BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29489_g1_i1 len=1197 path=[1175:0-1196]

Length=1197
                                                                      Score     E

ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   499   8e-174   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  497   5e-173   
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   495   2e-172   
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   495   2e-172   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  494   4e-172   
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         489   4e-170   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              489   6e-170   
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               488   2e-169   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        486   8e-169   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        485   2e-168   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             483   2e-167   
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                482   3e-167   Populus trichocarpa x Populus deltoides
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         482   3e-167   Ricinus communis
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         482   3e-167   
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             481   8e-167   
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   481   1e-166   
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             481   1e-166   
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         480   2e-166   Ricinus communis
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   480   2e-166   
gb|ACX37450.1|  plasma membrane intrinsic protein                       479   4e-166   Hevea brasiliensis [jebe]
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               479   4e-166   
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   479   5e-166   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   479   5e-166   
gb|AEQ20672.1|  PIP2;1                                                  479   6e-166   
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   478   2e-165   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             478   2e-165   Populus trichocarpa [western balsam poplar]
gb|AFH36337.1|  aquaporin PIP2;2                                        477   2e-165   
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   477   4e-165   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               475   1e-164   
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          475   2e-164   
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   475   3e-164   
emb|CAH60724.1|  putative plasma membrane intrinsic protein             474   4e-164   Populus tremula x Populus tremuloides
gb|AAO39007.1|  plasma intrinsic protein 2,1                            474   7e-164   Juglans regia
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                473   9e-164   
gb|AAO39008.1|  plasma intrinsic protein 2,2                            473   1e-163   Juglans regia
gb|AIA83104.1|  putative aquaporin PIP2                                 473   1e-163   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               473   2e-163   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               473   2e-163   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   471   4e-163   
gb|AAW80918.1|  putative plasma membrane intrinsic protein              471   4e-163   Astragalus penduliflorus
gb|AIA83106.1|  putative aquaporin PIP2                                 472   4e-163   
gb|AAB18227.1|  MipC                                                    471   5e-163   Mesembryanthemum crystallinum
gb|ABK60195.2|  PIP2 protein                                            471   7e-163   Gossypium hirsutum [American cotton]
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   470   1e-162   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    470   1e-162   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  471   1e-162   Mimosa pudica [sensitive-plant]
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    470   1e-162   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             470   2e-162   
emb|CDP06739.1|  unnamed protein product                                470   2e-162   
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          469   3e-162   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   469   4e-162   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             468   7e-162   
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   469   7e-162   
gb|ABB88840.1|  aquaporin                                               468   9e-162   Stevia rebaudiana
gb|AAC17529.1|  aquaporin 2                                             468   1e-161   Samanea saman [cow-tamarind]
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        468   1e-161   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        468   1e-161   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              467   2e-161   
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             467   2e-161   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        467   2e-161   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             467   2e-161   
gb|AEQ29857.1|  aquaporin PIP2                                          467   2e-161   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   467   3e-161   
gb|AEY75242.1|  plasma membrane intrinsic protein                       467   3e-161   
gb|ACU87558.1|  PIP protein                                             467   3e-161   
ref|XP_010098191.1|  Aquaporin PIP2-7                                   466   4e-161   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   466   5e-161   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                466   6e-161   
gb|KHG08488.1|  putative aquaporin PIP2-2                               466   7e-161   
ref|NP_001268056.1|  aquaporin PIP2                                     466   7e-161   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   465   1e-160   
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               466   1e-160   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         465   1e-160   
gb|AIG92831.1|  aquaporin PIP2                                          465   2e-160   
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   465   2e-160   
gb|ACZ06859.1|  plasma membrane intrinsic protein                       465   2e-160   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     468   2e-160   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               464   3e-160   
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              464   3e-160   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   464   4e-160   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        464   4e-160   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   464   5e-160   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                464   5e-160   Populus trichocarpa x Populus deltoides
gb|KHG00060.1|  putative aquaporin PIP2-2                               464   6e-160   
ref|NP_001240039.1|  uncharacterized protein LOC100782155               464   6e-160   
gb|KHN00691.1|  Aquaporin PIP2-2                                        463   6e-160   
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   463   7e-160   
gb|ACU24483.1|  unknown                                                 463   7e-160   Glycine max [soybeans]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              463   8e-160   
ref|XP_002322877.1|  major intrinsic protein 1                          463   9e-160   Populus trichocarpa [western balsam poplar]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             463   9e-160   
ref|NP_001240223.1|  prolactin-inducible protein                        463   1e-159   
gb|ABU94631.1|  putative aquaporin PIP2;3                               463   1e-159   Phaseolus vulgaris [French bean]
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               462   2e-159   
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               462   2e-159   
gb|ACU20229.1|  unknown                                                 462   2e-159   Glycine max [soybeans]
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               462   2e-159   
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  462   2e-159   Pyrus communis
gb|AGD98708.1|  aquaporin protein 5                                     462   3e-159   
gb|KHN05685.1|  Aquaporin PIP2-7                                        462   3e-159   
gb|ADK25057.1|  plasma membrane intrinsic protein                       462   3e-159   
gb|AHA84284.1|  prolactin-inducible protein                             462   3e-159   
gb|KHN38765.1|  Aquaporin PIP2-7                                        462   3e-159   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     464   4e-159   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             461   4e-159   
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        461   5e-159   
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  461   7e-159   Pyrus communis
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             461   7e-159   
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   461   7e-159   
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   461   7e-159   
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        461   7e-159   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        461   8e-159   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               460   9e-159   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               461   9e-159   
gb|ABB13430.2|  plasma membrane intrinsic protein                       461   1e-158   Olea europaea
gb|AGD98714.1|  aquaporin protein 11                                    460   1e-158   
gb|ACG33001.1|  aquaporin PIP2.2                                        460   2e-158   Zea mays [maize]
gb|AHB33479.1|  plasma intrinsic protein 2-3                            460   2e-158   
ref|NP_001105026.1|  aquaporin PIP2-4                                   460   2e-158   Zea mays [maize]
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   459   2e-158   
ref|NP_001268058.1|  aquaporin-like                                     459   3e-158   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   459   3e-158   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   459   3e-158   
gb|ADJ67992.1|  aquaporin                                               459   4e-158   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         459   4e-158   
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               459   4e-158   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          459   4e-158   Sorghum bicolor [broomcorn]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         458   6e-158   
gb|ABH09326.1|  putative aquaporin                                      458   6e-158   Vitis vinifera
gb|AAV80229.1|  aquaporin 2                                             458   8e-158   Aegiceras corniculatum
gb|EAY86778.1|  hypothetical protein OsI_08158                          458   8e-158   Oryza sativa Indica Group [Indian rice]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             458   8e-158   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              458   8e-158   Populus trichocarpa [western balsam poplar]
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   458   9e-158   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   458   9e-158   
gb|AIK66515.1|  putative aquaporin                                      458   1e-157   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             458   1e-157   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               457   1e-157   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               457   1e-157   
gb|AGG39693.1|  aquaporin protein AQU15                                 457   1e-157   
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               457   1e-157   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  459   2e-157   
gb|AAV69744.1|  aquaporin                                               457   2e-157   Vitis vinifera
ref|NP_001267922.1|  aquaporin-like                                     457   2e-157   
ref|NP_001047491.1|  Os02g0629200                                       457   2e-157   Oryza sativa Japonica Group [Japonica rice]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     457   2e-157   Vitis vinifera
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             457   2e-157   
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             457   2e-157   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         457   3e-157   Ricinus communis
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     456   3e-157   Vitis cinerea var. helleri x Vitis rupestris
gb|ABK60196.1|  PIP2 protein                                            457   3e-157   Gossypium hirsutum [American cotton]
ref|XP_004307390.1|  PREDICTED: probable aquaporin PIP2-5-like          456   3e-157   
gb|KHG29841.1|  putative aquaporin PIP2-2                               457   4e-157   
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               456   4e-157   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            456   4e-157   Juglans regia
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               456   4e-157   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        456   5e-157   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               456   5e-157   
gb|ABC69040.1|  aquaporin PIP2-1                                        456   6e-157   Rhododendron catawbiense [Catawba rosebay]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   456   7e-157   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   456   7e-157   
gb|AEY75244.1|  plasma membrane intrinsic protein                       456   7e-157   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   456   7e-157   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               456   8e-157   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    456   9e-157   Mesembryanthemum crystallinum
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        456   1e-156   Petunia x hybrida [garden petunia]
dbj|BAG06231.1|  plasma membrane intrinsic protein                      455   1e-156   Hordeum vulgare [barley]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               455   1e-156   
gb|AEO13898.1|  aquaporin 7                                             455   1e-156   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          455   2e-156   Sorghum bicolor [broomcorn]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    455   2e-156   
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   455   2e-156   
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          454   2e-156   
gb|ABO69705.2|  aquaporin PIP2                                          454   2e-156   Prunus humilis
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                454   2e-156   
gb|AGD98707.1|  aquaporin protein 4                                     454   2e-156   
ref|NP_001280185.1|  aquaporin PIP2-2                                   454   3e-156   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   454   4e-156   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        454   4e-156   
gb|AAY22203.1|  putative aquaporin                                      454   5e-156   Phaseolus vulgaris [French bean]
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   453   5e-156   
gb|AFK47400.1|  unknown                                                 453   8e-156   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               453   8e-156   
gb|AFK47442.1|  unknown                                                 453   8e-156   
ref|NP_001105025.1|  aquaporin PIP2-3                                   453   8e-156   Zea mays [maize]
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               453   9e-156   
gb|ABX83874.1|  plasma membrane intrinsic protein                       453   1e-155   Rhododendron catawbiense [Catawba rosebay]
ref|XP_003625627.1|  Aquaporin PIP2-1                                   453   1e-155   
gb|AFH36338.1|  aquaporin PIP2;3                                        453   1e-155   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              452   1e-155   
dbj|BAE02729.1|  PIP aquaporin                                          452   1e-155   Hordeum vulgare [barley]
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   452   1e-155   
emb|CAC82712.1|  major intrinsic protein 1                              452   1e-155   Populus tremula x Populus tremuloides
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        452   2e-155   
gb|AFQ23186.1|  aquaporin PIP2;1                                        452   2e-155   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   452   2e-155   
gb|AFK33316.1|  unknown                                                 452   2e-155   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 452   2e-155   
ref|NP_001235204.1|  Pip1 protein                                       452   2e-155   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     452   3e-155   
ref|XP_002316367.1|  putative aquaporin family protein                  451   4e-155   Populus trichocarpa [western balsam poplar]
emb|CDY56697.1|  BnaCnng31040D                                          451   4e-155   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   451   4e-155   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       451   5e-155   Raphanus sativus
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               451   6e-155   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               451   7e-155   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             451   8e-155   
dbj|BAA23744.1|  HvPIP2;1                                               451   9e-155   Hordeum vulgare [barley]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   451   9e-155   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   450   1e-154   
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                450   1e-154   
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        450   2e-154   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             449   2e-154   
gb|AHG32323.1|  PIP2-2                                                  449   2e-154   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   449   2e-154   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        449   2e-154   
ref|NP_001105639.1|  aquaporin PIP2-7                                   449   3e-154   Zea mays [maize]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           449   4e-154   Raphanus sativus
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   449   4e-154   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        449   4e-154   
gb|ABK93567.1|  unknown                                                 448   5e-154   Populus trichocarpa [western balsam poplar]
ref|NP_001274397.1|  aquaporin PIP2-1-like                              448   5e-154   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   448   7e-154   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             448   7e-154   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          448   9e-154   
gb|ABH09328.1|  putative aquaporin                                      448   9e-154   Vitis vinifera
ref|NP_001105616.1|  aquaporin PIP2-5                                   447   1e-153   Zea mays [maize]
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               447   1e-153   
emb|CDX91340.1|  BnaC04g08100D                                          447   1e-153   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   447   1e-153   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           447   1e-153   Raphanus sativus
ref|NP_001237286.1|  PIP2,2                                             447   1e-153   
emb|CDY46759.1|  BnaA03g17030D                                          447   1e-153   
gb|ACJ85173.1|  unknown                                                 447   1e-153   Medicago truncatula
dbj|BAG68661.1|  plasma membrane intrinsic protein                      447   2e-153   Tulipa gesneriana
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             447   2e-153   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   447   2e-153   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             447   2e-153   Populus tremula x Populus tremuloides
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             447   2e-153   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        447   2e-153   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                   446   3e-153   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             447   3e-153   
gb|AAG44947.1|AF290620_1  putative PIP2                                 446   3e-153   Nicotiana glauca [glaucous tobacco]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   446   3e-153   
gb|AEC45513.1|  plasma membrane intrinsic protein                       446   3e-153   
ref|XP_003606383.1|  Aquaporin PIP2-7                                   446   3e-153   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          446   4e-153   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        446   5e-153   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   446   6e-153   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               446   6e-153   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   446   6e-153   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             446   7e-153   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               445   7e-153   
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   444   8e-153   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          446   8e-153   
ref|NP_200874.1|  putative aquaporin PIP2-4                             446   8e-153   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19125.1|  unknown                                                 446   8e-153   Glycine max [soybeans]
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             445   9e-153   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   445   1e-152   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   445   1e-152   
ref|NP_001234625.1|  aquaporin                                          445   1e-152   
ref|NP_181254.1|  aquaporin PIP2-2                                      445   1e-152   Arabidopsis thaliana [mouse-ear cress]
gb|ACU21481.1|  unknown                                                 445   1e-152   Glycine max [soybeans]
emb|CDX91341.1|  BnaC04g08090D                                          445   1e-152   
ref|NP_001105024.1|  aquaporin PIP2-1                                   445   1e-152   Zea mays [maize]
emb|CDY13298.1|  BnaC06g14590D                                          445   1e-152   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   445   2e-152   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    444   2e-152   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 444   2e-152   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   444   2e-152   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   444   2e-152   
ref|NP_190910.1|  aquaporin PIP2-1                                      444   2e-152   Arabidopsis thaliana [mouse-ear cress]
gb|AHG32324.1|  PIP2-3                                                  444   2e-152   
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   443   3e-152   
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          444   3e-152   Sorghum bicolor [broomcorn]
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               444   3e-152   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   443   5e-152   
gb|AAO86707.1|  aquaporin                                               444   5e-152   Zea mays [maize]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        443   7e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             443   8e-152   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        443   9e-152   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   443   9e-152   
ref|NP_001105638.1|  aquaporin PIP2-2                                   443   1e-151   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        442   1e-151   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    442   1e-151   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             442   2e-151   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             442   2e-151   
gb|ABU94630.1|  putative aquaporin PIP2;2                               442   2e-151   
gb|ACF79873.1|  unknown                                                 442   2e-151   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    441   3e-151   
ref|NP_181255.1|  aquaporin PIP2-3                                      441   3e-151   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        441   3e-151   
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   441   3e-151   
gb|AAL32127.1|  aquaporin                                               441   3e-151   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             441   6e-151   
ref|NP_001275065.1|  major intrinsic protein 2                          441   7e-151   
gb|ACG39551.1|  aquaporin PIP2.1                                        441   8e-151   
gb|EPS68613.1|  hypothetical protein M569_06155                         440   1e-150   
emb|CDP07111.1|  unnamed protein product                                440   1e-150   
gb|ACG32567.1|  aquaporin PIP2.1                                        440   1e-150   
ref|NP_001059545.1|  Os07g0448800                                       440   1e-150   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    439   2e-150   
ref|NP_191042.1|  putative aquaporin PIP2-5                             439   2e-150   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   439   2e-150   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                439   2e-150   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          439   2e-150   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   439   3e-150   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   439   3e-150   
gb|ACM50914.1|  aquaporin                                               439   3e-150   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   439   4e-150   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  438   4e-150   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             439   4e-150   
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               439   5e-150   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               438   7e-150   
gb|EMT09900.1|  Putative aquaporin PIP2-2                               439   9e-150   
emb|CDX67611.1|  BnaA07g16510D                                          438   9e-150   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  437   1e-149   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             437   1e-149   
emb|CDY07519.1|  BnaC06g15450D                                          437   2e-149   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               437   2e-149   
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   437   2e-149   
dbj|BAF33069.1|  aquaporin                                              437   2e-149   
gb|EMS51072.1|  Aquaporin PIP2-5                                        437   2e-149   
dbj|BAE06148.1|  PIP aquaporin isoform                                  437   2e-149   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        445   4e-149   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               436   4e-149   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               436   4e-149   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 436   6e-149   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               435   8e-149   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    435   8e-149   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          435   1e-148   
ref|NP_001289999.1|  aquaporin PIP2-1                                   435   1e-148   
gb|ABN11917.1|  aquaporin                                               435   1e-148   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                434   2e-148   
emb|CDX73446.1|  BnaC08g25570D                                          434   3e-148   
gb|AAC16545.1|  aquaporin                                               434   4e-148   
gb|ADG03686.1|  aquaporin                                               434   4e-148   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  433   5e-148   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          433   5e-148   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          433   5e-148   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          433   7e-148   
ref|NP_001059542.1|  Os07g0448100                                       433   8e-148   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   432   9e-148   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             432   1e-147   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                433   1e-147   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   432   2e-147   
emb|CDX74984.1|  BnaA05g07300D                                          433   2e-147   
ref|NP_001053335.1|  Os04g0521100                                       432   2e-147   
gb|ABI96814.1|  plasma membrane intrinsic protein                       432   3e-147   
emb|CAB46351.1|  major intrinsic protein 2                              431   3e-147   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               431   3e-147   
emb|CDY14415.1|  BnaC03g21800D                                          431   4e-147   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               431   5e-147   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        430   7e-147   
gb|ABI96813.1|  plasma membrane intrinsic protein                       431   8e-147   
gb|AGD98712.1|  aquaporin protein 9                                     430   9e-147   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          430   1e-146   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    430   1e-146   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          429   3e-146   
gb|AGD98705.1|  aquaporin                                               429   3e-146   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          429   3e-146   
ref|NP_001105027.1|  aquaporin PIP2-6                                   429   4e-146   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        428   5e-146   
ref|NP_001267957.1|  aquaporin PIP2;2                                   428   6e-146   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       427   9e-146   
emb|CDY31523.1|  BnaA10g13480D                                          426   9e-146   
gb|ABH09327.1|  putative aquaporin                                      427   9e-146   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          427   1e-145   
ref|XP_009345758.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        427   2e-145   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     426   2e-145   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             426   3e-145   
emb|CDX88767.1|  BnaA03g08820D                                          425   3e-145   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             426   3e-145   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          426   4e-145   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  426   4e-145   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          426   5e-145   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         425   5e-145   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               426   7e-145   
emb|CDX71032.1|  BnaC03g11160D                                          424   8e-145   
gb|ACB87734.1|  aquaporin                                               424   1e-144   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   424   1e-144   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               424   2e-144   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       424   2e-144   
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    424   3e-144   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   423   4e-144   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             423   4e-144   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   423   4e-144   
gb|ABM54183.1|  aquaporin                                               423   4e-144   
emb|CDY09192.1|  BnaA02g06180D                                          422   4e-144   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             423   5e-144   
gb|ABK22173.1|  unknown                                                 422   1e-143   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             421   2e-143   
gb|ABK24156.1|  unknown                                                 421   2e-143   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    421   3e-143   
dbj|BAF32042.1|  putative aquaporin                                     421   3e-143   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    421   4e-143   
gb|AAC32107.1|  probable aquaporin                                      421   4e-143   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               420   4e-143   
gb|AFQ23567.1|  aquaporin PIP2;2                                        421   4e-143   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               421   4e-143   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   420   5e-143   
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             420   5e-143   
gb|ACU87555.1|  PIP protein                                             420   5e-143   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               420   9e-143   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             420   9e-143   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  419   1e-142   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               419   1e-142   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               419   1e-142   
emb|CCI55668.1|  EaPIP2,1                                               419   2e-142   
gb|ABK22146.1|  unknown                                                 419   2e-142   
dbj|BAF32141.1|  putative aquaporin                                     418   3e-142   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   419   3e-142   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   419   3e-142   
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        418   3e-142   
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             418   3e-142   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 418   3e-142   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    418   4e-142   
gb|ACB42441.1|  aquaporin PIP2;4                                        417   5e-142   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    417   5e-142   
ref|NP_179277.1|  putative aquaporin PIP2-8                             417   6e-142   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    417   8e-142   
gb|AAB65787.1|  plasma membrane intrinsic protein                       417   1e-141   
gb|ACU87556.1|  PIP protein                                             417   1e-141   
gb|ACB42440.1|  aquaporin PIP2;3                                        416   2e-141   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     416   2e-141   
ref|XP_003591905.1|  Aquaporin PIP                                      416   2e-141   
gb|AFH36336.1|  aquaporin PIP2;1                                        416   3e-141   
ref|XP_002306187.1|  membrane intrinsic family protein                  416   3e-141   
emb|CDX69112.1|  BnaC01g03410D                                          416   3e-141   
emb|CDY53629.1|  BnaC09g53920D                                          414   5e-141   
gb|AAG30607.1|AF314656_1  aquaporin                                     415   5e-141   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7-like                   415   5e-141   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               415   7e-141   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               414   1e-140   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   414   1e-140   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               414   1e-140   
gb|AAS65964.1|  aquaporin PIP 2                                         414   1e-140   
gb|KGN47819.1|  hypothetical protein Csa_6G405320                       414   1e-140   
gb|ACJ85211.1|  unknown                                                 413   1e-140   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                414   2e-140   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               414   2e-140   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               414   2e-140   
gb|ADL16407.1|  aquaporin                                               414   2e-140   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        414   2e-140   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               414   2e-140   
emb|CDX76314.1|  BnaA08g10860D                                          414   2e-140   
emb|CDY17511.1|  BnaC03g65520D                                          413   3e-140   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               412   6e-140   
gb|ABL76066.1|  aquaporin 2                                             412   8e-140   
gb|ACV66986.1|  plasma membrane aquaporin 2                             412   8e-140   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                412   1e-139   
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        412   1e-139   
ref|XP_001762521.1|  predicted protein                                  412   1e-139   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               412   1e-139   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               412   1e-139   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   412   1e-139   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   412   1e-139   
gb|ACB71281.1|  plasma membrane intrinsic protein                       412   1e-139   
gb|AFB82643.1|  aquaporin                                               412   1e-139   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        412   1e-139   
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  412   1e-139   
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        413   2e-139   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            411   2e-139   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     411   2e-139   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             411   2e-139   
ref|XP_009345757.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    412   2e-139   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        411   2e-139   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   411   2e-139   
gb|ABK23750.1|  unknown                                                 411   2e-139   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    411   2e-139   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        411   3e-139   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    411   3e-139   
ref|XP_010107654.1|  Aquaporin PIP2-7                                   410   3e-139   
gb|EEC81958.1|  hypothetical protein OsI_25844                          410   5e-139   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        410   6e-139   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       410   6e-139   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                409   9e-139   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         409   1e-138   
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    409   1e-138   
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g             409   1e-138   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               409   1e-138   
ref|XP_001753248.1|  predicted protein                                  409   2e-138   
gb|ACN40330.1|  unknown                                                 409   2e-138   
ref|XP_008449250.1|  PREDICTED: aquaporin PIP2-1-like                   409   2e-138   
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    410   2e-138   
ref|NP_001233846.1|  putative PIP-type aquaporin                        409   2e-138   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   408   3e-138   
gb|ACR56614.1|  plasma intrinsic protein 2;4                            408   3e-138   
ref|XP_004143246.1|  PREDICTED: aquaporin PIP2-2-like                   408   4e-138   
gb|ACE60220.1|  plasma membrane aquaporin                               408   4e-138   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          408   5e-138   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               407   6e-138   
gb|ABK21046.1|  unknown                                                 407   8e-138   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               407   1e-137   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      407   1e-137   
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    407   1e-137   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             407   1e-137   
ref|XP_008442677.1|  PREDICTED: probable aquaporin PIP2-4               407   1e-137   
gb|AFQ23181.1|  aquaporin PIP2;2                                        406   1e-137   
dbj|BAF63508.1|  plasma membrane intrinsic protein                      406   2e-137   



