDVSGIEEMHGRVADPLATVQDDGVVRLFGVNIS  303



>ref|XP_008342069.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
TEM1-like [Malus domestica]
Length=303

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 193/293 (66%), Gaps = 28/293 (10%)
 Frame = -3

Query  1081  NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRF  902
             NG       KLPSSR+KGVVPQ NGRWGAQIY+K  RVWLGTFN+EEEAA+ Y+IA  +F
Sbjct  18    NGANGARSNKLPSSRYKGVVPQSNGRWGAQIYDKSHRVWLGTFNDEEEAAKTYNIALLKF  77

Query  901   RGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRR----  734
             RG DA+T+   LS +     G D  EA+FL SHSKAEI+DMLRKH+Y +ELE  +     
Sbjct  78    RGLDAITH---LSRSQMKPYGRDVTEALFLESHSKAEIIDMLRKHSYANELEMYKHKLHN  134

Query  733   --AFNINN---MTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ  569
               A  +++    T       D  ++ RE LFEK  TPSDVG+LNR+VIPKQ AEKHF + 
Sbjct  135   GXALGLDDGGKRTKCYLXLMDTCSRERELLFEKVATPSDVGRLNRMVIPKQHAEKHFQVH  194

Query  568   NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS  389
                   KGVLL FED  GKVWRF Y YW+SSQSYVL+KGW RFVKEK LKAGDIV F RS
Sbjct  195   LSVGFGKGVLLKFEDELGKVWRFGYCYWSSSQSYVLSKGWIRFVKEKKLKAGDIVMFQRS  254

Query  388   TGPEKQLFIDWKARNGTGSPDISTV---------PVHPVQ---VFRLFGVNIS  266
              G +K+LFI+ + R      D+S +         P+  VQ   V RLFGVNIS
Sbjct  255   VGEDKKLFIECRPRK----VDVSRIEEMHGRVAGPLATVQDDGVVRLFGVNIS  303



>ref|XP_008379887.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Malus domestica]
Length=311

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 194/295 (66%), Gaps = 28/295 (9%)
 Frame = -3

Query  1078  GVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFR  899
             G +A S  KLPSS +KGVVPQ NGRWGAQIYEK  RVWLGTF++EEEAA+ Y+IA+ +FR
Sbjct  19    GAKAASSNKLPSSSYKGVVPQSNGRWGAQIYEKSHRVWLGTFDDEEEAAKTYNIASLKFR  78

Query  898   GRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR-RAFNI  722
             G DA+TNF P   T   R   D  EA+FL SHSKAEIVDMLRKH+Y +ELE  + + +N 
Sbjct  79    GLDAITNFSPNQMTPYER---DVTEALFLESHSKAEIVDMLRKHSYANELEMYKHKLYNG  135

Query  721   NNMTTPRKPE--------ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN  566
               +      +         D  +  RE LFEK  TPSDVG+LNR+VIPKQ AEKHF +  
Sbjct  136   GALGLDAGGKRMKCHLDLMDTCSSERELLFEKVATPSDVGRLNRMVIPKQHAEKHFQVHL  195

Query  565   GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST  386
                  KGVLL FED  G VWRF Y YW+SSQSYVL+KGW RFVKEK LKAGD+V F RS 
Sbjct  196   SVGFGKGVLLKFEDELGNVWRFGYCYWSSSQSYVLSKGWIRFVKEKKLKAGDVVRFERSV  255

Query  385   GPEKQLFIDWKARNGTGSPDISTV---------PVHPVQ---VFRLFGVNISKST  257
             G +K+LFID + RN     D+S +         P+   Q   + RLFGVNI  ST
Sbjct  256   GEDKKLFIDCRPRN----VDVSGIREMHGRVGQPLGTAQDDGMVRLFGVNIQPST  306



>emb|CDM81001.1| unnamed protein product [Triticum aestivum]
Length=320

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 176/248 (71%), Gaps = 18/248 (7%)
 Frame = -3

Query  1057  RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTN  878
             R  PSSRFKGVVPQPNGRWGAQIYEKH RVWLGTF +E+ A R YD+AA RFRG DAV N
Sbjct  42    RAAPSSRFKGVVPQPNGRWGAQIYEKHSRVWLGTFPDEDAAVRAYDVAALRFRGPDAVIN  101

Query  877   F-KPLSETTDGRN---GDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMT  710
               +P +    G +    + D E  FL+ HSKAEIVDMLRKHTY DEL Q  R        
Sbjct  102   HQRPTAAEEAGSSSSRSELDPELGFLADHSKAEIVDMLRKHTYDDELRQGLRRGRGRAQP  161

Query  709   TPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT---SKGVL  539
             TP        A +RE LFEKAVTPSDVGKLNRLV+PKQQAEKHFP    A T    KGVL
Sbjct  162   TP--------AWARELLFEKAVTPSDVGKLNRLVVPKQQAEKHFPPTTAAATGSNGKGVL  213

Query  538   LNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST---GPEKQL  368
             LNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKE  L+AGD V+F+RS      E QL
Sbjct  214   LNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVKETGLRAGDTVAFYRSAYGNDTEDQL  273

Query  367   FIDWKARN  344
             FID+K  N
Sbjct  274   FIDYKKMN  281



>ref|XP_003565959.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os05g0549800 
[Brachypodium distachyon]
Length=408

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 195/385 (51%), Positives = 227/385 (59%), Gaps = 62/385 (16%)
 Frame = -3

Query  1150  PATKSPESLCRMGSGA--SVIID------AENGVEAESGR----------KLPSSRFKGV  1025
             P   +P  L R+GSGA  S ++D      AE   ++ +GR          KLPSSR+KGV
Sbjct  38    PTKMTP--LHRVGSGAATSAVMDVDASATAEEEADSAAGRRIAMAAAVNNKLPSSRYKGV  95

Query  1024  VPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGR  845
             VPQPNGRWGAQIYE+H RVWLGTF  E EAAR YD AAQRFRGRDAVTNF+ L       
Sbjct  96    VPQPNGRWGAQIYERHSRVWLGTFTGEAEAARAYDAAAQRFRGRDAVTNFRALPS-----  150

Query  844   NGDDDYEAVFLSSHSKAEIVDMLRKHTYTDEL------EQSRRAFNINNMTTPRKPEADR  683
                D  E  FL+S SK E+VDMLRKHTY DEL             + +  ++   P A R
Sbjct  151   ---DAAELRFLASRSKGEVVDMLRKHTYLDELALFTSSSSPPAPPDFSPSSSSPAPAAAR  207

Query  682   SAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ-----NGAVTS--------KGV  542
               + RE LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ     +GAV S        KG+
Sbjct  208   QVRDREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQQLGSSSGAVFSGSGSGESNKGM  267

Query  541   LLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-------G  383
             LLNFED  GK WRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD V F+RS        G
Sbjct  268   LLNFEDGAGKAWRFRYSYWNSSQSYVLTKGWSRFVKEKGLCAGDAVGFYRSASANGNGNG  327

Query  382   PEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCS  203
              ++QLFID K R    +   S  P   V+  RLFGV++       +A A +     S C 
Sbjct  328   SQQQLFIDCKLRTKADTRSSSPRPGAVVRSVRLFGVDL-------LAAAPELETKTSICK  380

Query  202   GGKRIREVVMEFLPLECSKKQRVID  128
               +   E   +  P     K+R ID
Sbjct  381   RSRNHSEASPDH-PTHAVFKRRCID  404



>emb|CDJ26459.1| unnamed protein product [Triticum aestivum]
Length=351

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 198/325 (61%), Gaps = 49/325 (15%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             SRFKGVVPQPNGRWG+QIYE+H RVWLGTF +++ AAR YD+AA R+RGRDA TNF P +
Sbjct  56    SRFKGVVPQPNGRWGSQIYERHARVWLGTFPDQDLAARAYDVAALRYRGRDAATNF-PCA  114

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEAD  686
                         E  FL +HSKAEIVDMLRKHTY DEL Q  RR   +     P    A 
Sbjct  115   AAEA--------ELAFLGAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQPTPSWA-  165

Query  685   RSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----QNGAVTSKGVLLNFEDTN  518
                  RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL    +    T  GVLLNFED  
Sbjct  166   -----REPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRTPERTTTTGNGVLLNFEDGE  220

Query  517   GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWK----  353
             GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  S  G EKQLFID K    
Sbjct  221   GKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLAAGDSIIFSCSAYGQEKQLFIDCKKNTT  280

Query  352   ---ARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIRE  182
                 ++ +  P + T     V+V RLFGV+I                     +G KR R 
Sbjct  281   VNSGKSASPLPVVETAKGEQVRVVRLFGVDI---------------------AGVKRGRA  319

Query  181   VVMEFLPLECSKKQRVIDAL*HRSP  107
                E  P E  K+Q V      RSP
Sbjct  320   ATAEQGPPELLKRQCVPLPHGQRSP  344



>ref|XP_009357114.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Pyrus x bretschneideri]
Length=311

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/295 (54%), Positives = 193/295 (65%), Gaps = 28/295 (9%)
 Frame = -3

Query  1078  GVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFR  899
             G +A S  KLPSS +KGVVPQ NGRWGAQIYEK  RVWLGTF++EEEAA+ Y+IA+ +FR
Sbjct  19    GAKAASSNKLPSSGYKGVVPQSNGRWGAQIYEKSHRVWLGTFDDEEEAAKTYNIASLKFR  78

Query  898   GRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSR-RAFNI  722
             G DA+TNF     T       D  EA+FL SHSKAEIVDMLRKH+Y +ELE  + + +N 
Sbjct  79    GLDAITNFSRNQMTP---YECDVTEALFLESHSKAEIVDMLRKHSYANELEMYKHKLYNG  135

Query  721   NNMTTPRKPE--------ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN  566
               +      +         D  +  RE LFEK  TPSDVG+LNR+VIPKQ AEKHF +  
Sbjct  136   GALGLDAGGKRMKCHLDLMDTCSSERELLFEKVATPSDVGRLNRMVIPKQHAEKHFQVHL  195

Query  565   GAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST  386
                  KGVLL FED  G VWRF Y YW+SS+SYVL+KGW RFVKEK LKAGD+V F RS 
Sbjct  196   SVGFGKGVLLKFEDEVGNVWRFGYCYWSSSRSYVLSKGWIRFVKEKKLKAGDVVRFERSV  255

Query  385   GPEKQLFIDWKARNGTGSPDISTV---------PVHPVQ---VFRLFGVNISKST  257
             G +K++FID + RN     D+S +         P+  VQ   + RLFGVNI  ST
Sbjct  256   GEDKKMFIDCRPRN----VDVSGIREMHSRVGEPLGAVQDDGMVRLFGVNIQPST  306



>emb|CDM81004.1| unnamed protein product [Triticum aestivum]
Length=351

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 198/325 (61%), Gaps = 49/325 (15%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             SRFKGVVPQPNGRWG+QIYE+H RVWLGTF +++ AAR YD+AA R+RGRDA TNF P +
Sbjct  56    SRFKGVVPQPNGRWGSQIYERHARVWLGTFPDQDLAARAYDVAALRYRGRDAATNF-PCA  114

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEAD  686
                         E  FL +HSKAEIVDMLRKHTY DEL Q  RR   +     P    A 
Sbjct  115   AAEA--------ELAFLGAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQPTPSWA-  165

Query  685   RSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----QNGAVTSKGVLLNFEDTN  518
                  RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL    +    T  GVLLNFED  
Sbjct  166   -----REPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRTPERTTTTGNGVLLNFEDGE  220

Query  517   GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWK----  353
             GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  S  G EKQLFID K    
Sbjct  221   GKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLAAGDSIIFSCSAYGQEKQLFIDCKKNTT  280

Query  352   ---ARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIRE  182
                 ++ +  P + T     V+V RLFGV+I                     +G KR R 
Sbjct  281   VNSGKSASPLPVVETAKGEQVRVVRLFGVDI---------------------AGVKRGRA  319

Query  181   VVMEFLPLECSKKQRVIDAL*HRSP  107
                E  P E  K+Q V      RSP
Sbjct  320   ATAEQGPPELLKRQCVPLPHGQRSP  344



>emb|CDM81002.1| unnamed protein product [Triticum aestivum]
Length=350

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 182/273 (67%), Gaps = 28/273 (10%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSRFKGVVPQPNGRWGAQIYE+H RVWLGTF +++ AAR YD+A+ R+RGRD   NF P 
Sbjct  54    SSRFKGVVPQPNGRWGAQIYERHARVWLGTFPDQDSAARAYDVASLRYRGRDVAFNF-PC  112

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
             +          + E  FL++HSKAEIVDMLRK TY DEL Q  RR   +     P    A
Sbjct  113   AAV--------EGELAFLAAHSKAEIVDMLRKQTYADELRQGLRRGRGMGARAQPTPSWA  164

