BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29471_g1_i1 len=2493 path=[2471:0-2492]

Length=2493
                                                                      Score     E

ref|XP_009611159.1|  PREDICTED: xylem serine proteinase 1 isoform X1    935   0.0      
ref|XP_009798211.1|  PREDICTED: xylem serine proteinase 1               931   0.0      
ref|XP_009611160.1|  PREDICTED: xylem serine proteinase 1 isoform X2    931   0.0      
ref|XP_010326150.1|  PREDICTED: xylem serine proteinase 1               903   0.0      
emb|CDP15390.1|  unnamed protein product                                899   0.0      
ref|XP_006430257.1|  hypothetical protein CICLE_v10013548mg             867   0.0      
ref|XP_006481881.1|  PREDICTED: xylem serine proteinase 1-like          867   0.0      
ref|XP_011077880.1|  PREDICTED: xylem serine proteinase 1               865   0.0      
gb|EYU38627.1|  hypothetical protein MIMGU_mgv1a001905mg                852   0.0      
gb|KDO61088.1|  hypothetical protein CISIN_1g045363mg                   847   0.0      
ref|XP_009774138.1|  PREDICTED: xylem serine proteinase 1-like          834   0.0      
ref|XP_006381297.1|  subtilase family protein                           833   0.0      
ref|XP_002533546.1|  Xylem serine proteinase 1 precursor, putative      829   0.0      Ricinus communis
ref|XP_007027679.1|  Subtilisin-like serine endopeptidase family ...    828   0.0      
ref|XP_002277106.1|  PREDICTED: xylem serine proteinase 1 isoform X2    822   0.0      Vitis vinifera
ref|XP_009374771.1|  PREDICTED: xylem serine proteinase 1-like          822   0.0      
ref|XP_010068943.1|  PREDICTED: xylem serine proteinase 1-like          824   0.0      
ref|XP_010050421.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...    816   0.0      
gb|KDP42719.1|  hypothetical protein JCGZ_23659                         812   0.0      
gb|KCW89219.1|  hypothetical protein EUGRSUZ_A01524                     809   0.0      
ref|XP_010654056.1|  PREDICTED: xylem serine proteinase 1 isoform X1    808   0.0      
gb|EPS59928.1|  hypothetical protein M569_14877                         801   0.0      
emb|CBI30268.3|  unnamed protein product                                800   0.0      
ref|XP_006577065.1|  PREDICTED: xylem serine proteinase 1-like          792   0.0      
ref|XP_008462552.1|  PREDICTED: xylem serine proteinase 1               791   0.0      
ref|XP_004494157.1|  PREDICTED: xylem serine proteinase 1-like          791   0.0      
ref|XP_003537051.2|  PREDICTED: xylem serine proteinase 1-like          790   0.0      
gb|AIC80770.1|  subtilase                                               786   0.0      
ref|XP_004143378.1|  PREDICTED: xylem serine proteinase 1-like          783   0.0      
ref|XP_007203669.1|  hypothetical protein PRUPE_ppa026851mg             779   0.0      
gb|KCW89325.1|  hypothetical protein EUGRSUZ_A01616                     777   0.0      
ref|XP_003625782.1|  Xylem serine proteinase                            777   0.0      
ref|XP_009370679.1|  PREDICTED: xylem serine proteinase 1-like          776   0.0      
ref|XP_007162881.1|  hypothetical protein PHAVU_001G188400g             774   0.0      
ref|XP_009366748.1|  PREDICTED: xylem serine proteinase 1-like          774   0.0      
gb|KGN48248.1|  hypothetical protein Csa_6G451510                       769   0.0      
ref|XP_010683779.1|  PREDICTED: xylem serine proteinase 1               767   0.0      
gb|KDP27283.1|  hypothetical protein JCGZ_21014                         766   0.0      
ref|XP_008360563.1|  PREDICTED: xylem serine proteinase 1-like          771   0.0      
ref|XP_007145330.1|  hypothetical protein PHAVU_007G230000g             761   0.0      
ref|NP_568124.1|  Subtilisin-like serine endopeptidase family pro...    762   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010242651.1|  PREDICTED: xylem serine proteinase 1-like          757   0.0      
ref|XP_010423686.1|  PREDICTED: xylem serine proteinase 1-like          754   0.0      
ref|XP_006289761.1|  hypothetical protein CARUB_v10003361mg             754   0.0      
ref|XP_002871048.1|  subtilase family protein                           753   0.0      
ref|XP_010495057.1|  PREDICTED: xylem serine proteinase 1               752   0.0      
gb|KFK24826.1|  hypothetical protein AALP_AA8G030100                    751   0.0      
ref|XP_006398815.1|  hypothetical protein EUTSA_v10015584mg             743   0.0      
emb|CDY04892.1|  BnaAnng00740D                                          742   0.0      
ref|XP_009125514.1|  PREDICTED: xylem serine proteinase 1               741   0.0      
ref|XP_010242650.1|  PREDICTED: xylem serine proteinase 1-like          736   0.0      
ref|XP_008241424.1|  PREDICTED: xylem serine proteinase 1               734   0.0      
emb|CDY44378.1|  BnaC02g02990D                                          736   0.0      
ref|XP_004149226.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...    734   0.0      
ref|XP_010543901.1|  PREDICTED: xylem serine proteinase 1               734   0.0      
gb|KDP39759.1|  hypothetical protein JCGZ_02779                         716   0.0      
ref|XP_008442818.1|  PREDICTED: xylem serine proteinase 1-like          689   0.0      
ref|XP_006857987.1|  hypothetical protein AMTR_s00069p00181550          679   0.0      
ref|XP_007015871.1|  Cucumisin protein                                  677   0.0      
gb|KGN59114.1|  hypothetical protein Csa_3G775270                       669   0.0      
ref|XP_010456380.1|  PREDICTED: xylem serine proteinase 1-like          661   0.0      
ref|XP_011093181.1|  PREDICTED: xylem serine proteinase 1-like          665   0.0      
dbj|BAJ53130.1|  JHL05D22.1                                             664   0.0      
ref|XP_007051972.1|  Xylem serine peptidase 1 isoform 1                 661   0.0      
ref|XP_011019233.1|  PREDICTED: xylem serine proteinase 1-like          652   0.0      
ref|XP_011093183.1|  PREDICTED: xylem serine proteinase 1-like          659   0.0      
ref|XP_011023458.1|  PREDICTED: xylem serine proteinase 1-like          658   0.0      
ref|XP_002511771.1|  Xylem serine proteinase 1 precursor, putative      658   0.0      Ricinus communis
gb|KDP28708.1|  hypothetical protein JCGZ_14479                         658   0.0      
ref|XP_010255582.1|  PREDICTED: xylem serine proteinase 1               658   0.0      
ref|XP_006490974.1|  PREDICTED: xylem serine proteinase 1-like is...    657   0.0      
ref|XP_010692331.1|  PREDICTED: xylem serine proteinase 1               656   0.0      
ref|XP_004308419.1|  PREDICTED: xylem serine proteinase 1-like          655   0.0      
ref|XP_006490975.1|  PREDICTED: xylem serine proteinase 1-like is...    655   0.0      
emb|CDP08911.1|  unnamed protein product                                654   0.0      
ref|XP_011002076.1|  PREDICTED: xylem serine proteinase 1-like          654   0.0      
ref|XP_004492669.1|  PREDICTED: xylem serine proteinase 1-like          654   0.0      
ref|XP_002272598.1|  PREDICTED: xylem serine proteinase 1               653   0.0      Vitis vinifera
gb|EYU35056.1|  hypothetical protein MIMGU_mgv1a002051mg                652   0.0      
gb|AIC80768.1|  subtilase                                               651   0.0      
ref|XP_007134940.1|  hypothetical protein PHAVU_010G088400g             650   0.0      
emb|CBI31589.3|  unnamed protein product                                648   0.0      
ref|XP_010661610.1|  PREDICTED: xylem serine proteinase 1               648   0.0      
ref|XP_007139965.1|  hypothetical protein PHAVU_008G073700g             648   0.0      
gb|KHF99410.1|  Xylem serinease 1 -like protein                         645   0.0      
ref|XP_010426748.1|  PREDICTED: xylem serine proteinase 1               646   0.0      
ref|XP_010496905.1|  PREDICTED: xylem serine proteinase 1-like          646   0.0      
ref|XP_010456309.1|  PREDICTED: xylem serine proteinase 1-like          645   0.0      
ref|XP_006396223.1|  hypothetical protein EUTSA_v10028458mg             644   0.0      
ref|XP_006587877.1|  PREDICTED: xylem serine proteinase 1-like          643   0.0      
ref|XP_008232921.1|  PREDICTED: xylem serine proteinase 1               642   0.0      
ref|XP_011076782.1|  PREDICTED: cucumisin-like                          641   0.0      
ref|XP_010419558.1|  PREDICTED: xylem serine proteinase 1-like          641   0.0      
ref|XP_008461729.1|  PREDICTED: cucumisin-like isoform X1               642   0.0      
ref|XP_002301316.2|  hypothetical protein POPTR_0002s15330g             639   0.0      Populus trichocarpa [western balsam poplar]
gb|KEH20533.1|  subtilisin-like serine protease                         640   0.0      
ref|XP_002277563.1|  PREDICTED: cucumisin-like                          640   0.0      Vitis vinifera
ref|XP_009762586.1|  PREDICTED: xylem serine proteinase 1 isoform X1    640   0.0      
ref|XP_009762587.1|  PREDICTED: xylem serine proteinase 1 isoform X2    639   0.0      
emb|CBI31596.3|  unnamed protein product                                637   0.0      
ref|XP_002875042.1|  hypothetical protein ARALYDRAFT_490544             639   0.0      
ref|XP_004510915.1|  PREDICTED: xylem serine proteinase 1-like          638   0.0      
gb|KFK30606.1|  hypothetical protein AALP_AA6G003600                    637   0.0      
ref|XP_003623809.1|  Xylem serine proteinase                            641   0.0      
ref|XP_007220705.1|  hypothetical protein PRUPE_ppa021240mg             635   0.0      
gb|KHN29417.1|  Xylem serine proteinase 1                               632   0.0      
gb|KGN49552.1|  hypothetical protein Csa_5G000010                       635   0.0      
gb|KEH19005.1|  subtilisin-like serine protease                         635   0.0      
ref|NP_567155.1|  xylem serine proteinase 1                             635   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH19004.1|  subtilisin-like serine protease                         634   0.0      
ref|XP_008454753.1|  PREDICTED: xylem serine proteinase 1-like          634   0.0      
ref|XP_003636898.1|  Xylem serine proteinase                            633   0.0      
gb|KDP44852.1|  hypothetical protein JCGZ_01352                         630   0.0      
ref|XP_006339775.1|  PREDICTED: xylem serine proteinase 1-like          631   0.0      
ref|XP_007009160.1|  Subtilisin-like serine endopeptidase family ...    630   0.0      
gb|EPS71713.1|  hypothetical protein M569_03043                         629   0.0      
ref|XP_004149947.1|  PREDICTED: cucumisin-like                          629   0.0      
ref|XP_009611955.1|  PREDICTED: xylem serine proteinase 1               630   0.0      
ref|XP_010326073.1|  PREDICTED: xylem serine proteinase 1               630   0.0      
ref|XP_009111502.1|  PREDICTED: xylem serine proteinase 1               629   0.0      
ref|XP_006286453.1|  hypothetical protein CARUB_v10000284mg             628   0.0      
ref|XP_011034996.1|  PREDICTED: xylem serine proteinase 1-like          627   0.0      
ref|XP_008233510.1|  PREDICTED: cucumisin-like                          628   0.0      
ref|XP_004171206.1|  PREDICTED: cucumisin-like                          625   0.0      
ref|XP_010318121.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     626   0.0      
emb|CDY07233.1|  BnaCnng02480D                                          627   0.0      
emb|CBI31597.3|  unnamed protein product                                626   0.0      
ref|XP_011036040.1|  PREDICTED: cucumisin-like                          623   0.0      
ref|XP_002277115.3|  PREDICTED: cucumisin                               644   0.0      Vitis vinifera
ref|XP_007015872.1|  Cucumisin protein                                  628   0.0      
ref|XP_004156322.1|  PREDICTED: xylem serine proteinase 1-like          617   0.0      
ref|XP_008461730.1|  PREDICTED: cucumisin-like isoform X2               621   0.0      
ref|XP_008351270.1|  PREDICTED: cucumisin-like isoform X1               623   0.0      
ref|XP_008461726.1|  PREDICTED: cucumisin-like                          622   0.0      
ref|XP_004149139.1|  PREDICTED: xylem serine proteinase 1-like          621   0.0      
ref|XP_008391035.1|  PREDICTED: cucumisin-like isoform X1               620   0.0      
ref|XP_002320085.1|  hypothetical protein POPTR_0014s07050g             620   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU19955.1|  hypothetical protein MIMGU_mgv1a023738mg                618   0.0      
ref|XP_008461725.1|  PREDICTED: cucumisin-like                          620   0.0      
emb|CBI31599.3|  unnamed protein product                                619   0.0      
ref|XP_010658506.1|  PREDICTED: cucumisin isoform X2                    619   0.0      
ref|XP_010658505.1|  PREDICTED: cucumisin isoform X1                    619   0.0      
ref|XP_008351271.1|  PREDICTED: cucumisin-like isoform X2               617   0.0      
ref|XP_002316252.2|  cucumisin family protein                           616   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004300747.1|  PREDICTED: cucumisin-like                          618   0.0      
ref|XP_010658658.1|  PREDICTED: cucumisin                               639   0.0      
ref|XP_004145974.1|  PREDICTED: cucumisin-like                          617   0.0      
ref|XP_002316254.1|  hypothetical protein POPTR_0010s20420g             615   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004149953.1|  PREDICTED: cucumisin-like                          615   0.0      
emb|CBI31603.3|  unnamed protein product                                624   0.0      
ref|XP_004159601.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...    612   0.0      
emb|CBI38830.3|  unnamed protein product                                636   0.0      
ref|XP_010540255.1|  PREDICTED: xylem serine proteinase 1               614   0.0      
ref|XP_007009161.1|  Subtilisin-like serine endopeptidase family ...    613   0.0      
ref|XP_007009170.1|  Subtilisin-like serine endopeptidase family ...    613   0.0      
ref|XP_004168370.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...    612   0.0      
gb|AAC19302.1|  contains similarity to the subtilase family of se...    611   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004168804.1|  PREDICTED: xylem serine proteinase 1-like          605   0.0      
ref|XP_008245946.1|  PREDICTED: cucumisin-like                          608   0.0      
ref|XP_008238771.1|  PREDICTED: cucumisin-like                          611   0.0      
ref|XP_008779567.1|  PREDICTED: cucumisin-like                          608   0.0      
ref|XP_004140478.1|  PREDICTED: xylem serine proteinase 1-like          609   0.0      
ref|XP_007220224.1|  hypothetical protein PRUPE_ppa002172mg             608   0.0      
emb|CBI31598.3|  unnamed protein product                                613   0.0      
ref|XP_007221063.1|  hypothetical protein PRUPE_ppa016501mg             607   0.0      
ref|XP_008351272.1|  PREDICTED: cucumisin-like isoform X3               607   0.0      
ref|XP_009375889.1|  PREDICTED: xylem serine proteinase 1               608   0.0      
ref|XP_010108377.1|  hypothetical protein L484_010385                   608   0.0      
ref|XP_004165285.1|  PREDICTED: cucumisin-like                          609   0.0      
gb|AEM42989.1|  cucumisin                                               607   0.0      
ref|XP_002524250.1|  Cucumisin precursor, putative                      607   0.0      Ricinus communis
ref|XP_008234049.1|  PREDICTED: uncharacterized protein LOC103333026    630   0.0      
gb|KCW78235.1|  hypothetical protein EUGRSUZ_D02423                     605   0.0      
ref|XP_004149951.1|  PREDICTED: cucumisin-like                          610   0.0      
ref|XP_007145475.1|  hypothetical protein PHAVU_007G242100g             605   0.0      
ref|XP_007219696.1|  hypothetical protein PRUPE_ppa023961mg             604   0.0      
ref|XP_002275807.1|  PREDICTED: cucumisin-like                          606   0.0      Vitis vinifera
ref|XP_010053873.1|  PREDICTED: xylem serine proteinase 1               605   0.0      
ref|XP_010919430.1|  PREDICTED: cucumisin-like                          603   0.0      
ref|XP_006486543.1|  PREDICTED: cucumisin-like                          603   0.0      
ref|XP_010658507.1|  PREDICTED: cucumisin-like                          605   0.0      
ref|XP_004165286.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     603   0.0      
gb|KGN50589.1|  hypothetical protein Csa_5G187870                       603   0.0      
ref|XP_010919429.1|  PREDICTED: cucumisin-like                          603   0.0      
ref|XP_003544153.2|  PREDICTED: cucumisin-like                          603   0.0      
ref|XP_002524249.1|  Cucumisin precursor, putative                      602   0.0      Ricinus communis
ref|XP_010662545.1|  PREDICTED: cucumisin-like                          602   0.0      
emb|CAN72966.1|  hypothetical protein VITISV_025342                     603   0.0      Vitis vinifera
ref|XP_006850442.1|  hypothetical protein AMTR_s00165p00065060          602   0.0      
ref|XP_004149952.1|  PREDICTED: cucumisin-like                          602   0.0      
gb|KEH20534.1|  subtilisin-like serine protease                         598   0.0      
ref|XP_007009169.1|  Subtilisin-like serine endopeptidase family ...    600   0.0      
ref|XP_002262979.2|  PREDICTED: cucumisin-like                          602   0.0      Vitis vinifera
ref|XP_007210247.1|  hypothetical protein PRUPE_ppa014972mg             599   0.0      
emb|CDP00153.1|  unnamed protein product                                597   0.0      
emb|CBI34765.3|  unnamed protein product                                598   0.0      
ref|XP_011081055.1|  PREDICTED: cucumisin-like                          600   0.0      
gb|KDO69224.1|  hypothetical protein CISIN_1g043420mg                   597   0.0      
ref|XP_002264496.1|  PREDICTED: cucumisin-like                          600   0.0      Vitis vinifera
ref|XP_007009158.1|  Subtilisin-like serine endopeptidase family ...    617   0.0      
ref|XP_004165775.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     598   0.0      
emb|CAN77548.1|  hypothetical protein VITISV_004712                     600   0.0      Vitis vinifera
ref|XP_006486542.1|  PREDICTED: cucumisin-like                          595   0.0      
ref|XP_006435587.1|  hypothetical protein CICLE_v10033808mg             594   0.0      
ref|XP_008461745.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     594   0.0      
gb|KHN07611.1|  Cucumisin                                               594   0.0      
ref|XP_008454861.1|  PREDICTED: xylem serine proteinase 1-like          596   0.0      
ref|XP_010662562.1|  PREDICTED: cucumisin-like                          595   0.0      
ref|XP_008437519.1|  PREDICTED: cucumisin-like isoform X1               594   0.0      
ref|XP_006590070.1|  PREDICTED: cucumisin-like                          593   0.0      
ref|XP_010257110.1|  PREDICTED: cucumisin-like                          593   0.0      
ref|XP_009396946.1|  PREDICTED: cucumisin-like                          592   0.0      
ref|XP_008245984.1|  PREDICTED: cucumisin-like                          592   0.0      
ref|NP_001237585.1|  subtilisin-like protease C1 precursor              592   0.0      
ref|XP_008464909.1|  PREDICTED: cucumisin-like                          590   0.0      
ref|XP_010658504.1|  PREDICTED: cucumisin-like                          590   0.0      
ref|XP_007016591.1|  Subtilase family protein, putative isoform 1       592   0.0      
ref|XP_010658656.1|  PREDICTED: cucumisin-like                          611   0.0      
ref|XP_007016592.1|  Subtilase 4.13, putative isoform 2                 592   0.0      
ref|XP_007141823.1|  hypothetical protein PHAVU_008G228700g             591   0.0      
ref|XP_008461717.1|  PREDICTED: cucumisin-like                          591   0.0      
ref|XP_007163485.1|  hypothetical protein PHAVU_001G238100g             591   0.0      
gb|KHN17875.1|  Cucumisin                                               591   0.0      
gb|KHN20892.1|  Cucumisin                                               590   0.0      
emb|CBI31595.3|  unnamed protein product                                590   0.0      
gb|KHN20889.1|  Cucumisin                                               588   0.0      
emb|CBI31592.3|  unnamed protein product                                588   0.0      
ref|XP_010106763.1|  Xylem serine proteinase 1                          590   0.0      
emb|CDP15047.1|  unnamed protein product                                590   0.0      
ref|XP_002509690.1|  Cucumisin precursor, putative                      590   0.0      Ricinus communis
ref|XP_011081159.1|  PREDICTED: cucumisin-like                          589   0.0      
ref|XP_003545246.2|  PREDICTED: cucumisin-like                          588   0.0      
ref|XP_006857966.1|  hypothetical protein AMTR_s00069p00176100          587   0.0      
ref|XP_006477361.1|  PREDICTED: cucumisin-like                          588   0.0      
ref|XP_002524251.1|  Cucumisin precursor, putative                      586   0.0      Ricinus communis
ref|XP_011081160.1|  PREDICTED: cucumisin-like                          588   0.0      
ref|XP_004171308.1|  PREDICTED: cucumisin-like                          587   0.0      
ref|XP_004135366.1|  PREDICTED: cucumisin-like                          585   0.0      
ref|XP_010650972.1|  PREDICTED: cucumisin-like                          584   0.0      
ref|XP_007210779.1|  hypothetical protein PRUPE_ppa019173mg             585   0.0      
ref|XP_004293027.1|  PREDICTED: cucumisin-like                          585   0.0      
ref|XP_008344605.1|  PREDICTED: cucumisin-like                          584   0.0      
ref|XP_004149954.1|  PREDICTED: cucumisin-like                          584   0.0      
ref|XP_004164258.1|  PREDICTED: cucumisin-like                          585   0.0      
ref|XP_010273983.1|  PREDICTED: cucumisin-like                          584   0.0      
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg             603   0.0      