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   499 bits (1285),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 258/285 (91%), Positives = 270/285 (95%), Gaps = 1/285 (0%)
 Frame = +2

Query  77   EMGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            +M KD EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  8    QMAKDTEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  67

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQTDP   G + CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  68   YKSQTDPDHKG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  126

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRAIMYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  127  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSSGTGLGAEIIGTFV  186

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  187  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  246

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            KDKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  247  KDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  291



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   497 bits (1279),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 258/284 (91%), Positives = 270/284 (95%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ DP   G + CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAIMYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVL
Sbjct  120  LVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK
Sbjct  180  VYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  240  EKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  283



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   495 bits (1275),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/284 (90%), Positives = 270/284 (95%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ DP   G + CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAIMYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTFVL
Sbjct  120  LVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK
Sbjct  180  VYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  240  EKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  283



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   495 bits (1275),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/284 (90%), Positives = 270/284 (95%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD    G + CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDTDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAIMYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVL
Sbjct  120  LVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK
Sbjct  180  VYTVFAATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  240  EKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  283



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   494 bits (1273),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 256/285 (90%), Positives = 269/285 (94%), Gaps = 1/285 (0%)
 Frame = +2

Query  77   EMGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            +M KD EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  8    QMAKDTEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  67

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQ DP   G + CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  68   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  126

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRAIMYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTFV
Sbjct  127  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFV  186

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG
Sbjct  187  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  246

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            K+KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  247  KEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  291



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   489 bits (1260),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 256/284 (90%), Positives = 266/284 (94%), Gaps = 2/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKDVE G ++  KDY DPPPAP ID EE  QWSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDVE-GGDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTDP    +DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   KSQTDPS-KNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YM AQCLGAICGCGLVKAFQKAYY RYGGGANELADGYSKGTGLGAEIIGTFVL
Sbjct  119  LVRAILYMAAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSKGTGLGAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDDQWIFWVGPFIGAAIAAIYHQ+ILRAGA+KALGS RS +
Sbjct  239  DKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFRSTS  282



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   489 bits (1258),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 254/284 (89%), Positives = 267/284 (94%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDMEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQSS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  115

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAIMY+VAQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVL
Sbjct  116  LVRAIMYIVAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVL  175

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV+YG 
Sbjct  176  VYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYGH  235

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  236  NKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  279



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   488 bits (1255),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/285 (88%), Positives = 269/285 (94%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE-YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            MGKD+E      + +DYQDPPPAP +DPEELG+WSFYRA+IAEF+AT+LFLY+TVLTVIG
Sbjct  1    MGKDLEGAQPPLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQTDP + G+D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTMNGSD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA+MYMVAQCLGAICGCGLVKAFQ+AYY RYGGGANELADGYSKG GLGAEI+GTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVKAFQRAYYTRYGGGANELADGYSKGVGLGAEIVGTFV  179

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            KDKAWDDQW+FWVGPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  240  KDKAWDDQWMFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSNA  284



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   486 bits (1251),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 253/287 (88%), Positives = 267/287 (93%), Gaps = 3/287 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTG---TDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
             SQ      G   TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   NSQNSTDQCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRAIMY+VAQCLGAICGCGLVK+FQKAYYV+YGGGAN+L DGYS GTGLGAEIIGT
Sbjct  121  KVSLVRAIMYIVAQCLGAICGCGLVKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            F+LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI
Sbjct  181  FILVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            YG  KAW+DQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  241  YGHHKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  287



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   485 bits (1248),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/284 (89%), Positives = 266/284 (94%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ       TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   NSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  115

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAIMY+VAQCLGAICGCGLVK+FQKAYYV+YGGGAN+L DGYS GTGLGAEIIGTF+L
Sbjct  116  LVRAIMYIVAQCLGAICGCGLVKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIGTFIL  175

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG 
Sbjct  176  VYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGH  235

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KAW+DQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  236  HKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  279



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   483 bits (1242),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/284 (87%), Positives = 265/284 (93%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+S KDY DPPPAP ID EEL QWS YRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD     +DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDT-TKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICGCGLVKAFQK+YY +YGGG NELA G+SKGTGLGAEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGVNELATGFSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDD WIFWVGPFIGAAIAA+YHQ++LRA A+KALGS RS++
Sbjct  240  DKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   482 bits (1241),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 246/284 (87%), Positives = 265/284 (93%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+  KDY DPPPAP ID EEL QWS YRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD     +DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDT-TKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICGCGLVKAFQK+YY +YGGGANELA G+SKGTGLGAEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDD WIFWVGPFIGAAIAA+YHQ++LRA A+KALGS RS++
Sbjct  240  DKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   482 bits (1241),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 254/287 (89%), Positives = 265/287 (92%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            MGKDVEVG    E+  KDY DPPPAP ID EEL +WSFYRAIIAEF+ATLLFLY+TVLTV
Sbjct  1    MGKDVEVGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQTDP     DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQTDP-AKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRAIMYM AQCLGAICGCGLVKAFQ+AYY RYGGGANELADGYS GTGLGAEIIGT
Sbjct  120  KVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y K+KAWDDQWIFWVGPFIGAAIAAIYHQ++LRA A KALGS RS++
Sbjct  240  YNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRASAAKALGSFRSSS  286



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   482 bits (1241),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 252/287 (88%), Positives = 266/287 (93%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV     E+S KDY DPPPAP ID +ELGQWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQTDP+    DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKSQTDPN-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA+ YM+AQCLGAICGCGLVKAFQKAYY RYGGGANELADGY+KGTGLGAEIIGT
Sbjct  120  KVSLIRALGYMIAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y KDKAWDDQWIFWVGPF+GAAIAA YHQ+ILRA A+KALGS RSNA
Sbjct  240  YNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   481 bits (1238),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 247/284 (87%), Positives = 264/284 (93%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKDVEV  E+  KDY DPPPAP ID EEL QWS YRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDVEVRGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD     +DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDT-TKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICGCGLVKAFQK+YY +YGGGANELA G+SKGTGLGAEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDD WIFWVGPFIGAAIAA+YHQ++LRA A+KALGS RS++
Sbjct  240  DKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   481 bits (1237),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/284 (87%), Positives = 263/284 (93%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+S KDY DPPPAP ID EEL QWS YRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQIDTTKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK+YY  YGGGANELA G+SKGTGLGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDD WIFWVGPFIGAAIAA+YHQ++LRA A+KALGS RS++
Sbjct  240  DKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   481 bits (1238),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/290 (87%), Positives = 268/290 (92%), Gaps = 7/290 (2%)
 Frame = +2

Query  80   MGKDVEV------GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtv  241
            MGKDVEV      G E+S KDY DPPPAP ID EELG+WSFYRA+IAEF+ATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  242  ltvIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  421
            LTVIGYKSQTDP++  TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  61   LTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  422  LARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEI  601
            L RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGANELADGY+KGTGLGAEI
Sbjct  120  LGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEI  179

Query  602  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGA  781
            IGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA
Sbjct  180  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  239

Query  782  AVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            AVIY K+KAWDDQWIFWVGPFIGA +AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  AVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   480 bits (1236),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/288 (88%), Positives = 266/288 (92%), Gaps = 5/288 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KDVEV    G E+S KDY DPPPAP ID +ELG+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGYKSQTDP     DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  61   VIGYKSQTDPD-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA+ YMVAQCLGAICGCGLVKAFQKAYY RYGGGANELADGY+KGTGLGAEIIG
Sbjct  120  RKVSLIRALGYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY K+KAWDDQWIFWVGPFIGAAIAA YHQ+ILRA A+KALGS RSNA
Sbjct  240  IYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  287



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   480 bits (1235),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 247/284 (87%), Positives = 263/284 (93%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E++ KDY DPPPAP ID EEL QWS YRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQIDTTKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK+YY  YGGGANELA G+SKGTGLGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDD WIFWVGPFIGAAIAA+YHQ++LRA A+KALGS RS++
Sbjct  240  DKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   479 bits (1234),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 253/287 (88%), Positives = 261/287 (91%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEVG    E+  KDY DPPPAP ID EE  QWSFYRAIIAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDVEVGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQTDP     D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   IGYKSQTDP-AKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRAI+YM AQCLGAICGCGLVKAFQKAYY RYGGGANELADGYSKGTGLGAEIIGT
Sbjct  120  KVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYSKGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DKAWDDQWIFWVGPFIGAAIAA YHQ+ILRA A+KALGS RS +
Sbjct  240  YNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVKALGSFRSTS  286



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   479 bits (1233),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 265/285 (93%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE-YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            MGKD+E G   +  +DYQDPPPAP +DPEELG+WSFYRA+IAEF+AT+LFLY+TVLTVIG
Sbjct  1    MGKDMESGEPPFGARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQ DP + GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQVDPALNGTE-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA+MYMVAQCLGAICGCGLVKAFQKA Y RYGGGANEL+DGYSKG GLGAEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFV  179

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAV+Y 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYN  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            KDKAWDDQW+FWVGPFIGAAIAA Y+Q+ILRAGA+KA GS RSNA
Sbjct  240  KDKAWDDQWMFWVGPFIGAAIAAFYYQYILRAGAVKAFGSSRSNA  284



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   479 bits (1233),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 250/286 (87%), Positives = 267/286 (93%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVG-NEYS-LKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E G ++Y+  KDYQDPPPAP ID EELG+WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            +SL RA+MYM+AQCLGAICGCGLVKAFQK+YYVRYGGGANELA GYS GTGL AEIIGTF
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVRYGGGANELATGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            GKDKAWDDQWIFWVGP IGAAIAA+YHQ+ILRAGA+KALGS RSNA
Sbjct  240  GKDKAWDDQWIFWVGPLIGAAIAALYHQYILRAGAVKALGSFRSNA  285



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   479 bits (1232),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 250/285 (88%), Positives = 265/285 (93%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVG-NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            M KD+EVG  EY  KDYQDPPPAP IDPEELG+WS YRA+IAEF+ATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGTEYGAKDYQDPPPAPLIDPEELGKWSLYRAVIAEFIATLLFLYITVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQ+      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQS-----ATDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  115

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA++Y++AQCLGAI G GLVKAFQKAYYVRYGGGANELADGYS GTGL AEIIGTFV
Sbjct  116  SLVRAVLYIIAQCLGAISGVGLVKAFQKAYYVRYGGGANELADGYSTGTGLAAEIIGTFV  175

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  176  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  235

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            KDKAWDDQWIFWVGPFIGAAIAAIYHQ+ILRAGA KALGS RS++
Sbjct  236  KDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFRSSS  280



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   479 bits (1232),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 249/285 (87%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVG-NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            M KD+EVG N+Y  KDYQDPPPA   D EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGGNDYGAKDYQDPPPAELFDAEELTKWSFYRAIIAEFIATLLFLYVTVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQTDP    +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR V
Sbjct  61   YKSQTDP-ANSSDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARXV  119

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SL RA MYMVAQCLGAICGCGLVKAFQK YY +YGGGANELADGYS GTGLGAEI+GTFV
Sbjct  120  SLPRAFMYMVAQCLGAICGCGLVKAFQKTYYTKYGGGANELADGYSNGTGLGAEIVGTFV  179

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            KDKAWDDQW+FWVGP IGAAIAA YHQ++LRAGA+KALGS RSNA
Sbjct  240  KDKAWDDQWLFWVGPMIGAAIAAFYHQYVLRAGAVKALGSFRSNA  284



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   478 bits (1229),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/283 (88%), Positives = 263/283 (93%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+S KDY DPPPAP ID EE+ QWSFYRAIIAEFVATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDVNKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN LA GYSKG GLGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLGAICGCGLVKAFQKSYYTSYGGGANGLAIGYSKGNGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +KAWDD WIFWVGPFIGAAIAA+YHQFILRA A+K+LGS RS+
Sbjct  240  EKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   478 bits (1229),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 264/285 (93%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE-YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            M KD+EV     ++KDYQDPPPAP ID EELGQWSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQTDP   G DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SL+RA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANEL +GY+KGTGLGAEIIGTFV
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVKAFQKSYYNHYGGGANELQEGYNKGTGLGAEIIGTFV  179

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            + KAWDD W+FWVGPFIGAAIAA YHQFILRA A+KALGS RSNA
Sbjct  240  QSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKALGSFRSNA  284



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   477 bits (1228),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 262/286 (92%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    EYS KDY DPPPAP IDPEEL QWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP +   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDP-LKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++YMVAQCLGAICG GLVKAFQK+ Y RYGGGANELA GY+KGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKSLYTRYGGGANELAAGYNKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + KAWDD WIFWVGPF+GAAIAA YHQFILRA A+KALGS RSNA
Sbjct  240  NQSKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSNA  285



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   477 bits (1227),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/286 (87%), Positives = 267/286 (93%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVG-NEYS-LKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E G ++Y+  KDYQDPPPAP ID EELG+WSFYRAI+AEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            +SL RA+MYM+AQCLGAICGCGLVKAFQK+YYV YGGGANELA GYS GTGL AEIIGTF
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVNYGGGANELATGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            GK+KAWDDQWIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RSNA
Sbjct  240  GKEKAWDDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSNA  285



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   475 bits (1223),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 264/285 (93%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE-YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            M KD+EV     +++DYQDPPPAP ID EELGQWSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQTDP   G DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SL+RA++YMVAQCLGAICGCGLVKAFQK++Y  YGGGANEL +GY+KGTGLGAEIIGTFV
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVKAFQKSFYNHYGGGANELQEGYNKGTGLGAEIIGTFV  179