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----QNGAVTSKGVLLNFEDT  521
                   RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL    +    T KGVLLNFED 
Sbjct  165   ------REPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRTPETPTTTGKGVLLNFEDG  218

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKARN  344
              GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  S    EKQ FID K   
Sbjct  219   EGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLGAGDSILFSCSLYEQEKQFFIDCKKNT  278

Query  343   GT-GSPDISTVPV------HPVQVFRLFGVNIS  266
                G    S +PV        V+V RLFGV+IS
Sbjct  279   SMNGGKSASPLPVGVTTKGEQVRVVRLFGVDIS  311



>sp|Q9AWS7.1|Y1407_ORYSJ RecName: Full=Putative AP2/ERF and B3 domain-containing protein 
Os01g0140700 [Oryza sativa Japonica Group]
 dbj|BAB21211.1| putative AP2 domain containing protein RAP2.8 [Oryza sativa Japonica 
Group]
Length=317

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 197/287 (69%), Gaps = 29/287 (10%)
 Frame = -3

Query  1099  VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYD  920
             V+  AE  + + +    PSSR+KGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD
Sbjct  46    VVQAAELRLPSSTTATRPSSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYD  105

Query  919   IAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS  740
             +AA RFRGRDAVTN  P +E      G    E  FL++HSKAE+VDMLRKHTY DEL+Q 
Sbjct  106   VAALRFRGRDAVTNRAPAAE------GASAGELAFLAAHSKAEVVDMLRKHTYDDELQQG  159

Query  739   RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----  572
              R        TPR         +RE LFEKAVTPSDVGKLNRLV+PKQQAE+HFP     
Sbjct  160   LRR-GSRAQPTPR--------WAREPLFEKAVTPSDVGKLNRLVVPKQQAERHFPFPLRR  210

Query  571   QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR  392
              +     KGVLLNFED +GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+ GD V+F R
Sbjct  211   HSSDAAGKGVLLNFEDGDGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRPGDTVAFSR  270

Query  391   ST---GPEKQLFIDWKA--RNGTGSPDISTVPVHPVQVFRLFGVNIS  266
             S    G EK L ID K   RN     +++TV      V +LFGV+I+
Sbjct  271   SAAAWGTEKHLLIDCKKMERN-----NLATVDDDARVVVKLFGVDIA  312



>ref|XP_009357037.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Pyrus x bretschneideri]
Length=314

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 190/300 (63%), Gaps = 31/300 (10%)
 Frame = -3

Query  1081  NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRF  902
             N     S  KL SSR+KGVVPQ NGRWGAQIYEK  RVWLGTF++EEEAA+ YDIA+ + 
Sbjct  18    NQANGASSNKLSSSRYKGVVPQSNGRWGAQIYEKSNRVWLGTFDDEEEAAKTYDIASLKI  77

Query  901   RGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRR----  734
             RG DA+T    +S         D  EA+FL SHSKAEIVDMLRKH+Y +ELE  +     
Sbjct  78    RGLDAITQ---ISRNQMKPYECDVTEALFLESHSKAEIVDMLRKHSYANELEMYKHKLYN  134

Query  733   -----AFNINNMTTPRKPE---ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHF  578
                  A  +++     K      D  +  RE LFEK  TPSDVG+LNR+VIPK+ AEKHF
Sbjct  135   GCAACALGLDDGGRRMKCYHDLMDTCSSERELLFEKVATPSDVGRLNRMVIPKRHAEKHF  194

Query  577   PLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF  398
              +       KGVLL FED  GKVWRF Y YW+SSQSYVL+KGW RFVKEK LK GD+V F
Sbjct  195   QVHQSVGFGKGVLLKFEDEVGKVWRFGYCYWSSSQSYVLSKGWIRFVKEKKLKVGDVVRF  254

Query  397   HRSTGPEKQLFIDWKARNGTGSPDISTV---------PVHPVQ---VFRLFGVNISKSTV  254
              RS G +K+LFID ++RN     DIS +         P   VQ   V RLFGVNIS+  V
Sbjct  255   ERSVGEDKKLFIDCRSRN----LDISGIGEMHGTVGDPPATVQDDGVVRLFGVNISRKHV  310



>ref|XP_008379886.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor 
RAV2-like [Malus domestica]
Length=314

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 191/300 (64%), Gaps = 31/300 (10%)
 Frame = -3

Query  1081  NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRF  902
             N     S  KLPSSR+KGVVPQ NGRWGAQIYEK  RVWLGTF +EEEAA+ YDIA+ + 
Sbjct  18    NQANGASSNKLPSSRYKGVVPQSNGRWGAQIYEKSNRVWLGTFYDEEEAAKTYDIASLKI  77

Query  901   RGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRR----  734
             RG DA+T    +S         D  EA+FL SHSKAEIVDMLRKH+Y +ELE  +     
Sbjct  78    RGLDAITQ---ISRNQMKPYECDVTEALFLESHSKAEIVDMLRKHSYANELEMYKHKLYN  134

Query  733   -----AFNINNMTTPRKPE---ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHF  578
                  A  +++     K      D  ++ RE LFEK  TPSDVG+LNR+VIPK+ AEKHF
Sbjct  135   GCAACALGLDDGGKRMKCYHDFMDTCSRERELLFEKVATPSDVGRLNRMVIPKRYAEKHF  194

Query  577   PLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF  398
              +       KGVLL FED  GK+WRF Y YW+SSQSYVL+KGW RFVKEK LK GD+V F
Sbjct  195   QVHQSVGFGKGVLLKFEDEVGKLWRFGYCYWSSSQSYVLSKGWIRFVKEKKLKVGDVVRF  254

Query  397   HRSTGPEKQLFIDWKARNGTGSPDISTV---------PVHPVQ---VFRLFGVNISKSTV  254
              RS G +K+LFID ++RN     DIS +         P   VQ   V RLFGVNIS+  V
Sbjct  255   ERSVGEDKKLFIDCRSRN----LDISGIGEIHGTVGDPPATVQDDGVVRLFGVNISRKPV  310



>ref|XP_010230439.1| PREDICTED: putative AP2/ERF and B3 domain-containing protein 
Os01g0140700 isoform X2 [Brachypodium distachyon]
Length=348

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 183/273 (67%), Gaps = 26/273 (10%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFK----  872
             RFKGVVPQPNGRWGAQIYEKH RVWLGTF +E  AAR YD+AA RFRGRDAVTN+     
Sbjct  70    RFKGVVPQPNGRWGAQIYEKHARVWLGTFPDEPSAARAYDVAALRFRGRDAVTNYHHQIS  129

Query  871   ----PLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS--RRAFNINNMT  710
                   S ++         E  FL+ HSKAEIVDMLRKHTY DEL Q   R       + 
Sbjct  130   SSSSSPSSSSSSSPAATASELAFLAEHSKAEIVDMLRKHTYADELRQGLLRGHGAGARVR  189

Query  709   TPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNF  530
             TP        A +RE LFEKAVTPSDVGKLNRLV+PKQ AE+HFP       SKGVLLNF
Sbjct  190   TP--------AWAREVLFEKAVTPSDVGKLNRLVVPKQHAERHFPEPEKTTGSKGVLLNF  241

Query  529   EDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-----GPEKQLF  365
             ED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  ++     G ++QLF
Sbjct  242   EDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLAAGDTIVFSCASAAYGNGDQRQLF  301

Query  364   IDWKARNGTGSPDISTVPVHPVQVFRLFGVNIS  266
             ID++    T + D +   +    V +LFGV+I+
Sbjct  302   IDYRKMATTSNKDDA---MESHSVVKLFGVDIA  331



>gb|EAY72471.1| hypothetical protein OsI_00326 [Oryza sativa Indica Group]
Length=316

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 193/285 (68%), Gaps = 25/285 (9%)
 Frame = -3

Query  1099  VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYD  920
             V+  AE  + + +    PSSR+KGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD
Sbjct  45    VVQAAELRLPSSTTATRPSSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYD  104

Query  919   IAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS  740
             +AA RFRGRDAVTN  P +E      G    E  FL++HSKAE+VDMLRKHTY DEL+Q 
Sbjct  105   VAALRFRGRDAVTNRAPAAE------GASAGELAFLAAHSKAEVVDMLRKHTYDDELQQG  158

Query  739   RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----  572
              R        TPR         +RE LFEKAVTPSDVGKLNRLV+PKQQAE+HFP     
Sbjct  159   LRR-GSRAQPTPR--------WAREPLFEKAVTPSDVGKLNRLVVPKQQAERHFPFPLRR  209

Query  571   QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR  392
              +     KGVLLNFED +GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+ GD V+F R
Sbjct  210   HSSDAAGKGVLLNFEDGDGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRPGDTVAFSR  269

Query  391   ST---GPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNIS  266
             S    G EK L ID K       P   TV      V +LFGV+I+
Sbjct  270   SAAAWGTEKHLLIDCKKMERNNLP---TVDDDARVVVKLFGVDIA  311



>ref|XP_003565321.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0141000-like 
[Brachypodium distachyon]
Length=364

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 181/284 (64%), Gaps = 41/284 (14%)
 Frame = -3

Query  1036  FKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSET  857
             FKGVVPQPNGRWGAQIYE+H RVWLGTF +E  AAR YD+AA R+RGRDA TN      T
Sbjct  55    FKGVVPQPNGRWGAQIYERHSRVWLGTFPDESSAARAYDVAALRYRGRDAATNH---PST  111

Query  856   TDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA  677
                       E  FL++HSKAEIVDMLRKHTY DEL Q  R          R P     A
Sbjct  112   AGAAASVSGAELAFLAAHSKAEIVDMLRKHTYADELRQGLRRGQGAGARV-RTP-----A  165

Query  676   KSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT----------------SKG  545
              +R+ LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+  A +                +KG
Sbjct  166   WARQVLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRRASSQLPEPEKTAGAGIGAGNKG  225

Query  544   VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTG-PEKQL  368
             VLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  S+   EKQ 
Sbjct  226   VLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLGAGDAIVFSCSSAYGEKQF  285

Query  367   FIDWKARNGTGSPDISTVPVHPV-----------QVFRLFGVNI  269
             FID K +NG     + ++P               +V RLFGVNI
Sbjct  286   FIDCKKKNG----KLVSMPTACASATKGGEEEAGRVVRLFGVNI  325



>ref|XP_010230438.1| PREDICTED: putative AP2/ERF and B3 domain-containing protein 
Os01g0140700 isoform X1 [Brachypodium distachyon]
Length=367

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 183/273 (67%), Gaps = 26/273 (10%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFK----  872
             RFKGVVPQPNGRWGAQIYEKH RVWLGTF +E  AAR YD+AA RFRGRDAVTN+     
Sbjct  70    RFKGVVPQPNGRWGAQIYEKHARVWLGTFPDEPSAARAYDVAALRFRGRDAVTNYHHQIS  129

Query  871   ----PLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS--RRAFNINNMT  710
                   S ++         E  FL+ HSKAEIVDMLRKHTY DEL Q   R       + 
Sbjct  130   SSSSSPSSSSSSSPAATASELAFLAEHSKAEIVDMLRKHTYADELRQGLLRGHGAGARVR  189

Query  709   TPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNF  530
             TP        A +RE LFEKAVTPSDVGKLNRLV+PKQ AE+HFP       SKGVLLNF
Sbjct  190   TP--------AWAREVLFEKAVTPSDVGKLNRLVVPKQHAERHFPEPEKTTGSKGVLLNF  241

Query  529   EDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-----GPEKQLF  365
             ED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  ++     G ++QLF
Sbjct  242   EDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLAAGDTIVFSCASAAYGNGDQRQLF  301

Query  364   IDWKARNGTGSPDISTVPVHPVQVFRLFGVNIS  266
             ID++    T + D +   +    V +LFGV+I+
Sbjct  302   IDYRKMATTSNKDDA---MESHSVVKLFGVDIA  331



>gb|EAY75457.1| hypothetical protein OsI_03358 [Oryza sativa Indica Group]
Length=361

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 185/265 (70%), Gaps = 30/265 (11%)
 Frame = -3

Query  994  QIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVF  815
            +IYE+HQRVWLGTF  E++AAR YD+AAQRFRGRDAVTNF+PL+E           E  F
Sbjct  64   KIYERHQRVWLGTFAGEDDAARAYDVAAQRFRGRDAVTNFRPLAEADPDAAA----ELRF  119

Query  814  LSSHSKAEIVDMLRKHTYTDELEQSRRAFNIN--------------NMTTPRKPEADRSA  677
            L++ SKAE+VDMLRKHTY DEL QS+R F  +              ++++PR P A   A
Sbjct  120  LATRSKAEVVDMLRKHTYFDELAQSKRTFAASTPSAATTTASLSNGHLSSPRSPFA--PA  177