ref|XP_007219654.1|  hypothetical protein PRUPE_ppa025139mg             582   0.0      
emb|CBI31602.3|  unnamed protein product                                605   0.0      
ref|XP_008346999.1|  PREDICTED: cucumisin-like                          582   0.0      
ref|XP_009354470.1|  PREDICTED: cucumisin-like                          582   0.0      
gb|KDP25659.1|  hypothetical protein JCGZ_20815                         584   0.0      
ref|XP_006488409.1|  PREDICTED: cucumisin-like                          581   0.0      
ref|XP_010685662.1|  PREDICTED: cucumisin-like                          581   0.0      
ref|XP_008375470.1|  PREDICTED: cucumisin-like                          581   0.0      
ref|XP_010108373.1|  hypothetical protein L484_010381                   580   0.0      
ref|XP_008245823.1|  PREDICTED: cucumisin-like                          589   0.0      
ref|XP_007219793.1|  hypothetical protein PRUPE_ppa026521mg             581   0.0      
ref|XP_008461721.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     581   0.0      
ref|XP_007016590.1|  Subtilisin serine endopeptidase family prote...    584   0.0      
ref|XP_007220756.1|  hypothetical protein PRUPE_ppa024105mg             580   0.0      
ref|XP_006488676.1|  PREDICTED: cucumisin-like                          581   0.0      
ref|XP_009354506.1|  PREDICTED: cucumisin-like                          581   0.0      
emb|CBI31594.3|  unnamed protein product                                603   0.0      
ref|XP_008231574.1|  PREDICTED: cucumisin-like                          580   0.0      
emb|CAN64132.1|  hypothetical protein VITISV_013401                     581   0.0      Vitis vinifera
sp|Q39547.1|CUCM1_CUCME  RecName: Full=Cucumisin; AltName: Allerg...    580   0.0      Cucumis melo [Oriental melon]
ref|XP_007220684.1|  hypothetical protein PRUPE_ppa020430mg             578   0.0      
ref|XP_008437521.1|  PREDICTED: cucumisin-like isoform X2               578   0.0      
ref|XP_004515206.1|  PREDICTED: cucumisin-like                          578   0.0      
ref|XP_008238763.1|  PREDICTED: cucumisin-like                          578   0.0      
ref|XP_008807887.1|  PREDICTED: cucumisin-like isoform X1               577   0.0      
ref|XP_008810590.1|  PREDICTED: cucumisin-like                          576   0.0      
emb|CBI24459.3|  unnamed protein product                                577   0.0      
gb|KGN50592.1|  hypothetical protein Csa_5G188880                       573   0.0      
gb|KDO63610.1|  hypothetical protein CISIN_1g044427mg                   576   0.0      
ref|XP_004135365.1|  PREDICTED: cucumisin-like                          576   0.0      
ref|XP_010094195.1|  hypothetical protein L484_016738                   578   0.0      
gb|EYU39005.1|  hypothetical protein MIMGU_mgv1a021060mg                575   0.0      
ref|XP_004490922.1|  PREDICTED: cucumisin-like                          575   0.0      
ref|XP_006424942.1|  hypothetical protein CICLE_v10027939mg             573   0.0      
gb|EYU39007.1|  hypothetical protein MIMGU_mgv1a020931mg                575   0.0      
ref|XP_004515589.1|  PREDICTED: cucumisin-like                          579   0.0      
ref|XP_008437522.1|  PREDICTED: cucumisin-like isoform X3               570   0.0      
ref|XP_004515970.1|  PREDICTED: cucumisin-like                          573   0.0      
ref|XP_007016589.1|  Subtilase family protein, putative                 573   0.0      
ref|XP_008807888.1|  PREDICTED: cucumisin-like isoform X2               570   0.0      
ref|XP_010106563.1|  hypothetical protein L484_025323                   571   0.0      
ref|XP_008461724.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     572   0.0      
ref|XP_010108374.1|  hypothetical protein L484_010382                   593   0.0      
ref|XP_007040097.1|  Subtilase family protein                           572   0.0      
ref|XP_009126714.1|  PREDICTED: cucumisin-like                          570   0.0      
ref|XP_004307317.1|  PREDICTED: cucumisin-like                          571   0.0      
ref|XP_004490564.1|  PREDICTED: cucumisin-like                          572   0.0      
ref|XP_008446751.1|  PREDICTED: cucumisin-like                          590   0.0      
ref|XP_006590069.1|  PREDICTED: cucumisin-like                          570   0.0      
ref|XP_007051973.1|  Xylem serine peptidase 1 isoform 2                 565   0.0      
emb|CBI31873.3|  unnamed protein product                                568   0.0      
gb|KDP25527.1|  hypothetical protein JCGZ_20683                         569   0.0      
ref|XP_010477301.1|  PREDICTED: cucumisin-like                          568   0.0      
ref|XP_008349002.1|  PREDICTED: cucumisin-like                          568   0.0      
ref|XP_008385093.1|  PREDICTED: cucumisin-like                          567   0.0      
ref|XP_006379315.1|  hypothetical protein POPTR_0009s14800g             564   0.0      
ref|XP_002316255.2|  cucumisin family protein                           566   0.0      
emb|CBI24378.3|  unnamed protein product                                567   0.0      
ref|XP_008461722.1|  PREDICTED: cucumisin-like                          566   0.0      
ref|XP_010651696.1|  PREDICTED: cucumisin-like                          566   0.0      
gb|KDP25528.1|  hypothetical protein JCGZ_20684                         567   0.0      
ref|XP_004513571.1|  PREDICTED: cucumisin-like                          570   0.0      
ref|XP_003518399.2|  PREDICTED: cucumisin-like                          566   0.0      
ref|XP_011032221.1|  PREDICTED: cucumisin-like isoform X1               563   0.0      
gb|KHN13101.1|  Cucumisin                                               566   0.0      
ref|XP_011030191.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     566   0.0      
ref|XP_010272744.1|  PREDICTED: xylem serine proteinase 1-like          574   0.0      
ref|XP_010667129.1|  PREDICTED: cucumisin-like                          561   0.0      
ref|XP_002314147.1|  subtilase family protein                           561   0.0      
gb|EYU39006.1|  hypothetical protein MIMGU_mgv1a019125mg                561   0.0      
ref|XP_011032225.1|  PREDICTED: cucumisin-like                          561   0.0      
ref|XP_002866313.1|  subtilase family protein                           560   0.0      
ref|XP_003544157.1|  PREDICTED: cucumisin-like isoform X1               561   0.0      
gb|KHG27800.1|  Cucumisin                                               558   0.0      
ref|XP_010667150.1|  PREDICTED: cucumisin-like                          561   0.0      
gb|KFK27456.1|  hypothetical protein AALP_AA8G385200                    560   0.0      
ref|XP_006435588.1|  hypothetical protein CICLE_v10033662mg             557   0.0      
ref|XP_008221856.1|  PREDICTED: cucumisin-like                          560   0.0      
ref|XP_004514528.1|  PREDICTED: cucumisin-like                          559   0.0      
dbj|BAB09764.1|  serine protease-like protein                           559   0.0      
gb|KDO66668.1|  hypothetical protein CISIN_1g041951mg                   558   0.0      
ref|XP_002304456.2|  hypothetical protein POPTR_0003s12010g             560   0.0      
gb|KDP25529.1|  hypothetical protein JCGZ_20685                         560   0.0      
gb|KHN20890.1|  Cucumisin                                               559   0.0      
dbj|BAB09628.1|  subtilisin-like serine protease                        557   0.0      
ref|XP_006281910.1|  hypothetical protein CARUB_v10028115mg             557   0.0      
ref|XP_009409658.1|  PREDICTED: cucumisin-like                          557   0.0      
gb|KHG08490.1|  Cucumisin                                               557   0.0      
ref|XP_010106565.1|  hypothetical protein L484_025325                   560   0.0      
ref|XP_007208519.1|  hypothetical protein PRUPE_ppa026018mg             555   0.0      
ref|XP_006285171.1|  hypothetical protein CARUB_v10006516mg             554   0.0      
ref|XP_008810591.1|  PREDICTED: cucumisin-like                          553   0.0      
ref|XP_008653651.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     555   0.0      
ref|XP_004308603.1|  PREDICTED: cucumisin-like                          555   0.0      
ref|XP_002280348.3|  PREDICTED: cucumisin-like                          555   0.0      
ref|XP_007016588.1|  Subtilisin-like serine endopeptidase family ...    553   0.0      
ref|XP_002864593.1|  subtilase family protein                           552   0.0      
ref|XP_006491889.1|  PREDICTED: cucumisin-like                          555   0.0      
ref|NP_568889.4|  Subtilisin-like serine endopeptidase family pro...    553   0.0      
ref|XP_011032222.1|  PREDICTED: cucumisin-like isoform X2               552   0.0      
ref|XP_010477224.1|  PREDICTED: cucumisin-like                          552   0.0      
ref|XP_006280067.1|  hypothetical protein CARUB_v10025949mg             554   0.0      
ref|XP_010443667.1|  PREDICTED: cucumisin-like                          553   0.0      
ref|XP_010483489.1|  PREDICTED: cucumisin-like                          552   0.0      
ref|XP_002864145.1|  predicted protein                                  551   0.0      
ref|XP_007141831.1|  hypothetical protein PHAVU_008G229300g             551   0.0      
ref|XP_011033825.1|  PREDICTED: cucumisin-like                          553   0.0      
ref|NP_568901.1|  subtilase family protein                              550   0.0      
emb|CDX80297.1|  BnaC09g34450D                                          551   0.0      
ref|XP_010262905.1|  PREDICTED: cucumisin-like                          551   0.0      
ref|XP_006432273.1|  hypothetical protein CICLE_v10004018mg             552   0.0      
emb|CBI16045.3|  unnamed protein product                                550   0.0      
ref|XP_010483540.1|  PREDICTED: cucumisin-like                          551   0.0      
ref|XP_009101346.1|  PREDICTED: cucumisin-like                          549   0.0      
gb|EYU28709.1|  hypothetical protein MIMGU_mgv1a002151mg                549   0.0      
ref|XP_009132010.1|  PREDICTED: cucumisin-like                          550   0.0      
ref|XP_004490923.1|  PREDICTED: cucumisin-like                          557   0.0      
ref|XP_010935422.1|  PREDICTED: cucumisin-like                          569   1e-180   
emb|CDY17670.1|  BnaA06g34890D                                          548   1e-180   
ref|XP_002864615.1|  predicted protein                                  549   2e-180   
ref|XP_002862618.1|  subtilase family protein                           548   2e-180   
ref|XP_010483539.1|  PREDICTED: cucumisin                               549   2e-180   
emb|CDY02841.1|  BnaC02g10480D                                          548   3e-180   
ref|XP_006281614.1|  hypothetical protein CARUB_v10027732mg             547   3e-180   
ref|XP_011086390.1|  PREDICTED: cucumisin-like                          548   6e-180   
ref|XP_007141828.1|  hypothetical protein PHAVU_008G229100g             546   6e-180   
ref|NP_568898.2|  subtilase 4.13                                        547   7e-180   
emb|CDY54174.1|  BnaA10g29100D                                          548   7e-180   
ref|XP_006401035.1|  hypothetical protein EUTSA_v10015939mg             545   7e-180   
emb|CDY42952.1|  BnaA01g18020D                                          545   1e-179   
ref|XP_006401034.1|  hypothetical protein EUTSA_v10012810mg             546   1e-179   
ref|NP_001032101.1|  subtilase 4.12                                     547   1e-179   
ref|XP_004515553.1|  PREDICTED: cucumisin-like                          548   1e-179   
emb|CDY32681.1|  BnaA02g07430D                                          546   1e-179   
ref|XP_010520244.1|  PREDICTED: cucumisin-like                          546   1e-179   
gb|KDO50629.1|  hypothetical protein CISIN_1g044745mg                   547   1e-179   
emb|CDY14584.1|  BnaC02g25290D                                          546   1e-179   
gb|KFK27430.1|  hypothetical protein AALP_AA8G381500                    546   1e-179   
ref|XP_007141824.1|  hypothetical protein PHAVU_008G228700g             543   3e-179   
emb|CDY47801.1|  BnaC01g22570D                                          544   3e-179   
ref|XP_009120430.1|  PREDICTED: cucumisin-like                          546   3e-179   
gb|KDO66666.1|  hypothetical protein CISIN_1g0404622mg                  544   4e-179   
dbj|BAB10784.1|  subtilisin-like protease                               545   4e-179   
ref|NP_568895.1|  subtilase 4.12                                        546   4e-179   
ref|XP_002864617.1|  subtilase family protein                           545   8e-179   
ref|XP_010650971.1|  PREDICTED: cucumisin-like                          543   1e-178   
ref|XP_009126729.1|  PREDICTED: cucumisin-like                          543   1e-178   
emb|CDP00292.1|  unnamed protein product                                545   1e-178   
ref|XP_010443671.1|  PREDICTED: cucumisin-like                          544   1e-178   
ref|XP_002318260.2|  cucumisin family protein                           543   4e-178   
ref|XP_008653653.1|  PREDICTED: cucumisin-like                          543   6e-178   
ref|XP_006400999.1|  hypothetical protein EUTSA_v10015491mg             541   6e-178   
ref|XP_009101347.1|  PREDICTED: cucumisin-like                          541   9e-178   
gb|KGN50591.1|  hypothetical protein Csa_5G188380                       539   1e-177   
gb|EYU39004.1|  hypothetical protein MIMGU_mgv1a024251mg                541   1e-177   
ref|XP_010532507.1|  PREDICTED: cucumisin-like                          540   2e-177   
emb|CDY33016.1|  BnaA10g12220D                                          541   2e-177   
ref|XP_010532508.1|  PREDICTED: cucumisin-like                          541   2e-177   
emb|CDY32660.1|  BnaA02g07220D                                          540   2e-177   
ref|NP_001032102.1|  subtilase 4.12                                     541   3e-177   
ref|XP_006400988.1|  hypothetical protein EUTSA_v10015507mg             541   3e-177   
ref|XP_007219567.1|  hypothetical protein PRUPE_ppa022813mg             540   3e-177   
ref|XP_010454742.1|  PREDICTED: cucumisin-like                          540   4e-177   
ref|XP_010525171.1|  PREDICTED: cucumisin-like                          541   4e-177   
ref|XP_010103223.1|  hypothetical protein L484_003542                   541   5e-177   
ref|XP_009120422.1|  PREDICTED: cucumisin                               540   6e-177   
emb|CDY02839.1|  BnaC02g10500D                                          539   6e-177   
emb|CDY50278.1|  BnaAnng10420D                                          538   8e-177   
ref|NP_568896.1|  Subtilisin-like serine endopeptidase family pro...    540   9e-177   
ref|XP_002868237.1|  subtilase family protein                           538   1e-176   
ref|NP_568890.2|  Subtilase family protein                              538   1e-176   
gb|EYU28710.1|  hypothetical protein MIMGU_mgv1a002109mg                538   1e-176   
gb|KHG07231.1|  Cucumisin                                               538   1e-176   
ref|XP_011087067.1|  PREDICTED: cucumisin-like                          547   1e-176   
ref|XP_010651447.1|  PREDICTED: cucumisin                               538   1e-176   
emb|CDY02843.1|  BnaC02g10460D                                          538   2e-176   
emb|CBI16044.3|  unnamed protein product                                560   2e-176   
ref|XP_004308918.1|  PREDICTED: cucumisin-like                          538   2e-176   
ref|XP_002875805.1|  hypothetical protein ARALYDRAFT_485057             539   2e-176   
ref|XP_002864591.1|  predicted protein                                  537   2e-176   
ref|XP_006414605.1|  hypothetical protein EUTSA_v10026895mg             536   3e-176   
emb|CDX71132.1|  BnaC03g12160D                                          538   3e-176   
ref|XP_009145270.1|  PREDICTED: cucumisin-like                          538   4e-176   
emb|CDX88685.1|  BnaA03g09640D                                          537   5e-176   
gb|KDP44861.1|  hypothetical protein JCGZ_01361                         556   5e-176   
ref|XP_010525169.1|  PREDICTED: cucumisin-like                          536   6e-176   
ref|XP_007141832.1|  hypothetical protein PHAVU_008G229400g             536   7e-176   
ref|XP_009147912.1|  PREDICTED: cucumisin                               535   8e-176   
ref|XP_008223725.1|  PREDICTED: cucumisin-like                          536   8e-176   
ref|XP_002314148.2|  hypothetical protein POPTR_0009s04280g             537   9e-176   
ref|XP_011087071.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     536   9e-176   
ref|XP_010443666.1|  PREDICTED: cucumisin-like                          536   2e-175   
ref|XP_010532550.1|  PREDICTED: cucumisin-like                          534   2e-175   
emb|CDY17671.1|  BnaA06g34900D                                          534   2e-175   
ref|XP_006401036.1|  hypothetical protein EUTSA_v10015822mg             534   2e-175   
ref|XP_002461614.1|  hypothetical protein SORBIDRAFT_02g005460          536   2e-175   
ref|XP_002461615.1|  hypothetical protein SORBIDRAFT_02g005470          542   4e-175   
ref|XP_010520669.1|  PREDICTED: cucumisin-like                          533   6e-175   
ref|XP_008245822.1|  PREDICTED: cucumisin-like                          535   6e-175   
ref|XP_002863036.1|  subtilase family protein                           535   8e-175   
ref|XP_002271796.2|  PREDICTED: cucumisin-like                          534   8e-175   
ref|XP_007206804.1|  hypothetical protein PRUPE_ppa025699mg             533   9e-175   
gb|KEH22215.1|  subtilisin-like serine protease                         533   1e-174   
ref|XP_010532509.1|  PREDICTED: cucumisin-like                          533   1e-174   
ref|XP_002864592.1|  subtilase family protein                           534   1e-174   
ref|XP_006279478.1|  hypothetical protein CARUB_v10025945mg             534   1e-174   
ref|XP_002520491.1|  peptidase, putative                                565   1e-174   
ref|XP_009132012.1|  PREDICTED: cucumisin                               533   2e-174   
ref|XP_004514953.1|  PREDICTED: cucumisin-like                          534   2e-174   
emb|CDY32679.1|  BnaA02g07410D                                          533   2e-174   
ref|XP_010651438.1|  PREDICTED: cucumisin-like                          531   2e-174   
ref|XP_009126733.1|  PREDICTED: cucumisin-like                          532   4e-174   
ref|XP_006424939.1|  hypothetical protein CICLE_v10030060mg             529   4e-174   
ref|XP_006282786.1|  hypothetical protein CARUB_v10006393mg             531   4e-174   
emb|CDY32677.1|  BnaA02g07390D                                          531   5e-174   
ref|XP_006401033.1|  hypothetical protein EUTSA_v10015631mg             531   5e-174   
ref|XP_002864614.1|  subtilase family protein                           532   8e-174   
ref|XP_006404449.1|  hypothetical protein EUTSA_v10010149mg             532   8e-174   
gb|EYU28706.1|  hypothetical protein MIMGU_mgv1a001952mg                531   9e-174   
ref|XP_010532511.1|  PREDICTED: cucumisin-like                          531   1e-173   
emb|CDY32678.1|  BnaA02g07400D                                          531   1e-173   
ref|XP_009126731.1|  PREDICTED: cucumisin-like isoform X1               530   2e-173   
ref|XP_010426136.1|  PREDICTED: cucumisin-like                          530   2e-173   
ref|XP_002864613.1|  subtilase family protein                           531   2e-173   
dbj|BAB09627.1|  subtilisin-like serine protease                        528   3e-173   
ref|XP_006280069.1|  hypothetical protein CARUB_v10025952mg             530   4e-173   
ref|NP_568888.1|  Subtilisin-like serine endopeptidase family pro...    529   4e-173   
ref|XP_006400992.1|  hypothetical protein EUTSA_v10012780mg             530   5e-173   
ref|XP_006424943.1|  hypothetical protein CICLE_v10029841mg             527   6e-173   
ref|XP_010483538.1|  PREDICTED: cucumisin-like isoform X2               530   7e-173   
ref|XP_007040096.1|  Subtilase family protein                           530   8e-173   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                530   9e-173   
ref|XP_009126732.1|  PREDICTED: cucumisin-like isoform X2               527   9e-173   
ref|XP_010454754.1|  PREDICTED: cucumisin-like                          529   1e-172   
ref|XP_010483537.1|  PREDICTED: cucumisin-like isoform X1               529   1e-172   
ref|NP_568899.1|  Subtilase family protein                              528   2e-172   
emb|CAB51181.1|  subtilisin-like proteinase homolog                     528   2e-172   
ref|XP_010483490.1|  PREDICTED: cucumisin-like isoform X1               527   3e-172   
gb|AIC80767.1|  subtilase                                               531   6e-172   
ref|XP_009364421.1|  PREDICTED: cucumisin-like                          527   7e-172   
ref|XP_010532505.1|  PREDICTED: cucumisin-like                          526   8e-172   
ref|XP_008346979.1|  PREDICTED: cucumisin-like                          526   9e-172   
dbj|BAB09759.1|  serine protease-like protein                           525   1e-171   
pdb|3VTA|A  Chain A, Crystal Structure Of Cucumisin, A Subtilisin...    522   1e-171   
ref|XP_008375469.1|  PREDICTED: cucumisin-like                          526   1e-171   
ref|XP_006424940.1|  hypothetical protein CICLE_v10029849mg             523   2e-171   
gb|KEH41295.1|  subtilisin-like serine endopeptidase family protein     525   3e-171   
ref|XP_010230020.1|  PREDICTED: cucumisin-like                          526   3e-171   
ref|XP_010483491.1|  PREDICTED: cucumisin-like isoform X2               524   3e-171   
gb|KHN20891.1|  Cucumisin                                               522   4e-171   
ref|XP_010532549.1|  PREDICTED: cucumisin-like isoform X2               523   5e-171   
ref|NP_001190568.1|  Subtilase family protein                           524   7e-171   
ref|XP_011087070.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin-like     523   7e-171   
ref|NP_566887.2|  Subtilase family protein                              524   1e-170   