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            + KAWDD W+FWVGPFIGAAIAA YHQFILRA A+KALGS RSNA
Sbjct  240  QSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKALGSFRSNA  284



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
Length=285

 Score =   475 bits (1223),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 245/284 (86%), Positives = 260/284 (92%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVEVG E+  KDY DPPPAP +D EEL +WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDVEVGGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ DP   G+D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI YM AQCLGAICGCGLVKAFQK+YY +YGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DK WDD WIFWVGPFIGAAIAAIYHQFILRA A+KALGS RS++
Sbjct  240  DKPWDDHWIFWVGPFIGAAIAAIYHQFILRAAAVKALGSFRSSS  283



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   475 bits (1222),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 245/286 (86%), Positives = 263/286 (92%), Gaps = 2/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE-YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            MGKD+E G   ++ KDY DPPPAP ID EEL +WS YRA+IAEFVATLLFLY+TV TVIG
Sbjct  1    MGKDMEAGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  60

Query  257  YKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            YK Q+DP+V GTDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   YKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  120

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++YM+AQCLGAICG GLVK FQKAYYVRYGGGANEL+ GYSKGTGL AEIIGTF
Sbjct  121  VSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTF  180

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  181  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  240

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+KAWDDQWIFWVGPFIGAAIA  YHQF+LRAGA+KALGS RSNA
Sbjct  241  DKEKAWDDQWIFWVGPFIGAAIATAYHQFVLRAGAVKALGSFRSNA  286



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   474 bits (1220),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 262/284 (92%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+  KDY DPPPAP ID EEL QWS YRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD    G D CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDTAKNG-DVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK+YY +YGGGAN LA G+SKGT LGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSKGTALGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWDD WIFWVGPFIGAAIAA+YHQ++LRA A+KALGS RS++
Sbjct  240  DKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   474 bits (1219),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 261/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E   +  +S KDY DPPPAP ID EE  QWSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+ YM AQCLGA+CGCGLVKAFQKAYY +YGGGANELADGYSKGTGL AEIIGTF
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            GKDKAW+DQWIFWVGPFIGAAIAA YHQ+ILRAGA KALGS RS++
Sbjct  240  GKDKAWNDQWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSS  285



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   473 bits (1217),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 245/284 (86%), Positives = 260/284 (92%), Gaps = 3/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+EVG ++  KDY DPPPAP +D EEL +WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDIEVGGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQID---KGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  117

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YM AQCLGAICGCGLVKAFQK+YY RYGGGAN LADGYS GTGLGAEIIGTFVL
Sbjct  118  LVRAILYMAAQCLGAICGCGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVL  177

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+Y +
Sbjct  178  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYNQ  237

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DK WDDQWIFWVGPFIGAAIAAIYHQ+ILRA A KALGS RS++
Sbjct  238  DKPWDDQWIFWVGPFIGAAIAAIYHQYILRAAAAKALGSFRSSS  281



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   473 bits (1218),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 260/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E   +  +S KDY DPPPAP ID EE  QWSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+ YM AQCLGA+CGCGLVKAFQKAYY +YGGGANELADGYSKGTGL AEIIGTF
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            GKDKAWDDQWIFWVGPFIGAAIAA YHQ+ILRA A KALGS RS++
Sbjct  240  GKDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAAKALGSFRSSS  285



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   473 bits (1218),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 263/291 (90%), Gaps = 8/291 (3%)
 Frame = +2

Query  80   MGKDVEVGNE-------YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvt  238
            MGKDVEV  +       +S KDY DPPPAP ID EELG+WSFYRA+IAEF+ATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  239  vltvIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  418
            VLT IGYKSQTDP +  TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   VLTAIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  419  FLARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAE  598
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGANELADGY+KGTGLGAE
Sbjct  120  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  179

Query  599  IIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG  778
            IIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+ GTGINPARSFG
Sbjct  180  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPIIGTGINPARSFG  239

Query  779  AAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            AAVIY K+KAWDDQWIFWVGPFIGA +AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  AAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  290



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   473 bits (1216),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 261/283 (92%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG  YS KDYQDPPP P ID EELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS
Sbjct  61   KSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YM AQ LGAICG GLVKAFQ +YY +YGGGANELADGYS GTGLGAEI+GTFVL
Sbjct  120  LVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNN  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAW+DQWIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RS+
Sbjct  240  DKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   473 bits (1216),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 245/283 (87%), Positives = 261/283 (92%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG  YS KDYQDPPP P ID EELG+WSFYRAIIAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MGKDIEVGGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS
Sbjct  61   KSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQ LGAICG GLVKAFQ +YY +YGGGANELADGYS  TGLGAEI+GTFVL
Sbjct  120  LVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTSTGLGAEIVGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNN  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAW+DQWIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RS+
Sbjct  240  DKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   471 bits (1213),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/279 (89%), Positives = 258/279 (92%), Gaps = 3/279 (1%)
 Frame = +2

Query  104  NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKSQTDPHV  283
             EY+ KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGYKSQ     
Sbjct  1    TEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQNSTDQ  60

Query  284  TG---TDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAI  454
             G   TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAI
Sbjct  61   CGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAI  120

Query  455  MYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVF  634
            MY+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVF
Sbjct  121  MYIVAQCLGAICGCGLVKCFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLVYTVF  180

Query  635  SATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDKAWD  814
            +ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  KAW+
Sbjct  181  AATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGHHKAWN  240

Query  815  DQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  241  DQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  279



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   471 bits (1213),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 245/286 (86%), Positives = 261/286 (91%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKDVEV    E+S KDY DPPPAP ID  EL  WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MGKDVEVAEHGEFSAKDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG G VKAFQK+YYV++GGGANELADGY+KGTGL AEIIGTF
Sbjct  116  VSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGLAAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFWVGPF+GAAIAA YHQF+LRA A+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIKALGSFRSNA  281



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   472 bits (1214),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 247/293 (84%), Positives = 264/293 (90%), Gaps = 10/293 (3%)
 Frame = +2

Query  80   MGKDVEVGN---------EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllfly  232
            MGKDVEV           E+S KDY D PPAP ID +ELG+WSFYRA+IAEF+ATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  233  vtvltvIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  412
            VTVLTVIGYKSQTDP +  TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  61   VTVLTVIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  119

Query  413  GLFLARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLG  592
            GLFL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGANELADGY+KGTGLG
Sbjct  120  GLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLG  179

Query  593  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS  772
            AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS
Sbjct  180  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  239

Query  773  FGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            FGAAVIY K+KAWDDQWI WVGPFIGA +AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  FGAAVIYNKEKAWDDQWILWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  292



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   471 bits (1213),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 245/288 (85%), Positives = 263/288 (91%), Gaps = 5/288 (2%)
 Frame = +2

Query  80   MGKDVEVGN----EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KDVEV      E+S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGYKSQTDP+ T  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKSQTDPN-TNADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL++A++YMVAQCLGAICG G VKAFQKAYYVRYGGGANE+A GY+KGTGLGAEIIG
Sbjct  120  RKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTKGTGLGAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY + KAWDD WIFWVGPFIGAAIAA YHQ+ILRA A+KALGS RS+A
Sbjct  240  IYNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSSA  287



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   471 bits (1212),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 258/284 (91%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVEVG E+  KDY DPPPAP +D +EL QWSFYRAIIAEF+A LLFLY+TVLTVIGY
Sbjct  1    MAKDVEVGGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ DP   G D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQVDPDKGGQD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YM AQCLGAICGCGLVKAFQK+YY +YGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV++ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DK WDD WIFWVGPFIGAAIAAIYHQ+ILRAGA KALGS RS++
Sbjct  240  DKPWDDHWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFRSSS  283



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   470 bits (1209),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/271 (90%), Positives = 256/271 (94%), Gaps = 5/271 (2%)
 Frame = +2

Query  119  KDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKSQTDPHVTGTDA  298
            K YQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGYKSQ+      TD 
Sbjct  4    KTYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  299  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCL  478
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  479  GAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRN  658
            GAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRN
Sbjct  119  GAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRN  178

Query  659  ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDKAWDDQWIFWVG  838
            ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV+YG +KAWDDQWIFWVG
Sbjct  179  ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVG  238

Query  839  PFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            PFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  239  PFIGAAIAAFYHQFILRAGAVKALGSFRSNA  269



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   470 bits (1210),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/283 (87%), Positives = 261/283 (92%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG  YS KDYQD PP P ID EELG+WSFYRAIIAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MGKDIEVGGGYSAKDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS
Sbjct  61   KSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQ LGAICG GLVKAFQ +YY +YGGGANELADGYS GTGLGAEI+GTFVL
Sbjct  120  LVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNN  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAW+DQWIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RS+
Sbjct  240  DKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   471 bits (1211),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     YS KDY DPPPAP ID EELG+WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD  V   D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  120

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+Y+VAQCLGAICG GLVKAFQKAYY +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  121  VSLIRAILYIVAQCLGAICGVGLVKAFQKAYYTKYGGGANTLGDGYSVGTGLGAEIIGTF  180

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI+
Sbjct  181  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIF  240

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             + KAWD  WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  241  NQQKAWDKHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  285



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   470 bits (1210),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 261/283 (92%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+E+G  YS KDYQD PP P ID EELG+WSFYRAIIAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MGKDIEIGGGYSAKDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS
Sbjct  61   KSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQ LGAICG GLVKAFQ +YY +YGGGANELADGYS GTGLGAEI+GTFVL
Sbjct  120  LVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNN  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAW+DQWIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RS+
Sbjct  240  DKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   470 bits (1209),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 260/285 (91%), Gaps = 1/285 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+E G E++ KDY DPPPAP +D EEL +WS YRA+IAEF+ATLLFLY+TV TVIGY
Sbjct  1    MRKDMEAGAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIGY  60

Query  260  KSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            K Q+DP+V+G DA C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   KHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SL+RA++YM+AQCLGAICG GLVKAFQKAYY RYGGG NEL+ GYSKGTGL AEIIGTFV
Sbjct  121  SLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEIIGTFV  180

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS G AVIY 
Sbjct  181  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGPAVIYN  240

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             DKAWDDQWIFWVGPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  241  NDKAWDDQWIFWVGPFIGAAIAAAYHQYILRAGAIKALGSFRSNA  285



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   470 bits (1209),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 249/287 (87%), Positives = 262/287 (91%), Gaps = 7/287 (2%)
 Frame = +2

Query  80   MGKDVEVG----NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+EVG      Y  KDYQDPPPAP +DPEEL QWSFYRAIIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  61   VIGYKSQSDTKANG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSLVRA++YMVAQCLGAICGCGLVKAFQ+AYYVRYGGGAN L+DGYS GTGLGAEIIG
Sbjct  120  RKVSLVRAVLYMVAQCLGAICGCGLVKAFQRAYYVRYGGGANGLSDGYSTGTGLGAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            IYG  KAWDD WIFWVGPFIGAAIAA YHQ+ILRAGA+KALGS +S+
Sbjct  240  IYG--KAWDDHWIFWVGPFIGAAIAAFYHQYILRAGAVKALGSFKSS  284



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   469 bits (1207),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 259/284 (91%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVEVG E+  KDY DPPPAP +D +EL QWSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDVEVGGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ DP   G+  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQVDPD-KGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YM AQCLGAICGCGLVKAFQK+YY +YGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV++ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DK WDD WIFWVGPFIGAAIAAIYH++ILRAGA KALGS RS++
Sbjct  240  DKPWDDHWIFWVGPFIGAAIAAIYHEYILRAGAAKALGSFRSSS  283



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   469 bits (1206),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 263/286 (92%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGNEY--SLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E GN+     KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+D      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI Y+VAQCLGAICGCGLVK FQKAYYV+YGGGANELA GY+  TGLGAEIIGTF
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVKLFQKAYYVKYGGGANELAVGYNTATGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            GK+K+WDDQWIFWVGPFIGAAIAA+YHQ+ILRAGA K++ S RSNA
Sbjct  236  GKNKSWDDQWIFWVGPFIGAAIAALYHQYILRAGASKSINSFRSNA  281



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   468 bits (1205),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 247/281 (88%), Positives = 257/281 (91%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  +S KDY DPPPAP ID +EL QWSFYRA+IAEF+ATLLFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDAK-AGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGAICG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGTFVLVY
Sbjct  122  RAIMYMVAQCLGAICGVGLVKAFQKAYYTRYGGGANELSEGYSTGVGLGAEIIGTFVLVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY K+K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKEK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDDQWIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  242  AWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   469 bits (1206),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 245/289 (85%), Positives = 260/289 (90%), Gaps = 5/289 (2%)
 Frame = +2

Query  80   MGKDVEV-----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvl  244
            MGKD  +     G E++ KDY DPPPAP ID  ELG WS YRA+IAEF+ATLLFLY+TVL
Sbjct  1    MGKDDVIESGAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVL  60

Query  245  tvIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            TVIGYK QTDP+V GTDACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  61   TVIGYKHQTDPNVAGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSLVRA++Y+VAQCLGAICG GLVKAFQ AY+ RYGGGAN LA GYS+GTGLGAEII
Sbjct  121  ARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY KDK WDD WIFWVGPF GAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  241  VIYNKDKPWDDHWIFWVGPFAGAAIAAFYHQYILRAGAIKALGSFRSNA  289



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 243/271 (90%), Positives = 257/271 (95%), Gaps = 1/271 (0%)
 Frame = +2

Query  119  KDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKSQTDPHVTGTDA  298
            KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLYVTVLTVIGYKSQTDP++  TD 
Sbjct  12   KDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNLN-TDQ  70

Query  299  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCL  478
            CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCL
Sbjct  71   CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCL  130

Query  479  GAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRN  658
            GAICG GLVKAFQ +YY RYGGGANELADGY+KGTGLG EIIGTFVLVYTVFSATDPKR+
Sbjct  131  GAICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGTEIIGTFVLVYTVFSATDPKRS  190

Query  659  ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDKAWDDQWIFWVG  838
            ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY KDKAWDDQWIFWVG
Sbjct  191  ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVG  250

Query  839  PFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            PFIGAAIAA YHQF+LRAGA+KALGS RSNA
Sbjct  251  PFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  281



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     YS KDY DPPPAP ID EELG+WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQKAYY RYGGGAN L+DGYS GTGLGAEIIGTF
Sbjct  120  VSLIRAILYMVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             + KAWDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  240  NQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  284



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/286 (86%), Positives = 260/286 (91%), Gaps = 5/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKDVEV    E+  KDYQDPPPAP IDPEEL +WS YRA IAEF+ATLLFLYVTVLTVI
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY  Q D   +  D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSHQRD---STPDPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++YM+AQC GAICGCGLVKAFQ AYYVRY GGAN L+DGY+KGTGLGAEIIGTF
Sbjct  118  VSLVRAVLYMLAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+KAWDDQWIFWVGPFIGAAIAAIYHQ++LRAGA+KALGS RSNA
Sbjct  238  NKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFRSNA  283



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 263/286 (92%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E     E++ KDYQDPPP P  D EEL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDIEGAEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y+VAQCLGAICG GLVKAFQK+YYV+YGGGANELADGY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 262/286 (92%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGNEY--SLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E GN+     KDYQDPPPAP IDPEELG+WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+D      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI Y+VAQCLGAICGCGLVK FQKAYYV+YGGGANELA GY+  TGLGAEIIGTF
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVKLFQKAYYVKYGGGANELAVGYNIATGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            GK+K+WDDQWIFWVGPFIGAAIAAIYHQ+ILRAGA K++ S RSNA
Sbjct  236  GKNKSWDDQWIFWVGPFIGAAIAAIYHQYILRAGASKSINSFRSNA  281



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/283 (87%), Positives = 256/283 (90%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K    G  +S KDY DPPPAP ID +EL QWSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKHDAEGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQSDVK-AGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RAIMYMVAQCLGAICG GLVKAFQKAYY +YGGGANEL+DGYS G GLGAEIIGTFVL
Sbjct  120  LIRAIMYMVAQCLGAICGVGLVKAFQKAYYNKYGGGANELSDGYSTGVGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  240  EKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 256/283 (90%), Gaps = 0/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K       +S KDYQDPPPAP IDP ELG+WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MTKHAAEHGSFSAKDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD    GTDACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  120

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAIMYMVAQCLGAICG GLVK FQK+YY +YGGGAN LA+GY    GLGAEIIGTFVL
Sbjct  121  LVRAIMYMVAQCLGAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFVL  180

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY K
Sbjct  181  VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNK  240

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  241  DKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  283



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 249/285 (87%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK Q+D    G DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAICG GLVKAFQK+YY RYGGGAN LADGYS GTGLGAEIIGTF
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDK WDD WIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 263/286 (92%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E     E++ KDYQDPPP P  D EEL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDIEGAEHGEFASKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y+VAQCLGAICG GLVKAFQK+YYV+YGGGANELADGY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   467 bits (1202),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 262/286 (92%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    E++ KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP + GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+ YMVAQCLGAICGCGLVKAFQKAYY RYGGGANE+  GYSKGT LGAEIIGTF
Sbjct  120  VSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV+Y
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVMY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            G DKAWDDQWIFWVGPF+GAA AA Y+QF+LRA A+KALGS RSNA
Sbjct  240  GHDKAWDDQWIFWVGPFLGAAAAAFYYQFVLRAAAIKALGSFRSNA  285



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   467 bits (1201),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 259/285 (91%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EVG    +S KDYQDPPPAP ID  EL +WSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDMEVGERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP  T  DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDP-ATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQ LGAI G  LVKAFQK+YY++YGGGAN L+DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   467 bits (1201),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 260/285 (91%), Gaps = 4/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE+    + +DY DPPPAP ID EEL QWSFYRA+IAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MVKDVEMA---AGRDYHDPPPAPLIDSEELTQWSFYRALIAEFIATLLFLYVTVLTVIGY  57

Query  260  KSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            + QTDP     D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RKV
Sbjct  58   RVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKV  117

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA+MYMVAQCLGAICGCGLVK FQK+YY  YGGGANEL DG++KGTGLGAEIIGTFV
Sbjct  118  SLVRAVMYMVAQCLGAICGCGLVKGFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTFV  177

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY 
Sbjct  178  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  237

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            KDKAWDDQW+FWVGPFIGAAIAAIYHQ+ILRAGA+KALGS RSNA
Sbjct  238  KDKAWDDQWMFWVGPFIGAAIAAIYHQYILRAGAMKALGSFRSNA  282