Query  676  KSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNGKVWR  503
             +R+ LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLNFED  GKVWR
Sbjct  178  AARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAAGKVWR  237

Query  502  FRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR---STGPEKQLFIDWKARNGTG-  335
            FRYSYWNSSQSYVLTKGWSRFVKEK L AGD+V F+R   S G + +LFID K    TG 
Sbjct  238  FRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDVVGFYRSAASAGDDGKLFIDCKLVRSTGA  297

Query  334  ---SPDISTVPVHPVQVFRLFGVNI  269
               SP     P  PV+  RLFGV++
Sbjct  298  ALASPADQPAP-SPVKAVRLFGVDL  321



>dbj|BAJ93242.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 182/274 (66%), Gaps = 30/274 (11%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSRFKGVVPQPNGRWGAQIYE+H RVWLGTF +++ AAR YD+A+ R+RG DA  NF  +
Sbjct  54    SSRFKGVVPQPNGRWGAQIYERHARVWLGTFPDQDSAARAYDVASLRYRGGDAAFNFPCV  113

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
                        + E  FL++HSKAEIVDMLRK TY DEL Q  RR   +     P    A
Sbjct  114   VV---------EAELAFLAAHSKAEIVDMLRKQTYADELRQGLRRGRGMGVRAQPMPSWA  164

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL----QNGAVTSKGVLLNFEDT  521
                   R  LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL    +    T  GVLLNFED 
Sbjct  165   ------RVPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRSPETTTTTGNGVLLNFEDG  218

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKARN  344
              GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F  S  G EKQ FID K +N
Sbjct  219   QGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLGAGDSIMFSCSAYGQEKQFFIDCK-KN  277

Query  343   GTGSPDISTVPVH--------PVQVFRLFGVNIS  266
              T +   S  P+          V+V RLFGV+I+
Sbjct  278   TTVNGGKSASPLQVMEIAKAEQVRVVRLFGVDIA  311



>dbj|BAJ94578.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 199/318 (63%), Gaps = 51/318 (16%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSRFKGVVPQPNGRWG+QIYE+H RVWLGTF +++ AAR YD+A+ R+RGRDA TNF P 
Sbjct  59    SSRFKGVVPQPNGRWGSQIYERHARVWLGTFPDQDSAARAYDVASLRYRGRDAATNF-PC  117

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
             +            E  FL++HSKAEIVDMLRKHTY DEL Q  RR   +     P    A
Sbjct  118   AAAEA--------ELAFLTAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQPTPSWA  169

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGA----VTSKGVLLNFEDT  521
                   R  LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+  A     T  GVLLNFED 
Sbjct  170   ------RVPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKCTAETTTTTGNGVLLNFEDG  223

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKARN  344
              GKVWRFRYSYWNSSQSYVLTKGWS FV+EK L AGD + F  S  G EKQLFI+ K +N
Sbjct  224   EGKVWRFRYSYWNSSQSYVLTKGWSSFVREKGLGAGDSIVFSSSAYGQEKQLFINCK-KN  282

Query  343   GTGSPDISTVPVHPVQ--------VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRI  188
              T +   + +P+  V+        V +LFGV+I                     +G KR+
Sbjct  283   TTMNGGKTALPLPVVETAKGEQDHVVKLFGVDI---------------------AGVKRV  321

Query  187   REVVMEFLPLECSKKQRV  134
             R    E  P E  K+Q V
Sbjct  322   RAATGELGPPELFKRQSV  339



>ref|XP_002457391.1| hypothetical protein SORBIDRAFT_03g006590 [Sorghum bicolor]
 gb|EES02511.1| hypothetical protein SORBIDRAFT_03g006590 [Sorghum bicolor]
Length=388

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 179/331 (54%), Positives = 200/331 (60%), Gaps = 48/331 (15%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSRFKGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD+AA R+RGR+A TNF   
Sbjct  81    SSRFKGVVPQPNGRWGAQIYERHARVWLGTFADEEAAARAYDVAALRYRGREAATNFPG-  139

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
                     G    E  FL++HSKAEIVDMLRKHTY DEL Q  RR   +     P     
Sbjct  140   -------AGASAPELTFLAAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQP-----  187

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN-------GAVTSKGVLLNF  530
                A +R  LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+         A T KGVLLNF
Sbjct  188   -TPAWARSLLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRAPEASAAAATTGKGVLLNF  246

Query  529   EDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWK  353
             ED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+AGD + F  ST   EKQLFID K
Sbjct  247   EDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSHSTYSSEKQLFIDCK  306

Query  352   ARNGTGSPDISTVPV--------HPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSGG  197
                 T        PV           +V RLFGV+I+                   C   
Sbjct  307   KTKTTTVATTDGAPVPAPAEKKPSEARVVRLFGVDIAG----------------DGCQKR  350

Query  196   KRIREVVMEFLP-LECSKKQRVIDAL*HRSP  107
              R  E+  E  P  E  KK++ +    HRSP
Sbjct  351   ARPVEIAFEHGPQQELLKKKQCVGVAHHRSP  381



>dbj|BAJ89405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 198/318 (62%), Gaps = 51/318 (16%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSRFKGVVPQPNGRWG+QIYE+  RVWLGTF +++ AAR YD+A+ R+RGRDA TNF P 
Sbjct  59    SSRFKGVVPQPNGRWGSQIYERRARVWLGTFPDQDSAARAYDVASLRYRGRDAATNF-PC  117

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
             +            E  FL++HSKAEIVDMLRKHTY DEL Q  RR   +     P    A
Sbjct  118   AAAEA--------ELAFLTAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQPTPSWA  169

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGA----VTSKGVLLNFEDT  521
                   R  LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+  A     T  GVLLNFED 
Sbjct  170   ------RVPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKCTAETTTTTGNGVLLNFEDG  223

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKARN  344
              GKVWRFRYSYWNSSQSYVLTKGWS FV+EK L AGD + F  S  G EKQLFI+ K +N
Sbjct  224   EGKVWRFRYSYWNSSQSYVLTKGWSSFVREKGLGAGDSIVFSSSAYGQEKQLFINCK-KN  282

Query  343   GTGSPDISTVPVHPVQ--------VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRI  188
              T +   + +P+  V+        V +LFGV+I                     +G KR+
Sbjct  283   TTMNGGKTALPLPVVETAKGEQDHVVKLFGVDI---------------------AGVKRV  321

Query  187   REVVMEFLPLECSKKQRV  134
             R    E  P E  K+Q V
Sbjct  322   RAATGELGPPELFKRQSV  339



>emb|CDM83359.1| unnamed protein product [Triticum aestivum]
Length=320

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 177/248 (71%), Gaps = 18/248 (7%)
 Frame = -3

Query  1057  RKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTN  878
             R  PSSRFKGVVPQPNGRWGAQIYEKH RVWLGTF +E+ AAR YD+AA RFRG DAV N
Sbjct  42    RAAPSSRFKGVVPQPNGRWGAQIYEKHSRVWLGTFPDEDAAARAYDVAALRFRGPDAVIN  101

Query  877   F-KPLSETTDGRN---GDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMT  710
               +P +    G +    + D E  FL+ HSKAEIVDMLRKHTY DEL Q  R        
Sbjct  102   HQRPTAAEEAGSSSSRSELDPELGFLADHSKAEIVDMLRKHTYDDELRQGLRRGRGRAQP  161

Query  709   TPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT---SKGVL  539
             TP        A +RE LFEKAVTPSDVGKLNRLV+PKQQAEKHFP    A T    KGVL
Sbjct  162   TP--------AWARELLFEKAVTPSDVGKLNRLVVPKQQAEKHFPPTTAAATGSNGKGVL  213

Query  538   LNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST---GPEKQL  368
             LNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKE  L+AGD V+F+RS      E QL
Sbjct  214   LNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVKETGLRAGDTVAFYRSAYGNDTEDQL  273

Query  367   FIDWKARN  344
             FID+K  N
Sbjct  274   FIDYKKMN  281



>ref|XP_004968155.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0141000-like 
[Setaria italica]
Length=370

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 188/287 (66%), Gaps = 29/287 (10%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSR+KGVVPQPNGRWGAQIYE+H RVWLGTF  EE AAR YD+AA R+RGR+A TNF   
Sbjct  74    SSRYKGVVPQPNGRWGAQIYERHARVWLGTFPNEEAAARAYDVAALRYRGREAATNFPG-  132

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
                     G    E  FL++HSKAEIVDMLRKHTY DEL Q  RR   +     P     
Sbjct  133   -------AGASAPELAFLAAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQP-----  180

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNG--AVTSKGVLLNFEDTNG  515
                A +R  LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+    A T +GVLLNFED  G
Sbjct  181   -TPAWARAPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRAPEATTGEGVLLNFEDGEG  239

Query  514   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF-HRSTGPEKQLFIDWKARNGT  338
             KVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+AGD + F H + G EKQLFID +     
Sbjct  240   KVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSHSTYGQEKQLFIDCRKTKTA  299

Query  337   GSPDISTV-------PVHPVQVFRLFGVNIS----KSTVSPMAMAMD  230
              +             P     V RLFGV+I+    +    P+ MA +
Sbjct  300   TTDAAPAPAAAPLEKPKEARVVVRLFGVDITGDGCQKRARPVEMAFE  346



>dbj|BAJ92496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=308

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 192/283 (68%), Gaps = 19/283 (7%)
 Frame = -3

Query  1087  AENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQ  908
             AE+ VE+ S    PSSRFKGVVPQPNGRWGAQIYEKH RVWLGTF +EE AA  YD+AA 
Sbjct  24    AEDAVESSSPVAAPSSRFKGVVPQPNGRWGAQIYEKHSRVWLGTFGDEEAAACAYDVAAL  83

Query  907   RFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAF  728
             RFRGRDAVTN + L    +G       E  FL+ HSKAEIVDMLRKHTY DEL Q  R  
Sbjct  84    RFRGRDAVTNHQRLP-AAEGAGWSSTSELAFLADHSKAEIVDMLRKHTYDDELRQGLRRG  142

Query  727   NINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP---LQNGAV  557
             +     TP        A +RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFP         
Sbjct  143   HGRAQPTP--------AWAREFLFEKAVTPSDVGKLNRLVVPKQHAEKHFPPTTAAAAGG  194

Query  556   TSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST---  386
               KG+LLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD V+F RS    
Sbjct  195   DGKGLLLNFEDGQGKVWRFRYSYWNSSQSYVLTKGWSRFVQEKGLCAGDTVTFSRSAYVM  254

Query  385   -GPEKQLFIDWK-ARNGTGSPDISTVPVHPVQ--VFRLFGVNI  269
                ++QLFID+K +     + D++T   +       +LFGV+I
Sbjct  255   NDTDEQLFIDYKQSSKNDEAADVATADENEAGHVAVKLFGVDI  297



>ref|XP_006645486.1| PREDICTED: putative AP2/ERF and B3 domain-containing protein 
Os01g0140700-like [Oryza brachyantha]
Length=307

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 198/306 (65%), Gaps = 32/306 (10%)
 Frame = -3

Query  1135  PESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGT  956
             PE L  M        D   G +A   R  PSSR+KGVVPQPNGRWGAQIYE+H RVWLGT
Sbjct  22    PEDLVAMEEDE--FQDLGGGHQAVELRVRPSSRYKGVVPQPNGRWGAQIYERHSRVWLGT  79

Query  955   FNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDML  776
             F +EE AAR YD+AA RFRGR+AVTN      T +G +        FL++HSKAEIVDML
Sbjct  80    FPDEEAAARAYDVAALRFRGREAVTN----RVTPEGASAG---VLAFLAAHSKAEIVDML  132

Query  775   RKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQ  596
             RKHTY DEL+Q  R        TPR         +RE LFEKAVTPSDVGKLNRLV+PKQ
Sbjct  133   RKHTYDDELQQGLRR-GARAQPTPR--------WAREPLFEKAVTPSDVGKLNRLVVPKQ  183

Query  595   QAEKHFPL-------QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
             QAEKHFP           A T KGVLLNFED +GKVWRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  184   QAEKHFPFPLRRSSDAAAAATGKGVLLNFEDGDGKVWRFRYSYWNSSQSYVLTKGWSRFV  243

Query  436   KEKSLKAGDIVSFHRST-GPEKQLFIDWK--ARNGTGSPDISTVPVHPVQVFRLFGVNIS  266
             +EK L+ GD V+F +S  G +K L ID K   RN     +   +     +V +LFGV+I+
Sbjct  244   REKGLRPGDTVAFSQSAWGTDKHLLIDCKKMQRN----QETHAIADDEARVVKLFGVDIA  299