>ref|XP_009611159.1| PREDICTED: xylem serine proteinase 1 isoform X1 [Nicotiana tomentosiformis]
Length=743

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/718 (63%), Positives = 562/718 (78%), Gaps = 5/718 (1%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRI-HSYRRSFSGFVAR  314
             ++ +RK YIVYMGELP D +   +D HHN+L +A GD  LARE R+ HSY RSF+ FVAR
Sbjct  22    NENERKSYIVYMGELPKDTSF-LLDNHHNLLKQAFGDRGLARESRVLHSYGRSFNAFVAR  80

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             LLP EA  LS ++ V+SVF NT  +L TTRSWDFLGM     R P+ ESD+IVG++DTG+
Sbjct  81    LLPGEADVLSRREDVISVFPNTIRQLRTTRSWDFLGMPKNVKRIPQVESDIIVGVIDTGI  140

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDG  674
             W+ESPSF D+G+GPPP+KWKGKC KG+NFT CN KVIGAQYFN+E  AP D+ +PADFDG
Sbjct  141   WIESPSFNDEGFGPPPSKWKGKCDKGVNFTKCNNKVIGAQYFNLENIAPTDRMTPADFDG  200

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS  AG  V GASLYG+A+GTARGGVPSARIA+YK CW  GC D D+LA FDAAI
Sbjct  201   HGTHTASTVAGISVPGASLYGLAKGTARGGVPSARIATYKACWEIGCTDSDILAAFDAAI  260

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGVDVIS+SVGG  R FF D IAIG++HA+KK I+T+ A GN+GP   TI+NV+PW+ T
Sbjct  261   ADGVDVISLSVGGAARDFFDDTIAIGAFHALKKGILTSCAGGNDGPTLQTIENVAPWIFT  320

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+SIDR+FE+D  LGNG  ISG SINTFE   K +PL SG+LA+ KNA+  GN S+CD
Sbjct  321   VAASSIDRQFETDAMLGNGVQISGLSINTFEPTKKWFPLTSGSLAEAKNASDHGNSSSCD  380

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDG  1388
               ++ E  V+GKIVYCL S+ QDYTIK + G G +I +D++ DT   T+I AT ++ +D 
Sbjct  381   IGTLEESKVKGKIVYCLGSSGQDYTIKDLKGAGAIILADRMTDTAFSTVISATSINPKDA  440

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
              +I+KYI +TK+P A I++SR V  TAPFV SFS+RGPQ ISLNILKPD+AAPGLSILAA
Sbjct  441   SQIEKYIYSTKSPQAVIYKSRTVNVTAPFVTSFSSRGPQPISLNILKPDIAAPGLSILAA  500

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             Y+ L T+TG  +D RVVKYNVESGTSMA PHAA A AYVK+FHPDWSPAAIKSALMTTAK
Sbjct  501   YSGLTTLTGNNEDNRVVKYNVESGTSMACPHAAAATAYVKSFHPDWSPAAIKSALMTTAK  560

Query  1749  AMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             +MKI+P+GA LASGAG I P KA+ PGLI+D++   Y+SY CKE +N+ ++  LTGSK  
Sbjct  561   SMKIRPVGAELASGAGQINPRKAINPGLIYDLDFDSYISYFCKEGYNSTNIALLTGSKKY  620

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++P A+G DGLNYPSMHLQL + N++  SA +YRTVTYVG G  V+KAKI+AP GL+
Sbjct  621   NCSSVPKAKGTDGLNYPSMHLQLNHANSSDISAVYYRTVTYVGRGKAVYKAKIRAPKGLS  680

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             ++VVP ILSF Q N+K+S++V++ GKF +  SW++SGSLVW     +V+SPILVYR L
Sbjct  681   ITVVPKILSFSQVNEKKSFRVILKGKFIRERSWFLSGSLVWSGKKPNVKSPILVYRPL  738



>ref|XP_009798211.1| PREDICTED: xylem serine proteinase 1 [Nicotiana sylvestris]
Length=743

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/716 (63%), Positives = 559/716 (78%), Gaps = 5/716 (1%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRI-HSYRRSFSGFVAR  314
             ++ QRK YIVYMGELP D +   +D HHN+L +A G+  LARE R+ HSY RSF+ FVAR
Sbjct  22    NENQRKSYIVYMGELPKDTSF-LLDNHHNLLKQAFGERGLARESRVLHSYGRSFNAFVAR  80

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             LLP EA  LS ++ V+SVF NT  +L TTRSWDF+GM+    R P+ ESD+IVG++DTG+
Sbjct  81    LLPEEADVLSRREDVISVFPNTIRQLRTTRSWDFIGMTKNVKRIPQVESDIIVGVIDTGI  140

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDG  674
             WVESPSF D+G+GPPP+KWKGKC KG+NFT CN KVIGA+YFN+E  A  D+ +PADFDG
Sbjct  141   WVESPSFNDEGFGPPPSKWKGKCDKGVNFTKCNNKVIGARYFNLENVAATDRITPADFDG  200

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS  AG  V GASLYG+A+GTARGGVPSARIASYK CW  GC D D+LA FDAAI
Sbjct  201   HGTHTASTVAGISVLGASLYGLAKGTARGGVPSARIASYKACWEIGCTDSDILAAFDAAI  260

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGVD+IS+SVGG  R FF D IAIG++HA+KK I+T+ A GN+GP   TI+NV+PW+ T
Sbjct  261   ADGVDIISLSVGGAARDFFDDTIAIGAFHALKKGILTSCAGGNDGPTLQTIENVAPWIFT  320

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+SIDR+FE+D  LGNG  ISG S+NTFE   K +PL SG+L + KNA+  GN S+CD
Sbjct  321   VAASSIDRQFETDAMLGNGVKISGLSVNTFEPTKKWFPLTSGSLVEVKNASDHGNSSSCD  380

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDG  1388
               ++ E  V+GKIVYCL+S  QDY IK + G G +I +DK+ DT  PT+IPAT  + +DG
Sbjct  381   IGTLEESKVKGKIVYCLTSGGQDYIIKDLKGAGAIILADKMTDTAFPTVIPATSTNPKDG  440

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
               + KYIN+TK+P A I++SR V  TAPFV SFS+RGPQTISLNILKPD+AAPGLSILAA
Sbjct  441   AAVTKYINSTKSPQAVIYKSRTVNITAPFVASFSSRGPQTISLNILKPDIAAPGLSILAA  500

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             Y+ L T+T    D RVVKYNVESGTSMA PHAA A AYVK+FHPDWSPAAIKSALMTTAK
Sbjct  501   YSGLTTLTASNGDNRVVKYNVESGTSMACPHAAAATAYVKSFHPDWSPAAIKSALMTTAK  560

Query  1749  AMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             +MKI+P+GA LASGAG I P KA+ PGLI+D++   Y+SY CKE +N+ ++  LTGSK  
Sbjct  561   SMKIRPVGAELASGAGQINPRKAINPGLIYDLDFDSYISYFCKEGYNSTNIALLTGSKKY  620