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   466 bits (1200),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 245/286 (86%), Positives = 259/286 (91%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV  G E+  KDY DPPPAP IDPEEL QWSFYRA+IAEF+ATLLFLYVT+LTVI
Sbjct  1    MAKDVEVVEGGEFQAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+      TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQS-----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++Y+VAQCLGAICG GLVKAFQ +YY R+GGGAN LAD Y+KG GLGAEIIGTF
Sbjct  116  VSLVRAVLYIVAQCLGAICGTGLVKAFQSSYYNRHGGGANTLADHYNKGVGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              DKAWDDQWIFWVGPFIGAAIAA YHQ+ILRAGA+KALGS RS A
Sbjct  236  NNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAIKALGSFRSTA  281



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   466 bits (1200),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 261/287 (91%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV     E++ KDY DPPPAP IDPEEL +WSFYRA+IAEF+ATLLFLYVTVLTV
Sbjct  1    MAKDVEVQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKVQSDTKAGGDD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YMVAQCLGAICGCGLVKAFQK+YY RYGGGAN LA GY+KGTGLGAEIIGT
Sbjct  120  KVSLVRALLYMVAQCLGAICGCGLVKAFQKSYYNRYGGGANVLASGYNKGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DKAWDD W+FWVGPFIGA  AA+YHQ++LRA A+KALGS RSNA
Sbjct  240  YNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLRAAAIKALGSFRSNA  286



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 262/287 (91%), Gaps = 8/287 (3%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+E G   +EY  KDY DPPPAP ID EEL +WS YRA+IAEF ATLLFLY+TVLTV
Sbjct  1    MAKDIEGGAAAHEYGAKDYHDPPPAPLIDSEELTKWSLYRAVIAEFTATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQS-----AADGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++Y++AQCLGAICGCGLVKAFQK+YYV +GGGANELA GYSKGTGL AEIIGT
Sbjct  116  KVSLVRAVLYIIAQCLGAICGCGLVKAFQKSYYVEHGGGANELALGYSKGTGLAAEIIGT  175

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            YGKDKAWDDQWIFWVGPFIGAAIAAIYHQ+ILRAGA+KALGS RS++
Sbjct  236  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFRSSS  282



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   466 bits (1199),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 256/285 (90%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNEY-SLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            MGKD+E   E  S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  257  YKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            YK QTDP     D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAICGCGLVKAFQK YY  YGGGANEL  G++KGTGLGAEIIGTF
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTF  180

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY
Sbjct  181  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  240

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K+KAWDDQWIFWVGPFIGAAIAA YHQ+ILRA A+KA GS RSN
Sbjct  241  NKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKAFGSSRSN  285



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   466 bits (1198),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 258/285 (91%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEV-GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            M KDVE  G E+S KDY DPPPAP IDP+EL QWS YRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MTKDVETSGQEFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            YKSQ+D     TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQSD-----TDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  115

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA+MYM+AQCLGA+CG GLVKAFQ + Y RYGGGANELA GY+KG GLGAEIIGTFV
Sbjct  116  SLVRALMYMIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGTFV  175

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY 
Sbjct  176  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  235

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             DKAWDD W+FWVGPFIGAAIAA YHQ+ILRA A+KALGS RSNA
Sbjct  236  NDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  280



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 257/285 (90%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD      DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN LADGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             +DK WDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  237  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  281



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   466 bits (1198),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 260/288 (90%), Gaps = 4/288 (1%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVE      EY++KDY DPPPAP  D EEL +WS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDVEAAAGHGEYAVKDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP+V  TDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YM+ QCLGAICG GLVK FQKA++VRYGGGANEL+DGYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYMIGQCLGAICGVGLVKGFQKAFFVRYGGGANELSDGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY KDKAWDDQWIFWVGP IGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  241  IYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILRAGAVKALGSFRSNA  288



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 255/283 (90%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDV     +S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MVKDVAEQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTDP     D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA+MYMVAQ LGAICG GLVKAFQ AYY RYGGGAN LADGYS G GLGAEIIGTFVL
Sbjct  120  LVRAVMYMVAQSLGAICGVGLVKAFQSAYYKRYGGGANTLADGYSTGVGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNH  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAWDDQWIFWVGPF+GAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  DKAWDDQWIFWVGPFLGAAIAAFYHQFILRAGAVKALGSFRSN  282



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 243/283 (86%), Positives = 257/283 (91%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDV     +S KDY DPPPAP IDP EL +WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MTKDVPEQGSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KS TDP +   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSTTDPALNA-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RAIMYMVAQCLGAICG GLVKAF K+ Y RYGGGAN LADGY+KGTGLGAEIIGTFVL
Sbjct  120  LIRAIMYMVAQCLGAICGVGLVKAFNKSLYNRYGGGANSLADGYNKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY K
Sbjct  180  VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +K WDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS+
Sbjct  240  EKIWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSS  282



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 258/286 (90%), Gaps = 4/286 (1%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            MGKDVE      E++ KDY DPPPAP ID EEL  WS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP+V GTDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YM+AQCLGAICG GLV+ FQKAYYVRYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVRGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
            IY K+KAWDDQWIFWVGPFIGAAIA  YHQ++LRA A KALGS RS
Sbjct  241  IYNKEKAWDDQWIFWVGPFIGAAIAEAYHQYVLRASAAKALGSFRS  286



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 257/285 (90%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD      DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN LADGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             +DK WDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  237  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  281



>gb|KCW51592.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=383

 Score =   468 bits (1205),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 257/289 (89%), Gaps = 0/289 (0%)
 Frame = +2

Query  62   LSSTVEMGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtv  241
             +    M K       +S KDYQDPPPAP IDP ELG+WSFYRA+IAEF+ATLLFLY+TV
Sbjct  94   FAKNTSMTKHAAEHGSFSAKDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITV  153

Query  242  ltvIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  421
            LTVIGYKSQTD    GTDACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  154  LTVIGYKSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  213

Query  422  LARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEI  601
            LARKVSLVRAIMYMVAQCLGAICG GLVK FQK+YY +YGGGAN LA+GY    GLGAEI
Sbjct  214  LARKVSLVRAIMYMVAQCLGAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEI  273

Query  602  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGA  781
            IGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA
Sbjct  274  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  333

Query  782  AVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AVIY KDKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  334  AVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  382



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   464 bits (1195),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 246/287 (86%), Positives = 261/287 (91%), Gaps = 8/287 (3%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD EVG   N +S KDYQDPPPAP ID EELGQWSFYRAIIAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDSEVGGGHNRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ+D      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRAI+YMVAQ LGAICG GLVKAFQKAY+ +YGGGAN LADGYS+GTGL AEIIGT
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVKAFQKAYFTKYGGGANGLADGYSQGTGLAAEIIGT  175

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVI
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  235

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y  DKAWDDQWIFWVGPFIGAAIAA YHQ+ILRAGA+KALGS RS++
Sbjct  236  YDNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSSS  282



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   464 bits (1195),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 245/289 (85%), Positives = 259/289 (90%), Gaps = 5/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M K+VE     G E+S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLYV+VLT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVLT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTD      DA CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
             RKVSL+RAIMYMVAQCLGAICGCGLVKAFQK YY  YGGGANEL  GY+KGTGLGAEII
Sbjct  121  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNTYGGGANELQPGYNKGTGLGAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAA
Sbjct  181  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY ++KAWDDQWIFWVGPFIGAAIAA YHQ+ILRA A+KALGS RSNA
Sbjct  241  VIYNREKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   464 bits (1194),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 260/287 (91%), Gaps = 6/287 (2%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+EVG     +  KDYQDPPPAP +D EELGQWSFYRAIIAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ +   T  D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQVE---TSGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YMVAQCLGA+CGCGLVK FQKAYY+  GGGAN L++GYS GTGL AEIIGT
Sbjct  118  KVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEIIGT  177

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+
Sbjct  178  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  237

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            YGK KAWD+QWIFWVGPFIGAAIAA YHQ+ILRAGA KALGS RS++
Sbjct  238  YGKQKAWDEQWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSS  284



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   464 bits (1194),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 258/283 (91%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+E G  +++KDYQDPPPAP ID EEL QWSFYRAIIAEFVATLLFLYVTVLTVIGY
Sbjct  1    MSKDLEAGG-FAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ+D   +G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   SSQSDTK-SGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RAI+YM AQCLGAICGC LVK+FQKA Y  YGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  119  LIRAILYMAAQCLGAICGCALVKSFQKALYNGYGGGANSLADGYSTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAWDDQWIFWVGPFIGAAIAAIYHQ +LRAGA+KALGS RS+
Sbjct  239  DKAWDDQWIFWVGPFIGAAIAAIYHQIVLRAGAVKALGSFRSS  281



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVG--NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE    +++S KDY DPPPA  IDP+EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVESSEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD    GTD CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKRQTDSSHNGTD-CGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MY++AQCLGAICG GLVK FQK+YYVRYGGGANELADGYSKG GL AEIIGTF
Sbjct  120  VSLIRAVMYIIAQCLGAICGVGLVKGFQKSYYVRYGGGANELADGYSKGVGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAW D WIFWVGPFIGAAIAA YHQ+ILRA A+KALGS RSN
Sbjct  240  NKDKAWHDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSN  284



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 249/283 (88%), Positives = 265/283 (94%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+S KDY DPPPAP ID EE+ QWSFYRAIIAEFVATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD +  G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN LA+GYSKGTGLGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANGLANGYSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +KAWDD W+FWVGPFIGAAIAA+YHQFILRA A+K+LGS RS+
Sbjct  240  EKAWDDHWVFWVGPFIGAAIAALYHQFILRAAAVKSLGSXRSS  282



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   464 bits (1193),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 258/289 (89%), Gaps = 5/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E     G E+S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTDP     D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
             RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGANEL  G++KGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA
Sbjct  181  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY K+KAWDDQWIFWVGPFIGAA AA YHQ+ILRA A+KALGS RSNA
Sbjct  241  VIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKALGSFRSNA  289



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   464 bits (1193),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 244/281 (87%), Positives = 255/281 (91%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  +S KDY DPPPAP ID EEL QWSFYRA+IAEF+AT+LFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDVK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGAICG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGTFVLVY
Sbjct  122  RAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAV+Y + K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  242  AWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   463 bits (1192),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 245/281 (87%), Positives = 255/281 (91%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  +S KDY DPPPAP ID EEL QWSFYRA+IAEF+ATLLFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDVK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGAICG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGTFVLVY
Sbjct  122  RAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAV+Y + K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  242  AWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   463 bits (1192),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 244/281 (87%), Positives = 256/281 (91%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  +S KDY DPPPAP ID EEL QWSFYRA+IAEF+ATLLFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDVK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGA+CG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGTFVLVY
Sbjct  122  RAIMYMVAQCLGAMCGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV+Y + K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVMYNQKK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDDQWIFWVGPFIGAAIAA YHQFILRA A KA+GS RSN
Sbjct  242  AWDDQWIFWVGPFIGAAIAAFYHQFILRASAAKAVGSFRSN  282



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   463 bits (1192),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 256/285 (90%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD      DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTD----HADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCL AICG GLVKAFQK+Y+ +YGGGAN LADGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLSAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             +DK WDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  237  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  281



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   463 bits (1192),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 243/286 (85%), Positives = 259/286 (91%), Gaps = 5/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKDVEV    E+  KDYQDPPPAP IDPEEL +WS YRA IAEF+ATLLFLYVTVLTVI
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY   +    T  D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GY---SHGRATDADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++Y++AQC GAICGCGLVKAFQ AYYVRY GGAN L+DGY+KGTGLGAEIIGTF
Sbjct  118  VSLVRALLYIIAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+KAWDDQWIFWVGPFIGAAIAAIYHQ++LRAGA+KALGS RSNA
Sbjct  238  NKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFRSNA  283



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   463 bits (1191),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 250/283 (88%), Positives = 265/283 (94%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG E+S KDY DPPPAP ID EE+ QWSFYRAIIAEFVATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD +  G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN LA+GYSKGTGLGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANGLANGYSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ K
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +KAWDD WIFWVGPFIGAAIAA+YHQFILRA A+K+LGS RS+
Sbjct  240  EKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   463 bits (1191),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 258/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    EY+ KDYQDPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+I
Sbjct  1    MAKDVEVQEQGEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTII  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD +V GT+ C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   GYKRQTDANVGGTE-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y+VAQC GAICG GL K FQKAYY RYGGGAN +ADGY+KGT LGAEIIGTF
Sbjct  120  VSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+K WDDQWIFWVGP IGAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  NKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   463 bits (1191),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 242/287 (84%), Positives = 256/287 (89%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV   G EYS KDY DPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN +ADGY+ GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DK WDDQWIFWVGP +GAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  YNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   463 bits (1191),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/285 (87%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK Q+D    G DACGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAICG GLVKAFQK+YY RYGGGAN LADGYS GTGLGAEIIGTF
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDK WDD WIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   462 bits (1190),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/285 (85%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPAP ID  EL +WSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP V   DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++YMVAQ LGAI G  LVKAFQK+YY++YGGGAN L+DGYS G GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   462 bits (1190),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 261/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD++V  G   + +DY+DPPPAP +D EEL +WS YRA+IAEFVATLLFLYV+VLTVI
Sbjct  1    MAKDLDVQEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGTF
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+KAWDDQWIFWVGP IGAA AA+YHQFILRA A+KALGS RSNA
Sbjct  240  NKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSNA  285



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 244/281 (87%), Positives = 254/281 (90%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  +S KDY DPPPAP ID EEL QWS YRA+IAEF+ATLLFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDVK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGAICG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGTFVLVY
Sbjct  122  RAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAV+Y + K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNQQK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  242  AWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 257/285 (90%), Gaps = 5/285 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDYQDPPPAP ID EEL +WSFYRA+IAEF+AT+LFLY+TVLTVI
Sbjct  1    MAKDIEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D +    D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+YY +Y GGAN LADGYS GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYTKYQGGANILADGYSTGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  238  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSN  282



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 261/286 (91%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    E++ KDY DPPP P  D EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y++AQCLGAICG GLVKAFQK+YYV+YGGGANEL+ GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 258/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+ V  +  YS KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+T+LTVI
Sbjct  1    MAKDMGVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ DP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MY+VAQCLGAICG  LVKAFQ+AYY RYGGGANE+A GY+KGT LGAEIIGTF
Sbjct  120  VSLIRAVMYIVAQCLGAICGVALVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + KAWDD WIFWVGPF+GA IAA YHQFILRA A+KALGS RSNA
Sbjct  240  NQKKAWDDHWIFWVGPFVGAVIAAFYHQFILRAAAIKALGSFRSNA  285



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 256/287 (89%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV   G EYS KDY DPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK QTD  V GT+ C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQTDTTVGGTE-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN +ADGY+ GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DK WDDQWIFWVGP +GAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  YNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 256/287 (89%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV   G EYS KDY DPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN +ADGY+ GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DK WDDQWIFWVGP +GAA+AA YHQ+ILRA A+KALGS +SNA
Sbjct  240  YNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFKSNA  286



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 258/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    EY+ KDYQDPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+I
Sbjct  1    MAKDVEVQEQGEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTII  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD +V GT+ C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   GYKRQTDANVGGTE-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y+VAQC GAICG GL K FQKAYY RYGGGAN +ADGY+KGT LGAEIIGTF
Sbjct  120  VSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPK+NARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKKNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+K WDDQWIFWVGP IGAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  NKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 256/287 (89%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV   G EYS KDY DPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK QTD  + GT+ C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQTDATLGGTE-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN +ADGY+ GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y KDK WDDQWIFWVGP +GAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  YNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   464 bits (1194),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 260/287 (91%), Gaps = 6/287 (2%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+EVG     +  KDYQDPPPAP +D EELGQWSFYRAIIAEF+ATLLFLY+TVLTV
Sbjct  71   MAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  130

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ +   T  D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  131  IGYKSQVE---TSGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  187

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YMVAQCLGA+CGCGLVK FQKAYY+  GGGAN L++GYS GTGL AEIIGT
Sbjct  188  KVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEIIGT  247

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+
Sbjct  248  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  307

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            YGK KAWD+QWIFWVGPFIGAAIAA YHQ+ILRAGA KALGS RS++
Sbjct  308  YGKQKAWDEQWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSS  354



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   461 bits (1187),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 251/286 (88%), Positives = 263/286 (92%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EVG   E+  KDY DPPPAP ID EEL +WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAICGCGLVKAFQK+YY RYGGGANELADGYS GTGLGAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRA A KALGS +S++
Sbjct  240  KKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS  285



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   461 bits (1187),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 239/286 (84%), Positives = 258/286 (90%), Gaps = 4/286 (1%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            MGKDVE      E++ KDY DPPPAP ID EEL +WS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+D +V G DA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YM+AQCLGAICG GLVK FQKAYYVRYGGGANEL+ GYS+GTGL AEIIG
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSRGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
            IY +DKAWDDQWIFWVGPFIGAAIAA YHQ++LRA A KALGS RS
Sbjct  241  IYNEDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGKALGSYRS  286



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   461 bits (1186),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPAP ID  EL +WSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP V   DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++YMVAQ LGAI G  LVKAFQK+YY++YGGGAN L+DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   461 bits (1186),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 261/287 (91%), Gaps = 8/287 (3%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+EVG   + +S KDYQDPPPAP ID EELGQWSFYRAIIAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSE-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRAI+YMVAQ LGAICG GLVKAFQ AY+ +YGGGAN LADGYS+GTGL AEIIGT
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVKAFQNAYFTKYGGGANGLADGYSQGTGLAAEIIGT  175

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVI
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  235

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y  DKAWDDQWIFWVGPFIGAAIAA YHQ+ILRAGA+KALGS RS++
Sbjct  236  YNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSSS  282



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   461 bits (1185),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 242/283 (86%), Positives = 257/283 (91%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+E G  +++KDYQDPPPAP ID EEL QWSFYRAIIAEFVATLLFLYVTVLTVIGY
Sbjct  1    MSKDLEAGG-FAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   SSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RAI+YMVAQCLGAICGC LVK+FQKA Y  +GGGAN LADGYS GTGL AEIIGTFVL
Sbjct  119  LIRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ K
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNK  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DK WDDQWIFWVGPFIGAAIAAIYHQ +LRAGA+KALGS RS+
Sbjct  239  DKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFRSS  281



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   461 bits (1185),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 242/281 (86%), Positives = 254/281 (90%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  ++ KDY DPPPAP ID EEL QWSFYRA+IAEF+AT+LFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDVK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGAICG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGTFVLVY
Sbjct  122  RAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAV+Y + K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDD WIFWVGPFIGAAIAA YHQFILRA A KALGS RSN
Sbjct  242  AWDDHWIFWVGPFIGAAIAAFYHQFILRASAAKALGSFRSN  282