Query  265   KSTVSP  248
                  P
Sbjct  300   GDKGVP  305



>ref|XP_006646228.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like 
[Oryza brachyantha]
Length=325

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 187/279 (67%), Gaps = 30/279 (11%)
 Frame = -3

Query  1006  RWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDY  827
             ++  ++Y  HQR++L TF  E++AAR YD+AAQRFRGRDAVTNF+PL+E           
Sbjct  23    KYSTKMY--HQRIFLLTFAGEDDAARAYDVAAQRFRGRDAVTNFRPLAEADPDAA----A  76

Query  826   EAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNI--------------NNMTTPRKPEA  689
             E  FL++ SKAE+VDMLRKHTY DEL QS+RA                 +N+++PR P A
Sbjct  77    ELRFLATRSKAEVVDMLRKHTYFDELAQSKRALAASTPSAATTTACLANDNLSSPRSPSA  136

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNG  515
                A +R+ LF+K VTPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLNFED  G
Sbjct  137   --GAAARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAAG  194

Query  514   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR---STGPEKQLFIDWKARN  344
             KVWRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD+V F+R   STG E +LFI+ K   
Sbjct  195   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDVVGFYRSATSTGDEGKLFIECKLVR  254

Query  343   GTGSPDISTV---PVHPVQVFRLFGVNISKSTVSPMAMA  236
              T +   +        PV+  RLFGV++ K+      MA
Sbjct  255   TTSAALAAPADQPAASPVKTVRLFGVDLLKTPAPEQQMA  293



>gb|EAY72473.1| hypothetical protein OsI_00328 [Oryza sativa Indica Group]
Length=369

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 189/280 (68%), Gaps = 35/280 (13%)
 Frame = -3

Query  1045  SSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPL  866
             SSR+KGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD+AA R+RGRDA TNF   
Sbjct  67    SSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRYRGRDAATNFPGA  126

Query  865   SETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEA  689
             + +          E  FL++HSKAEIVDMLRKHTY DEL Q  RR   +     P    A
Sbjct  127   AASAA--------ELAFLAAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQPTPSWA  178

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN--------GAVTSKGVLLN  533
                   RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+          A T KGVLLN
Sbjct  179   ------REPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLRRAASSDSASAAATGKGVLLN  232

Query  532   FEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDW  356
             FED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+AGD + F RS  GP+K LFID 
Sbjct  233   FEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSRSAYGPDKLLFIDC  292

Query  355   KARN----------GTGSPDISTVPVHPVQVFRLFGVNIS  266
             K  N          G   P  +T    P +V RLFGV+I+
Sbjct  293   KKNNAAVAATTTCAGDERPTTTTSGAEP-RVVRLFGVDIA  331



>ref|NP_001041982.1| Os01g0141000 [Oryza sativa Japonica Group]
 sp|Q9AWS0.1|Y1410_ORYSJ RecName: Full=AP2/ERF and B3 domain-containing protein Os01g0141000 
[Oryza sativa Japonica Group]
 dbj|BAB21218.1| putative AP2 domain containing protein RAP2.8 [Oryza sativa Japonica 
Group]
 dbj|BAF03896.1| Os01g0141000 [Oryza sativa Japonica Group]
 dbj|BAG89320.1| unnamed protein product [Oryza sativa Japonica Group]
Length=365

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 191/292 (65%), Gaps = 32/292 (11%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             R+KGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD+AA R+RGRDA TNF   + 
Sbjct  68    RYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRYRGRDAATNFPGAAA  127

Query  859   TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEADR  683
             +          E  FL++HSKAEIVDMLRKHTY DEL Q  RR   +     P       
Sbjct  128   SAA--------ELAFLAAHSKAEIVDMLRKHTYADELRQGLRRGRGMGARAQP------T  173

Query  682   SAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN--------GAVTSKGVLLNFE  527
              + +RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+          A T KGVLLNFE
Sbjct  174   PSWAREPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLRRAASSDSASAAATGKGVLLNFE  233

Query  526   DTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKA  350
             D  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+AGD + F RS  GP+K LFID K 
Sbjct  234   DGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSRSAYGPDKLLFIDCKK  293

Query  349   RN-------GTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNI  215
              N         G    +T    P +V RLFGV+I+         A++    +
Sbjct  294   NNAAAATTTCAGDERPTTSGAEP-RVVRLFGVDIAGGDCRKRERAVEMGQEV  344



>gb|EMT31332.1| AP2/ERF and B3 domain-containing protein [Aegilops tauschii]
Length=333

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 188/335 (56%), Gaps = 69/335 (21%)
 Frame = -3

Query  1099  VIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYD  920
             V I  E+     +  +L  SRFKGVVPQPNGRWG+QIYE+H RVWLGTF +++ AAR YD
Sbjct  41    VAIADESVTSRSTSAQLALSRFKGVVPQPNGRWGSQIYERHARVWLGTFADQDLAARAYD  100

Query  919   IAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS  740
              A                             E  FL++HSKAEIVDMLRKHTY DEL Q 
Sbjct  101   EA-----------------------------ELAFLAAHSKAEIVDMLRKHTYADELRQG  131

Query  739   -RRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL---  572
              RR   +     P    A      RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL   
Sbjct  132   LRRGRGMGTRAQPTPSWA------REPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLKRT  185

Query  571   -QNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
              +    T  GVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L AGD + F 
Sbjct  186   PETTTTTGNGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLAAGDSIVFS  245

Query  394   RST-GPEKQLFIDWK-------ARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAM  239
              S  G EKQ FI+ K        ++ +  P + T     V+V RLFGV+I          
Sbjct  246   CSAYGQEKQFFINCKKNTTVNGGKSASPLPVVETAKGEQVRVVRLFGVDI----------  295

Query  238   AMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRV  134
                        +G KR R    E  P E  K+Q V
Sbjct  296   -----------AGVKRGRAATAEHGPPELFKRQCV  319



>gb|EYU40862.1| hypothetical protein MIMGU_mgv1a013817mg [Erythranthe guttata]
Length=209

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 161/226 (71%), Gaps = 23/226 (10%)
 Frame = -3

Query  781  MLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSA-----KSRERLFEKAVTPSDVGKLN  617
            MLRKHTY DELEQSRR F  N     R   A         K+RE+LFEKAVTPSDVGKLN
Sbjct  1    MLRKHTYADELEQSRRNFGKNGGGAARGGGAFGFCGGAAEKAREQLFEKAVTPSDVGKLN  60

Query  616  RLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFV  437
            RLVIPKQ AEKHFPLQ+G+ TSKG+LLN ED   KVWRFRYSYWNSSQSYVLTKGWSRFV
Sbjct  61   RLVIPKQHAEKHFPLQSGS-TSKGILLNLEDRGAKVWRFRYSYWNSSQSYVLTKGWSRFV  119

Query  436  KEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSP-DISTVPVHPVQVFRLFGVNISKS  260
            KEK+L+AGD+VSFHRSTGP+KQL+IDWK RN   +P   + + V P Q+ RLFGVNI +S
Sbjct  120  KEKNLRAGDVVSFHRSTGPDKQLYIDWKPRNNVNAPLPAAAIAVVPGQMVRLFGVNIFES  179

Query  259  TVSPMAMAMDTTNNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
                            +  GGKR+ E  ME L L  SKKQRV++AL
Sbjct  180  P--------------RNSGGGKRMVE--MELLGLHTSKKQRVVNAL  209



>ref|XP_004971642.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0141000-like 
[Setaria italica]
Length=292

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 171/264 (65%), Gaps = 28/264 (11%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             R KGVV QP GRWGAQIYE H+RVWLGTF ++E AAR YD+AA R+RGR AVTNF     
Sbjct  35    RLKGVVLQPTGRWGAQIYEDHERVWLGTFPDQETAARAYDVAALRYRGRGAVTNFP----  90

Query  859   TTDGRNGDDD--YEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEAD  686
                 R G DD   +  FL++HSK+EIVDMLR  TY DEL    R         P  P   
Sbjct  91    ---ARRGADDEARQLAFLAAHSKSEIVDMLRNQTYADELRHGVR------RGVPALP---  138

Query  685   RSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGA---VTSKGVLLNFEDTNG  515
               A +R  LFEKAVTPSDVGKLNR V+PK+ AE+H P    A      KGV+L  ED  G
Sbjct  139   --AWARVPLFEKAVTPSDVGKLNRFVVPKKHAERHLPPLRAAEEGTAGKGVVLAVEDGEG  196

Query  514   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKARNGT  338
             KVWRFRYSYW SSQSYVLTKGW RFV+EK L+AGD V+F R T GPE+QL ID + +   
Sbjct  197   KVWRFRYSYWESSQSYVLTKGWIRFVREKGLRAGDAVAFSRWTFGPEEQLLIDCRKKPKN  256

Query  337   GSPDISTVPVHPVQVFRLFGVNIS  266
              +  I+        + +LFGV+I+
Sbjct  257   KADAIAV----QAPIVKLFGVDIA  276



>emb|CBI16858.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 173/293 (59%), Gaps = 74/293 (25%)
 Frame = -3

Query  1147  ATKSPESLCRMGSGASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRV  968
              TK  +   R+G G S I D+ENGV A   RKL SS++KGVVPQPNGRWGAQIYEKH+R+
Sbjct  27    VTKMSDYSWRVG-GTSGISDSENGVGAVYLRKLTSSKYKGVVPQPNGRWGAQIYEKHRRI  85

Query  967   WLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEI  788
             WLGTFNEE EAA+ YD                            DD E  FL+SHSKAEI
Sbjct  86    WLGTFNEEGEAAKAYDGI-------------------------QDDIETTFLNSHSKAEI  120

Query  787   VDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLV  608
             VDMLRKHTY DELEQS   +                  S+E       + +DV       
Sbjct  121   VDMLRKHTYNDELEQSAHNYG-----------------SKE-------SGADV-------  149

Query  607   IPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEK  428
                              +SKG LLNFED  GK+WRFRYS+WNSSQSYVLTKGW RFVKEK
Sbjct  150   ---------------MDSSKGGLLNFEDNGGKIWRFRYSFWNSSQSYVLTKGWRRFVKEK  194

Query  427   SLKAGDIVSFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
             +LKAGDIVSFHRSTG +K+LFI+W+ R+ +  P  S   V   Q+ RLFGVN+
Sbjct  195   NLKAGDIVSFHRSTGSDKRLFIEWEQRDSSRKP--SMKQVESGQMVRLFGVNL  245



>ref|XP_002961048.1| hypothetical protein SELMODRAFT_71153, partial [Selaginella moellendorffii]
 ref|XP_002966965.1| hypothetical protein SELMODRAFT_66538, partial [Selaginella moellendorffii]
 gb|EFJ31564.1| hypothetical protein SELMODRAFT_66538, partial [Selaginella moellendorffii]
 gb|EFJ38587.1| hypothetical protein SELMODRAFT_71153, partial [Selaginella moellendorffii]
Length=238

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 170/245 (69%), Gaps = 23/245 (9%)
 Frame = -3

Query  1054  KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNF  875
             KLPSS++KGVVPQPNGR+GAQIYEKHQRVWLGTF+ E EAA+ YD+AA + RG DA+TNF
Sbjct  1     KLPSSQYKGVVPQPNGRFGAQIYEKHQRVWLGTFDTEVEAAKAYDVAATKIRGNDALTNF  60

Query  874   KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS---------RRAFNI  722
              P+ E+        + E+ FLS HSK +I+DMLRKHTY  +L ++               
Sbjct  61    PPVDES--------EPESAFLSLHSKEQIIDMLRKHTYNQQLIKNTALDTSSSSSSTTTT  112

Query  721   NNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGV  542
             NN   P K  +  +   RE LF K VTPSDVGKLNRLVIPK  AE+ FPL   A   KG+
Sbjct  113   NNHNAP-KSSSLLAQHHREHLFFKVVTPSDVGKLNRLVIPKHHAERCFPL---APHEKGL  168

Query  541   LLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST--GPEKQL  368
             LL+FED  GK WRFRYSYW+SSQSYVLT+GWSRFVK+K L+ GD V F R+T  G   +L
Sbjct  169   LLSFEDERGKHWRFRYSYWSSSQSYVLTRGWSRFVKDKQLQVGDAVFFDRATTAGSSCKL  228

Query  367   FIDWK  353
             FI WK
Sbjct  229   FIHWK  233



>gb|EEC69916.1| hypothetical protein OsI_00337 [Oryza sativa Indica Group]
Length=349

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 173/292 (59%), Gaps = 48/292 (16%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             R+KGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD+AA R+RGRDA TNF     
Sbjct  68    RYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRYRGRDAATNF-----  122

Query  859   TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQS-RRAFNINNMTTPRKPEADR  683
                                  A        HTY DEL Q  RR   +     P       
Sbjct  123   -------------------PGAAASAAELAHTYADELRQGLRRGRGMGARAQP------T  157