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++P A+G DGLNYPSMHLQL N +++  SA +YRTVTYVG G  V+KAKI+AP GL+
Sbjct  621   NCSSVPKAKGTDGLNYPSMHLQLKNASSSDISAVYYRTVTYVGRGKAVYKAKIRAPKGLS  680

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             ++VVP ILSF + N+K+S++V++ GKF +  SW++SGSLVW     +V+SPILVYR
Sbjct  681   ITVVPKILSFSKQNEKKSFRVILKGKFIRERSWFLSGSLVWSGKKPNVKSPILVYR  736



>ref|XP_009611160.1| PREDICTED: xylem serine proteinase 1 isoform X2 [Nicotiana tomentosiformis]
Length=742

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/718 (63%), Positives = 562/718 (78%), Gaps = 6/718 (1%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRI-HSYRRSFSGFVAR  314
             ++ +RK YIVYMGELP D +   +D HHN+L +A G E LARE R+ HSY RSF+ FVAR
Sbjct  22    NENERKSYIVYMGELPKDTSF-LLDNHHNLLKQAFG-EGLARESRVLHSYGRSFNAFVAR  79

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             LLP EA  LS ++ V+SVF NT  +L TTRSWDFLGM     R P+ ESD+IVG++DTG+
Sbjct  80    LLPGEADVLSRREDVISVFPNTIRQLRTTRSWDFLGMPKNVKRIPQVESDIIVGVIDTGI  139

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDG  674
             W+ESPSF D+G+GPPP+KWKGKC KG+NFT CN KVIGAQYFN+E  AP D+ +PADFDG
Sbjct  140   WIESPSFNDEGFGPPPSKWKGKCDKGVNFTKCNNKVIGAQYFNLENIAPTDRMTPADFDG  199

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS  AG  V GASLYG+A+GTARGGVPSARIA+YK CW  GC D D+LA FDAAI
Sbjct  200   HGTHTASTVAGISVPGASLYGLAKGTARGGVPSARIATYKACWEIGCTDSDILAAFDAAI  259

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGVDVIS+SVGG  R FF D IAIG++HA+KK I+T+ A GN+GP   TI+NV+PW+ T
Sbjct  260   ADGVDVISLSVGGAARDFFDDTIAIGAFHALKKGILTSCAGGNDGPTLQTIENVAPWIFT  319

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+SIDR+FE+D  LGNG  ISG SINTFE   K +PL SG+LA+ KNA+  GN S+CD
Sbjct  320   VAASSIDRQFETDAMLGNGVQISGLSINTFEPTKKWFPLTSGSLAEAKNASDHGNSSSCD  379

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDG  1388
               ++ E  V+GKIVYCL S+ QDYTIK + G G +I +D++ DT   T+I AT ++ +D 
Sbjct  380   IGTLEESKVKGKIVYCLGSSGQDYTIKDLKGAGAIILADRMTDTAFSTVISATSINPKDA  439

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
              +I+KYI +TK+P A I++SR V  TAPFV SFS+RGPQ ISLNILKPD+AAPGLSILAA
Sbjct  440   SQIEKYIYSTKSPQAVIYKSRTVNVTAPFVTSFSSRGPQPISLNILKPDIAAPGLSILAA  499

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             Y+ L T+TG  +D RVVKYNVESGTSMA PHAA A AYVK+FHPDWSPAAIKSALMTTAK
Sbjct  500   YSGLTTLTGNNEDNRVVKYNVESGTSMACPHAAAATAYVKSFHPDWSPAAIKSALMTTAK  559

Query  1749  AMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             +MKI+P+GA LASGAG I P KA+ PGLI+D++   Y+SY CKE +N+ ++  LTGSK  
Sbjct  560   SMKIRPVGAELASGAGQINPRKAINPGLIYDLDFDSYISYFCKEGYNSTNIALLTGSKKY  619

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++P A+G DGLNYPSMHLQL + N++  SA +YRTVTYVG G  V+KAKI+AP GL+
Sbjct  620   NCSSVPKAKGTDGLNYPSMHLQLNHANSSDISAVYYRTVTYVGRGKAVYKAKIRAPKGLS  679

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             ++VVP ILSF Q N+K+S++V++ GKF +  SW++SGSLVW     +V+SPILVYR L
Sbjct  680   ITVVPKILSFSQVNEKKSFRVILKGKFIRERSWFLSGSLVWSGKKPNVKSPILVYRPL  737



>ref|XP_010326150.1| PREDICTED: xylem serine proteinase 1 [Solanum lycopersicum]
Length=773

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/720 (61%), Positives = 549/720 (76%), Gaps = 8/720 (1%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDE-ELAREYRI-HSYRRSFSGFVA  311
             +D QRK YIVYMGELP D T S +  H+NIL +A G    +A+  R+ HSY +SF+GFV 
Sbjct  51    NDNQRKSYIVYMGELPKD-TRSLISNHNNILKQAFGSNLAVAQLPRVLHSYHKSFNGFVT  109

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTG  491
             +LLP EA  LS +  V+SVF NT  +L TTRSWDF+GM     RN + ESD+IVG++DTG
Sbjct  110   KLLPEEADLLSHRQDVISVFPNTIRQLRTTRSWDFVGMPLNVERN-QVESDIIVGVIDTG  168

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFD  671
             +W++S SF D G+GPPP+KWKGKC +G NFT CN KVIGAQ+FN+ G   +++ SPADF+
Sbjct  169   IWIQSESFNDKGFGPPPSKWKGKCAQGANFTKCNNKVIGAQFFNLGGAGNDNELSPADFE  228

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H+AS   G  V GASLYGIAEGTARGGVPSARIA+YK CW  GC DMD+LA FDAA
Sbjct  229   GHGTHVASTVGGVPVPGASLYGIAEGTARGGVPSARIATYKACWSMGCTDMDILAAFDAA  288

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I+DGVD+IS+SVGG  R FF+D IAIG++HA+KK I+T+ AAGN GP  GTI+NV+PW+ 
Sbjct  289   ISDGVDIISLSVGGGGREFFEDSIAIGAFHALKKGILTSCAAGNSGPDLGTIENVAPWIF  348

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSAC  1208
             TVAATS DR+FE+D  LGNG  ISG S+NTFE   K +PL SGTLAQ KNA+Y GNYSAC
Sbjct  349   TVAATSSDRKFETDAMLGNGVAISGISVNTFEPTKKWFPLTSGTLAQAKNASYYGNYSAC  408

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
             DY ++ +  V+GKIVYCL S  QDYT+K + G G +I SDK+ DT   T I +T ++   
Sbjct  409   DYGTLDDTKVKGKIVYCLGSNQQDYTLKALQGAGTIILSDKMTDTPFITYISSTSINTTY  468

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
               ++DKYI +TK+P A I ++R V  TAPFVPSFS+RGPQ+ISLNILKPD+ APGLSILA
Sbjct  469   AAQVDKYIQSTKSPQAVIHKTRTVNMTAPFVPSFSSRGPQSISLNILKPDITAPGLSILA  528

Query  1566  AYTALATMTGQ-VDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             A+T L ++      D R+VKYNV+SGTSM+ PHAA A AYVK+FHPDWSPAAIKSALMTT
Sbjct  529   AFTGLNSINSDGTKDKRIVKYNVDSGTSMSCPHAAAATAYVKSFHPDWSPAAIKSALMTT  588

Query  1743  AKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             A +MKI+P+G  LASG+G I P KA+ PGLI+D++ + Y+ Y CKE +N+ ++  LTGSK
Sbjct  589   ATSMKIRPVGDELASGSGQINPRKAINPGLIYDLDINSYIGYFCKEGYNSTNIALLTGSK  648

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
                C +IP A GADGLNYPSMHLQL NPN T  SA FYRTVTYVG G+ V+KAK++ P  
Sbjct  649   MYNCSSIPKALGADGLNYPSMHLQLQNPNETDISAIFYRTVTYVGNGNAVYKAKVRGPKC  708

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             L+++VVPNILSF + N+K+S+ V + GKF +  SWY+S SLVW  N  +V+SPILVYR L
Sbjct  709   LSINVVPNILSFSKVNEKKSFTVELKGKFTRDKSWYISSSLVWGGNKPNVKSPILVYRPL  768



>emb|CDP15390.1| unnamed protein product [Coffea canephora]
Length=741

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/717 (62%), Positives = 550/717 (77%), Gaps = 7/717 (1%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             +D +RK YIVYMGELP++  IS VDEHHN+L E +G+E +ARE +IHSY RSF+GFVARL
Sbjct  24    NDNERKTYIVYMGELPEE-GISTVDEHHNLLQETIGNERIARESKIHSYGRSFNGFVARL  82

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
             LP EA+ LS+K  VVSVF NT  KL TTRSWDF+GM     RN + ES+ IV +LDTG+W
Sbjct  83    LPHEAKSLSQKKGVVSVFPNTVQKLRTTRSWDFIGMPETVERNHQVESETIVAVLDTGIW  142

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGH  677
             ++SPSF D+GYGPPP KWKGKC KG NFTGCNRKVIGAQYFN+ G A +   SP D  GH
Sbjct  143   IKSPSFNDEGYGPPPPKWKGKCAKGANFTGCNRKVIGAQYFNLGGGASDGPISPVDLVGH  202

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H +S AAG  V  ASL+G+AEGTARGGVPSARIA YKVCWG GC DMD+LAGFDAAIA
Sbjct  203   GTHTSSTAAGVPVRDASLFGLAEGTARGGVPSARIAMYKVCWGVGCDDMDLLAGFDAAIA  262

Query  858   DGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             DGVD+IS+S+GG  R FF+DP+AIGS+HA+K+ I+T+ +AGN GP   +++NV+PW+MTV
Sbjct  263   DGVDIISVSIGGPSRRFFEDPMAIGSFHALKRGILTSCSAGNSGPDLQSVENVAPWIMTV  322

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDY  1214
             AA+SIDR+F S VKLG G+ ISG SINTF   K MYPL +G  A + +    GN SACDY
Sbjct  323   AASSIDRQFVSTVKLGEGDTISGVSINTFTPTKQMYPLTNGDRAANSSTANYGNVSACDY  382

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGK  1391
              ++S   VRG IV+C     QD TI+ + GVGVI S D+  D     +IPAT V++ DG+
Sbjct  383   GTLSASKVRGNIVFCRGRG-QDSTIQELGGVGVIMSADQYTDMASACLIPATTVNVTDGE  441

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YIN TKAP A I ++  V  TAPF+ SFS+RGPQ I+LN+LKPD+AAPGL ILAAY
Sbjct  442   LIDHYINATKAPKAVIDKAVTVNMTAPFIASFSSRGPQVIALNVLKPDVAAPGLDILAAY  501

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             + L ++TG   D R+V+YN+ SGTSMA PHAA AAAYVKTFHP WSPAAIKSALMTTAK+
Sbjct  502   SQLVSLTGDTSDKRIVEYNILSGTSMACPHAAAAAAYVKTFHPKWSPAAIKSALMTTAKS  561

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
             MKIKPIG  LASGAG I P KA+ PGL++D++ + Y+S+LCKE +N+ ++ ++TG + + 
Sbjct  562   MKIKPIGLALASGAGQINPRKALDPGLVYDLDVNSYVSFLCKEGYNDTAITAITGDRTSN  621

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNP--NATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
             C + P A+G DGLNYPSMHLQL +P  N T  SA FYRTVTYVG G TV++AK+K+P  L
Sbjct  622   CSSFPPAKGTDGLNYPSMHLQLVDPTSNNTDISAIFYRTVTYVGEGKTVYRAKVKSPKVL  681

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             +V+VVP +LSF + +QKRS+KV+V G F +  SW M  SLVW +  H+V+SPIL+YR
Sbjct  682   SVTVVPKVLSFTKQHQKRSFKVMVKGNFVRRKSWLMPASLVWSNCRHNVKSPILIYR  738



>ref|XP_006430257.1| hypothetical protein CICLE_v10013548mg, partial [Citrus clementina]
 gb|ESR43497.1| hypothetical protein CICLE_v10013548mg, partial [Citrus clementina]
Length=718

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/717 (61%), Positives = 539/717 (75%), Gaps = 11/717 (2%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             +PYIVYMG +P++  ISAV EHH++LT A+GDE+LARE +IHSY +SF+GFVARLLP EA
Sbjct  1     QPYIVYMGNVPEEAGISAVKEHHSLLTTAIGDEKLARESKIHSYGKSFNGFVARLLPHEA  60

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWVESP  509
             +RLSE++ VVSVF NT  KL TTR+WDFLGMS K   RN KA+S++IVGLLDTG+WVESP
Sbjct  61    KRLSEEESVVSVFENTRRKLHTTRTWDFLGMSEKLQKRNSKAQSNIIVGLLDTGIWVESP  120

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGF--APEDQESPADFDGHGS  683
             SF D G+GPPPAKWKGKC  G NFT CN+KVIGA+Y+N++       DQ+SP D DGHG+
Sbjct  121   SFNDKGFGPPPAKWKGKCVTGANFTRCNKKVIGARYYNLDNALDTNTDQKSPVDTDGHGT  180

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H +S AAG  V+G+SLYGIA+GTARGGVPSARIA YKVCW  GC DMD+LA FD AI DG
Sbjct  181   HTSSTAAGETVKGSSLYGIAQGTARGGVPSARIAMYKVCWSGGCADMDILAAFDDAIGDG  240

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             VD+ISIS+GG  RS+F D I+IGS+HAMKK I+T  +AGN+GPY GT++NV+PW+MTVAA
Sbjct  241   VDLISISIGGPSRSYFDDSISIGSFHAMKKGILTACSAGNDGPYQGTVENVAPWIMTVAA  300

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLS  1220
             +SIDR+F + VKLGNG   SG SINTF   K MYPL +G  A +  A   GN SACDY +
Sbjct  301   SSIDRKFVTAVKLGNGMRTSGISINTFSPRKAMYPLTNGARAANVTAEIYGNVSACDYGT  360

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKI  1397
             +S K V+GKIVYCL S SQDYTI  + G G ++A D   D  + T+I  T V  E G KI
Sbjct  361   LSMKKVKGKIVYCLGSGSQDYTIDHLQGAGTIMAVDAPTDIAIATLIAGTFVVPEVGIKI  420

Query  1398  DKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             D+YIN+TK P A I+++R V T TAPF+ SFS+RGPQ I+LNILKPD+AAPGL ILAAY+
Sbjct  421   DQYINSTKNPQAVIYKTRVVNTSTAPFIASFSSRGPQKITLNILKPDIAAPGLDILAAYS  480

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              LA++TG   D R+V +N+ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSALMTTA  M
Sbjct  481   ELASVTGLPGDRRIVPFNILSGTSMACPHAAAAAAYVKSFHPDWSPAAIKSALMTTATPM  540

Query  1755  KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-K  1928
             K K   A LASG+G I PTKAV PGLI+D+N S Y  +LCKE +N+ ++G L G K    
Sbjct  541   KTKSDDAELASGSGQINPTKAVHPGLIYDLNLSSYTRFLCKEGYNSTAIGRLIGRKKKLN  600

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C  I  AQG DGLNYPSMH  LT  N ++ SA F RTVT VG   +++KA + +P GL+V
Sbjct  601   CSTIRPAQGLDGLNYPSMHFHLT--NESSISAIFRRTVTNVGFAKSLYKATVHSPKGLSV  658

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             +V P +L+F +++Q RS+ V+V G  Q   S  +S  L W D  HSV+SPILVY+  
Sbjct  659   TVSPRVLTFSRSHQTRSFTVLVKGSMQSGAS-ILSALLEWSDTKHSVKSPILVYKQF  714



>ref|XP_006481881.1| PREDICTED: xylem serine proteinase 1-like [Citrus sinensis]
Length=748

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/721 (61%), Positives = 539/721 (75%), Gaps = 11/721 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D +RKPYIVYMG +P++  ISAV EHH++LT A+GDE+LARE +I SY +SF+GFVARLL
Sbjct  27    DRERKPYIVYMGNVPEEAGISAVKEHHSLLTTAIGDEKLARESKIRSYGKSFNGFVARLL  86

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVW  497
             P EA+RLSE++ VVSVF NT  KL TTR+WDFLGMS K   R+ KA+S++IVGLLDTG+W
Sbjct  87    PHEAKRLSEEESVVSVFENTRRKLHTTRTWDFLGMSEKLQKRSSKAQSNIIVGLLDTGIW  146

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPE-DQESPADFD  671
             VESPSF D G+GPPPAKWKGKC  G NFT CN+KVIGA+Y+N++    P  DQ+SP D D
Sbjct  147   VESPSFNDKGFGPPPAKWKGKCVTGANFTRCNKKVIGARYYNLDNALDPNTDQKSPVDTD  206

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H +S AAG  V+GASLYGIA+GTARGGVPSARIA YKVCW  GC DMD+LA FD A
Sbjct  207   GHGTHTSSTAAGETVKGASLYGIAQGTARGGVPSARIAMYKVCWSGGCADMDILAAFDDA  266