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   461 bits (1186),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 240/287 (84%), Positives = 256/287 (89%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV   G EYS KDY DPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK QTD  + GT+ C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQTDATLGGTE-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQC GAICG GL K FQK+YY RYGGGAN +ADGY+ GT LGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQKSYYNRYGGGANSVADGYNNGTALGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y KDK WDDQWIFWVGP +GAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  YNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   461 bits (1185),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 253/285 (89%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE G   EY  KDY DPPP P +D EEL +WS YRA IAEFVAT+LFLYVTV TVI
Sbjct  1    MAKDVEAGGRGEYGGKDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVATVI  60

Query  254  GYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            GYK Q+DP V  TDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   GYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            K+SLVRA++YM+AQCLGAICG GLVK FQ AYYVRYGGGANEL+DGYSKGTGL AEIIGT
Sbjct  121  KISLVRALLYMIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
            Y KDKAWDDQW+FWVGPFIGAA+AA YHQ+ILRA   KALGS  S
Sbjct  241  YNKDKAWDDQWMFWVGPFIGAAVAAAYHQYILRASGAKALGSSSS  285



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score =   460 bits (1184),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 257/283 (91%), Gaps = 5/283 (2%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD+EVG  YS KDYQDPPP P ID EELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MGKDIEVGGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQTD  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS
Sbjct  61   KSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YM AQ LGAICG GLVKAFQ +YY +YGGGANELADGYS GTGLGAEI+GTFVL
Sbjct  120  LVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNN  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAW+DQWIFWVGPF    IAA+YHQ+ILRAGA+KALGS RS+
Sbjct  240  DKAWNDQWIFWVGPF----IAALYHQYILRAGAVKALGSFRSS  278



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   461 bits (1185),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 256/285 (90%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPAP ID  EL +WSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP  T  DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDP-ATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++YMVAQ LGAI G  LVKAFQK+YY +YGGGAN L+DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYXKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   461 bits (1185),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/287 (84%), Positives = 257/287 (90%), Gaps = 1/287 (0%)
 Frame = +2

Query  71   TVEMGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            T ++   VE   EYS KDY DPPPAP ID +EL  WSFYRA+IAEFVATLLFLYVTVLTV
Sbjct  2    TKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLTV  61

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ DP   G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  62   IGYKSQIDP-AHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQCLGAICG GLVKAFQK+YY +YGGGANELA GY+KG GLGAEIIGT
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYHKYGGGANELAPGYNKGVGLGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DK WDD WIFWVGPF+GA IAAIYHQ+ILRAGA+KALGS RSNA
Sbjct  241  YNEDKPWDDHWIFWVGPFVGALIAAIYHQYILRAGAIKALGSFRSNA  287



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   460 bits (1184),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/288 (83%), Positives = 258/288 (90%), Gaps = 5/288 (2%)
 Frame = +2

Query  80   MGKDVE----VGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M K+VE       E+S KDY DPPPAP +D  EL +WSFYRAIIAEF+ATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGYKSQTDP +   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKSQTDP-IKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YMVAQC GAICG GLVKAFQ+AYY RYGGGANE+A GY+KGT LGAEIIG
Sbjct  120  RKVSLIRALLYMVAQCSGAICGVGLVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY + KAWDD WIFWVGPF+GAAIAA YHQFILRA A+KALGS RSNA
Sbjct  240  IYNQKKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSNA  287



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   460 bits (1183),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/289 (83%), Positives = 256/289 (89%), Gaps = 6/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E       E+S KDY DPPPAP +D EEL QWS YRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTD   +G DA CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGANEL+DGYSKGTGL AEII
Sbjct  121  ARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSNA
Sbjct  241  VIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA  288



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   460 bits (1183),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 242/283 (86%), Positives = 256/283 (90%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+E G  +++KDYQDPPPAP ID EEL QWSFYRAIIAEFVATLLFLYVTVLTVIGY
Sbjct  1    MSKDLEAGG-FAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   SSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L RAI+YMVAQCLGAICGC LVK+FQKA Y  +GGGAN LADGYS GTGL AEIIGTFVL
Sbjct  119  LTRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ K
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNK  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DK WDDQWIFWVGPFIGAAIAAIYHQ +LRAGA+KALGS RS+
Sbjct  239  DKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFRSS  281



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   460 bits (1183),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/289 (83%), Positives = 256/289 (89%), Gaps = 6/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E       E+S KDY DPPPAP ID EEL QWS YRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTD   +G DA CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGANEL+DGYSKGTGL AEII
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSNA
Sbjct  241  VIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA  288



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   459 bits (1182),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 249/286 (87%), Positives = 262/286 (92%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E+G   E+  KDY DPPPAP ID EEL QWSFYRA IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEIGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAICGCGLVKAFQK+YY RYGGGANELADGYS GTGLGAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+KAWDDQWIFWVGPFIGAAIAA YHQFILRA A KALGS +S++
Sbjct  240  SKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS  285



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   459 bits (1182),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 257/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV    + +LKDY DPPPAP +DPEELG WSFYRAIIAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTDP+  G + C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKNQTDPYHHGNE-CNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQC GAICGCGLVK FQ  YY+RYGGGANELA GYS GTGL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQCGGAICGCGLVKLFQDIYYIRYGGGANELASGYSIGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + KAW D W+FW GPFIGAAIAA YHQFILRAGA+KALGS +S++
Sbjct  240  NQPKAWSDHWVFWAGPFIGAAIAAFYHQFILRAGAVKALGSFKSSS  285



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   459 bits (1182),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 260/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKD+EVG +  +S KDY DPPP P ID EE G+WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MGKDIEVGPQGGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+D  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDT-LKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL RA++Y+VAQ LGAICGCGLVK+FQ A Y  YGGGAN LADGYSKGTGL AEIIGTF
Sbjct  120  VSLPRAVLYIVAQSLGAICGCGLVKSFQSALYTNYGGGANGLADGYSKGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              +KAWDD WIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RS++
Sbjct  240  NNEKAWDDHWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSSS  285



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   459 bits (1181),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 250/286 (87%), Positives = 261/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EVG   E+  KDY DPPPAP ID EEL QWSFYRA IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAICGCGLVKAFQK+YY RYGGGANELADGYS G GLGAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRA A KALGS +S++
Sbjct  240  KKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS  285



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   459 bits (1181),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 243/286 (85%), Positives = 256/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D  + G DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDADLGG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MY+VAQ LGAI G GLVKAFQK+YY +YGGGANELADGYS G GL AEIIGTF
Sbjct  120  VSLVRAVMYIVAQSLGAIAGVGLVKAFQKSYYTKYGGGANELADGYSTGVGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSNA
Sbjct  240  DKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  285



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   459 bits (1181),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 255/285 (89%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN LA GYS GTGLGAEIIGTF
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLAAGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             +DK WDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  240  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  284



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   459 bits (1180),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 260/286 (91%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE     E++ KDY DPPP P  D EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y++AQCLGAICG GLVKAFQK+YYV+YGGGANEL+ GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   459 bits (1181),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 240/290 (83%), Positives = 257/290 (89%), Gaps = 6/290 (2%)
 Frame = +2

Query  80   MGKDVEV-----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvl  244
            MGKD  +     G E++ KDY DPPPAP ID  ELG WS YRA+IAEF+ATLLFLY+TV 
Sbjct  1    MGKDDVIESGAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVA  60

Query  245  tvIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  421
            TVIGYK QTD   +G DA CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  61   TVIGYKHQTDATASGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  120

Query  422  LARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEI  601
            LARKVSLVRA++Y+VAQCLGAICG GLVKAFQ AY+ RYGGGAN LA GYS+GTGLGAEI
Sbjct  121  LARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEI  180

Query  602  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGA  781
            IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GA
Sbjct  181  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGA  240

Query  782  AVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            AVIY KDK WDD WIFWVGPF+GAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  241  AVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   458 bits (1179),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 258/284 (91%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+ E   E+  KDY DPPPAP  D EELG+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKEAEAAGEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQID----GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  116

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCLGAICGCGLVKAFQK++Y RYGG ANEL+ GYSKGTGLGAEIIGTFVL
Sbjct  117  LVRAILYMVAQCLGAICGCGLVKAFQKSHYSRYGG-ANELSGGYSKGTGLGAEIIGTFVL  175

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY  
Sbjct  176  VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNT  235

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDDQWIFWVGPFIGAAIAA Y+Q+ILRAGA+KAL S RS++
Sbjct  236  EKAWDDQWIFWVGPFIGAAIAAFYYQYILRAGAVKALASFRSSS  279



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   458 bits (1179),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 243/286 (85%), Positives = 256/286 (90%), Gaps = 6/286 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQ AYY RYGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS A
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSTA  282



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   458 bits (1179),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = +2

Query  80   MGKDVEVG-NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIG  256
            M KD+EVG    + KDYQDPPPAP ID EEL +WS YRA+IAEF+ATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGPGANAPKDYQDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVLTVIG  60

Query  257  YKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            Y SQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA+KV
Sbjct  61   YSSQTDPD-KNPDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQKV  119

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA++YM+AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGY+KGTGLGAEIIGTFV
Sbjct  120  SLVRAMLYMMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFV  179

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIYG
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYG  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            K K WDDQWIFW GPFIGA IAA YHQFILRAGA+KALGS RSNA
Sbjct  240  KKKTWDDQWIFWGGPFIGAPIAAFYHQFILRAGAIKALGSYRSNA  284



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   458 bits (1179),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 238/289 (82%), Positives = 256/289 (89%), Gaps = 6/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E     G E+S KDY DPPPAP ID EEL +WS YRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK Q+D  V  TDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSL+RA++Y++AQCLGAICG GLVK FQ +YY RYGGGANEL+DGYSKGTGLGAEII
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSNA
Sbjct  241  VIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSNA  288



>ref|XP_006436425.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 ref|XP_006485687.1| PREDICTED: probable aquaporin PIP2-5-like [Citrus sinensis]
 gb|ESR49665.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=287

 Score =   458 bits (1179),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 252/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD  V     YS KDY DPPP P  D  EL +WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP     D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAI G GLVKAFQK+YY RYGGGANELADGYS G GL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQW+FWVGPFIGAAIAA YHQFILRAGA+KALGS RS +
Sbjct  240  NKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSQS  285



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   458 bits (1178),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 254/285 (89%), Gaps = 5/285 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD EV     +S KDYQDPPPAP ID EEL +WSFYRA+IAEF+AT+LFLY+TVLTVI
Sbjct  1    MAKDTEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D +    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQC GAICG GLVKAFQK+YY +Y GGAN LADGYS GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCAGAICGVGLVKAFQKSYYTKYNGGANVLADGYSTGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
               KAW DQWIFW GPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  238  NNKKAWHDQWIFWAGPFIGAAIAAFYHQFILRAGAIKALGSFRSN  282



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   458 bits (1178),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 259/284 (91%), Gaps = 2/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MG+D+EVG  ++ KDYQDPPP P IDPEE G+WSFYRAIIAEFVATLLFLY+TVLTVIGY
Sbjct  1    MGRDIEVGG-FAAKDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+D  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   KSQSDT-LKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L RA++Y+VAQCLGAICGCGLVK+FQ A Y  YGGGAN LADGYS+GTGL AEIIGTFVL
Sbjct  119  LPRAVLYIVAQCLGAICGCGLVKSFQSALYSNYGGGANGLADGYSEGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY  
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDD WIFWVGPFIGAAIAA+YHQ ILRAGA KA GS RS++
Sbjct  239  EKAWDDHWIFWVGPFIGAAIAALYHQNILRAGAAKASGSFRSSS  282



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   458 bits (1178),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 241/283 (85%), Positives = 255/283 (90%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+E G  +++KDYQDPPPAP ID EEL QWSFYRAIIAEFVATLLFLYVTVLTVIGY
Sbjct  1    MSKDLEAGG-FAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISG HINPAVTFGLFLARKVS
Sbjct  60   SSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGDHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L RAI+YMVAQCLGAICGC LVK+FQKA Y  +GGGAN LADGYS GTGL AEIIGTFVL
Sbjct  119  LTRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ K
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNK  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DK WDDQWIFWVGPFIGAAIAAIYHQ +LRAGA+KALGS RS+
Sbjct  239  DKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFRSS  281



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   458 bits (1178),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 255/285 (89%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQ AYY RYGGGANELA GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYNRYGGGANELATGYSKGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRST  281



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   458 bits (1179),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 260/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD++V  G   + +DY+DPPPAP +D EELG+WS YRA+IAEFVATLLFLYV+VLTVI
Sbjct  13   MAKDLDVQEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVLTVI  72

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARK
Sbjct  73   GYKAQTDATAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARK  131

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGTF
Sbjct  132  VSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTF  191

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  192  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  251

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K+KAWDDQWIFWVGP IGAA AA+YHQFILRA A+KAL S RS+A
Sbjct  252  NKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALNSFRSSA  297



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   457 bits (1177),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/287 (83%), Positives = 260/287 (91%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD++V   G   + +DY DPPPAP +D EEL +WS YRA+IAEFVATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGT
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y ++KAWDDQWIFWVGP IGAA AA+YHQFILRA A+KALGS RS+A
Sbjct  240  YNQEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSSA  286



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   457 bits (1177),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/287 (83%), Positives = 259/287 (90%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD++V   G     +DY DPPPAP +D EEL +WS YRA+IAEFVATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGT
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y K+KAWDDQWIFWVGP IGAA AA+YHQFILRA A+KALGS RS+A
Sbjct  240  YNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSSA  286



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   457 bits (1177),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 258/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+ V  +  YS KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+T+LTVI
Sbjct  1    MAKDMGVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ DP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MY+VAQCLGAICG  LVKAFQ +YY  YGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVMYIVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             ++KAW D W+FWVGPFIGAAIAA YHQFILRAGA+KALGS RS++
Sbjct  240  NQEKAWHDHWMFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSSS  285



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   457 bits (1177),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 236/286 (83%), Positives = 260/286 (91%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE     E++ KDY DPPP P  D EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y++AQCLGAICG GLVKAFQK+YY++YGGGANEL+ GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              DKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NXDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|KDO44716.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=337

 Score =   459 bits (1182),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 252/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD  V     YS KDY DPPP P  D  EL +WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  51   MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI  110

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTDP     D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  111  GYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  169

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAI G GLVKAFQK+YY RYGGGANELADGYS G GL AEIIGTF
Sbjct  170  VSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTF  229

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  230  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  289

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQW+FWVGPFIGAAIAA YHQFILRAGA+KALGS RS +
Sbjct  290  NKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSQS  335



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   457 bits (1176),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 255/285 (89%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQ AYY RYGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRST  281



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   457 bits (1176),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 256/286 (90%), Gaps = 6/286 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQ AYY RYGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPK++ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKKSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS A
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSTA  282



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   457 bits (1176),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/289 (82%), Positives = 255/289 (88%), Gaps = 6/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E     G E+S KDY DPPPAP ID EEL +WS YRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK Q+D  V  TDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSL+RA++Y++AQCLGAICG GLVK FQ +YY RYGGGANEL+DGYSKGTGLGAEII
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS G A
Sbjct  181  GTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGTA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSNA
Sbjct  241  VIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSNA  288



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   457 bits (1175),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 255/285 (89%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQ AYY RYGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRST  281



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   457 bits (1176),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 256/285 (90%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD  V   DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDTTVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++YMVAQ LGAI G  LVKAFQ++YY +YGGGANEL+ GYSKG GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQESYYTKYGGGANELSQGYSKGVGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K+KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   457 bits (1175),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/286 (82%), Positives = 259/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV  G   + +DY DPPPAP +D EEL +WS YRA+IAEFVATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLARK
Sbjct  61   GYKAQTDASAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVR ++Y+VAQCLGAICGCG VKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGTF
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             ++KAWDDQWIFWVGP IGAA AA+YHQF+LRA A+KALGS RS+A
Sbjct  240  NQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAAIKALGSFRSSA  285



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   457 bits (1175),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 257/285 (90%), Gaps = 7/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EVG    +S KDY DPPPAP ID  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MVKDMEVGERGPFSAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++     +D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----SDSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAIMYMVAQCLGAICG GLVKAFQ ++Y RYGGGAN L D YS G GLGAEIIGTF
Sbjct  116  VSLVRAIMYMVAQCLGAICGVGLVKAFQSSHYKRYGGGANTLDDNYSTGVGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  176  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             +DKAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  236  NQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  280



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   456 bits (1174),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 255/285 (89%), Gaps = 6/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQ AYY RYGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
              +KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRST  281



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   457 bits (1175),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/284 (84%), Positives = 255/284 (90%), Gaps = 2/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+EVG E+  KDY DPPPAP +D +EL +WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDIEVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K+QTDP   G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KTQTDPAKGGED-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI YM AQCLGAICGCGLVKAFQ +YY +YGGGAN LA+GYS GTGL AEIIGTFVL
Sbjct  120  LVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVP-VLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            VYTVFSATDPKRNARDSH+P VLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ 
Sbjct  180  VYTVFSATDPKRNARDSHIPVVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  239

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +DK WDD WIFWVGPFIGAAIAAIYHQFILRA   KALGS RS+
Sbjct  240  QDKIWDDHWIFWVGPFIGAAIAAIYHQFILRASGAKALGSFRSS  283



>ref|XP_004307390.1| PREDICTED: probable aquaporin PIP2-5-like [Fragaria vesca subsp. 
vesca]
Length=285

 Score =   456 bits (1174),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 255/285 (89%), Gaps = 5/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDYQDPPPAP  D  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYQDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D    G DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQID---LGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MY+VAQ LGAI G GLVKAFQK+YY +YGGGANELA+GYS G GL AEIIGTF
Sbjct  118  VSLVRAVMYIVAQSLGAIAGVGLVKAFQKSYYTKYGGGANELAEGYSTGVGLAAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  238  DKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  282



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   457 bits (1175),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 257/291 (88%), Gaps = 7/291 (2%)
 Frame = +2

Query  80   MGKDVEV------GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtv  241
            M KD+E       G E+S KDY DPPPAP ID EEL +WS YRA IAEF+ATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  242  ltvIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  418
            LTVIGYK QTDP     D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  419  FLARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAE  598
            F+ RKVSL+RA++YMVAQCLGAICGCGLVKAFQK YY  YGGGANEL DG++KGTGLGAE
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGAE  180

Query  599  IIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG  778
            IIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG
Sbjct  181  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  240

Query  779  AAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            AAVIY ++KAWDDQWIFWVGPFIGA +AA YHQ+ILRA A+KALGS RSNA
Sbjct  241  AAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  291



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   456 bits (1174),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 256/286 (90%), Gaps = 4/286 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            MGKDVE    G E++ KDY DPPPA  ID EE+ +WS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEGGEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP+V G DA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSLVRA++YM+AQCLGAICG GLVK FQ+AYY RYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLVRALLYMIAQCLGAICGVGLVKGFQRAYYDRYGGGANELSSGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
            IY  +KAWDDQWIFWVGPFIGAAIAA YHQ++LRA A KALGS RS
Sbjct  241  IYNNEKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGKALGSFRS  286