Query  682   SAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN--------GAVTSKGVLLNFE  527
              + +RE LFEKAVTPSDVGKLNRLV+PKQ AEKHFPL+          A T KGVLLNFE
Sbjct  158   PSWAREPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLRRAASSDSASAAATGKGVLLNFE  217

Query  526   DTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST-GPEKQLFIDWKA  350
             D  GKVWRFRYSYWNSSQSYVLTKGWSRFV+EK L+AGD + F RS  GP+K LFID K 
Sbjct  218   DGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSRSAYGPDKLLFIDCKK  277

Query  349   RN-------GTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNI  215
              N         G    +T    P +V RLFGV+I+         A++    +
Sbjct  278   NNAAAATTTCAGDERPTTSGAEP-RVVRLFGVDIAGGDCRKRERAVEMGQEV  328



>gb|AAR83846.1| AP2 domain transcription factor [Capsicum annuum]
Length=176

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 125/146 (86%), Gaps = 5/146 (3%)
 Frame = -3

Query  1156  NLPATKSPESLCRMGSG-ASVIIDAENGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEK  980
             ++  TK PESLCRMGSG +SVIID ENGVEAES RKLPSS++KGVVPQPNGRWGAQIYEK
Sbjct  34    SMTTTKPPESLCRMGSGTSSVIIDGENGVEAES-RKLPSSKYKGVVPQPNGRWGAQIYEK  92

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTFNEE EAAR YD+AAQRFRGRDAVTNFKPL E    +  DDD E  FL+SHS
Sbjct  93    HQRVWLGTFNEENEAARAYDVAAQRFRGRDAVTNFKPLLEN---QESDDDVEIAFLNSHS  149

Query  799   KAEIVDMLRKHTYTDELEQSRRAFNI  722
             KAEIVDMLRKHTY DELEQS++ F I
Sbjct  150   KAEIVDMLRKHTYIDELEQSKKLFGI  175



>ref|XP_010679664.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
RAV1-like [Beta vulgaris subsp. vulgaris]
Length=294

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 172/278 (62%), Gaps = 17/278 (6%)
 Frame = -3

Query  1054  KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNF  875
             +  + ++KGVVPQPNGRWGAQ+YE ++RVW+GTF+  E AAR YD A  RFRG  A TNF
Sbjct  26    QFSACQYKGVVPQPNGRWGAQLYEGNKRVWIGTFDRREVAARAYDTAVIRFRGPHAATNF  85

Query  874   KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQ---SRRAFNINNMTTP  704
                  +          +  FL+S SK  ++DMLR +TY DEL +   +R A N       
Sbjct  86    SICHYSV--------LQLEFLASLSKPRVIDMLRTNTYHDELARFMLARCAKNRRRRLGQ  137

Query  703   RKP-EADRSAK--SRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLN  533
              +P E D  ++  SRE +FEK VTPSDVGKLNRLVIPKQ A+++ P+        G++L 
Sbjct  138   EEPMEEDMMSQDSSREWVFEKVVTPSDVGKLNRLVIPKQYAKRYLPVITADEDVGGIMLR  197

Query  532   FEDT-NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDW  356
             FED    K+WRF+Y YW SSQ+YVLTKGW  FVK++ L+ GD+V F+ S G +K+ +ID 
Sbjct  198   FEDERREKIWRFKYCYWKSSQNYVLTKGWGEFVKDRGLRCGDVVRFYTSVGADKRFYIDT  257

Query  355   KARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMA  242
              ++    +  I+       ++ RLFGV+I    V+  A
Sbjct  258   ISK--ASAKQINDNGSASSKMLRLFGVDIVCPVVTATA  293



>ref|XP_010246118.1| PREDICTED: B3 domain-containing protein At2g36080-like [Nelumbo 
nucifera]
Length=370

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 149/239 (62%), Gaps = 30/239 (13%)
 Frame = -3

Query  1054  KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNF  875
             K+PSSR+KGVVPQ NGRWGAQIYE   R+WLGTF+ EE AAR YD AA  FRGRDA  NF
Sbjct  27    KIPSSRYKGVVPQSNGRWGAQIYENQHRLWLGTFDSEEAAARSYDRAASLFRGRDAALNF  86

Query  874   KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKP  695
                   T+ ++ +D+ E                      D+     R   +++      P
Sbjct  87    -----NTNQQDNEDELE----------------------DQQTTGDRETMVDDHDHDHNP  119

Query  694   EADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG---VLLNFED  524
                R  + RE +FEK +TPSDVGKLNRLVIPKQ AEK+FPL  G     G   +LL+FED
Sbjct  120   GGQRDQEEREHMFEKPLTPSDVGKLNRLVIPKQHAEKYFPLGGGGGGDSGEKGLLLSFED  179

Query  523   TNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR  347
              +GK WRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD+VSF R      + +I W+ R
Sbjct  180   ESGKSWRFRYSYWNSSQSYVLTKGWSRFVKEKRLDAGDVVSFERRKFNGDRFYIRWRRR  238



>ref|XP_008657835.1| PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like 
[Zea mays]
Length=287

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 153/245 (62%), Gaps = 43/245 (18%)
 Frame = -3

Query  883  TNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAF--------  728
            TNF+PL++       D   E  FL+S SKAE+VDMLRKHTY DEL Q++RAF        
Sbjct  16   TNFRPLADA----GPDAAAELRFLASRSKAEVVDMLRKHTYFDELAQNKRAFAAAAAAAS  71

Query  727  -----------NINNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKH  581
                       N N  ++P        A +RE LF+KAVTPSDVGKLNRLVIPKQ AE+H
Sbjct  72   SAAATTSTSLGNDNRSSSP--------ACAREHLFDKAVTPSDVGKLNRLVIPKQHAERH  123

Query  580  FPLQNGAVT----SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAG  413
            FPL   A      S GVLLN ED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK L+AG
Sbjct  124  FPLHLAAAAGGGESTGVLLNLEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLQAG  183

Query  412  DIVSFHRS-TGPEKQLFIDWKAR------NGTGSPDISTVPVHPV-QVFRLFGVNISKST  257
            D+V F+RS  G + +LFID K R        T SP  S+ P  PV +  RLFGV++  + 
Sbjct  184  DVVGFYRSAAGADSKLFIDCKLRPNSVDTASTTSPVGSSPPPAPVAKAVRLFGVDLLTAP  243

Query  256  VSPMA  242
               MA
Sbjct  244  ADAMA  248



>gb|EEE64597.1| hypothetical protein OsJ_19449 [Oryza sativa Japonica Group]
Length=348

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 156/236 (66%), Gaps = 33/236 (14%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR--------KLPSSRFKGVVPQPNGRWGAQIYEKHQ  974
             L R+GSGAS ++DA E G EA+SG         KLPSS++KGVVPQPNGRWGAQIYE+HQ
Sbjct  30    LQRVGSGASAVMDAAEPGAEADSGGERRGGGGGKLPSSKYKGVVPQPNGRWGAQIYERHQ  89

Query  973   RVWLGTFNEEEEAARVYDI-AAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSK  797
             RVWLGTF  E EAAR      A   RGRDAVTNF+PL+E+    + +   E  FL+S SK
Sbjct  90    RVWLGTFTGEAEAARALRRGGAAGSRGRDAVTNFRPLAES----DPEAAVELRFLASRSK  145

Query  796   AEIVDMLRKHTYTDELEQSRRAFNINNMTTPR--KPEADRSAKSRERLFEKAVTPSDVGK  623
             AE+VDMLRKHTY +EL Q++RAF   +   P+        S+ +RE LF+K VTPSDVGK
Sbjct  146   AEVVDMLRKHTYLEELTQNKRAFAAISPPPPKHPASSPTSSSAAREHLFDKTVTPSDVGK  205

Query  622   LNRLVIPKQQAEKHFPLQNGAVTS-----------------KGVLLNFEDTNGKVW  506
             LNRLVIPKQ AEKHFPLQ    T+                 KGVLLNFED  GKV+
Sbjct  206   LNRLVIPKQHAEKHFPLQLPPPTTTSSVAAAADAAAGGGDCKGVLLNFEDAAGKVF  261



>gb|EAZ10480.1| hypothetical protein OsJ_00312 [Oryza sativa Japonica Group]
Length=276

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 159/266 (60%), Gaps = 62/266 (23%)
 Frame = -3

Query  1048  PSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKP  869
             PSSR+KGVVPQPNGRWGAQIYE+H RVWLGTF +EE AAR YD+AA RFRGRDAVTN  P
Sbjct  63    PSSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRFRGRDAVTNRAP  122

Query  868   LSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEA  689
              +E      G    E  FL++HSKAE+VDMLRKHTY DEL+Q  R  +     TPR   A
Sbjct  123   AAE------GASAGELAFLAAHSKAEVVDMLRKHTYDDELQQGLRRGS-RAQPTPRSDAA  175

Query  688   DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKV  509
                                                           KGVLLNFED +GKV
Sbjct  176   ---------------------------------------------GKGVLLNFEDGDGKV  190

Query  508   WRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRST---GPEKQLFIDWKA--RN  344
             WRFRYSYWNSSQSYVLTKGWSRFV+EK L+ GD V+F RS    G EK L ID K   RN
Sbjct  191   WRFRYSYWNSSQSYVLTKGWSRFVREKGLRPGDTVAFSRSAAAWGTEKHLLIDCKKMERN  250

Query  343   GTGSPDISTVPVHPVQVFRLFGVNIS  266
                  +++TV      V +LFGV+I+
Sbjct  251   -----NLATVDDDARVVVKLFGVDIA  271



>ref|XP_010262926.1| PREDICTED: B3 domain-containing protein At2g36080-like [Nelumbo 
nucifera]
Length=358

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 148/236 (63%), Gaps = 27/236 (11%)
 Frame = -3

Query  1054  KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNF  875
             ++P+SR+KGVVPQPNGRWGAQI E H R+WLGTF+ EE AAR Y  A   F GRD+  NF
Sbjct  24    RIPTSRYKGVVPQPNGRWGAQIQENHHRLWLGTFDSEEAAARSYLRAVSMFGGRDSALNF  83

Query  874   KPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKP  695
              P    T   N ++D                 L     T++ E       ++N  T    
Sbjct  84    NP----TQHDNNEED-----------------LEDQQTTEDRE------TVDNDDTDHAN  116

Query  694   EADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNG  515
             +     + RE +FEK +TPSDVGKLNRLVIPKQ AEK+FPL  G    KG+LL+FED +G
Sbjct  117   QHHHHQEEREHMFEKPLTPSDVGKLNRLVIPKQHAEKYFPLGGGDSGEKGLLLSFEDESG  176

Query  514   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR  347
             K WRFRYSYWNSSQSYVLTKGWSRFVKEK L AGD+VSF R      + +I W+ R
Sbjct  177   KSWRFRYSYWNSSQSYVLTKGWSRFVKEKRLDAGDVVSFERRKLNGDRFYIRWRRR  232



>gb|AFW79017.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=306

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 145/207 (70%), Gaps = 25/207 (12%)
 Frame = -3

Query  1126  LCRMGSGASVIIDA-ENGVEAESGR----------KLPSSRFKGVVPQPNGRWGAQIYEK  980
             L R+GSG S ++DA E G EA+SG           KLPSS++KGVVPQPNGRWGAQIYE+
Sbjct  33    LQRVGSGTSAVMDAAEPGAEADSGGAGRAPGGVSGKLPSSKYKGVVPQPNGRWGAQIYER  92

Query  979   HQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHS  800
             HQRVWLGTF  E EAAR YD+AAQRFRGRDAVTNF+PL+E+      +   E  FL+S S
Sbjct  93    HQRVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFRPLAESEP----EAAVELRFLASRS  148

Query  799   KAEIVDMLRKHTYTDELEQSRRAF----------NINNMTTPRKPEADRSAKSRERLFEK  650
             KAE+VDMLRKHTY +EL  +RRAF            NN   P    +   A +RE LF+K
Sbjct  149   KAEVVDMLRKHTYGEELAHNRRAFAAASPAASPPPENNRRPPAASSSSSPAAAREHLFDK  208

Query  649   AVTPSDVGKLNRLVIPKQQAEKHFPLQ  569
              VTPSDVGKLNRLVIPKQ AEKHFPL+
Sbjct  209   TVTPSDVGKLNRLVIPKQHAEKHFPLR  235


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  560  RHLQGSSLELRGHQRKSMAVPVLVLEQQPELRPHQRVEPFREGEELESRRHCEFPQIDRT  381
            R +QG + +LRG +R+ + VPVLVLEQQPELR  Q VEP R+GE    RR        R 
Sbjct  235  RRVQGRAPQLRGRRREGVEVPVLVLEQQPELRADQGVEPLRQGEGAPRRRRRRVLPFRRR  294