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVD+ISIS+GG  RS+F D I+IGS+HAMKK I+T  +AGN+GPY GT++NV+PW+M
Sbjct  267   IGDGVDLISISIGGPSRSYFDDSISIGSFHAMKKGILTACSAGNDGPYQGTVENVAPWIM  326

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSAC  1208
             TVAA+SIDR+F + VKLGNG   SG SINTF   K MYPL +G  A +  A   GN  AC
Sbjct  327   TVAASSIDRKFVTAVKLGNGMRTSGISINTFSPRKAMYPLTNGARAANVTAEIYGNVGAC  386

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
             DY ++S K V+GKIVYCL S SQDYTI  + G G ++A D   D  + T+I  T V  E 
Sbjct  387   DYGTLSMKKVKGKIVYCLGSGSQDYTIDRLQGAGTIVAVDAPTDIAIATLIAGTFVVPEV  446

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G KID+YIN+TK P A I+++R V T TAPF+ SFS+RGPQ I+LNILKPD+AAPGL IL
Sbjct  447   GIKIDQYINSTKNPQAVIYKTRVVNTSTAPFIASFSSRGPQKITLNILKPDIAAPGLDIL  506

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AAY+ LA++TG   D R+V +N+ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSALMTT
Sbjct  507   AAYSELASVTGLPGDRRIVPFNILSGTSMACPHAAAAAAYVKSFHPDWSPAAIKSALMTT  566

Query  1743  AKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             A  MK K   A LASG+G I PTKAV PGLI+D+N S Y  +LCKE +N+ ++G L G K
Sbjct  567   ATPMKTKSDDAELASGSGQINPTKAVHPGLIYDLNLSSYTRFLCKEGYNSTAIGRLIGRK  626

Query  1920  DN-KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
                 C  I  AQG DGLNYPSMH   T  N ++ SA F RTVT VG   +++KA + +P 
Sbjct  627   KKLNCSTIRPAQGLDGLNYPSMHFHFT--NESSISAIFRRTVTNVGFAKSLYKATVHSPK  684

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             GL+V+V P +L+F ++ Q RS+ V+V G  Q   S  +S  L W D  HSV+SPILVY+ 
Sbjct  685   GLSVTVSPRVLTFSRSQQTRSFTVLVKGSMQSGAS-ILSALLEWSDTKHSVKSPILVYKQ  743

Query  2277  L  2279
              
Sbjct  744   F  744



>ref|XP_011077880.1| PREDICTED: xylem serine proteinase 1 [Sesamum indicum]
Length=741

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/726 (59%), Positives = 539/726 (74%), Gaps = 9/726 (1%)
 Frame = +3

Query  120   RATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFS  299
             R +    D +R+PYIVYMGELP+D  IS +D HHN+L +A+GD  +AR  +IHSY RSF+
Sbjct  21    RPSYASDDDERQPYIVYMGELPED-RISLMDVHHNLLVQAIGDGTIARNSKIHSYGRSFN  79

Query  300   GFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGL  479
             GF ARLLP EARRLS+K+ +VSVFR+    LLTTRSWDFLGMS K  RN +AES++IV L
Sbjct  80    GFAARLLPHEARRLSQKEGIVSVFRSRTQNLLTTRSWDFLGMSEKLKRNQQAESNIIVAL  139

Query  480   LDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESP  659
             LDTGVWVESPSF D G+GPPP KWKGKC++G NFTGCN KVIGAQYFN+       + +P
Sbjct  140   LDTGVWVESPSFNDVGFGPPPLKWKGKCEEGGNFTGCNNKVIGAQYFNLAHSVQPYETTP  199

Query  660   ADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAG  839
              D DGHG+H AS AAG  VE ASLYGIAEGTARGGVPSARIASYKVCW  GC+D+D+LA 
Sbjct  200   VDTDGHGTHTASTAAGVFVERASLYGIAEGTARGGVPSARIASYKVCWPSGCEDVDILAA  259

Query  840   FDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVS  1019
             FDAAIADGVD+IS+S+GG  RSF +DPIAIGS+HA +K I+T  AAGNEGPY  T+QN +
Sbjct  260   FDAAIADGVDIISVSIGGASRSFTKDPIAIGSFHASRKGILTVCAAGNEGPYEATVQNAA  319

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGN  1196
             PW+MTVAA++IDR+F +DVKLGNGE ISG ++NTF   K  YPL +G  +++ +    GN
Sbjct  320   PWIMTVAASTIDRQFHADVKLGNGEKISGIAVNTFAPEKGFYPLTNGAQSKNFSGDLYGN  379

Query  1197  YSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS--DKLPDTVLPTMIPATI  1370
              SACDY S+    V+GKIVYC   A  D  ++ + G G I S  D L DT   T+   T 
Sbjct  380   ASACDYGSLRTDKVKGKIVYC-QGAGGDTVVQNLGGAGTIMSSNDDL-DTAFATIGIGTY  437

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             + +EDG++IDKYIN+T++  A ++++R V+  AP V SFS+RGP  +S NILKPD++APG
Sbjct  438   ISVEDGQRIDKYINSTRSARAVVYKTRTVEAPAPAVASFSSRGPSRLSPNILKPDISAPG  497

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             ++ILAAY+   T+TG+  D RVVK+NVESGTSMA PH AGAAAY+K+FHP WSPAAIKSA
Sbjct  498   VNILAAYSKFTTVTGEEGDKRVVKFNVESGTSMACPHVAGAAAYIKSFHPRWSPAAIKSA  557

Query  1731  LMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLT  1910
             LMTT+K MKIKP+ A LASG+G I P  AV PGL++DI    Y+S+LCK+   +   +L 
Sbjct  558   LMTTSKPMKIKPLEAELASGSGEINPRAAVHPGLVYDIGTKSYVSFLCKQGYESKDVALI  617

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
               K+  C NI  A GADGLNYPS+HL++ N + +  SA FYRTVT VG G + +   I+ 
Sbjct  618   TGKNYNCSNITQAIGADGLNYPSIHLKVDNTD-SVISAVFYRTVTNVGIGRSTYVVDIEP  676

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P GL+V V PNIL F + +QK+S+KV++ GK  +   WY+SGSL W D+ H VRSPILV 
Sbjct  677   PEGLSVEVTPNILRFFRLHQKKSFKVMLKGKSIQKNMWYLSGSLSWSDSKHHVRSPILV-  735

Query  2271  RSLQTD  2288
              SL TD
Sbjct  736   -SLPTD  740



>gb|EYU38627.1| hypothetical protein MIMGU_mgv1a001905mg [Erythranthe guttata]
Length=741

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/719 (58%), Positives = 539/719 (75%), Gaps = 8/719 (1%)
 Frame = +3

Query  120   RATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFS  299
             R +   +D +R+ YIVYMGELP + TIS  D HH++L++ +GDE +AR+ +++SY RSF+
Sbjct  23    RFSTASNDNERQIYIVYMGELPAEQTISLTDVHHSLLSDIIGDETIARKSKLYSYGRSFN  82

Query  300   GFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGL  479
              F ARLLPREA  LS+K+ VVSVF+N ++KLLTTR+WDFLGMS K  RN + ES++IV L
Sbjct  83    AFAARLLPREAELLSKKEGVVSVFKNRKLKLLTTRTWDFLGMSEKIKRNHQTESNIIVAL  142

Query  480   LDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESP  659
             +DTG+W ESPSF D G+GPPP+KWKGKC  G+NFTGCN KVIGAQYFN+   AP D+ +P
Sbjct  143   IDTGIWTESPSFNDKGFGPPPSKWKGKCVTGVNFTGCNNKVIGAQYFNIGESAPPDEATP  202

Query  660   ADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAG  839
             AD +GHG+H AS A G  V  ASLYG+ EGTARG VPSAR+ASYKVCWG GC D+D+LA 
Sbjct  203   ADTEGHGTHTASTATGAAVASASLYGLGEGTARGAVPSARVASYKVCWGYGCMDVDMLAA  262

Query  840   FDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVS  1019
             FDAAIADGVD+IS+S+GG  RSF +D I IGS+HA+KK I+T  A GN+GPY G+I NV 
Sbjct  263   FDAAIADGVDIISVSIGGSVRSFTEDSIGIGSFHALKKGILTVCAGGNDGPYLGSISNVG  322

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGN  1196
             PW+MTVAA+++DRRFE+DV+LGNG+ ISG +INTF   K +YPL SG LA++ NAT+ GN
Sbjct  323   PWIMTVAASTVDRRFETDVELGNGDKISGIAINTFAPKKGLYPLTSGALAKN-NATF-GN  380

Query  1197  YSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIV  1373
              SACDY ++ ++ V+GKIVYC   A  DY +K + G G V+++D+  DT   T   A+ V
Sbjct  381   SSACDYGTLDKEKVKGKIVYC-KGAGGDYVVKELGGAGTVMSNDQDMDTAYATGSSASYV  439

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              ++DG KI+KYIN+TK+    ++++R V TTAPF+ SFS+RGPQT+  NILKPD+AAPG+
Sbjct  440   TLKDGLKIEKYINSTKSAQGVVYKTRIVNTTAPFIASFSSRGPQTLISNILKPDIAAPGV  499

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             +ILAA +   T+ G  +D +   +N  SGTSMA PH AGAAAYVK+FHP WS AAIKSAL
Sbjct  500   NILAAISKFTTVVGHENDKKTSIFNFNSGTSMACPHVAGAAAYVKSFHPKWSHAAIKSAL  559

Query  1734  MTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             MTT+K +K+K  G  LASG+G I P  AV PGLI+DIN + Y+  LCK+ + +  +  +T
Sbjct  560   MTTSKPIKVKE-GGELASGSGQINPKMAVHPGLIYDINTTSYVGLLCKQGYKDKEIALIT  618

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             GS    C  I   +GADG+NYPS++LQ+ +   T  SA FYR VT VG G +V+KA++++
Sbjct  619   GSGKYNCSKIQRGKGADGINYPSINLQVKS-RETNISAVFYRRVTNVGVGKSVYKARVES  677

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             P G++V VVP+IL F + +QKRS+KV + GKF    S Y+SGSLVW D  H VRSPILV
Sbjct  678   PKGVSVKVVPDILLFSRADQKRSFKVTLKGKFVDKDSRYLSGSLVWSDTKHEVRSPILV  736



>gb|KDO61088.1| hypothetical protein CISIN_1g045363mg [Citrus sinensis]
Length=712

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/711 (61%), Positives = 530/711 (75%), Gaps = 11/711 (2%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG +P++  ISAV EHH++LT A+GDE+LARE +I SY +SF+GFVARLLP EA+RLSE+
Sbjct  1     MGNVPEEAGISAVKEHHSLLTTAIGDEKLARESKIRSYGKSFNGFVARLLPHEAKRLSEE  60

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWVESPSFKDDG  527
             + VVSVF NT  KL TTR+WDFLGMS K   R+ KA+S++IVGLLDTG+WVESPSF D G
Sbjct  61    ESVVSVFENTRRKLHTTRTWDFLGMSEKLQKRSSKAQSNIIVGLLDTGIWVESPSFNDKG  120

Query  528   YGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPE-DQESPADFDGHGSHIASIA  701
             +GPPPAKWKGKC  G NFT CN+KVIGA+Y+N++    P  DQ+SP D DGHG+H +S A
Sbjct  121   FGPPPAKWKGKCVTGANFTRCNKKVIGARYYNLDNALDPNTDQKSPVDTDGHGTHTSSTA  180

Query  702   AGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISI  881
             AG  V+GASLYGIA+GTARGGVPSARIA YKVCW  GC DMD+LA FD AI DGVD+ISI
Sbjct  181   AGETVKGASLYGIAQGTARGGVPSARIAMYKVCWSGGCADMDILAAFDDAIGDGVDLISI  240

Query  882   SVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRR  1061
             S+GG  RS+F D I+IGS+HAMKK I+T  +AGN+GPY GT++NV+PW+MTVAA+SIDR+
Sbjct  241   SIGGPSRSYFDDSISIGSFHAMKKGILTACSAGNDGPYQGTVENVAPWIMTVAASSIDRK  300

Query  1062  FESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISEKLV  1238
             F + VKLGNG   SG SINTF   K MYPL +G  A +  A   GN  ACDY ++S K V
Sbjct  301   FVTAVKLGNGMRTSGISINTFSPRKAMYPLTNGARAANVTAEIYGNVGACDYGTLSMKKV  360

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             +GKIVYCL S SQDYTI  + G G ++A D   D  + T+I  T V  E G KID+YIN+
Sbjct  361   KGKIVYCLGSGSQDYTIDRLQGAGTIVAVDAPTDIAIATLIAGTFVVPEVGIKIDQYINS  420

Query  1416  TKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             TK P A I+++R V T TAPF+ SFS+RGPQ I+LNILKPD+AAPGL ILAAY+ LA++T
Sbjct  421   TKNPQAVIYKTRVVNTSTAPFIASFSSRGPQKITLNILKPDIAAPGLDILAAYSELASVT  480

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG  1772
             G   D R+V +N+ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSALMTTA  MK K   
Sbjct  481   GLPGDRRIVPFNILSGTSMACPHAAAAAAYVKSFHPDWSPAAIKSALMTTATPMKTKSDD  540

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKNIPA  1946
             A LASG+G I PTKAV PGLI+D+N S Y  +LCKE +N+ ++G L G K    C  I  
Sbjct  541   AELASGSGQINPTKAVHPGLIYDLNLSSYTRFLCKEGYNSTAIGRLIGRKKKLNCSTIRP  600

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNI  2126
             AQG DGLNYPSMH   T  N ++ SA F RTVT VG   +++KA + +P GL+V+V P +
Sbjct  601   AQGLDGLNYPSMHFHFT--NESSISAIFRRTVTNVGFAKSLYKATVHSPKGLSVTVSPRV  658

Query  2127  LSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             L+F ++ Q RS+ V+V G  Q   S  +S  L W D  HSV+SPILVY+  
Sbjct  659   LTFSRSQQTRSFTVLVKGSMQSGAS-ILSALLEWSDTKHSVKSPILVYKQF  708



>ref|XP_009774138.1| PREDICTED: xylem serine proteinase 1-like [Nicotiana sylvestris]
Length=734

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/716 (58%), Positives = 533/716 (74%), Gaps = 16/716 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +RKPYIVYMGELP+D T+    +HH++L+EA+GD+ +ARE +IHSY RSF+ F ARLLP 
Sbjct  30    ERKPYIVYMGELPEDATLLLD-DHHSLLSEAIGDDTIARESKIHSYGRSFNAFAARLLPD  88

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA RLS+K+ +VSVF NT  +L TTRSWDF+GM+    RN +AESD IV +LDTG+W+ES
Sbjct  89    EAERLSQKEGIVSVFPNTVRRLRTTRSWDFIGMTETVQRNQQAESDTIVAVLDTGIWMES  148

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSH  686
              SF D G+GPPPAKWKGKC +G+NFTGCN KVIGAQ+FN++  A  ++ SPADF+GHG+H
Sbjct  149   QSFNDTGFGPPPAKWKGKCDQGVNFTGCNNKVIGAQFFNLDKKAATNEISPADFEGHGTH  208

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG  V GA+L G A GTARGGVPSARIA+YKVCW  GC D+++L  FDAAI+DGV
Sbjct  209   TASTAAGIPVPGANLDGFANGTARGGVPSARIAAYKVCWSSGCSDINLLGAFDAAISDGV  268

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             D++S+SVGG  RSFF+D ++IG++HAMK  I+T+ +AGN+GP    ++NV+PW+MTVAAT
Sbjct  269   DIVSVSVGGPARSFFKDSMSIGAFHAMKNGILTSCSAGNDGPDLSQVENVAPWIMTVAAT  328

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
             SIDR+FE+  +LGNGE  +G S+N F+  GKM PL SG LA++K+A    + S CD  S+
Sbjct  329   SIDRQFETTTQLGNGESFTGISLNLFDTNGKMSPLTSGILAKNKSAGSDVDPSDCDDGSL  388

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKID  1400
                 V+G IV CL +  QD  I+   G G I S D   DT + T+IPAT V   DG KI+
Sbjct  389   DGSKVKGNIVLCLENNDQDAIIQKYGGAGAIMSTDDFSDTAMSTVIPATYVREADGDKIN  448

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              YINTTK+PTA IFRSR +  TAPF+PSFS+RGPQTISLNILKPD+AAPGLSILAA+   
Sbjct  449   LYINTTKSPTATIFRSRTINITAPFIPSFSSRGPQTISLNILKPDIAAPGLSILAAF---  505

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
                      + V KYN+  GTSM+ PHAA AAAYVKTFHPDWSPAAIKSALMTTAK MKI
Sbjct  506   ---------SEVRKYNLIWGTSMSCPHAAAAAAYVKTFHPDWSPAAIKSALMTTAKPMKI  556

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
              P    LASG+G I PT A+ PGL++DI+ + Y+S+LCKE +N++++  + G+    C N
Sbjct  557   DPEEKELASGSGQINPTGALDPGLVYDIDINSYISFLCKEGYNSSNIAQIAGNGTFNCSN  616