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   456 bits (1174),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 256/286 (90%), Gaps = 4/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKDVE     EYS KDYQDPPPAP IDPEEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MGKDVEGAEQGEYSAKDYQDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK Q+       D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKVQSS--APDADDCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  118

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++YMVAQCLGAICG GLVK FQK +Y + GGGANELA GY+KG GLGAEIIGTF
Sbjct  119  VSLIRAVLYMVAQCLGAICGVGLVKGFQKTHYNQNGGGANELAPGYNKGVGLGAEIIGTF  178

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  179  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  238

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             +DKAWDDQWIFWVGPFIGAAIAA YHQFILRA  LKALGS RSNA
Sbjct  239  NQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAEPLKALGSFRSNA  284



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   456 bits (1174),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 234/286 (82%), Positives = 260/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV  G   + +DYQDPPPAP  D EELG+WS YRA+IAEFVATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN+LADGY+KGTGLGAEIIGTF
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             ++KAWDDQWIFWVGP IGAA AA+YHQF+LRA  +K+LGS RS+A
Sbjct  240  NQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFRSSA  285



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   456 bits (1174),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 239/293 (82%), Positives = 262/293 (89%), Gaps = 14/293 (5%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E     E++ KDYQDPPP P  D EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEGAEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTA-------GISGGHINPAVTF  412
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTA        I+GGHINPAVTF
Sbjct  61   GYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAPPSCFSMTIAGGHINPAVTF  115

Query  413  GLFLARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLG  592
            GLFLARKVSL+RA++Y+VAQCLGAICG GLVKAFQK+YYV+YGGGANELADGY+KGTGLG
Sbjct  116  GLFLARKVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLG  175

Query  593  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS  772
            AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS
Sbjct  176  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS  235

Query  773  FGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            FGAAVIY KDKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  FGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  288



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   456 bits (1173),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 238/284 (84%), Positives = 256/284 (90%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPAP  D +EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+YY RYGGGAN LADG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKRYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
             +DKAWDD WIFWVGPF GAAIAA YHQFILRAGA+KALGS RS
Sbjct  238  NQDKAWDDHWIFWVGPFAGAAIAAFYHQFILRAGAVKALGSFRS  281



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   456 bits (1172),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 255/285 (89%), Gaps = 7/285 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV  +  YS KDY DPPPA  ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MSKDVEVAEQPAYSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQT      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTT-----TDPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL RA++YMVAQCLGAICG GLVKAFQK+Y+ RYGGGANE+A GY+KGT LGAEIIGTF
Sbjct  116  VSLFRAVLYMVAQCLGAICGVGLVKAFQKSYFDRYGGGANEVASGYNKGTALGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
               KAWDDQWIFWVGPF GAAIAA YHQFILRA A+KALGS RSN
Sbjct  236  NNSKAWDDQWIFWVGPFAGAAIAAFYHQFILRAAAIKALGSFRSN  280



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   456 bits (1172),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 237/284 (83%), Positives = 257/284 (90%), Gaps = 2/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+EVG  ++ KDY DPPP P IDPEE G+WSFYRAIIAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDIEVGG-FAAKDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+D  + G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   KSQSDT-LKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L RA+MY+VAQ LGAICGC LVK+FQ A Y  YGGGAN LADGY+KGTGL AEIIGTFVL
Sbjct  119  LPRAVMYIVAQSLGAICGCALVKSFQSALYTNYGGGANGLADGYNKGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY  
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNN  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDD WIFWVGPFIGAAIAA+YHQ+ILRAGA+KALGS RS++
Sbjct  239  EKAWDDHWIFWVGPFIGAAIAAMYHQYILRAGAVKALGSFRSSS  282



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   456 bits (1172),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 254/285 (89%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKDVEV     +S KDY DPPP P ID  EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MGKDVEVAEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY+SQTD    G D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYRSQTDQAHNGGD-CEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVK FQKAYY+R GGGAN LA GYSKG GLGAEIIGTF
Sbjct  120  VSLIRAVMYMVAQCLGAICGVGLVKGFQKAYYMRSGGGANSLALGYSKGVGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAWDD WIFWVGPF GAA+AA+YHQ+ILRA A+KALGS RSN
Sbjct  240  NKDKAWDDHWIFWVGPFTGAALAALYHQYILRAAAIKALGSFRSN  284



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   456 bits (1172),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 236/286 (83%), Positives = 260/286 (91%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE     E++ KDY DPPP P  D EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ++      D CGGVGILGIAWAFGGMIF+LVY TAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYYTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y++AQCLGAICG GLVKAFQK+YYV++GGGANEL+ GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKFGGGANELSAGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_004487111.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=287

 Score =   456 bits (1172),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 234/286 (82%), Positives = 253/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            MGKDVEV   G EYS KDYQDPPPAP  DP EL +WS YRA+IAEF+ATLLFLY+TVLT+
Sbjct  1    MGKDVEVQEQGGEYSAKDYQDPPPAPLFDPAELTKWSLYRAVIAEFIATLLFLYITVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGY  QTD  +TG   C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYSRQTDTTITGNTECDGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLGR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++Y++AQCLGAICG GL K FQK+YY RY GG N ++DGYSKGT LGAEIIGT
Sbjct  121  KVSLIRAVLYIIAQCLGAICGAGLAKGFQKSYYNRYHGGVNLVSDGYSKGTALGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG AVI
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            Y  DKAWDDQWI+WVGPFIGAAIAA YHQFILRA A+KALGS RSN
Sbjct  241  YNNDKAWDDQWIYWVGPFIGAAIAAFYHQFILRATAIKALGSFRSN  286



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   456 bits (1172),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 254/285 (89%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP  D  EL +WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD  V   DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDTAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA++YMVAQ LGAI G  LVKAFQK+YY +YGGGANEL+ GYS G GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYTKYGGGANELSQGYSTGVGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K KAWDDQWIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   456 bits (1172),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 240/287 (84%), Positives = 257/287 (90%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD E G        KDYQDPPP+P  D EEL +WSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDFETGGGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP V+G DA CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RK+SL+RAIMYMVAQCLGAICG G VKAFQ AYY +YGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            IY  +KAWDDQWIFWVGPFIGAAIAAIYHQ+ILRAG +KALGS RS+
Sbjct  241  IYNNNKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGFIKALGSFRSS  287



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   456 bits (1172),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 251/283 (89%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+V     ++ KDYQDPPPAP IDP EL QWSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKNVGSEGSFTTKDYQDPPPAPLIDPAELTQWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KS++DP     D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSESDP-AKNADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L+DGYSK  GL AEIIGTFVL
Sbjct  120  LIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSKSVGLSAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            DKAW D WIFWVGPFIGAAIAA YHQFILRAGA KALGS RS+
Sbjct  240  DKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSS  282



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   455 bits (1171),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/279 (84%), Positives = 251/279 (90%), Gaps = 2/279 (1%)
 Frame = +2

Query  101  GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKSQTDPH  280
            G +++ KDY DPPPAP +D  EL  WS YRA+IAEF+ATLLFLY+TV TVIGYK QTDP 
Sbjct  12   GGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDPA  71

Query  281  VTGTD--ACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAI  454
            V      ACGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+
Sbjct  72   VNSAADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAL  131

Query  455  MYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVF  634
            +YMVAQCLGA+CG GLVKAFQ AY+VRYGGGAN LA GYSKGTGL AEIIGTFVLVYTVF
Sbjct  132  LYMVAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVF  191

Query  635  SATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDKAWD  814
            SATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDKAWD
Sbjct  192  SATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWD  251

Query  815  DQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DQWIFWVGP IGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  252  DQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   455 bits (1170),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/284 (84%), Positives = 254/284 (89%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKDVE   E+S KDY DPPPAP ID EEL QWSFYRA IAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MGKDVEAATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ AYY RYGGGAN +A G++KG GL AEIIGTFVL
Sbjct  120  LIRALVYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANVMAAGHTKGVGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DKAWD+ WIFWVGPFIGA  AA YHQ+ILRAGA+KALGS RSNA
Sbjct  240  DKAWDEHWIFWVGPFIGAFAAAAYHQYILRAGAVKALGSFRSNA  283



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   455 bits (1170),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 235/287 (82%), Positives = 255/287 (89%), Gaps = 5/287 (2%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+E    G E+S KDY DPPPAP +D EEL +WS YRA+IAEFVATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP V  TDA C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            IY KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSN
Sbjct  241  IYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN  286



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 237/289 (82%), Positives = 252/289 (87%), Gaps = 5/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E       E+S KDY DPPPAP ID  EL QWS YRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTD   +G DA CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGANEL+DGYSKGTGL AEII
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY  DKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K   S RSNA
Sbjct  241  VIYNNDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASASKLGSSYRSNA  289



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 232/286 (81%), Positives = 258/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV  G   + +DY DPPPAP +D EE G+WS YRA+IAEFV TLLFLYV+VLTVI
Sbjct  1    MAKDLEVQEGGATAARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGTF
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             ++KAWDDQWIFWVGP IGAA AA+YHQF+LRA  +K+LGS RS+A
Sbjct  240  NQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFRSSA  285



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/288 (83%), Positives = 256/288 (89%), Gaps = 5/288 (2%)
 Frame = +2

Query  80   MGKDVEVGNE----YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M K+VEV  E    +S KDY DPPPAP +D EEL QWS YRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YMVAQCLGAICG GLVK FQ AYYVRYGGGAN +A G++KG GL AEIIG
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVGLVKGFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY +DKAWD+ WIFWVGPFIGA  AA+YHQFILRAGA+KALGS RSNA
Sbjct  240  IYNQDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFRSNA  287



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   454 bits (1169),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 253/284 (89%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K +EVG E+  KDY DPPPAP +D +EL +WSFYRA+IAEF+ATL FLY+TVLTVIGY
Sbjct  1    MAKAIEVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K+QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KTQTDLAKGGED-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI YM AQCLGAICGCGLVKAFQ +YY +YGGGAN LA+GYS GTGL AEIIGTFVL
Sbjct  120  LVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            DK WDD WIFWVGPFIGAAIAAIYHQF+LRA   KALGS RS++
Sbjct  240  DKIWDDHWIFWVGPFIGAAIAAIYHQFVLRASGAKALGSFRSSS  283



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   454 bits (1169),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 257/286 (90%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE     E++ KDY DPPP PF D EEL +WSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSS-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL RA++Y+VAQ LGAICG GLVKAFQK YY  YGGGANELA GY+KGTGLGAEIIGTF
Sbjct  116  VSLPRAVLYIVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA+YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   454 bits (1169),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 256/287 (89%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEVGNE---YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVE  +    +S KDY DPPPAP  D  EL QWSFYRA+IAEF+ATLLFLYVTVLTV
Sbjct  1    MAKDVECADPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK Q+D  V G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKVQSDA-VHGGDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQCLGAICG GLVKAFQK+YYVRYGGGAN LA GY+ G GLGAEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYVRYGGGANTLAHGYNTGVGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +  DKAWDDQWIFWVGPF+GAAIAA YHQFILRA A+KALGS RS+A
Sbjct  240  FNNDKAWDDQWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSHA  286



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   454 bits (1169),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 257/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+ V  +  YS KDYQDPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+T+LTVI
Sbjct  1    MAKDMGVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ DP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA +YMVAQCLGAICG  LVKAFQ +YY  YGGGANEL+ GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAGLYMVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             ++KAW D W+FWVGPFIGAAIAA YHQFILRAGA+KALGS RS++
Sbjct  240  NQEKAWHDHWMFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSSS  285



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   454 bits (1167),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 239/286 (84%), Positives = 257/286 (90%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE     E++ KDY DPPP PF D EEL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSS-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL RA++Y++AQ LGAICG GLVKAFQK YY  YGGGANELA GY+KGTGLGAEIIGTF
Sbjct  116  VSLPRAVLYIIAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFW+GPFIGAAIAA+YHQ+ILRAGA+KALGS RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   454 bits (1168),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 239/288 (83%), Positives = 255/288 (89%), Gaps = 5/288 (2%)
 Frame = +2

Query  80   MGKDVEVGNE----YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M K+VEV  E    +S KDY DPPPAP +D EEL QWS YRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN +A G++KG GL AEIIG
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY  DKAWD+ WIFWVGPFIGA  AA+YHQFILRAGA+KALGS RSNA
Sbjct  240  IYNHDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFRSNA  287



>ref|XP_006481457.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Citrus sinensis]
 ref|XP_006481458.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Citrus sinensis]
Length=287

 Score =   454 bits (1167),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 248/285 (87%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EVG   E+  KDY DPPPAP ID EEL QWSFYRA IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAICGCGLVKAFQK+YY RYGGGANELADGYS G GLGAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR ARD HVPVLAPL IGFAVFMVHLATIPVTGTGINPARSFG AVIY
Sbjct  180  VLVYTVFSATDPKRKARDPHVPVLAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDKAWDDQWIFWVGPFIGAAIAA YHQFILRA A KALGS+RS+
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAAKALGSRRSS  284



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   454 bits (1167),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 254/286 (89%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    EY+ KDYQDPPPAP  DPEEL QWSFYRA+IAEF+ATLLFLYVTVLT+I
Sbjct  1    MAKDVEVQEQGEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTII  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD +V GT+ C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   GYKRQTDANVGGTE-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y+VAQC GAICG GL K FQKAYY R GGGAN +ADGY+KGT LGAEIIGTF
Sbjct  120  VSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRCGGGANSVADGYNKGTALGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
             LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTG GINPARSFGAAVIY
Sbjct  180  ALVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGAGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              +K WDDQWIFWVGP IGAA+AA YHQ+ILRA A+KALGS RSNA
Sbjct  240  NNEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score =   453 bits (1166),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 252/284 (89%), Gaps = 3/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+V     ++ KDYQDPPPAP IDPEEL QWSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKNVNSEGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+    T +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQS---ATTSDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  117

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L+DGYS G GL AEIIGTFVL
Sbjct  118  LIRALMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFVL  177

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ +
Sbjct  178  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQ  237

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KAW D WIFWVGPFIGAAIAA YHQFILRAGA KALGS RS++
Sbjct  238  HKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSS  281



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   453 bits (1166),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 255/285 (89%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKVQSDVK-NGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAI+YMVAQCLGAICG GLVKAFQK++Y +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  120  VSLIRAILYMVAQCLGAICGVGLVKAFQKSHYNKYGGGANSLNDGYSTGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+A DSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSAGDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             + K WDD WIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NQSKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   453 bits (1165),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 230/284 (81%), Positives = 257/284 (90%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+EV    + +DYQDPPPAP  D EELG+WS YRA+IAEFVATLLFLYV++LTVIGY
Sbjct  1    MAKDLEVQEGRAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KAQTDASAGGAD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVR ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN+LA+GY+KGTGLGAEIIGTFVL
Sbjct  120  LVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VY VF+ATDPKR+ARDSH+PVLAPLPIGFA FMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYPVFAATDPKRSARDSHIPVLAPLPIGFAAFMVHLATIPITGTGINPARSFGAAVIYNQ  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +KAWDDQWIFWVGP IGAA AA+YHQF+LRA  +K+LGS RS+A
Sbjct  240  EKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFRSSA  283



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   453 bits (1166),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 253/285 (89%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY  QTD    G DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVK-AGGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAI G GLVKAFQ AY+ RYGGGAN L DGYS G GLGAEI+GTF
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS G+AVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGSAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDK WDD WIFWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   453 bits (1166),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 237/287 (83%), Positives = 255/287 (89%), Gaps = 6/287 (2%)
 Frame = +2

Query  86   KDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            +D+E       E+S KDY DPPPAP ID +EL +WS YRA+IAEF+ATLLFLY+TV TVI
Sbjct  4    QDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVI  63

Query  254  GYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            GYK QTD   +G DA CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  64   GYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  123

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGANEL+DGYSKGTGL AEIIGT
Sbjct  124  KVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGT  183

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  184  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  243

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSNA
Sbjct  244  YNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA  289



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   453 bits (1165),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 237/290 (82%), Positives = 257/290 (89%), Gaps = 6/290 (2%)
 Frame = +2

Query  80   MGKD--VEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvl  244
            M KD  +E G    +++ KDY DPPPAP ID  EL  WS YRA+IAEF+ATLLFLY+TV 
Sbjct  1    MAKDEVMESGGGHQDFAAKDYTDPPPAPLIDAAELASWSLYRAVIAEFIATLLFLYITVA  60

Query  245  tvIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  421
            TVIGYK QTD   +G DA CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  61   TVIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  120

Query  422  LARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEI  601
            LARKVSLVRA++YM+AQCLGA+CG GLVKAFQ AY+VRYGGGAN LA GYSKGTGL AEI
Sbjct  121  LARKVSLVRALLYMIAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEI  180

Query  602  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGA  781
            IGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA
Sbjct  181  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  240

Query  782  AVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            AVI+ KDKAWDDQWIFWVGP +GAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  241  AVIFNKDKAWDDQWIFWVGPMVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>gb|ABX83874.1| plasma membrane intrinsic protein [Rhododendron catawbiense]
Length=284

 Score =   453 bits (1165),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/286 (82%), Positives = 256/286 (90%), Gaps = 6/286 (2%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M K++ V  +  +S KDY DPPPAP IDP+EL +WSFYRA+IAEF+ TLLFLY+TVLTVI
Sbjct  1    MAKEMGVAEQGSFSAKDYHDPPPAPLIDPQELVKWSFYRAVIAEFITTLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQTD      D CGGVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD----NADPCGGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  116

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG  LVKAFQK++Y RYGGGAN LA GYSKGTGL AEIIGTF
Sbjct  117  VSLIRALMYMVAQCLGAICGVALVKAFQKSHYDRYGGGANSLALGYSKGTGLAAEIIGTF  176

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              DKAW+DQW+FWVGPFIGAAIAA YHQFILRAGA+KALGS RS +
Sbjct  237  NNDKAWNDQWMFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSGS  282



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   453 bits (1165),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 256/286 (90%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSL--KDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E   +  +  KDY DPPPAP  D  ELGQWSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++YMVAQCLGAICG GLVKAFQK YY RY GGAN L+ GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
              +KAWDDQWIFWVGPFIGAAIAAIYHQF+LRA A KALGS RS++
Sbjct  240  NNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFRSSS  285