Query  380  GKTALHRLE  354
               ALHRL+
Sbjct  295  QAAALHRLQ  303



>ref|XP_010679708.1| PREDICTED: putative AP2/ERF and B3 domain-containing protein 
Os01g0140700 [Beta vulgaris subsp. vulgaris]
Length=321

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 179/302 (59%), Gaps = 32/302 (11%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             ++KG+VPQPNGRWGAQ+Y+ ++R+W+GTF+ +  AA  YDIAA RFRG  A+TN+ PL  
Sbjct  38    KYKGIVPQPNGRWGAQLYQDNKRIWIGTFDCQHVAAHAYDIAAIRFRGTQALTNY-PLRH  96

Query  859   TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADRS  680
                     D  +  FL+SHSK  I+D+LR  TY +EL +  R+           P+ +++
Sbjct  97    Y-------DKPQLHFLASHSKVRIIDILRNQTYEEELTRFMRSRTKAIRARRMAPDFEQN  149

Query  679   AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDT-NGKVWR  503
               +RERLFEK +TPSDVG+L+RLVIPK  A  + P+    V  +G++L+FED    K+WR
Sbjct  150   LVARERLFEKVLTPSDVGRLHRLVIPKHYARCYLPV---IVDIRGIMLSFEDERREKIWR  206

Query  502   FRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS-TGPEKQLFIDWKAR-------  347
             F+  YW SSQ+YVLTKGW  FV++K L+ GD V F+ +  G + +  ID   +       
Sbjct  207   FKCCYWKSSQNYVLTKGWGEFVRDKGLRPGDSVVFYTTLVGSDLRFSIDTMFKQHDVEEI  266

Query  346   --NGTGS-PDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTTNNISSCSG-GKRIREV  179
               +G GS  D     V   +  RLFGV+I      P    + T+ + S C G G+RI   
Sbjct  267   SDSGNGSNGDHEVELVFRSKFLRLFGVDI-----CPF---IPTSISSSWCDGKGQRITSS  318

Query  178   VM  173
             V 
Sbjct  319   VF  320



>ref|XP_006304241.1| hypothetical protein CARUB_v10010429mg [Capsella rubella]
 gb|EOA37139.1| hypothetical protein CARUB_v10010429mg [Capsella rubella]
Length=178

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 133/197 (68%), Gaps = 30/197 (15%)
 Frame = -3

Query  688  DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTS-------KGVLLNF  530
            D  +K+RE LFEKAVTPSDVGKLNRLVIPKQ AEKHFPL      +       KG+L+N 
Sbjct  4    DAVSKAREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPAMTTATGMNPSPTKGLLINL  63

Query  529  EDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKA  350
            ED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+L+AGD+V F RSTGP++QL+IDWK 
Sbjct  64   EDRTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIDWKV  123

Query  349  RNGTGSPDISTVPVHPVQ-VFRLFGVNISKSTVSPMAMAMDTTNNISSCSGGKRIREVVM  173
            R+             PVQ V RLFGVNI      P  +A+D       C+GGK+ R    
Sbjct  124  RSS------------PVQTVVRLFGVNIFND--RPNGVAVD-------CTGGKK-RSRDD  161

Query  172  EFLPLECSKKQRVIDAL  122
            +   L CSKKQ +I+ L
Sbjct  162  DLFSLGCSKKQTIINIL  178



>gb|EAZ13178.1| hypothetical protein OsJ_03098 [Oryza sativa Japonica Group]
Length=231

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 131/194 (68%), Gaps = 26/194 (13%)
 Frame = -3

Query  781  MLRKHTYTDELEQSRRAFNIN--------------NMTTPRKPEADRSAKSRERLFEKAV  644
            MLRKHTY DEL QS+R F  +              ++++PR P A   A +R+ LF+K V
Sbjct  1    MLRKHTYFDELAQSKRTFAASTPSAATTTASLSNGHLSSPRSPFA--PAAARDHLFDKTV  58

Query  643  TPSDVGKLNRLVIPKQQAEKHFPLQ--NGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQS  470
            TPSDVGKLNRLVIPKQ AEKHFPLQ  +    SKGVLLNFED  GKVWRFRYSYWNSSQS
Sbjct  59   TPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAAGKVWRFRYSYWNSSQS  118

Query  469  YVLTKGWSRFVKEKSLKAGDIVSFHR---STGPEKQLFIDWKARNGTG----SPDISTVP  311
            YVLTKGWSRFVKEK L AGD+V F+R   S G + +LFID K    TG    SP     P
Sbjct  119  YVLTKGWSRFVKEKGLHAGDVVGFYRSAASAGDDGKLFIDCKLVRSTGAALASPADQPAP  178

Query  310  VHPVQVFRLFGVNI  269
              PV+  RLFGV++
Sbjct  179  -SPVKAVRLFGVDL  191



>gb|AFW68588.1| hypothetical protein ZEAMMB73_576107 [Zea mays]
 gb|AFW83639.1| hypothetical protein ZEAMMB73_082033 [Zea mays]
 gb|AIB05375.1| ABI3VP1 transcription factor, partial [Zea mays]
Length=242

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 132/211 (63%), Gaps = 39/211 (18%)
 Frame = -3

Query  781  MLRKHTYTDELEQSRRAF-------------------NINNMTTPRKPEADRSAKSRERL  659
            MLRKHTY DEL Q++RAF                   N N  ++P        A +RE L
Sbjct  1    MLRKHTYFDELAQNKRAFAAAAAAASSAAATTSTSLGNDNRSSSP--------ACAREHL  52

Query  658  FEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT----SKGVLLNFEDTNGKVWRFRYS  491
            F+KAVTPSDVGKLNRLVIPKQ AE+HFPL   A      S GVLLN ED  GKVWRFRYS
Sbjct  53   FDKAVTPSDVGKLNRLVIPKQHAERHFPLHLAAAAGGGESTGVLLNLEDAAGKVWRFRYS  112

Query  490  YWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRS-TGPEKQLFIDWKAR------NGTGS  332
            YWNSSQSYVLTKGWSRFVKEK L+AGD+V F+RS  G + +LFID K R        T S
Sbjct  113  YWNSSQSYVLTKGWSRFVKEKGLQAGDVVGFYRSAAGADSKLFIDCKLRPNSVDTASTTS  172

Query  331  PDISTVPVHPV-QVFRLFGVNISKSTVSPMA  242
            P  S+ P  PV +  RLFGV++  +    MA
Sbjct  173  PVGSSPPPAPVAKAVRLFGVDLLTAPADAMA  203



>gb|KCW86365.1| hypothetical protein EUGRSUZ_B03050 [Eucalyptus grandis]
Length=163

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 113/152 (74%), Gaps = 7/152 (5%)
 Frame = -3

Query  715  MTTPRKPEA-DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQN--GAVTSKG  545
            M   R P   DR+A +   LF+K VT SDVGKLNR VIPKQ AEKHFPL+N     TSKG
Sbjct  1    MEAIRDPSGPDRAAMACHLLFQKEVTQSDVGKLNRFVIPKQHAEKHFPLRNRTSPTTSKG  60

Query  544  VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLF  365
            VLLNF D+ GKVWRFRYSYWNSS+SYVLT+GW+RFVKEKSL+ GDIVSFHRS GPEKQL 
Sbjct  61   VLLNFIDSGGKVWRFRYSYWNSSRSYVLTRGWTRFVKEKSLRTGDIVSFHRSAGPEKQLH  120

Query  364  IDWKARNGTGSPDISTVPVHPVQVFRLFGVNI  269
            I    R+G         P+HPVQ+ RLFGV+I
Sbjct  121  IKCMRRSGLSQAG----PIHPVQMVRLFGVDI  148



>ref|XP_010241058.1| PREDICTED: B3 domain-containing protein Os03g0120900-like [Nelumbo 
nucifera]
 ref|XP_010241059.1| PREDICTED: B3 domain-containing protein Os03g0120900-like [Nelumbo 
nucifera]
Length=431

 Score =   204 bits (519),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 156/275 (57%), Gaps = 68/275 (25%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYD-IAAQRFRGRDAVTNFKPLS  863
             ++KGVVP+PN RWG Q+YEKHQ        +EEEA R YD  A   F G+DAVTNF    
Sbjct  38    QYKGVVPRPNRRWGGQMYEKHQ--------QEEEAVRSYDRPAPLEFHGQDAVTNF----  85

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEADR  683
                                + K  ++D+                  IN     R  EAD 
Sbjct  86    -------------------NQKLGLIDLS----------------TINGGDASRG-EADG  109

Query  682   SAKS------RERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDT  521
                +      RE +F+K VTPSDVGKLNRLVIPKQ AEK+FPL + A   KG+LLNFED 
Sbjct  110   GGNTSGGCVEREHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPL-DSATNEKGLLLNFEDR  168

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPE--KQLFIDWKAR  347
             +GK WRFRYSYWNSSQSYV+TKGWSRFVKEK L AGDIVSF R  G     +L+IDW+ R
Sbjct  169   SGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFERGVGESGRDRLYIDWRRR  228

Query  346   NGTGSPDISTVPVHPVQVFRLFG--VNISKSTVSP  248
                  PD   +P  P      FG  +++++S+V P
Sbjct  229   PDV--PDPGMLPPLP------FGNPLSLARSSVVP  255



>ref|XP_002440616.1| hypothetical protein SORBIDRAFT_09g004140 [Sorghum bicolor]
 gb|EES19046.1| hypothetical protein SORBIDRAFT_09g004140 [Sorghum bicolor]
Length=311

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 152/228 (67%), Gaps = 23/228 (10%)
 Frame = -3

Query  1060  GRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVT  881
              R  PSSR+KGVVPQPNGRWGAQ YE+H RVWLGTF +E  AAR YD+AA RFRGR A  
Sbjct  32    ARAPPSSRYKGVVPQPNGRWGAQTYERHARVWLGTFADEAAAARAYDVAALRFRGRGAAA  91

Query  880   NFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPR  701
             NF          +  D  E  FL++  KAE+VDMLRKHTY DEL Q+ R+          
Sbjct  92    NFPG--------HPADAAEMAFLAARPKAEVVDMLRKHTYDDELRQALRSGGSGG-----  138

Query  700   KPEADRS--AKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFE  527
                 DRS     R  +FEKAVTPSDVG+LNR+V+PK  AEKHFP    A  +  VLL FE
Sbjct  139   ---GDRSLVVLPRVTMFEKAVTPSDVGRLNRMVVPKLHAEKHFPRIEEAADAAPVLLAFE  195

Query  526   D-----TNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF  398
             D       GKVWRFRYSYW+SSQSYVLT+GWSRFV+EK L AGD V+F
Sbjct  196   DVGVGGGTGKVWRFRYSYWSSSQSYVLTRGWSRFVREKGLAAGDTVAF  243



>ref|XP_010251300.1| PREDICTED: B3 domain-containing protein Os03g0120900-like [Nelumbo 
nucifera]
Length=453

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 154/262 (59%), Gaps = 56/262 (21%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYD---IAAQRFRGRDAVTNFKP  869
             ++KGVVPQP+ RWG Q+YE+HQ        +EEEA R YD    A   F G++AVTNF  
Sbjct  48    QYKGVVPQPDRRWGGQMYERHQ--------QEEEAGRSYDRPAAAPLEFHGQEAVTNF--  97

Query  868   LSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMTTPRKPEA  689
                                  + K E++D+            +RR+ +I+   +     +
Sbjct  98    ---------------------NRKLELIDL-----------STRRSDDISRGESDGGGSS  125

Query  688   DRSAKS--RERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNG  515
                     RE +F+K VTPSDVGKLNRLVIPKQ AEK+FPL + A   KG+LL+FED +G
Sbjct  126   SGGGGCVEREHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPL-DSAANEKGLLLSFEDRSG  184

Query  514   KVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPE--KQLFIDWKARNG  341
             K WRFRYSYWNSSQSYV+TKGWSRFVKEK L AGDIVSF R  G     +L+IDW+ R  
Sbjct  185   KPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFERGVGESGRNRLYIDWRRR--  242

Query  340   TGSPDISTVPV----HPVQVFR  287
               +PD + +P     HP+ + R
Sbjct  243   PDAPDPAILPPLPFSHPLSLPR  264



>pdb|1WID|A Chain A, Solution Structure Of The B3 Dna-Binding Domain Of Rav1
Length=130

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -3

Query  667  ERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSY  488
            E LFEKAVTPSDVGKLNRLVIPK  AEKHFPL +  V+ KGVLLNFED NGKVWRFRYSY
Sbjct  11   EALFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWRFRYSY  70