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
                A+G DGLNYPSMHLQL  PN +T  A F+RTVT VG G  ++ A +++P GL++ V 
Sbjct  617   FSQAKGIDGLNYPSMHLQLQPPNNSTIFATFFRTVTNVGQGKALYNATVQSPDGLSIVVT  676

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQT  2285
             P+ L F Q N+ +S++V +SG F    ++Y+S SLVW D+ H V+SPILVYRSL +
Sbjct  677   PSSLMFNQQNETQSFQVSLSGNFTDPKAFYLSASLVWSDSIHVVKSPILVYRSLSS  732



>ref|XP_006381297.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59094.1| subtilase family protein [Populus trichocarpa]
Length=740

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/727 (58%), Positives = 532/727 (73%), Gaps = 8/727 (1%)
 Frame = +3

Query  117   VRATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSF  296
             V A    + ++RKPYIVYMGE      IS  DEHH++L  A GDE +A+  +I+SY ++F
Sbjct  17    VTAVHASNGSERKPYIVYMGE-ARGAGISTSDEHHSLLLAATGDESIAKNSKIYSYGKNF  75

Query  297   SGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVG  476
             +GF ARLLP E +RLS++D VVSVF NT  KL TTRSWDFLGM   A R    ES+ IVG
Sbjct  76    NGFAARLLPHEVKRLSDEDSVVSVFANTRNKLHTTRSWDFLGMPQTAKRRLDIESNTIVG  135

Query  477   LLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQES  656
             +LDTG++V++PSF D+GYGP PAKWKGKC KG NFTGCN KVIGA+Y+N+E    E+  S
Sbjct  136   VLDTGIYVDAPSFNDEGYGPVPAKWKGKCVKGANFTGCNNKVIGARYYNLENSEVEN-PS  194

Query  657   PADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLA  836
             PAD DGHG+H +S AAG  V+ ASLYGIA+GTARGGVPSARIA YKVCWG GC DMD+LA
Sbjct  195   PADLDGHGTHTSSTAAGIAVKDASLYGIAQGTARGGVPSARIAMYKVCWGSGCSDMDLLA  254

Query  837   GFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNV  1016
              FD AI+DGVD+IS+S+GG  RSFFQDPIAIGS+H+MKK I+T+ +AGN GPY G+++NV
Sbjct  255   AFDDAISDGVDIISVSIGGASRSFFQDPIAIGSFHSMKKGILTSCSAGNNGPYPGSVENV  314

Query  1017  SPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPG  1193
             +PW+MT+AATSIDR+F + VKLGNG   +G SINTF   K  YPLI G  A + +  + G
Sbjct  315   APWIMTIAATSIDRQFTTAVKLGNGMKATGISINTFSPKKETYPLIDGARASNSSGDHYG  374

Query  1194  NYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATI  1370
             N SACDY ++S   V+GK+VYCL S  QDYTIK + G GVI S   P DT   T+IP T 
Sbjct  375   NISACDYGTLSMDKVKGKLVYCLGSNGQDYTIKELQGAGVITSLDAPTDTAYATVIPGTS  434

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             V ++DG KID YIN+T+ P A I+++R    +AP V SFS+RGPQ I+LNILKPD+AAPG
Sbjct  435   VQLKDGYKIDVYINSTRNPRAVIYKTRTTYMSAPSVASFSSRGPQLINLNILKPDIAAPG  494

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             L ILAAY+ LAT+TG  +D+R   +N+ SGTSM+ PHAA AAAYVKTFHPDWSPAAIKSA
Sbjct  495   LGILAAYSKLATVTGDPNDSRYSPFNIISGTSMSCPHAAAAAAYVKTFHPDWSPAAIKSA  554

Query  1731  LMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLT  1910
             LMTTA  +KIK + A L SG+G I P KAV PGL++DI  S Y+ +LCKE  N++  SL 
Sbjct  555   LMTTATPIKIKDVDAELGSGSGQINPLKAVHPGLVYDIPMSSYIRFLCKEGYNSTTISLL  614

Query  1911  --GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTG-STVFKAK  2081
               G K  +C N   AQG DGLNYPSMH QL +   +  SA FYRT+T VG G ++++KA 
Sbjct  615   LGGKKKYRCSNFQPAQGTDGLNYPSMHAQLKSAE-SNISAVFYRTLTNVGYGNNSLYKAT  673

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             + +P  L++ +VPN L F + +QK+S+KV V G   +  +  +S  L W D+ H VRSPI
Sbjct  674   VTSPKDLSIKIVPNSLKFNRPHQKQSFKVFVEGGSMQNGTRLLSALLEWSDSKHIVRSPI  733

Query  2262  LVYRSLQ  2282
             ++Y S Q
Sbjct  734   IIYNSSQ  740



>ref|XP_002533546.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28836.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=740

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/717 (57%), Positives = 521/717 (73%), Gaps = 7/717 (1%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D +RKPYIVYMG+LP+   IS VD+HHN+L  A+GDE +ARE +I+SY RSF+GFVARLL
Sbjct  27    DNERKPYIVYMGDLPE-AGISVVDQHHNLLVTAVGDESIARESKIYSYGRSFNGFVARLL  85

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P E  RLSE++ VVSVF NT  KL TTRSWD+LGM+    R    ES ++VG+LDTG++V
Sbjct  86    PHEVNRLSEEESVVSVFENTRNKLHTTRSWDYLGMTETIQRRLTIESSIVVGVLDTGIYV  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
              +PSF+D+GYGP PAKWKGKC  G NFTGCN+KVIGA+Y++++  +  D+ SPAD DGHG
Sbjct  146   NAPSFRDEGYGPNPAKWKGKCATGANFTGCNKKVIGAKYYDLQNISTRDK-SPADDDGHG  204

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H +S  AG  V  ASLYGI  GTARGGVPSARIA YKVCW  GC DMD+LA FD AIAD
Sbjct  205   THTSSTVAGVAVNSASLYGIGNGTARGGVPSARIAMYKVCWEGGCTDMDLLAAFDDAIAD  264

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD++S+S+GG  R + QDPIAIGS+HAMK  I+T+ +AGN+GP   ++ NV+PW+MTV 
Sbjct  265   GVDLLSVSIGGWSRDYIQDPIAIGSFHAMKHGILTSCSAGNDGPMQSSVSNVAPWIMTVG  324

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+SIDR+F++ +KLGNG   +G SI+TF   K MYPL SG LA + + +   N SACD  
Sbjct  325   ASSIDRQFKTALKLGNGLKTTGISISTFAPKKQMYPLTSGPLANNVSNSDYVNTSACDAG  384

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKK  1394
             ++ +  V+GKIVYCL +  QDYTI+ + G GVI S D   D    ++I +T V I+DG K
Sbjct  385   TLDKNKVKGKIVYCLGNGPQDYTIRDLKGAGVILSIDTFNDVAFTSVIRSTSVSIKDGLK  444

Query  1395  IDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             ID YINTTK P A I+++R V   AP + SFSARGPQ ISLNILKPDLAAPGL ILA Y+
Sbjct  445   IDHYINTTKNPQAVIYKTRTVPIAAPAIASFSARGPQLISLNILKPDLAAPGLDILAGYS  504

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              LAT+TG   D R   +N+ SGTSM+ PHAA AA YVK+FHPDWSPA IKSALMTTA  M
Sbjct  505   RLATITGDPADKRYSAFNIISGTSMSCPHAAAAAGYVKSFHPDWSPAMIKSALMTTATPM  564

Query  1755  KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-K  1928
             KIK I   L SG+G I P +A+ PGL++DI+ S Y+S+LCKE +N+ ++GSL G K    
Sbjct  565   KIKDISMELGSGSGQINPRRAIHPGLVYDISMSNYLSFLCKEGYNSTTIGSLIGGKKKYN  624

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C +   A+G+DGLNYPSMHLQL  P  +  SA +YRTVT+VG G +V+KA +KAP    V
Sbjct  625   CSDFKPARGSDGLNYPSMHLQLKTPE-SKISAVYYRTVTHVGYGKSVYKAIVKAPENFLV  683

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
              V+P+ L F   +QK ++KV+V G          +  L W D+ HSV+SPI +YR+L
Sbjct  684   KVIPDTLRFTTKHQKLNFKVLVKGDQMANGKEIQTAWLEWNDSKHSVKSPIAIYRNL  740



>ref|XP_007027679.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY08181.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=751

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/720 (57%), Positives = 532/720 (74%), Gaps = 10/720 (1%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPD-DPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             + +RKPYIVYMGE P  +  IS +D+HHN+L +A+GDE +ARE +I+SY +S + F ARL
Sbjct  33    ENERKPYIVYMGEAPHHEARISVMDKHHNLLLKAVGDENIARESKIYSYGKSINAFAARL  92

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGV  494
             LP EA+RLS  D V+SVF NT  KLLTTRSWDFLGM  K   RN  AES++IVG+LDTG+
Sbjct  93    LPDEAKRLSGVDGVISVFENTRRKLLTTRSWDFLGMHEKLKKRNAIAESNIIVGVLDTGI  152

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADFD  671
             W +SPSF D GYGPPPAKWKGKC KG NFTGCN KVIGA+Y+ ++   P  +  +P D D
Sbjct  153   WPKSPSFNDKGYGPPPAKWKGKCDKGANFTGCNNKVIGARYYQLDNTYPIMEDPTPVDTD  212

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H AS AAG  V+ +SLYGIA+GTARGGVPSARIA YKVCW  GC DMD+LA +D A
Sbjct  213   GHGTHTASTAAGIAVKDSSLYGIAKGTARGGVPSARIAMYKVCWISGCSDMDLLAAYDDA  272

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVD+ISIS+GG P+ FF DPIAIG++HAM+K I+T+ A GNEGP   T+QNV+PW+M
Sbjct  273   IHDGVDLISISIGGPPKEFFHDPIAIGAFHAMRKGILTSCAGGNEGPMLATVQNVAPWIM  332

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG-NYSA  1205
             TVAA+SIDR+F S +KLG+G   SG  INTF +  KMYP  +G  A +    Y   N SA
Sbjct  333   TVAASSIDRQFTSKIKLGDGTTTSGNGINTFSMKNKMYPFTNGAHATNLTGNYTDRNISA  392

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIP-ATIVDI  1379
             CDY ++S+  V+GKIVYCL  A QDYTI+ + G G ++A+D   D    T+ P AT+V  
Sbjct  393   CDYGTMSQDRVKGKIVYCLGEAGQDYTIQLLGGAGTIMATDAPQDYYFLTLTPAATVVRS  452

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             +DG K+D+YIN+TK P A I++SR VK  APFV SFS+RGPQ ++ NILKPD+AAPGL+I
Sbjct  453   KDGDKLDRYINSTKKPQAVIYKSRTVKMNAPFVASFSSRGPQLLNRNILKPDIAAPGLNI  512

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAAYT L ++TG+  D R   +N  SGTSMA PHA+ AAAYVK+ HPDWSPAAIKSALMT
Sbjct  513   LAAYTNLRSITGEPSDKRYSAFNFMSGTSMACPHASAAAAYVKSMHPDWSPAAIKSALMT  572

Query  1740  TAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             TA  MKI+     L+SG+G I P +A+ PGLI+DI++  Y+S+LCK+ +N+ ++G L G 
Sbjct  573   TATPMKIRDKFGELSSGSGQINPIRAIQPGLIYDIDERSYISFLCKQGYNSTTIGLLIGG  632

Query  1917  KDN-KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             +    C +   A+G DGLNYPSMH+ L +  +  F A FYRTVT+V  G++ FKAK+ +P
Sbjct  633   EQKLDCSSFKPARGTDGLNYPSMHVHLNSTESRIF-AVFYRTVTHVAYGNSEFKAKVTSP  691

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              GL+++V+PN L F +T+QK+S+KV+V G   K  +  +S +L W +  HSV+SPILVY+
Sbjct  692   KGLSIAVIPNTLKFNRTHQKQSFKVLVKGGLMKNGTEILSATLEWSNKEHSVKSPILVYK  751



>ref|XP_002277106.1| PREDICTED: xylem serine proteinase 1 isoform X2 [Vitis vinifera]
Length=744

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/720 (57%), Positives = 525/720 (73%), Gaps = 15/720 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             DTQRKPYIVYMG+LP    ++A D HH++L+  +G + +AR+  IHSY RSF+GF ARLL
Sbjct  28    DTQRKPYIVYMGDLPKTGAVTAAD-HHSLLSAVVGSDRMARDSTIHSYGRSFNGFAARLL  86

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVW  497
             P EA+ LSEK+ VVSVF NT  KL TTRSWDFLGM  K   RNPKAE ++++GLLDTG+W
Sbjct  87    PHEAKILSEKEGVVSVFPNTMRKLHTTRSWDFLGMREKMKKRNPKAEINMVIGLLDTGIW  146

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG----FAPEDQESPAD  665
             ++ PSFKD GYGPPP KWKGKC     FTGCN KVIGA+Y++++        +D  SP D
Sbjct  147   MDCPSFKDKGYGPPPTKWKGKCSNSSGFTGCNNKVIGAKYYDLDHQPGMLGKDDILSPVD  206

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
              DGHG+H AS AAG +V+ ASL+G+ +GTARGGVP ARIA YKVCW  GC DM++LAGFD
Sbjct  207   TDGHGTHTASTAAGIVVKNASLFGVGKGTARGGVPLARIAMYKVCWYTGCSDMNLLAGFD  266

Query  846   AAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
              AIADGVDV+S+S+GG    FF+DPIAIG++HAM++ ++ +++AGN+GP   T+QNV+PW
Sbjct  267   DAIADGVDVLSVSIGGTVGPFFEDPIAIGAFHAMRRGVLVSSSAGNDGPLEATVQNVAPW  326

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYS  1202
             ++TV AT +DR F S VKLGNG   SG S+NTF    KMYPL SGTLA + +  Y GN S
Sbjct  327   ILTVGATGLDREFRSQVKLGNGMKASGVSVNTFSPRKKMYPLTSGTLASNSSGAYWGNVS  386

Query  1203  ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDI  1379
             ACD+ S+  + V+GKIVYC+ +  QD+ I+ + G+G I S D+  D     +IP+T V  
Sbjct  387   ACDWASLIPEEVKGKIVYCMGNRGQDFNIRDLGGIGTIMSLDEPTDIGFTFVIPSTFVTS  446

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             E+G+KIDKYIN+TK   A I++S+A K  APFV SFS+RGPQ +S NILKPD+ APGL I
Sbjct  447   EEGRKIDKYINSTKKAQAVIYKSKAFKIAAPFVSSFSSRGPQDLSPNILKPDIVAPGLDI  506

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA Y+ LA ++G  +D R   +N+ +GTSM+ PH A AAAYVK+FHP WSPAAIKSALMT
Sbjct  507   LAGYSKLAPISGDPEDRRFANFNILTGTSMSCPHVAAAAAYVKSFHPKWSPAAIKSALMT  566

Query  1740  TAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             TA  +KIK     L SG+G + P  AV PGL++DI  S Y+ +LCKE +N+ ++G LTG 
Sbjct  567   TATTLKIKD--NALGSGSGQLNPRIAVHPGLVYDIPTSGYIRFLCKEGYNSTTIGLLTGG  624

Query  1917  KDN-KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             K   KC N   A G+DGLNYPSMHLQ+ +P A  FSA FYRTVT VG G++V+KA +KA 
Sbjct  625   KQKYKCSNFRPALGSDGLNYPSMHLQIKDPTA-RFSAVFYRTVTSVGHGASVYKATVKAT  683

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              GL+V VVPN LSF + +Q+RS+K+V+ GK     S   S  L W D+ H V+SPILVYR
Sbjct  684   KGLSVRVVPNTLSFQKAHQRRSFKIVLKGKPNN--SRIQSAFLEWSDSKHKVKSPILVYR  741



>ref|XP_009374771.1| PREDICTED: xylem serine proteinase 1-like [Pyrus x bretschneideri]
Length=746

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/719 (57%), Positives = 527/719 (73%), Gaps = 9/719 (1%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D  RKPYIVYMGELP  P IS +  HHN+L +A+GD ++ARE RIHSY RSF+GFVARLL
Sbjct  30    DDGRKPYIVYMGELPA-PEISVMSRHHNLLAQAIGDVKVARESRIHSYGRSFNGFVARLL  88

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVW  497
             P EA+ LS+ D VVSVF NT  KL TTRSWD+LG+  K+  RN + ES+ IVG+LD+G++
Sbjct  89    PHEAQALSDDDSVVSVFPNTVRKLHTTRSWDYLGLPLKSKKRNSRIESNTIVGVLDSGIY  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGH  677
             +++PSF D GYGPPPAKWKGKC KG NFTGCN KVIGA+YF +        +SP D DGH
Sbjct  149   MQAPSFNDKGYGPPPAKWKGKCMKGANFTGCNNKVIGAKYFKLNIARTWGIQSPVDDDGH  208

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAI  854
             G+H AS  AG  V+GASLYG+A+GTARGGVP +RIA YKVCW   GC DMD+LA FD AI
Sbjct  209   GTHTASTIAGAAVKGASLYGVAKGTARGGVPLSRIAVYKVCWSTLGCSDMDILAAFDEAI  268