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   453 bits (1165),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/284 (83%), Positives = 251/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDV     +  KDY DPPPAP  DP EL +WSFYRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MTKDVAEHGSFPAKDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ DP + G DACGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQIDPALKG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG  LVKAFQ AYYV+YGGGAN L+DGYS G GLGAEI+GTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVALVKAFQSAYYVKYGGGANSLSDGYSTGVGLGAEIVGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR ARDSHVPVLAPLPIGFAVF+VHLATIPVTGTGINPARS GAAVIY  
Sbjct  180  VYTVFSATDPKRKARDSHVPVLAPLPIGFAVFIVHLATIPVTGTGINPARSLGAAVIYNN  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            D AW D W+FWVGPFIGAA+AA YHQFILRAGA KALGS RSN+
Sbjct  240  DTAWKDHWLFWVGPFIGAALAAFYHQFILRAGAAKALGSFRSNS  283



>ref|NP_001274386.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33477.1| plasma intrinsic protein 2-1 [Cucumis sativus]
 gb|KGN48148.1| hypothetical protein Csa_6G445130 [Cucumis sativus]
Length=284

 Score =   452 bits (1164),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 252/285 (88%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E G    +S KDY+DPPPAP IDP E  QWSFYRAIIAEFVATLLFLYVTVLTVI
Sbjct  1    MPKDIEAGAHGGFSGKDYEDPPPAPLIDPHEFAQWSFYRAIIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK Q+D    G + CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKVQSDVK-NGGETCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI+YM AQ LGAICGC LVKAFQ A+Y  YGGGAN LADGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMAAQSLGAICGCALVKAFQNAHYTEYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV++
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVVF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K K WDDQWIFWVGPFIGAAIAAIYHQFILRAGA KALGS  S+
Sbjct  240  NKSKPWDDQWIFWVGPFIGAAIAAIYHQFILRAGAAKALGSFSSS  284



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   452 bits (1164),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 254/287 (89%), Gaps = 5/287 (2%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+E    G E+S KDY DPPPAP +D EEL +WS YRA+IAEFVATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP V  TDA C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            IY  DKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSN
Sbjct  241  IYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN  286



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   452 bits (1164),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/288 (83%), Positives = 252/288 (88%), Gaps = 7/288 (2%)
 Frame = +2

Query  80   MGKDVEV-----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvl  244
            M KD+E      G EY+ KDY DPPPAP ID EEL +WS YRA+IAEFVATLLFLY+TV 
Sbjct  1    MAKDIEAAAAPEGGEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVA  60

Query  245  tvIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  421
            TVIGYK QTD   +G DA CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GLF
Sbjct  61   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGLF  120

Query  422  LARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEI  601
            LARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGANEL+DGYSKGTGL AEI
Sbjct  121  LARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  180

Query  602  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGA  781
            IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GA
Sbjct  181  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  240

Query  782  AVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
            AVIY  DKAWDD WIFWVGPFIGAAIAA YHQ++LRA A K LGS  S
Sbjct  241  AVIYNNDKAWDDHWIFWVGPFIGAAIAAAYHQYVLRASASK-LGSSAS  287



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   452 bits (1164),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 254/283 (90%), Gaps = 1/283 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            MGKD E G E S KDY DPPPAP ID EE+ QWSFYRAIIAEFVATLLFLY+TVLTVIGY
Sbjct  1    MGKDFEGGGELSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K+QTD H  G + CGGVGILGIAWAFGGM FILVYCTAGISG HINPAVTFGLFLARKVS
Sbjct  61   KNQTDVHKNGHE-CGGVGILGIAWAFGGMNFILVYCTAGISGRHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRAI+YMVAQCL AICGCGLVKAF K+YY  +GGG + LA  YSKGTGLGAEIIGTFVL
Sbjct  120  LVRAILYMVAQCLWAICGCGLVKAFPKSYYTNHGGGTHGLAIRYSKGTGLGAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVF ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K
Sbjct  180  VYTVFCATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +KAWDD WIFWVGPFIGAAIAA+YHQFILRA A+K+LGS RS+
Sbjct  240  EKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   452 bits (1164),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 237/287 (83%), Positives = 253/287 (88%), Gaps = 3/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD EV    EY  KDY DPPPAP ID EEL +WS YRA IAEFVAT+LFLYVTV TVI
Sbjct  1    MAKDTEVAGRGEYGGKDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATVI  60

Query  254  GYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            GYK Q+DP+V   DA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   GYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLAR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YMVAQCLGAICG GLVK FQ+AY+VRYGGGANEL+ GYSKGTGL AEIIGT
Sbjct  121  KVSLVRALLYMVAQCLGAICGVGLVKGFQEAYFVRYGGGANELSAGYSKGTGLAAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  181  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y +DKAWDDQWIFWVGPF+GAAIAA YHQ++LRA   KA+GS  SNA
Sbjct  241  YNQDKAWDDQWIFWVGPFVGAAIAAAYHQYVLRASGAKAMGSFGSNA  287



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   452 bits (1163),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 254/286 (89%), Gaps = 4/286 (1%)
 Frame = +2

Query  80   MGKDVE---VGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M K+VE      EYS KDY DPPPA F D +EL +WSFYRA+IAEFVATLLFLY+ VLTV
Sbjct  1    MAKEVEGVSEQPEYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK QTDP   G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKHQTDPDAGGAD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL RA  YMVAQCLGAICG GLVKAFQ++YY RY GGAN +A GY+KG GL AEIIGT
Sbjct  120  KVSLPRAFFYMVAQCLGAICGVGLVKAFQRSYYHRYEGGANMVAPGYTKGVGLSAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            YG DKAWDDQWIFWVGPF+GAAIAA+YHQ+ILRAGA+KALGS RSN
Sbjct  240  YGADKAWDDQWIFWVGPFVGAAIAALYHQYILRAGAIKALGSFRSN  285



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score =   452 bits (1163),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 251/284 (88%), Gaps = 3/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+V     ++ KDYQDPPPAP IDPEEL QWSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKNVGSEGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+    T TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQS---ATATDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  117

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L+D YS G GL AEIIGTFVL
Sbjct  118  LIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDDYSHGVGLSAEIIGTFVL  177

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ +
Sbjct  178  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQ  237

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KAW D WIFWVGPFIGAAIAA YHQFILRAGA KALGS RS++
Sbjct  238  HKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSS  281



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   452 bits (1163),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 254/284 (89%), Gaps = 3/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSL--KDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+E   +  +  KDY DPPPAP  D  ELGQWSFYRA+IAEFVATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++YMVAQCLGAICG GLVKAFQK YY RY GGAN L+ GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
              +KAWDDQWIFWVGPFIGAAIAAIYHQF+LRA A KALGS RS
Sbjct  240  NNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFRS  283



>tpg|DAA64687.1| TPA_exp: aquaporin PIP2 10 [Nicotiana tabacum]
Length=283

 Score =   452 bits (1163),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/284 (82%), Positives = 252/284 (89%), Gaps = 3/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+V     ++ KDYQDPPPAP IDPEEL QWSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKNVNSEGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K+Q+    T +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KNQS---ATTSDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  117

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L+DGYS G GL AEIIGTFVL
Sbjct  118  LIRALMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFVL  177

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ +
Sbjct  178  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQ  237

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KAW D WIFWVGPFIGAAIAA YHQFILRAGA KALGS RS++
Sbjct  238  HKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSS  281



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   452 bits (1162),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/281 (86%), Positives = 251/281 (89%), Gaps = 2/281 (1%)
 Frame = +2

Query  86   KDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKS  265
             DVE G  +S KDY DPPPAP ID EEL QWSFYRA+IAEF+ATLLFLY+TVLTVIGYKS
Sbjct  4    HDVE-GGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKS  62

Query  266  QTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLV  445
            Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+
Sbjct  63   QSDVK-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI  121

Query  446  RAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVY  625
            RAIMYMVAQCLGAICG GLVKAFQKAYY RYGGGANEL++GYS G GLGAEIIGT   VY
Sbjct  122  RAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTSGGVY  181

Query  626  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDK  805
            TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLA IPVTGTGINPARS GAAV+Y + K
Sbjct  182  TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLANIPVTGTGINPARSLGAAVMYNQQK  241

Query  806  AWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            AWDD WIFWVGPFIGAAIAA YHQFILRAGA KALGS RSN
Sbjct  242  AWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   452 bits (1162),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/288 (83%), Positives = 257/288 (89%), Gaps = 4/288 (1%)
 Frame = +2

Query  80   MGKDVEVG---NEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+E      E+  KDY DPPPAPF+   EL +WSFYRA+IAEFVATLLFLY+TV TV
Sbjct  1    MAKDIEAAAGAGEFPAKDYTDPPPAPFLGIGELTKWSFYRALIAEFVATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+D  +   +A C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDTTLGTPNADCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++YM+AQCLGAICG GLVK FQKA+YVRYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLIRAVLYMIAQCLGAICGVGLVKGFQKAFYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY K KAWDDQWIFWVGPFIGAAIAA YHQ+ILRAGA+KALGS RSNA
Sbjct  241  IYNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILRAGAIKALGSFRSNA  288



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   451 bits (1161),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 236/284 (83%), Positives = 254/284 (89%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPAP  D +EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQID---GSADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+YY +YGGGAN LADG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
             +DKAWD  WIFWVGPF GAAIAA YHQFILRAGA+KALGS RS
Sbjct  238  NQDKAWDGHWIFWVGPFAGAAIAAFYHQFILRAGAVKALGSFRS  281



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   451 bits (1161),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 251/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE   G  +  +DYQDPPPAP  DPEEL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + K WDD WIFWVGPF+GAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  NESKPWDDHWIFWVGPFVGAAIAAFYHQFVLRASGSKSLGSFRSAA  285



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   451 bits (1161),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 236/284 (83%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    Y  +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGAEGYQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   451 bits (1160),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 251/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE   G  +  +DYQDPPPAP  DPEEL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK +TD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIETDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  NESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  285



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   451 bits (1160),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 242/287 (84%), Positives = 261/287 (91%), Gaps = 3/287 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV    EY+ KDY DPPPAP +D EEL +WS YRA IAEF+AT+LFLYVTVLTVI
Sbjct  1    MAKDIEVAEQGEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            GYK Q+DP+V  TDA C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   GYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA +Y+VAQCLGAICG GLVK FQKAY+VRYGGGANEL+DGYSKGTGLGAEIIGT
Sbjct  121  KVSLVRAFLYIVAQCLGAICGVGLVKGFQKAYFVRYGGGANELSDGYSKGTGLGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  181  FVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y KDKAWDDQWIFWVGP IGAAIAA YHQ++LRA  +KALGS RS+A
Sbjct  241  YNKDKAWDDQWIFWVGPAIGAAIAAAYHQYVLRASGVKALGSFRSSA  287



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   451 bits (1160),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 236/288 (82%), Positives = 257/288 (89%), Gaps = 5/288 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD EV    G E+  KDY+DPPPAP +D EEL +WSFYRA+IAEFVATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  248  vIGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            VIGY  Q+D    G D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYSRQSDT-THGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            R+VSLVRAI+YMVAQCLGA+CGCGLVKAFQ+AYY RYGGGAN L  GYSKGTGLGAEIIG
Sbjct  120  RRVSLVRAILYMVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIG  179

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTV SATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFVLVYTVLSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +Y K+KAWDDQWIFWVGPFIGAAIAA YHQ +LRA A+KALGS RS++
Sbjct  240  MYNKEKAWDDQWIFWVGPFIGAAIAAFYHQHVLRAAAIKALGSFRSSS  287



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   451 bits (1159),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 234/281 (83%), Positives = 254/281 (90%), Gaps = 1/281 (0%)
 Frame = +2

Query  89   DVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKSQ  268
            DV+ G   + +DY+DPPPAP +D EE+ +WS YRA+IAEFVATLLFLYV+VLTVIGYK+Q
Sbjct  6    DVQEGGAPAARDYRDPPPAPLLDMEEIRKWSLYRAVIAEFVATLLFLYVSVLTVIGYKAQ  65

Query  269  TDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVR  448
            TD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR
Sbjct  66   TDATAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVR  124

Query  449  AIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVYT  628
             ++Y+VAQCLGAICGCGLVKAFQ +YY RYGGGANELADGY+KGTGLGAEIIGTFVLVYT
Sbjct  125  TVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYT  184

Query  629  VFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDKA  808
            VFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY  +KA
Sbjct  185  VFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKA  244

Query  809  WDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            WDDQWIFWVGP IGAA AA YHQFILRA A+KALGS RS A
Sbjct  245  WDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFRSFA  285



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   451 bits (1159),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 253/287 (88%), Gaps = 5/287 (2%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD+E    G E+S KDY DPPPAP +D EEL +WS YRA+IAEFVATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP V  TDA C GVG LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            IY  DKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSN
Sbjct  241  IYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN  286



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   451 bits (1159),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 238/289 (82%), Positives = 253/289 (88%), Gaps = 6/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E       E+S KDY DPPPAP ID EEL +WS YRA IAEFVATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTD   +G DA CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSLVRA++Y++AQCLGAICG GLVK FQ AY+VRYGGGANEL+ GYSKGTGL AEII
Sbjct  121  ARKVSLVRAVLYIIAQCLGAICGVGLVKGFQSAYFVRYGGGANELSAGYSKGTGLAAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY  DKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RSNA
Sbjct  241  VIYNNDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSFRSNA  288



>gb|KDO41796.1| hypothetical protein CISIN_1g023108mg [Citrus sinensis]
Length=287

 Score =   450 bits (1158),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 259/286 (91%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EVG E  +  KDY DPPPAP I  EEL +WSFYRAIIAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGREGEFHDKDYHDPPPAPLIGAEELTRWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            G+KSQTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GHKSQTDAK-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQCLGAICGCGLVKAFQK+YY RYGGGANELADGYS G GLGAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR ARD HVPVLAPL IGFAVFMVHLATIPVTGTGINPARSFG AVIY
Sbjct  180  VLVYTVFSATDPKRKARDPHVPVLAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             KDKAWDDQWIFWVGPFIGAAIAA+YHQFILRA A KALGS+RS++
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAALYHQFILRASASKALGSRRSSS  285



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   450 bits (1157),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 259/287 (90%), Gaps = 8/287 (3%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M K+VE      E++ KDY DPPPAP ID +EL +WSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKEVECAEPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQ++      D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSE-----YDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQCLGAICG G VKAFQK++Y ++GGGAN LA GY+KGTGLGAEIIGT
Sbjct  116  KVSLIRAVLYMVAQCLGAICGVGFVKAFQKSHYNKFGGGANTLALGYNKGTGLGAEIIGT  175

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  176  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  235

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +  +KAWDD WIFWVGPFIGAAIAAIYHQF+LRAGA+KALGS RSNA
Sbjct  236  FNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLRAGAIKALGSFRSNA  282



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   450 bits (1157),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/289 (82%), Positives = 254/289 (88%), Gaps = 6/289 (2%)
 Frame = +2

Query  80   MGKDVEV----GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvlt  247
            M KD+E     G E+S KDY DPPPAP +D EEL +WS YRA IAEFVATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  248  vIGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  424
            VIGYK QTD   +G DA CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  120

Query  425  ARKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEII  604
            ARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGANEL+ GYSKGTGL AEII
Sbjct  121  ARKVSLVRAVLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSAGYSKGTGLAAEII  180

Query  605  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  784
            GTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAA
Sbjct  181  GTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  240

Query  785  VIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            VIY  DKAWDDQWIFWVGP IGAAIAA YHQ++LRA A K LGS RS++
Sbjct  241  VIYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSSS  288



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   449 bits (1156),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/286 (83%), Positives = 252/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE   G  +  +DYQDPPPAP  DPEEL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVPGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI+YMVAQCLGAICG G VKAFQ +YY+RYGGGAN LA+GYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYIRYGGGANSLAEGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + K WDD WIFWVGPFIGAAIAAIYHQF+LRA   K+LGS RS A
Sbjct  240  NESKPWDDHWIFWVGPFIGAAIAAIYHQFVLRASGSKSLGSFRSAA  285



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   449 bits (1156),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 253/287 (88%), Gaps = 3/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            MGKDVEV   G E+S KDYQDPPPAP  D  E  +WS YRA+IAEFVATLLFLY+TVLT+
Sbjct  1    MGKDVEVQEQGAEFSAKDYQDPPPAPLFDSAEFKKWSLYRAVIAEFVATLLFLYITVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK Q+D  + G   C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  61   IGYKRQSDTDIKGNTECDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++Y++AQCLGAICG GL K FQ +YY RYGGGAN ++DGYSKGT LGAEIIGT
Sbjct  121  KVSLIRALLYIIAQCLGAICGAGLAKGFQSSYYNRYGGGANTVSDGYSKGTALGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG AVI
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +  DKAWDDQWI+WVGPFIGAA+AAIYHQ+ILR  A+KALGS RSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>ref|XP_008449255.1| PREDICTED: aquaporin PIP2-2-like [Cucumis melo]
Length=284

 Score =   449 bits (1156),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 251/283 (89%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD + G  ++ KDY DPPPAPFIDP E  QWSFYRAIIAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MAKDSDAG-AFAAKDYHDPPPAPFIDPHEFTQWSFYRAIIAEFIATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   SSQSDIKHNG-QICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICGC LVK+FQK  Y+RYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  119  LVRAVLYMVAQCLGAICGCALVKSFQKGLYIRYGGGANSLADGYSTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV+  +
Sbjct  179  VYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVLNE  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K W+D WIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS 
Sbjct  239  SKPWNDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRST  281



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   449 bits (1156),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    ++ +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G D CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KISSDTK-AGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   449 bits (1155),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 251/287 (87%), Gaps = 3/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVE      EYS KDY DPPPAP IDP+EL +WS YRA IAEF+ATLLFLY+TVLT+
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK Q+D  + G   C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N ++DGY+KGT LGAEIIGT
Sbjct  121  KVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG AVI
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +  DKAWDDQWI+WVGPF+GAA+AAIYHQ+ILR  A+KALGS RSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   449 bits (1154),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 248/284 (87%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE     + +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLY+TVLTVIGY
Sbjct  1    MAKDVEGAEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KISSDTK-AGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_008446888.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=287

 Score =   449 bits (1154),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 229/280 (82%), Positives = 250/280 (89%), Gaps = 0/280 (0%)
 Frame = +2

Query  89   DVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGYKSQ  268
            DV     +S KDY DPPPAP  D  ELG+WSFYRAIIAEF+ATLLFLYVT+LT+IGY SQ
Sbjct  5    DVTAARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIGYNSQ  64

Query  269  TDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVR  448
            TD +  GT+AC GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVR
Sbjct  65   TDTNKPGTNACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVR  124

Query  449  AIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVLVYT  628
            A+ YM+AQCLGA+CG GLVKAFQK+YY +YGGGAN+LA GYSKGTGLGAEI+GTF+LVYT
Sbjct  125  AVAYMIAQCLGAVCGAGLVKAFQKSYYNKYGGGANQLAHGYSKGTGLGAEIVGTFILVYT  184