Query  487  WNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKARNGT  338
            WNSSQSYVLTKGWSRFVKEK+L+AGD+VSF RS G ++QL+I WK+R+G+
Sbjct  71   WNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS  120



>ref|XP_002325139.2| hypothetical protein POPTR_0018s11780g [Populus trichocarpa]
 gb|EEF03704.2| hypothetical protein POPTR_0018s11780g [Populus trichocarpa]
Length=549

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 142/229 (62%), Gaps = 14/229 (6%)
 Frame = -3

Query  1069  AESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRD  890
             A SG  + +S+FKGVVP PNG WG QIY  HQR+WLGTF  E+EAA  YD AA + R  D
Sbjct  36    ARSGSNISASKFKGVVPLPNGHWGCQIYANHQRIWLGTFKSEKEAAMAYDSAAIKLRSGD  95

Query  889   AVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNINNMT  710
             +  NF PL++ T         E  F S  S   +++M++  TY  +     R  + +  T
Sbjct  96    SRRNF-PLTDVTVE-------EPKFQSYFSTEVVLNMIKDGTYQCKFANFTRTCSQSVET  147

Query  709   ----TPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP-LQNGAVTSKG  545
                     P++++    ++ LF+K +TPSDVGKLNR+VIPK+ A K+FP +   A    G
Sbjct  148   ELSLKLMMPQSNQGLTCKQ-LFQKELTPSDVGKLNRIVIPKKYAIKYFPHISESAEEVDG  206

Query  544   VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF  398
             V+L F D + K+W+FRY YW SSQSYV T+GW+RFVKEK LKA D +SF
Sbjct  207   VMLAFYDKSMKLWKFRYCYWKSSQSYVFTRGWNRFVKEKKLKANDTISF  255



>ref|XP_008451118.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g50680-like [Cucumis melo]
Length=357

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 136/222 (61%), Gaps = 15/222 (7%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             +FKGVVPQ NGRWGAQIY  HQR+WLGTF  E++AA  YD AA + R RD+  NF     
Sbjct  52    KFKGVVPQQNGRWGAQIYANHQRIWLGTFKTEKDAAMAYDSAAIKLRTRDSHRNFPWTRR  111

Query  859   TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELE---QSRRAFNINNMTTPRKPE-  692
             T +  N        F    S   ++ M++  +Y  +     ++R   +  N+  P+K + 
Sbjct  112   TIEEPN--------FQVKFSTDAVLSMIKDGSYYSKFSAYLRTRSQIHDTNLQNPKKLDN  163

Query  691   -ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL--QNGAVTSKGVLLNFEDT  521
                 S  S   LF+K +TPSDVGKLNRLVIPK+ A KHFP   ++  V    + + F DT
Sbjct  164   GDGDSLFSCSHLFQKELTPSDVGKLNRLVIPKKYAVKHFPYISESAEVNGDDIEIVFYDT  223

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
             + K W+FRY YW SSQS+V T+GW+RFVKEK LKA DI++F+
Sbjct  224   SMKTWKFRYCYWRSSQSFVFTRGWNRFVKEKKLKANDIITFY  265



>ref|XP_004149034.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g51120-like [Cucumis sativus]
 ref|XP_004169754.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g51120-like [Cucumis sativus]
Length=356

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 137/222 (62%), Gaps = 15/222 (7%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             +FKGVVPQ NGRWGAQIY  HQR+WLGTF  E++AA  YD A+ + R RD+  NF     
Sbjct  52    KFKGVVPQQNGRWGAQIYANHQRIWLGTFKTEKDAAMAYDSASIKLRTRDSHRNFPWTRR  111

Query  859   TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELE---QSRRAFNINNMTTPRKPE-  692
             T +  N        F    S   ++ M++  +Y  +     ++R   +  N+  P+K + 
Sbjct  112   TIEEPN--------FQIKFSTDAVLSMIKDGSYYSKFSAYLRTRSQIHDTNIQNPKKIDN  163

Query  691   -ADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG--VLLNFEDT  521
                 S  S   LF+K +TPSDVGKLNRLVIPK+ A KHFP  + +    G  + + F DT
Sbjct  164   GDGDSLFSCSHLFQKELTPSDVGKLNRLVIPKKYAVKHFPYISESAEENGDDIEIVFYDT  223

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
             + K+W+FRY YW SSQS+V T+GW+RFVKEK LKA DI++F+
Sbjct  224   SMKIWKFRYCYWRSSQSFVFTRGWNRFVKEKKLKANDIITFY  265



>ref|XP_011033440.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g51120-like [Populus euphratica]
 ref|XP_011033441.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g51120-like [Populus euphratica]
 ref|XP_011033442.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g51120-like [Populus euphratica]
Length=345

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 135/234 (58%), Gaps = 18/234 (8%)
 Frame = -3

Query  1069  AESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRD  890
             A SG  + +SRFKGVVPQPNG WG QIY  HQR+WLGTF  E EAA  YD AA + R  D
Sbjct  36    ARSGCNVSASRFKGVVPQPNGHWGCQIYANHQRIWLGTFKSEREAAMAYDSAAIKLRSGD  95

Query  889   AVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNIN---  719
             +  NF P   T +        E  F S +S   ++ M++  TY  +     R  + +   
Sbjct  96    SRRNFPPTDITVE--------EPKFQSYYSIEVVLAMIKDGTYQSKFADFIRTCSQSVGT  147

Query  718   NMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP-----LQNGAVT  554
              ++     +      + ++LF K +TPSDVGKLNRLVIPK+ A K+FP      +     
Sbjct  148   ALSLKLMMQQSSEGLACKQLFRKELTPSDVGKLNRLVIPKKYAIKYFPNISESAEEDLAA  207

Query  553   SK--GVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSF  398
              K   V+L F D + K+W+FRY YW SSQSYV T+GW+RFVKEK LKA D + F
Sbjct  208   DKVVDVILAFYDKSMKLWKFRYCYWKSSQSYVFTRGWNRFVKEKKLKANDSIVF  261



>ref|XP_006453664.1| hypothetical protein CICLE_v10010403mg, partial [Citrus clementina]
 gb|ESR66904.1| hypothetical protein CICLE_v10010403mg, partial [Citrus clementina]
Length=316

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 149/259 (58%), Gaps = 27/259 (10%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             S+FKGVVPQ NG WGAQIY  HQR+WLGTF  E++AA  YD AA R R  D+  NF P +
Sbjct  43    SKFKGVVPQQNGHWGAQIYANHQRIWLGTFKSEKDAAMAYDSAAIRLRSVDSHRNF-PWT  101

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYT----DELEQSRRAFNINNMTTPRKP  695
             + T         E  F S +S   +++M+R  +Y+    D L    R    + + T  + 
Sbjct  102   KITIE-------EPNFQSHYSTEAVINMIRDGSYSSRFADFLRSHSRTLEEDVIFTQMRA  154

Query  694   EADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP-----LQNGAVTSKG--VLL  536
               D     R+ LF+K +TPSDVGKLNRLVIPK+ A K+FP     ++  A   K   V L
Sbjct  155   GTDGWMMCRQ-LFQKELTPSDVGKLNRLVIPKKYAVKYFPQISERVEEHAENDKADDVQL  213

Query  535   NFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR------STGPEK  374
             +F D + K+W+FRY YW SSQS+V T+GW+RFVKE  LKA D + F+       + G + 
Sbjct  214   DFHDKSMKLWKFRYCYWKSSQSFVFTRGWNRFVKENQLKANDTICFYLCELRDIAKGTKT  273

Query  373   QLFIDW-KARNGTGSPDIS  320
                ID  K  NG  S ++S
Sbjct  274   FCMIDANKGENGGASAEVS  292



>ref|XP_004497481.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g50680-like [Cicer arietinum]
Length=303

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 158/287 (55%), Gaps = 32/287 (11%)
 Frame = -3

Query  1072  EAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGR  893
             E E GR     +FKGVVPQPNG WGAQIY KHQR+WLGTF  E EAA  YD A  + R  
Sbjct  31    EVEVGR---CEKFKGVVPQPNGNWGAQIYAKHQRIWLGTFKSEIEAAMAYDSATIKLRSG  87

Query  892   DAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTY----TDELEQSRRAFN  725
             ++  NF   ++T          E +F S +S   +++M+R  TY    +  L    ++  
Sbjct  88    ESHRNFPWNNQTVQ--------EPLFQSHYSLQIVLNMIRNGTYQSIFSTFLNTQNQSHF  139

Query  724   INNMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP------LQNG  563
              NN     K E + S     +LF+K +TPSDVGKLNRLVIPK+ A  +FP      ++N 
Sbjct  140   TNNGNLGVKGEEEFSCT---KLFQKELTPSDVGKLNRLVIPKKHALTYFPCVCGNNVKND  196

Query  562   AVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHR---  392
                +  V + F D   ++W+FRY YW SSQSYV T+GW+RFVK+K L A D + F+    
Sbjct  197   EECNYDVEVAFYDKLMRLWKFRYCYWKSSQSYVFTRGWNRFVKDKKLNAKDTIVFYLCEP  256

Query  391   ---STGPEKQLF--IDWKARNGTGSPDISTVPVHPVQVFRLFGVNIS  266
                + G E+Q+F  ID    N        ++     +  RLFGV+I+
Sbjct  257   INFTKGGERQVFSMIDVIYNNDGDRILRHSIENKRARGLRLFGVSIN  303



>ref|XP_006473975.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g51120-like [Citrus sinensis]
 gb|KDO59411.1| hypothetical protein CISIN_1g018549mg [Citrus sinensis]
Length=354

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 137/227 (60%), Gaps = 20/227 (9%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             S+FKGVVPQ NG WGAQIY  HQR+WLGTF  E++AA  YD AA R RG D+  NF P +
Sbjct  43    SKFKGVVPQQNGHWGAQIYANHQRIWLGTFKSEKDAAMAYDSAAIRLRGVDSHRNF-PWT  101

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYT----DELEQSRRAFNINNMTTPRKP  695
             + T         E  F S +S   +++M+R  +Y+    D L    R    + + T  + 
Sbjct  102   KITIE-------EPNFQSHYSTEAVINMIRDGSYSSRFADFLRSHSRTLEEDVIFTQMRA  154

Query  694   EADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFP-----LQNGAVTSKG--VLL  536
               D     R+ LF+K +TPSDVGKLNRLVIPK+ A K+FP     ++  A   K   V L
Sbjct  155   GTDGWMMCRQ-LFQKELTPSDVGKLNRLVIPKKYAVKYFPQISERVEEHAENDKADDVQL  213

Query  535   NFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
              F D + K+W+FRY YW SSQS+V T+GW+RFVKE  LKA D + F+
Sbjct  214   VFHDKSMKLWKFRYCYWKSSQSFVFTRGWNRFVKENQLKANDTICFY  260



>ref|XP_007030917.1| AP2 domain-containing transcription factor, putative isoform 
2 [Theobroma cacao]
 gb|EOY11419.1| AP2 domain-containing transcription factor, putative isoform 
2 [Theobroma cacao]
Length=339

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 147/238 (62%), Gaps = 18/238 (8%)
 Frame = -3

Query  1063  SGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAV  884
             SG    SSRFKGV+ Q NG+WGAQ+Y  H R+WLGTF  E +AA  YD AA +FR  D  
Sbjct  36    SGSNGTSSRFKGVIRQKNGQWGAQLYANHTRIWLGTFKSETDAAMAYDSAAIKFRTGDTH  95

Query  883   TNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR----KHTYTDELEQSRRAFNIN-  719
              NF PL++ T         E  F S++S   ++ M+R    ++ + D L+ S R   +  
Sbjct  96    RNF-PLTDITVE-------EPKFQSNYSAEAVLSMIRDGSYQYKFMDFLKNSFRNGKVEI  147

Query  718   NMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG--  545
             ++ + RK        S ++LF+K +TPSDVGKLNRLVIPK+ A K FP   G+  SKG  
Sbjct  148   DLNSVRKYSG--KGLSCKQLFQKELTPSDVGKLNRLVIPKKYAVKFFPPIEGS-GSKGSD  204

Query  544   VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQ  371
               L F D   ++W+FRY YWNSSQS+V T+GW+RF+KEK LKA D++SF+     ++Q
Sbjct  205   AELIFYDKFMRLWKFRYCYWNSSQSFVFTRGWNRFLKEKELKANDVISFYVCESRKEQ  262



>emb|CBI27062.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 113/154 (73%), Gaps = 11/154 (7%)
 Frame = -3

Query  583  HFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIV  404
            H  ++ G  TSKGVLLNFED  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEK+LKAGDIV
Sbjct  86   HDSIRTGT-TSKGVLLNFEDMGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIV  144