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGVD+ISIS+GGH R F  DPIAIGS+HAMKK I  + +AGN+G    ++QNV+PW+MT
Sbjct  269   ADGVDLISISIGGHSRRFLDDPIAIGSFHAMKKGIFVSCSAGNDG-LPASVQNVAPWIMT  327

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACD  1211
             VAA ++DR+ ++ VKLGNG+ ISG ++NT+   K MYPLISG LA + +  + GN SACD
Sbjct  328   VAANTLDRQLQTVVKLGNGQRISGNALNTYSPKKLMYPLISGALAYNTSNEFGGNASACD  387

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDG  1388
               +++  LV+G+IVYC     QDYTI+ + G G +I+ D+L D     +IP T + ++DG
Sbjct  388   SWTLNANLVKGRIVYCQGFGYQDYTIQRLKGAGTLISRDELNDYAYSPIIPGTDILVQDG  447

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
              KIDKYIN+TK PTA I+++R  + TAP V SFS+RGPQ I+LNILKPD++APG++ILAA
Sbjct  448   IKIDKYINSTKNPTAVIYKTRTPRMTAPIVASFSSRGPQQITLNILKPDISAPGVNILAA  507

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             Y+ + ++TG  +D R   +NV SGTSM+ PH A AAAYVK+FHPDWSPAAIKSALMTTA 
Sbjct  508   YSKIPSITGYPEDLRHNVFNVLSGTSMSCPHVAAAAAYVKSFHPDWSPAAIKSALMTTAT  567

Query  1749  AMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
              MK +     LA+GAG + P KAV PGL++DI   +Y S+LCKE FN+  +G L G K N
Sbjct  568   PMKNETADTQLAAGAGQVNPKKAVHPGLVYDITLDDYFSFLCKEGFNDTDIGKLVGDKKN  627

Query  1926  -KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
               C N    +G DGLNYPSMHLQL   + ++ SA FYR VT+VG G++V+KAK+    GL
Sbjct  628   YNCSNFKPPRGTDGLNYPSMHLQLLPNDNSSVSAVFYRRVTHVGFGNSVYKAKVMNSNGL  687

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
              V V+PN L+F + +Q+RS+KVVV+G+        M   L W D+ H+V+S I+VY+ L
Sbjct  688   RVKVIPNTLTFTKLHQRRSFKVVVTGR-PTMTETVMHAILQWDDSIHNVKSHIVVYKHL  745



>ref|XP_010068943.1| PREDICTED: xylem serine proteinase 1-like [Eucalyptus grandis]
Length=868

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/716 (58%), Positives = 524/716 (73%), Gaps = 10/716 (1%)
 Frame = +3

Query  156   PYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREAR  335
             PYI+YMGELP+  T S  D+HH++L  A+GDEE+AR+ +I+SY +SF+GF ARLLP E +
Sbjct  152   PYIIYMGELPEART-SIEDKHHSLLMAAIGDEEIARQAKIYSYGKSFNGFAARLLPHEVQ  210

Query  336   RLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGVWVESPS  512
             +LS++D VVSVF N + KL TTRSWDFLGM  T  +RN K ESD+I+G+LDTG++V +PS
Sbjct  211   KLSDEDAVVSVFANKKRKLHTTRSWDFLGMPGTSGSRNSKVESDIIIGILDTGIYVNAPS  270

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIA  692
             F D G+GP PAKWKGKC KG NFTGCN KVIGA+YFN+E  A     +PAD DGHG+H +
Sbjct  271   FGDKGFGPAPAKWKGKCVKGANFTGCNNKVIGAKYFNLEN-AATGSVTPADDDGHGTHTS  329

Query  693   SIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDV  872
             SIAAG  V+GAS YGIA GTARGG  SARIA YKVCW  GC DMD+LAGFD AIADGVD+
Sbjct  330   SIAAGVAVKGASFYGIARGTARGGASSARIAMYKVCWENGCSDMDLLAGFDEAIADGVDL  389

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             IS+S+GG  + FF DP+AIGS+HAMK+ I+T+ + GN+GP   TI+NV+PW+MTVAA+SI
Sbjct  390   ISVSIGGPSKDFFSDPMAIGSFHAMKRGILTSCSGGNDGPTEYTIENVAPWIMTVAASSI  449

Query  1053  DRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISE  1229
             DR+F+++ KLGNG    G SINTF   K MYPLISGTLA D +     N SAC+Y S+S+
Sbjct  450   DRKFQTEFKLGNGASYDGLSINTFAPKKQMYPLISGTLAADTSHQSYLNASACEYGSLSQ  509

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLP--DTVLPTMIPATIVDIEDGKKID  1400
               V+G++VYC     QD TIK + GVG+ AS D L   D      +P T V  +DG+KID
Sbjct  510   HKVKGRVVYCEGYFGQDDTIKQLGGVGLAASGDSLADVDVAFVMSMPGTTVSNKDGEKID  569

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+TK P A I ++R  K  APF+ +FS+RGPQ I+LNILKPDLAAPG+ ILAAY+ L
Sbjct  570   RYINSTKNPQAVISKTRTAKMNAPFIAAFSSRGPQLIALNILKPDLAAPGIDILAAYSKL  629

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
               +T    D R   +N+ SGTSMA PH   AAAYVK+FHP+WSPA IKSALMTTA  MKI
Sbjct  630   PPVTEDPLDKRHATFNILSGTSMACPHTVAAAAYVKSFHPNWSPATIKSALMTTAVPMKI  689

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCK  1934
             K   A L+SG+G I P KAV PGL++DI    Y+S+LCKE +N  ++  LTG K    C 
Sbjct  690   KDEFAELSSGSGQINPVKAVHPGLVYDITMRSYISFLCKEGYNGTTIALLTGGKKKFNCS  749

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +   A G DGLNYPSMHLQLT+ NA + SA FYRTVT VG+  +++KAK+ AP G+++ V
Sbjct  750   SFRPAHGTDGLNYPSMHLQLTDTNA-SISAVFYRTVTNVGSAKSLYKAKVTAPEGVSIQV  808

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
             VP+ L F + ++ RS+KVVV G   K  +  MSGSL W D+ H V+SPIL++ + Q
Sbjct  809   VPDTLKFDKLHENRSFKVVVKGGRVKKGTRIMSGSLEWSDSRHRVKSPILIFTTDQ  864



>ref|XP_010050421.1| PREDICTED: LOW QUALITY PROTEIN: xylem serine proteinase 1 [Eucalyptus 
grandis]
Length=717

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/715 (58%), Positives = 525/715 (73%), Gaps = 8/715 (1%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             +PYI+YMGELP+  T S  D+HH++L  A+GDEE+AR+ +I+SY +SF+GF ARLLP E 
Sbjct  2     QPYIIYMGELPEAKT-SVEDKHHSLLMAAIGDEEIARQAKIYSYGKSFNGFAARLLPHEV  60

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGVWVESP  509
             ++LS++D V+SVF N + KL TTRSWDFLGM  T  +RN K ESD+I+G+LDTG++V +P
Sbjct  61    QKLSDEDVVMSVFANKKRKLHTTRSWDFLGMPETSGSRNSKVESDIIIGILDTGIYVNAP  120

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D G+GP PAKWKGKC KG NFTGCN KVIGA+YFN+E  AP    +PAD  GHG+H 
Sbjct  121   SFDDKGFGPAPAKWKGKCVKGANFTGCNNKVIGAKYFNLEN-APTGSVTPADDIGHGTHT  179

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             +SIAAG  V+GAS YGIA+GTARGG  SA IA YKVC   GC DMD+LAGFD AIADGVD
Sbjct  180   SSIAAGVAVKGASFYGIAKGTARGGASSAHIAMYKVCSKNGCSDMDLLAGFDEAIADGVD  239

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +IS+S+GG    FF DP+AIGS+HAMK+ I+T+ + GN GP   TI+NV+PW+MTVAA+S
Sbjct  240   LISVSIGGPSTDFFSDPMAIGSFHAMKRGILTSCSGGNYGPTEYTIENVAPWIMTVAASS  299

Query  1050  IDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSIS  1226
             IDR+F+++ KLGNG    G SINTF   K MYPLISGTLA D +     N SACDY S+S
Sbjct  300   IDRKFQTEFKLGNGASYDGLSINTFSPKKQMYPLISGTLAADTSHXSHLNASACDYGSLS  359

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKIDK  1403
             +  V+G++VYC    SQD TIK + GVG++AS D L D      +P T V  +DG+KID+
Sbjct  360   QHKVKGRVVYCEGYLSQDDTIKQLGGVGLVASGDSLADVAFVVSMPRTTVSNKDGEKIDR  419

Query  1404  YINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             YIN+TK P A I ++R  K  APF+ SFS+RGPQ I+LNILKPDLAAPGL ILAAY+ L 
Sbjct  420   YINSTKYPRAVISKTRTAKMNAPFIASFSSRGPQLIALNILKPDLAAPGLDILAAYSKLP  479

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK  1763
              +T    D R   +N+ SGTSMA PHA  AAAYVK+FHP+WSPAAIKSALMTTA  MKIK
Sbjct  480   PVTEDPLDKRHATFNILSGTSMACPHAVAAAAYVKSFHPNWSPAAIKSALMTTAMPMKIK  539

Query  1764  PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKN  1937
                A L+SG+G I P KAV PGL++DI    Y+S+LCKE +N  ++  L G K    C +
Sbjct  540   DEFAELSSGSGQINPVKAVHPGLVYDITMRSYISFLCKEGYNGTTIALLAGGKKKFNCSS  599

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
                A G DGLNYPSMHLQLT+ +A + SA FYRTVT VG+  +++KAK+ AP G+++ VV
Sbjct  600   FRPAHGTDGLNYPSMHLQLTDTSA-SISAIFYRTVTNVGSAKSLYKAKVTAPEGVSIQVV  658

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
             P+ L F + ++ RS+KVVV G   K  +  MSGSL W D+ H V+SPIL++ + Q
Sbjct  659   PDTLKFDKLHENRSFKVVVKGGRVKKGTHIMSGSLEWSDSRHRVKSPILIFTTDQ  713



>gb|KDP42719.1| hypothetical protein JCGZ_23659 [Jatropha curcas]
Length=708

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/707 (58%), Positives = 523/707 (74%), Gaps = 8/707 (1%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+LP    ISA +EHH +L  A+GDE  ARE +IHSY +SF+ F ARLLP E  +L  +
Sbjct  1     MGDLPRH-AISAAEEHHKLLMAAIGDEAKAREAKIHSYGKSFNAFAARLLPNEVEKLLGE  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             + VVSVF NT  KL TTRSWDFLGM+    R  K+ES++IVG++DTG++V+S SF D GY
Sbjct  60    EGVVSVFANTINKLHTTRSWDFLGMTETIIRRTKSESNIIVGMMDTGIYVDSVSFNDYGY  119

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP--EDQESPADFDGHGSHIASIAA  704
             GPPPAKWKG+C  G NFTGCN+KVIGA+Y+N+E   P  ED++SPAD DGHG+H +S  A
Sbjct  120   GPPPAKWKGECVTGGNFTGCNKKVIGARYYNLENGDPQSEDEQSPADTDGHGTHTSSTVA  179

Query  705   GRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVDVISI  881
             G  V GASLYGIA GTARGGVPSARIA YKVCW   GC DMD+LAGFD AIADGVD+IS 
Sbjct  180   GVAVSGASLYGIANGTARGGVPSARIAMYKVCWENSGCSDMDLLAGFDDAIADGVDIIST  239

Query  882   SVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRR  1061
             S+GG PRSFF+DPIAIGS+HAMKK I+T+ ++GN+GP   T++NV+PW+MTVAA++IDRR
Sbjct  240   SIGGWPRSFFEDPIAIGSFHAMKKGILTSCSSGNDGPTLATVENVAPWIMTVAASTIDRR  299

Query  1062  FESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVR  1241
             F + +KLGNG   +G SINTF   KMYPL +G LA +      GN SACDY ++    V+
Sbjct  300   FITPIKLGNGTKAAGVSINTFSSNKMYPLTTGDLASNVTGDSYGNASACDYGTLGMDKVK  359

Query  1242  GKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKIDKYINTT  1418
             GKI+YC+ S  QDY IK + GVG I S  +  DT   T+IPAT V++ D  KI++YINTT
Sbjct  360   GKIIYCVGSYGQDYFIKQLKGVGAIMSISEGTDTAFTTLIPATNVNLIDANKINQYINTT  419

Query  1419  KAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQ  1598
             K P A I+++R VK  AP + SFS+RGPQ +S NILKPDLAAPGL ILAAY+ L T+TG+
Sbjct  420   KNPQAVIYKTRTVKVGAPALASFSSRGPQPVSKNILKPDLAAPGLDILAAYSKLTTVTGE  479

Query  1599  VDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAY  1778
              DDTR+  +N+ SGTSMA PHA+ AAAYVK+FHPDWSPAAIKSALMTTA  MK+K     
Sbjct  480   PDDTRISSFNIISGTSMACPHASAAAAYVKSFHPDWSPAAIKSALMTTATPMKMKDDYTD  539

Query  1779  LASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKNIPAAQ  1952
             L +G+G I P +A +PGLI+DI+ S Y+ +LCKE +N+ ++G L G K    C +   AQ
Sbjct  540   LGAGSGQINPRRAFSPGLIYDISMSSYLRFLCKEGYNSTTIGMLLGGKKKYNCSDFKPAQ  599

Query  1953  GADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILS  2132
             G DGLNYPSMH QL +  ++  SA F+RTVT VG  ++V+KA + +P  L++ VVP+ L+
Sbjct  600   GTDGLNYPSMHKQLESA-SSDISAVFHRTVTNVGYKNSVYKATVTSPGELSIVVVPDTLT  658

Query  2133  FPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             F + +QK+S+KV+V G   K  ++ ++  L W D+ HSV+SPI++ +
Sbjct  659   FTEVHQKQSFKVIVKGSPMKTDTFILAALLEWNDSKHSVKSPIVICK  705



>gb|KCW89219.1| hypothetical protein EUGRSUZ_A01524, partial [Eucalyptus grandis]
Length=703

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/704 (58%), Positives = 515/704 (73%), Gaps = 10/704 (1%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             +PYI+YMGELP+  T S  D+HH++L  A+GDEE+AR+ +I+SY +SF+GF ARLLP E 
Sbjct  2     QPYIIYMGELPEART-SIEDKHHSLLMAAIGDEEIARQAKIYSYGKSFNGFAARLLPHEV  60

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGVWVESP  509
             ++LS++D VVSVF N + KL TTRSWDFLGM  T  +RN K ESD+I+G+LDTG++V +P
Sbjct  61    QKLSDEDAVVSVFANKKRKLHTTRSWDFLGMPGTSGSRNSKVESDIIIGILDTGIYVNAP  120

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D G+GP PAKWKGKC KG NFTGCN KVIGA+YFN+E  A     +PAD DGHG+H 
Sbjct  121   SFGDKGFGPAPAKWKGKCVKGANFTGCNNKVIGAKYFNLEN-AATGSVTPADDDGHGTHT  179

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             +SIAAG  V+GAS YGIA GTARGG  SARIA YKVCW  GC DMD+LAGFD AIADGVD
Sbjct  180   SSIAAGVAVKGASFYGIARGTARGGASSARIAMYKVCWENGCSDMDLLAGFDEAIADGVD  239

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +IS+S+GG  + FF DP+AIGS+HAMK+ I+T+ + GN+GP   TI+NV+PW+MTVAA+S
Sbjct  240   LISVSIGGPSKDFFSDPMAIGSFHAMKRGILTSCSGGNDGPTEYTIENVAPWIMTVAASS  299

Query  1050  IDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSIS  1226
             IDR+F+++ KLGNG    G SINTF   K MYPLISGTLA D +     N SAC+Y S+S
Sbjct  300   IDRKFQTEFKLGNGASYDGLSINTFAPKKQMYPLISGTLAADTSHQSYLNASACEYGSLS  359

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLP--DTVLPTMIPATIVDIEDGKKI  1397
             +  V+G++VYC     QD TIK + GVG+ AS D L   D      +P T V  +DG+KI
Sbjct  360   QHKVKGRVVYCEGYFGQDDTIKQLGGVGLAASGDSLADVDVAFVMSMPGTTVSNKDGEKI  419

Query  1398  DKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
             D+YIN+TK P A I ++R  K  APF+ +FS+RGPQ I+LNILKPDLAAPG+ ILAAY+ 
Sbjct  420   DRYINSTKNPQAVISKTRTAKMNAPFIAAFSSRGPQLIALNILKPDLAAPGIDILAAYSK  479

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
             L  +T    D R   +N+ SGTSMA PH   AAAYVK+FHP+WSPA IKSALMTTA  MK
Sbjct  480   LPPVTEDPLDKRHATFNILSGTSMACPHTVAAAAYVKSFHPNWSPATIKSALMTTAVPMK  539