Query  629  VFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKDKA  808
            VFSATD KRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGT INPARSFG AVI  ++K 
Sbjct  185  VFSATDSKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTSINPARSFGPAVILNREKP  244

Query  809  WDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            WDD WIFWVGPF+GAAIAA YHQFILRAGA KALGS RSN
Sbjct  245  WDDHWIFWVGPFVGAAIAAFYHQFILRAGAAKALGSFRSN  284



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   449 bits (1154),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 236/286 (83%), Positives = 250/286 (87%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV--GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE   G  +  +DYQDPPPAP  DP EL +WSFYRA+IAEFVATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRAI+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + K WDD WIFWVGPF+GAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  NESKPWDDHWIFWVGPFVGAAIAAFYHQFVLRASGSKSLGSFRSAA  285



>gb|ABK93567.1| unknown [Populus trichocarpa]
Length=285

 Score =   448 bits (1153),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 253/284 (89%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPA   D +EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAQLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQID---GSADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+YY +YGGGAN LADG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
             +DKAWD  WIFWVGPF GAAIAA YHQFILRAGA+KALGS RS
Sbjct  238  NQDKAWDGHWIFWVGPFAGAAIAAFYHQFILRAGAVKALGSFRS  281



>ref|NP_001274397.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33478.1| plasma intrinsic protein 2-2 [Cucumis sativus]
 gb|KGN48147.1| Aquaporin [Cucumis sativus]
Length=284

 Score =   448 bits (1153),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 234/283 (83%), Positives = 251/283 (89%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD + G  ++ KDY DPPPAPFIDP E  QWSFYRAIIAEF+ATLLFLYVTVLTVIGY
Sbjct  1    MAKDSDAG-AFAAKDYHDPPPAPFIDPHEFTQWSFYRAIIAEFIATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
             SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   SSQSDIKHNG-QICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICGC LVK+FQK  Y RYGGGAN LA+GYS GTGL AEIIGTFVL
Sbjct  119  LVRAVLYMVAQCLGAICGCALVKSFQKGLYTRYGGGANSLAEGYSTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV++ +
Sbjct  179  VYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVFNE  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             K W+D WIFWVGPFIGAAIAA YHQFILRAGA+KALGS RS 
Sbjct  239  SKPWNDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRST  281



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   448 bits (1153),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    ++ +DYQDPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGAEGFAARDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+
Sbjct  61   KISSDTTAGGVE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVT  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRALLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   448 bits (1152),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    +  +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGAEGFPARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LA+GYS GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLAEGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   448 bits (1152),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 253/287 (88%), Gaps = 4/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M K+VE      E+S KDY DPPPAP +D EEL QWSFYRAIIAEF+ATLLFLY+T+LTV
Sbjct  1    MTKEVESVTERGEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGY+ Q D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYQHQADVD-AGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQCLGAICG G VKAFQ AYY RYGGG N +A G++KG GLGAEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAAGHNKGVGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            Y  DKAWD+ WIFWVGPFIGA IAA YHQF+LRAGA+KALGS RSNA
Sbjct  240  YNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLRAGAIKALGSFRSNA  286



>gb|ABH09328.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   448 bits (1152),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 235/286 (82%), Positives = 255/286 (89%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV    + +LKDY D PPAP + PEELG WSFYRAII+EFVATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDSPPAPLVYPEELGSWSFYRAIISEFVATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK+QTDP+  G + C GVGILGIAWAFGG+IFILVYCTAGISGGHINPAVTFG+FLARK
Sbjct  61   GYKNQTDPYHHGNE-CNGVGILGIAWAFGGVIFILVYCTAGISGGHINPAVTFGVFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSLVRA+MYMVAQC GAICGCGLVK FQ  YY+RYGGGANELA GYS GTGL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQCGGAICGCGLVKLFQDIYYIRYGGGANELASGYSIGTGLAAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLGAAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             + KAW D W+FW GPFIGAAIAA YHQFILRAGA+KALGS +S++
Sbjct  240  NQPKAWSDHWVFWAGPFIGAAIAAFYHQFILRAGAVKALGSFKSSS  285



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 232/283 (82%), Positives = 249/283 (88%), Gaps = 2/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD+E    +  KDY DPPPAP +D EEL +WS YRA+IAEFVATLLFLY+TV TVIGY
Sbjct  1    MAKDIEAAAAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGY  60

Query  260  KSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            K QTD   +G DA CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTFGLFLARKV
Sbjct  61   KHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKV  120

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA++Y+VAQCLGAICG GLVK FQ A+YVRYGGGANEL+ GYSKGTGL AEIIGTFV
Sbjct  121  SLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFV  180

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY 
Sbjct  181  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYN  240

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
             DKAWDD WIFWVGPFIGAAIAA YHQ++LRA A K LGS  S
Sbjct  241  NDKAWDDHWIFWVGPFIGAAIAAAYHQYVLRASAAK-LGSSAS  282



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 249/285 (87%), Gaps = 1/285 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDV     +S KDY DPPPAP  D  ELG+WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDVAEHGSFSGKDYHDPPPAPLFDATELGKWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVT-GTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
             SQT+  +  G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   NSQTNTTLNPGADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  120

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA+MYMVAQCLGAICG GLVKAFQ +YY RYGGGAN LA GYS G G+GAEIIGTFV
Sbjct  121  SLVRAVMYMVAQCLGAICGVGLVKAFQSSYYTRYGGGANSLASGYSVGVGVGAEIIGTFV  180

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ 
Sbjct  181  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  240

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            ++K WDD WIFWVGPF GAAIAA YHQF+LRA A KALGS RS +
Sbjct  241  QEKPWDDHWIFWVGPFAGAAIAAFYHQFVLRAAAAKALGSFRSQS  285



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+VE    ++ +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKEVEGAEGFASRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G D CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KISSDTK-AGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 248/284 (87%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE     + +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGAEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G D CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KISSDTKAGGDD-CGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+VE    ++ +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKEVEGAEGFATRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G D CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KISSDTK-AGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/287 (80%), Positives = 250/287 (87%), Gaps = 3/287 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVE      EYS KDY DPPPAP IDP+EL +WS YRA IAEF+ATLLFLY+TVLT+
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK Q+D  + G   C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N ++DGY+KGT LGAEIIGT
Sbjct  121  KVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFM HLATIPVTGTGINPARSFG AVI
Sbjct  181  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMAHLATIPVTGTGINPARSFGPAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            +  DKAWDDQWI+WVGPF+GAA+AAIYHQ+ILR  A+KALGS RSNA
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>emb|CDY46759.1| BnaA03g17030D [Brassica napus]
Length=285

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KD E    ++ +DYQDPPPAPF D EEL +WS YRA+IAEFVATLLFLYVTVLTV+GY
Sbjct  1    MAKDAEGAEGFATRDYQDPPPAPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVMGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K  +D    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+
Sbjct  61   KISSDTAAGGVE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVT  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LVRALLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score =   447 bits (1151),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 250/285 (88%), Gaps = 3/285 (1%)
 Frame = +2

Query  80   MGKDVEVGNE--YSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV     +S KDY DPPPAP ID EEL +WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY  QTD    G DACGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVK-AGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLARK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RAIMYMVAQCLGAI G GLVKAFQ AY+ RYGGGAN L DGYS G GLGAEI+GTF
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYT FSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS G+AVIY
Sbjct  180  VLVYTAFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGSAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KDK WDD W FWVGPFIGAAIAA YHQFILRAGA+KALGS RSN
Sbjct  240  NKDKPWDDHWFFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   447 bits (1150),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/288 (81%), Positives = 255/288 (89%), Gaps = 4/288 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSL---KDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KD E          KDY DPPPAPF+   EL +WSFYRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDPEAAAGAPAFTAKDYTDPPPAPFLGVGELAKWSFYRAVIAEFIATLLFLYITVATV  60

Query  251  IGYKSQTDPHVTGTDA-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  427
            IGYK Q+DP+++  +A C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL + 
Sbjct  61   IGYKHQSDPNLSTPNAGCEGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLVG  120

Query  428  RKVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIG  607
            RKVSL+RA+ YMVAQCLGAICG G VKAFQKA+YVRYGGGANEL+ GYSKGTGL AEIIG
Sbjct  121  RKVSLIRAVFYMVAQCLGAICGVGFVKAFQKAFYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  608  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  787
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  788  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            IY KDKAWDDQWIFWVGPFIGAAIAA YHQ++LRAGA+KALGS RSNA
Sbjct  241  IYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAIKALGSFRSNA  288



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   447 bits (1150),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 251/284 (88%), Gaps = 2/284 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE G  ++ +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVE-GEGFTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  59

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  60   KIQSDTAAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  118

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGY+ GTGL AEIIGTFVL
Sbjct  119  LIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVL  178

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  179  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  238

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  239  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  282



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   447 bits (1150),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    +  +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGPEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGY+ GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYNTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>emb|CAH60723.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   447 bits (1149),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 253/284 (89%), Gaps = 5/284 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KD+EV     +S KDY DPPPAP  D +EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ D      D+CGGVGILGIA AFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQID---GSADSCGGVGILGIALAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+YY +YGGGAN LADG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSIGTGLGAEIIGTF  177

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
             +DKAWD  WIFWVGPF GAAIAA YHQFILRAGA+KALGS RS
Sbjct  238  NQDKAWDHHWIFWVGPFAGAAIAAFYHQFILRAGAVKALGSFRS  281



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   447 bits (1149),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 233/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    +  +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGPEGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDKTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGY+ GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   447 bits (1149),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/286 (80%), Positives = 250/286 (87%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEV---GNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVE      EYS KDY DPPPAP IDP+EL +WS YRA IAEF+ATLLFLY+TVLT+
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLTI  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYK Q+D  + G   C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSLVRA++YM+AQC GAICG GL K FQK+YY RYGGG N ++DGY+KGT LGAEIIGT
Sbjct  121  KVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIGT  180

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG AVI
Sbjct  181  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVI  240

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
            +  DKAWDDQWI+WVGPF+GAA+AA YHQ+ILRA A+KALGS RSN
Sbjct  241  FNNDKAWDDQWIYWVGPFVGAAVAAFYHQYILRAAAIKALGSFRSN  286



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2-like [Fragaria vesca subsp. vesca]
Length=281

 Score =   446 bits (1148),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 234/286 (82%), Positives = 253/286 (88%), Gaps = 7/286 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVE     E++ KDY DPPP P  D +EL +WSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYKSQ+      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA++Y+VAQ LGAICG GLVKAFQK  Y  YGGGAN LA GYSKGTGL AEIIGTF
Sbjct  116  VSLLRAVLYIVAQSLGAICGVGLVKAFQKTLYDEYGGGANTLAPGYSKGTGLAAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             +DKAWDD W+FW+GPFIGAAIAA YHQF+LRAGA+KALGS RSNA
Sbjct  236  NQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  281



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   447 bits (1149),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 233/284 (82%), Positives = 250/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    +  +DY+DPPP PF D +EL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGY+ GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAAIYHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAIYHQFVLRASGSKSLGSFRSAA  283



>gb|AAG44947.1|AF290620_1 putative PIP2 [Nicotiana glauca]
Length=284

 Score =   446 bits (1148),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/283 (82%), Positives = 248/283 (88%), Gaps = 3/283 (1%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K+V     ++ KDYQDPPPAP IDP EL QWSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKNVGSEGSFTTKDYQDPPPAPLIDPVELTQWSFYRALIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            KSQ+    T TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KSQS---ATTTDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVS  117

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA+MYMVAQCLGAICG GLVKA Q AYY RY GG N L+DGYS G GL AEIIGTFVL
Sbjct  118  LIRAVMYMVAQCLGAICGVGLVKALQSAYYHRYDGGVNMLSDGYSHGVGLSAEIIGTFVL  177

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ +
Sbjct  178  VYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQ  237

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
             KAW D WIFWVGPFIGAAIAA YHQFILRAGA KALGS RS+
Sbjct  238  HKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSS  280



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   446 bits (1148),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 248/284 (87%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M K VE    Y  +DY+DPPP PF D +EL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKGVEGAEGYQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN LADGYS GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   446 bits (1148),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 229/274 (84%), Positives = 248/274 (91%), Gaps = 4/274 (1%)
 Frame = +2

Query  80   MGKDVEVGN---EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVEV     E+S KDY DPPPAP ID EELG+WS YRA+IAEF+ATLLFLY TVLTV
Sbjct  1    MAKDVEVAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQTDP +   D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  61   IGYKSQTDP-LKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KVSL+RA++YMVAQCLGAICGCGLVKAFQKAYY RYGGGANEL+DGY+KGTGLGAEIIGT
Sbjct  120  KVSLIRALLYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELSDGYNKGTGLGAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+VHLATIP+TGTGINPARS GAA+I
Sbjct  180  FVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRA  892
            + KDK WDD WIFWVGPFIGAA+AA+YHQ ++RA
Sbjct  240  FNKDKGWDDHWIFWVGPFIGAALAALYHQVVIRA  273



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   446 bits (1148),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 251/286 (88%), Gaps = 3/286 (1%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            M KDVEV    EYS KDYQDPPPAP ID EEL +WSFYRA+IAEFVATLLFLYVTVLT+I
Sbjct  1    MAKDVEVQEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLTII  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GY  Q+DP   GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ RK
Sbjct  61   GYSHQSDPKAGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGRK  119

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+ YM AQ  GAICG GL K FQKAY+ RYGGGAN + DGY+KGT LGAEIIGTF
Sbjct  120  VSLIRAVFYMAAQSAGAICGTGLAKGFQKAYFDRYGGGANFVHDGYNKGTALGAEIIGTF  179

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFG+AVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGSAVIY  239

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
               K WDDQWIFWVGPFIGAA+AAIYHQ+ILR  A+KALGS RSNA
Sbjct  240  NDGKIWDDQWIFWVGPFIGAAVAAIYHQYILRGSAIKALGSFRSNA  285



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   446 bits (1147),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 250/285 (88%), Gaps = 7/285 (2%)
 Frame = +2

Query  80   MGKDVEVGN--EYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvI  253
            MGKDVEV    E++ KDY DPPPA  ID EEL +WSFYRA+IAEF+ATLLFLYVTV TVI
Sbjct  1    MGKDVEVSEQPEFTAKDYTDPPPAALIDLEELTKWSFYRALIAEFIATLLFLYVTVATVI  60

Query  254  GYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  433
            GYK      V+  D C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYK-----RVSEADQCDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  115

Query  434  VSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTF  613
            VSL+RA+MYMVAQCLGAICG GLVK FQ AYY RYGGGAN L++GY KG GLGAEIIGTF
Sbjct  116  VSLIRAVMYMVAQCLGAICGVGLVKGFQSAYYNRYGGGANTLSNGYDKGVGLGAEIIGTF  175

Query  614  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  793
            VLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  176  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  235

Query  794  GKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSN  928
               KAWDDQWIFWVGPFIGAAIAA YHQ+ILRA A+KALGS RSN
Sbjct  236  NNKKAWDDQWIFWVGPFIGAAIAAAYHQYILRAAAIKALGSFRSN  280



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   446 bits (1147),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 233/284 (82%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDVE    +  +DY+DPPP PF D EEL +WS YRA+IAEFVATLLFLYVTVLTVIGY
Sbjct  1    MAKDVEGPEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY  60

Query  260  KSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  439
            K Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS
Sbjct  61   KIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS  119

Query  440  LVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFVL  619
            L+RA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN LADGY+ GTGL AEIIGTFVL
Sbjct  120  LIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVL  179

Query  620  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGK  799
            VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ +
Sbjct  180  VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNE  239

Query  800  DKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
             K WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS A
Sbjct  240  SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   446 bits (1147),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 249/285 (87%), Gaps = 4/285 (1%)
 Frame = +2

Query  80   MGKDVE---VGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltv  250
            M KDVE    G  +  +DY DPPPA  +D EEL +WSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDVEGGVAGEGFPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLTV  60

Query  251  IGYKSQTDPHVTGTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  430
            IGYKSQTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  61   IGYKSQTDTKAGGDD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  431  KVSLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGT  610
            KV+LVRA++YMVAQCLGAICG GLVKAFQ +YY RYGGGAN LADGYSKGTGL AEIIGT
Sbjct  120  KVTLVRALLYMVAQCLGAICGVGLVKAFQSSYYDRYGGGANSLADGYSKGTGLAAEIIGT  179

Query  611  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  790
            FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  239

Query  791  YGKDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRS  925
            Y KDK WDD WIFWVGPFIGAAIAA YHQF+LRA   K+LGS RS
Sbjct  240  YNKDKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRS  284



>ref|XP_010555818.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   446 bits (1147),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 249/285 (87%), Gaps = 1/285 (0%)
 Frame = +2

Query  80   MGKDVEVGNEYSLKDYQDPPPAPFIDPEELGQWSFYRAIIAEFvatllflyvtvltvIGY  259
            M KDV     +S KDY DPPPAP  D  ELG+WSFYRA+IAEF+ATLLFLY+TVLTVIGY
Sbjct  1    MAKDVAEQGSFSGKDYHDPPPAPVFDTAELGKWSFYRAVIAEFIATLLFLYITVLTVIGY  60

Query  260  KSQTDPHVT-GTDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  436
            KSQTD  +  G D CGGVGILGIAWAFGGMIFILVYCT GISGGHINPAVTFGL LARKV
Sbjct  61   KSQTDATLNAGADQCGGVGILGIAWAFGGMIFILVYCTGGISGGHINPAVTFGLLLARKV  120

Query  437  SLVRAIMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANELADGYSKGTGLGAEIIGTFV  616
            SLVRA+MY+VAQCLGAICG GLVKAFQ +YY RYGGGAN LADGYS G G+GAEIIGTFV
Sbjct  121  SLVRAVMYIVAQCLGAICGVGLVKAFQSSYYSRYGGGANSLADGYSVGVGVGAEIIGTFV  180

Query  617  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  796
            LVYTVFSATDPKRNARDSHVPVLAPLPIGF+VFMVHLATIP+TGTGINPARS GAAVIY 
Sbjct  181  LVYTVFSATDPKRNARDSHVPVLAPLPIGFSVFMVHLATIPITGTGINPARSLGAAVIYN  240

Query  797  KDKAWDDQWIFWVGPFIGAAIAAIYHQFILRAGALKALGSQRSNA  931
            ++KAWDD WIFWVGPF GAAIAA YHQF+LRA A KA+GS  S +
Sbjct  241  QEKAWDDHWIFWVGPFAGAAIAAFYHQFVLRAAAAKAIGSFMSQS  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3047179601208