Query  403  SFHRSTGPEKQLFIDWKARNGTGSPDISTVPVHPVQVFRLFGVNISKSTVSPMAMAMDTT  224
            SF RSTG +KQL+IDWKARNG   P     PV PV++ RLFGVNI K    P+  ++   
Sbjct  145  SFQRSTGGDKQLYIDWKARNG---PTNQINPVEPVEMVRLFGVNIFK---VPVNSSVVVA  198

Query  223  NNISSCSGGKRIREVVMEFLPLECSKKQRVIDAL  122
            NN S    GKR+ E  ME L  ECSKKQRVI A+
Sbjct  199  NNGSWT--GKRMIE--MELLSFECSKKQRVIGAV  228



>ref|XP_011025403.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g50680-like [Populus euphratica]
Length=369

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 140/239 (59%), Gaps = 25/239 (10%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             ++FKG+VPQ NG WGAQIY  HQR+WLGTF  E+EAA  YD AA + R  D+  NF P +
Sbjct  43    AKFKGIVPQKNGHWGAQIYSNHQRIWLGTFKTEKEAAMAYDSAAIKLRSTDSHRNF-PWN  101

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTD-----ELEQSRRAFNINNMTTP--  704
             +    RN     E  F + +S  EI++M+R  +Y        ++QS+R   I     P  
Sbjct  102   D----RNVQ---EPSFQNQYSTEEILNMIRDGSYQQIFVDFIMKQSQRE-EIGGSDDPNG  153

Query  703   RKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVL-----  539
             R+  AD    S  +LF+K +TPSDVGKLNRLVIPK+ A K+FP     V    VL     
Sbjct  154   RRVHADDEQLSCTQLFQKDLTPSDVGKLNRLVIPKKFAVKYFPYIFKDVEDDRVLNTAGV  213

Query  538   ----LNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEK  374
                 L F D   K W+FRY YW SSQS+V TKGW+RFVKEK LK  DI+ F+    P K
Sbjct  214   DDTELIFYDRFMKSWKFRYCYWRSSQSFVFTKGWNRFVKEKKLKEKDIIVFYTCACPNK  272



>gb|AFD22858.1| AP2 domain-containing transcription factor, partial [Tamarix 
androssowii]
Length=219

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 130/222 (59%), Gaps = 60/222 (27%)
 Frame = -3

Query  637  SDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLT  458
            SDVGKLNRLVIPKQ AEKHFPL  G+ T KGVLLNFED N KVWRFRYSYWNSSQSYVLT
Sbjct  1    SDVGKLNRLVIPKQHAEKHFPLMAGS-TLKGVLLNFEDGNDKVWRFRYSYWNSSQSYVLT  59

Query  457  KGWSRFVKEKSLKAGDIVSFHRSTGPEKQLFIDWKAR-----------------------  347
            KGWSRFVKEK+LKAGD+VSFHRST PEKQL+IDW+A                        
Sbjct  60   KGWSRFVKEKNLKAGDVVSFHRSTLPEKQLYIDWRAAAAAADNNNNNNNNKSNITSNTIN  119

Query  346  -NGTGSPDI-STVPVHPVQ----------VFRLFGVNIS-------KSTVSPMAMAMDTT  224
             NG   P + S+  V P+Q          +FRLFGVNI              + +A +  
Sbjct  120  VNGGLMPVVGSSGLVIPIQSLPTNNIVAPMFRLFGVNICSSSSSGSSGVGGGLEIAAEKV  179

Query  223  NNISSCSGG-----------KRIREVVMEFLPLECSKKQRVI  131
             N    SGG           KR+RE  ME   LE S K+R++
Sbjct  180  GN----SGGTPSGPAAGGGGKRLRE--MELFSLESSCKKRMV  215



>gb|KGN66438.1| hypothetical protein Csa_1G605670 [Cucumis sativus]
Length=745

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 137/222 (62%), Gaps = 15/222 (7%)
 Frame = -3

Query  1039  RFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLSE  860
             +FKGVVPQ NGRWGAQIY  HQR+WLGTF  E++AA  YD A+ + R RD+  NF     
Sbjct  52    KFKGVVPQQNGRWGAQIYANHQRIWLGTFKTEKDAAMAYDSASIKLRTRDSHRNFPWTRR  111

Query  859   TTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELE---QSRRAFNINNMTTPRKPEA  689
             T +  N        F    S   ++ M++  +Y  +     ++R   +  N+  P+K + 
Sbjct  112   TIEEPN--------FQIKFSTDAVLSMIKDGSYYSKFSAYLRTRSQIHDTNIQNPKKIDN  163

Query  688   --DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG--VLLNFEDT  521
                 S  S   LF+K +TPSDVGKLNRLVIPK+ A KHFP  + +    G  + + F DT
Sbjct  164   GDGDSLFSCSHLFQKELTPSDVGKLNRLVIPKKYAVKHFPYISESAEENGDDIEIVFYDT  223

Query  520   NGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
             + K+W+FRY YW SSQS+V T+GW+RFVKEK LKA DI++F+
Sbjct  224   SMKIWKFRYCYWRSSQSFVFTRGWNRFVKEKKLKANDIITFY  265



>ref|XP_011015305.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g50680-like [Populus euphratica]
Length=369

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 140/239 (59%), Gaps = 25/239 (10%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             ++FKG+VPQ NG WGAQIY  HQR+WLGTF  E+EAA  YD AA + R  D+  NF P +
Sbjct  43    AKFKGIVPQKNGHWGAQIYSNHQRIWLGTFKTEKEAAMAYDSAAIKLRSTDSHRNF-PWN  101

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTD-----ELEQSRRAFNINNMTTP--  704
             +    RN     E  F + +S  EI++M+R  +Y        ++QS+R   I     P  
Sbjct  102   D----RNVQ---EPSFQNQYSTEEILNMIRDGSYQQIFVDFIMKQSQRE-EIGGSDDPNG  153

Query  703   RKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVL-----  539
             R+  AD    S  +LF+K +TPSDVGKLNRLVIPK+ A K+FP     V    VL     
Sbjct  154   RRVHADDEQLSCTQLFQKDLTPSDVGKLNRLVIPKKFAVKYFPYIFKDVEDDRVLNTAGV  213

Query  538   ----LNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEK  374
                 L F D   K W+FRY YW SSQS+V TKGW+RFVKEK LK  DI+ F+    P K
Sbjct  214   DDTELIFYDRFMKSWKFRYCYWRSSQSFVFTKGWNRFVKEKKLKEKDIIIFYTCACPNK  272



>ref|XP_007030916.1| AP2/B3 transcription factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY11418.1| AP2/B3 transcription factor family protein, putative isoform 
1 [Theobroma cacao]
Length=435

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 147/238 (62%), Gaps = 18/238 (8%)
 Frame = -3

Query  1063  SGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAV  884
             SG    SSRFKGV+ Q NG+WGAQ+Y  H R+WLGTF  E +AA  YD AA +FR  D  
Sbjct  132   SGSNGTSSRFKGVIRQKNGQWGAQLYANHTRIWLGTFKSETDAAMAYDSAAIKFRTGDTH  191

Query  883   TNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLR----KHTYTDELEQSRRAFNIN-  719
              NF PL++ T         E  F S++S   ++ M+R    ++ + D L+ S R   +  
Sbjct  192   RNF-PLTDITVE-------EPKFQSNYSAEAVLSMIRDGSYQYKFMDFLKNSFRNGKVEI  243

Query  718   NMTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKG--  545
             ++ + RK        S ++LF+K +TPSDVGKLNRLVIPK+ A K FP   G+  SKG  
Sbjct  244   DLNSVRKYSG--KGLSCKQLFQKELTPSDVGKLNRLVIPKKYAVKFFPPIEGS-GSKGSD  300

Query  544   VLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQ  371
               L F D   ++W+FRY YWNSSQS+V T+GW+RF+KEK LKA D++SF+     ++Q
Sbjct  301   AELIFYDKFMRLWKFRYCYWNSSQSFVFTRGWNRFLKEKELKANDVISFYVCESRKEQ  358



>ref|XP_006445925.1| hypothetical protein CICLE_v10017535mg [Citrus clementina]
 gb|ESR59165.1| hypothetical protein CICLE_v10017535mg [Citrus clementina]
Length=332

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 141/236 (60%), Gaps = 24/236 (10%)
 Frame = -3

Query  1060  GRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVT  881
             G+ +   +FKGVVPQ NG WGAQIY  HQR+WLGTF  E EAA  YD AA + RG D+  
Sbjct  41    GKNVSLVKFKGVVPQQNGHWGAQIYANHQRIWLGTFKSEREAAMAYDSAAIKIRGGDSHR  100

Query  880   NFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTY----TDELE-QSRRAFNINN  716
             NF P ++T       ++ E  F + +S   +++M+R  TY     D L  QS+R  N +N
Sbjct  101   NF-PWTDT-------NNQEPNFQNQYSTEAVLNMIRDGTYQPKFADYLRVQSQREDNNSN  152

Query  715   MTTPRKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPL---------QNG  563
              +  +         +  +LF+K +TPSDVGKLNRLVIPK+ A K+FP           NG
Sbjct  153   ASLNQIMVHGDEQFAYRQLFQKELTPSDVGKLNRLVIPKKYAVKYFPFISENAEENAING  212

Query  562   AVTSKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
              V    + L F D   + W+FRY +W SSQSYV T+GW+RFVKEK LK  DI++F+
Sbjct  213   GVDD--MELVFFDKLMRPWKFRYCFWRSSQSYVFTRGWNRFVKEKKLKEKDIITFY  266



>ref|XP_008443869.1| PREDICTED: AP2/ERF and B3 domain-containing transcription factor 
At1g50680-like [Cucumis melo]
Length=338

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 141/240 (59%), Gaps = 21/240 (9%)
 Frame = -3

Query  1081  NGVEAESGRKLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRF  902
             NG  +  GR L +S+FKGVVPQ NG WGAQIY  HQR+WLGTF  E EAA  YD AA R 
Sbjct  33    NGC-SRQGRSL-TSKFKGVVPQQNGHWGAQIYANHQRIWLGTFKSENEAAMAYDSAAIRI  90

Query  901   RGRDAVTNFKPLSETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTDELEQSRRAFNI  722
             R  D   NF     T +  N        F   ++   +++M++  +Y  +  +  R  + 
Sbjct  91    RSGDCHRNFPWTKFTIEEPN--------FQKLYTTETLLNMIKDGSYRTKFSEYLRDCSE  142

Query  721   NNMT--TPRKPEA-DRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVT-  554
             +  T  +P   +A +    S ++LF+K +TPSDVGKLNRLVIPK+ A K+FP  + + T 
Sbjct  143   STQTSVSPSTEKAHNNGGTSIKQLFQKELTPSDVGKLNRLVIPKKYAVKYFPQISASTTE  202

Query  553   -------SKGVLLNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFH  395
                     + V L F D   + W+FRY YW SSQSYV T+GW+RFVKEK LKA D ++F+
Sbjct  203   NVEPVDDDRDVQLVFFDKMMRQWKFRYCYWKSSQSYVFTRGWNRFVKEKQLKANDTIAFY  262



>ref|XP_002304025.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|EEE79004.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=369

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 141/241 (59%), Gaps = 25/241 (10%)
 Frame = -3

Query  1042  SRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARVYDIAAQRFRGRDAVTNFKPLS  863
             ++FKG+VPQ NG WGAQIY  HQR+WLGTF  E+EAA  YD AA + R  D+  NF P +
Sbjct  43    AKFKGIVPQKNGHWGAQIYSNHQRIWLGTFKTEKEAAMAYDSAAIKLRSTDSHRNF-PWN  101

Query  862   ETTDGRNGDDDYEAVFLSSHSKAEIVDMLRKHTYTD-----ELEQSRRAFNINNMTTP--  704
             +    RN     E  F + +S  EI++M+R  +Y        ++QS+R   I     P  
Sbjct  102   D----RNVQ---EPSFQNQYSTEEILNMIRDGSYQQIFVDFIMKQSQRE-EIGGSDDPNG  153

Query  703   RKPEADRSAKSRERLFEKAVTPSDVGKLNRLVIPKQQAEKHFPLQNGAVTSKGVL-----  539
             R+  AD    S  +LF+K +TPSDVGKLNRLVIPK+ A K+FP     V    VL     
Sbjct  154   RRVHADDEQFSCIQLFQKDLTPSDVGKLNRLVIPKKFAVKYFPNIFKDVEDDRVLNAAGV  213

Query  538   ----LNFEDTNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFHRSTGPEKQ  371
                 L F D   K W+FRY YW SSQS+V TKGW+RFVKEK LK  DI+ F+    P K 
Sbjct  214   DDTELIFYDRFMKSWKFRYCYWRSSQSFVFTKGWNRFVKEKKLKEKDIIIFYTCACPNKV  273

Query  370   L  368
             L
Sbjct  274   L  274



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273381520216