Query  1758  IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KC  1931
             IK   A L+SG+G I P KAV PGL++DI    Y+S+LCKE +N  ++  LTG K    C
Sbjct  540   IKDEFAELSSGSGQINPVKAVHPGLVYDITMRSYISFLCKEGYNGTTIALLTGGKKKFNC  599

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
              +   A G DGLNYPSMHLQLT+ NA + SA FYRTVT VG+  +++KAK+ AP G+++ 
Sbjct  600   SSFRPAHGTDGLNYPSMHLQLTDTNA-SISAVFYRTVTNVGSAKSLYKAKVTAPEGVSIQ  658

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTH  2243
             VVP+ L F + ++ RS+KVVV G   K  +  MSGSL W D+ H
Sbjct  659   VVPDTLKFDKLHENRSFKVVVKGGRVKKGTRIMSGSLEWSDSRH  702



>ref|XP_010654056.1| PREDICTED: xylem serine proteinase 1 isoform X1 [Vitis vinifera]
Length=771

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/747 (55%), Positives = 525/747 (70%), Gaps = 42/747 (6%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             DTQRKPYIVYMG+LP    ++A D HH++L+  +G + +AR+  IHSY RSF+GF ARLL
Sbjct  28    DTQRKPYIVYMGDLPKTGAVTAAD-HHSLLSAVVGSDRMARDSTIHSYGRSFNGFAARLL  86

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVW  497
             P EA+ LSEK+ VVSVF NT  KL TTRSWDFLGM  K   RNPKAE ++++GLLDTG+W
Sbjct  87    PHEAKILSEKEGVVSVFPNTMRKLHTTRSWDFLGMREKMKKRNPKAEINMVIGLLDTGIW  146

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG----FAPEDQESPAD  665
             ++ PSFKD GYGPPP KWKGKC     FTGCN KVIGA+Y++++        +D  SP D
Sbjct  147   MDCPSFKDKGYGPPPTKWKGKCSNSSGFTGCNNKVIGAKYYDLDHQPGMLGKDDILSPVD  206

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
              DGHG+H AS AAG +V+ ASL+G+ +GTARGGVP ARIA YKVCW  GC DM++LAGFD
Sbjct  207   TDGHGTHTASTAAGIVVKNASLFGVGKGTARGGVPLARIAMYKVCWYTGCSDMNLLAGFD  266

Query  846   AAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
              AIADGVDV+S+S+GG    FF+DPIAIG++HAM++ ++ +++AGN+GP   T+QNV+PW
Sbjct  267   DAIADGVDVLSVSIGGTVGPFFEDPIAIGAFHAMRRGVLVSSSAGNDGPLEATVQNVAPW  326

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYS  1202
             ++TV AT +DR F S VKLGNG   SG S+NTF    KMYPL SGTLA + +  Y GN S
Sbjct  327   ILTVGATGLDREFRSQVKLGNGMKASGVSVNTFSPRKKMYPLTSGTLASNSSGAYWGNVS  386

Query  1203  ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDI  1379
             ACD+ S+  + V+GKIVYC+ +  QD+ I+ + G+G I S D+  D     +IP+T V  
Sbjct  387   ACDWASLIPEEVKGKIVYCMGNRGQDFNIRDLGGIGTIMSLDEPTDIGFTFVIPSTFVTS  446

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILK----------  1529
             E+G+KIDKYIN+TK   A I++S+A K  APFV SFS+RGPQ +S NILK          
Sbjct  447   EEGRKIDKYINSTKKAQAVIYKSKAFKIAAPFVSSFSSRGPQDLSPNILKVKKSSPLCSF  506

Query  1530  -----------------PDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATP  1658
                              PD+ APGL ILA Y+ LA ++G  +D R   +N+ +GTSM+ P
Sbjct  507   SSLLSCVPTTNENFNEQPDIVAPGLDILAGYSKLAPISGDPEDRRFANFNILTGTSMSCP  566

Query  1659  HAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIF  1838
             H A AAAYVK+FHP WSPAAIKSALMTTA  +KIK     L SG+G + P  AV PGL++
Sbjct  567   HVAAAAAYVKSFHPKWSPAAIKSALMTTATTLKIK--DNALGSGSGQLNPRIAVHPGLVY  624

Query  1839  DINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKNIPAAQGADGLNYPSMHLQLTNPNAT  2012
             DI  S Y+ +LCKE +N+ ++G LTG K   KC N   A G+DGLNYPSMHLQ+ +P A 
Sbjct  625   DIPTSGYIRFLCKEGYNSTTIGLLTGGKQKYKCSNFRPALGSDGLNYPSMHLQIKDPTA-  683

Query  2013  TFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQK  2192
              FSA FYRTVT VG G++V+KA +KA  GL+V VVPN LSF + +Q+RS+K+V+ GK   
Sbjct  684   RFSAVFYRTVTSVGHGASVYKATVKATKGLSVRVVPNTLSFQKAHQRRSFKIVLKGKPNN  743

Query  2193  AISWYMSGSLVWKDNTHSVRSPILVYR  2273
               S   S  L W D+ H V+SPILVYR
Sbjct  744   --SRIQSAFLEWSDSKHKVKSPILVYR  768



>gb|EPS59928.1| hypothetical protein M569_14877 [Genlisea aurea]
Length=740

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/713 (55%), Positives = 515/713 (72%), Gaps = 15/713 (2%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             R+ YIVYMGELP++  +S +DEHH+++++A+GDE LAR+  I+SY+RSF+GF ARLLPRE
Sbjct  33    RRAYIVYMGELPEN-RVSLMDEHHSLMSDAIGDEGLARDNLIYSYKRSFNGFAARLLPRE  91

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A  LSE+D +VSVF +   K+LTTRSWD+LGM     RN + E+D IVG+LDTGVW ES 
Sbjct  92    AELLSERDGIVSVFESRTRKVLTTRSWDYLGMPLNVKRNLQIETDTIVGMLDTGVWPESE  151

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D+G+GPPP  W+G CQ+GLNF+GCN K+IGA+YFN+ G      E+P D  GHGSH 
Sbjct  152   SFNDNGFGPPPKTWRGVCQRGLNFSGCNNKLIGARYFNLAGTVDPKSETPLDTQGHGSHT  211

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAG  V+GASLYGIAEGTARG VPSARI+SYKVCW  GC D D+LAGFD AIADGVD
Sbjct  212   ASTAAGSAVKGASLYGIAEGTARGAVPSARISSYKVCWTLGCSDTDILAGFDHAIADGVD  271

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             VIS+S+GG P+ F  D IAIGS+HA K  I+T  AAGN GPY G+IQNV+PW++TVAA++
Sbjct  272   VISVSIGGDPQRFTSDAIAIGSFHAAKNGILTVCAAGNSGPYLGSIQNVAPWILTVAAST  331

Query  1050  IDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLSIS  1226
             IDR+F SDV+LGNG+  +G  INTF L  K YPL +G LAQ  +    GN +AC+Y+++ 
Sbjct  332   IDRQFVSDVRLGNGQKYTGIGINTFTLQNKSYPLTNGALAQ-ASGDVVGNSTACEYMTLD  390

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKIDK  1403
             +  V GK++YC  S S D  I+ + G  VI S D++ D    T++P T V + DG KID 
Sbjct  391   KFKVEGKLMYCRGSGS-DTLIRDLGGAAVIMSNDQMLDVAFSTLLPGTSVSLSDGWKID-  448

Query  1404  YINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
                  ++P+  +++SR +   AP V +FS+RGPQ  + NILKPD+ APG++ILAA+T  A
Sbjct  449   -----QSPSGVVYKSRTIPIDAPAVATFSSRGPQDQTPNILKPDITAPGVNILAAFTIFA  503

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK  1763
             TMTG+  D R+VKYN++SGTSMATPH +GAAAYVKTFHPDWSPAAIKSALMTT+ ++KI 
Sbjct  504   TMTGEDTDDRIVKYNLDSGTSMATPHVSGAAAYVKTFHPDWSPAAIKSALMTTSTSLKID  563

Query  1764  PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNI  1940
             P    LA+G+G + P  A  PGL++DI+   Y+S+LCKE + +  +  L G+K+  C  +
Sbjct  564   PAEGELATGSGELSPVPAANPGLVYDIDTISYISFLCKEGYADKEISQLMGNKNYNCSTV  623

Query  1941  PAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVP  2120
             P AQGADGLNYP+ HLQ+ N      +A +YR VT V      +K ++KAP GL+V V P
Sbjct  624   PRAQGADGLNYPTFHLQV-NATQNRVNAVYYRVVTNVEDRKATYKVEVKAPEGLSVRVTP  682

Query  2121  NILSF-PQTNQKRSYKVVVSGKFQKAISWYMSGSLVW-KDNTHSVRSPILVYR  2273
             N+L+F    ++++ +KV + GKF    SW + GS+ W  D    VRSP++VYR
Sbjct  683   NVLAFGGGADERKKFKVELKGKFLNRDSWNLRGSIDWVSDEGLRVRSPVVVYR  735



>emb|CBI30268.3| unnamed protein product [Vitis vinifera]
Length=707

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/710 (56%), Positives = 515/710 (73%), Gaps = 15/710 (2%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+LP    ++A D HH++L+  +G + +AR+  IHSY RSF+GF ARLLP EA+ LSEK
Sbjct  1     MGDLPKTGAVTAAD-HHSLLSAVVGSDRMARDSTIHSYGRSFNGFAARLLPHEAKILSEK  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVWVESPSFKDDG  527
             + VVSVF NT  KL TTRSWDFLGM  K   RNPKAE ++++GLLDTG+W++ PSFKD G
Sbjct  60    EGVVSVFPNTMRKLHTTRSWDFLGMREKMKKRNPKAEINMVIGLLDTGIWMDCPSFKDKG  119

Query  528   YGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG----FAPEDQESPADFDGHGSHIAS  695
             YGPPP KWKGKC     FTGCN KVIGA+Y++++        +D  SP D DGHG+H AS
Sbjct  120   YGPPPTKWKGKCSNSSGFTGCNNKVIGAKYYDLDHQPGMLGKDDILSPVDTDGHGTHTAS  179

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVI  875
              AAG +V+ ASL+G+ +GTARGGVP ARIA YKVCW  GC DM++LAGFD AIADGVDV+
Sbjct  180   TAAGIVVKNASLFGVGKGTARGGVPLARIAMYKVCWYTGCSDMNLLAGFDDAIADGVDVL  239

Query  876   SISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSID  1055
             S+S+GG    FF+DPIAIG++HAM++ ++ +++AGN+GP   T+QNV+PW++TV AT +D
Sbjct  240   SVSIGGTVGPFFEDPIAIGAFHAMRRGVLVSSSAGNDGPLEATVQNVAPWILTVGATGLD  299

Query  1056  RRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSISEK  1232
             R F S VKLGNG   SG S+NTF    KMYPL SGTLA + +  Y GN SACD+ S+  +
Sbjct  300   REFRSQVKLGNGMKASGVSVNTFSPRKKMYPLTSGTLASNSSGAYWGNVSACDWASLIPE  359

Query  1233  LVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKIDKYI  1409
              V+GKIVYC+ +  QD+ I+ + G+G I S D+  D     +IP+T V  E+G+KIDKYI
Sbjct  360   EVKGKIVYCMGNRGQDFNIRDLGGIGTIMSLDEPTDIGFTFVIPSTFVTSEEGRKIDKYI  419

Query  1410  NTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATM  1589
             N+TK   A I++S+A K  APFV SFS+RGPQ +S NILKPD+ APGL ILA Y+ LA +
Sbjct  420   NSTKYAQAVIYKSKAFKIAAPFVSSFSSRGPQDLSPNILKPDIVAPGLDILAGYSKLAPI  479

Query  1590  TGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPI  1769
             +G  +D R   +N+ +GTSM+ PH A AAAYVK+FHP WSPAAIKSALMTTA  +KIK  
Sbjct  480   SGDPEDRRFANFNILTGTSMSCPHVAAAAAYVKSFHPKWSPAAIKSALMTTATTLKIKD-  538

Query  1770  GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKNIP  1943
                L SG+G + P  AV PGL++DI  S Y+ +LCKE +N+ ++G LTG K   KC N  
Sbjct  539   -NALGSGSGQLNPRIAVHPGLVYDIPTSGYIRFLCKEGYNSTTIGLLTGGKQKYKCSNFR  597

Query  1944  AAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPN  2123
              A G+DGLNYPSMHLQ+ +P A  FSA FYRTVT VG G++V+KA +KA  GL+V VVPN
Sbjct  598   PALGSDGLNYPSMHLQIKDPTA-RFSAVFYRTVTSVGHGASVYKATVKATKGLSVRVVPN  656

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              LSF + +Q+RS+K+V+ GK     S   S  L W D+ H V+SPILVYR
Sbjct  657   TLSFQKAHQRRSFKIVLKGKPNN--SRIQSAFLEWSDSKHKVKSPILVYR  704



>ref|XP_006577065.1| PREDICTED: xylem serine proteinase 1-like [Glycine max]
Length=746

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/720 (55%), Positives = 515/720 (72%), Gaps = 7/720 (1%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             ++ +RKPYIVYMGELP   T +    HHN+L  A+GD++LARE +IHSY +SF+GFVARL
Sbjct  25    NEHERKPYIVYMGELPVARTYAVESHHHNLLEAAIGDKQLARESKIHSYGKSFNGFVARL  84

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
             LP EA +L E+D VVSVF NT  KL TTRSWDFLGM     RN K ES +IVG+LDTG+W
Sbjct  85    LPHEAEKLQEEDSVVSVFPNTHRKLHTTRSWDFLGMPLNVKRNSKVESHIIVGVLDTGIW  144

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV-EGFAPEDQESPADFDG  674
             V+ PSF  +GYGPPP +WKGKC+ G NFTGCN KVIGA+YFN+ +  +P D  SPAD  G
Sbjct  145   VDCPSFNAEGYGPPPRRWKGKCETGANFTGCNNKVIGAKYFNLAKSNSPSDNLSPADDIG  204

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG  V+GASLYGI +GTARGGVPSAR+A YKVCW   C DMD+LA FD AI
Sbjct  205   HGTHTASTAAGAAVKGASLYGIGKGTARGGVPSARVAMYKVCWLDDCNDMDMLAAFDEAI  264

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGV++ISIS+GG    FF DPIAIGS+HAM + I+T+ +AGN GP   T++NV+PWL+T
Sbjct  265   ADGVNIISISIGGPSHDFFTDPIAIGSFHAMGRGILTSCSAGNGGPRPMTVENVAPWLLT  324

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA++++R+F + V  G+G+ I+G SINTF    KMYPL SG LA + +    G+ S CD
Sbjct  325   VAASAVNRQFTTLVAFGDGKNITGLSINTFAPKKKMYPLTSGLLASNLSGEGYGSASGCD  384

Query  1212  YLSISEKLVRGKIVYCL-SSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
             Y ++S++ V+G+IVYC+  + +QD TIK + G G +I  D+  D    T+IP T V+   
Sbjct  385   YGTLSKEKVQGRIVYCVGGTGTQDLTIKELGGAGAIIGLDEEIDASYTTVIPGTFVEAST  444

Query  1386  -GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
              G  ID YIN+TK   A I ++   +  APF+ SFS+RGPQTI+ NILKPDL APG++IL
Sbjct  445   VGNTIDLYINSTKNARAVIHKTTTTEVPAPFLASFSSRGPQTITPNILKPDLVAPGVNIL  504

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AAY+ L T+TG  +D R   +N+ SGTSMA PHA   AAYVK+FHPDWSPAAIKSALMTT
Sbjct  505   AAYSKLVTLTGYHEDNRYDVFNILSGTSMACPHATATAAYVKSFHPDWSPAAIKSALMTT  564

Query  1743  AKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             A  +KI      L SG+G I P KA+ PGL++D+  S Y+ +LCK  FNN ++G L G  
Sbjct  565   ATPIKISDNFTELGSGSGQIDPVKALHPGLVYDMRISSYIGFLCKAGFNNTNIGILIGKP  624

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             +  C +I  + G DG+NYPSMH+QL +  +   SA F RTVT VG+ ++ +KAK+  P G
Sbjct  625   NFNCTSIKPSPGTDGINYPSMHIQLLSA-SDRISAVFLRTVTNVGSRNSTYKAKVTTPKG  683

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             L+V V PNIL F + +QK S+KVV+ G      ++  S SL WKD+ H+VRSPILV++ +
Sbjct  684   LSVKVKPNILKFSRLHQKLSFKVVLKGPPMPEDTFVESASLEWKDSEHTVRSPILVFKPM  743



>ref|XP_008462552.1| PREDICTED: xylem serine proteinase 1 [Cucumis melo]
Length=744

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/717 (56%), Positives = 521/717 (73%), Gaps = 8/717 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             +RKPYIVYMG+LP   P+ +  D+HHN+L +A+GDE++ARE +I+SY +SF+GF ARLLP
Sbjct  29    ERKPYIVYMGDLPAGSPSTTVADDHHNLLLDAIGDEKIARESKIYSYGKSFNGFAARLLP  88

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWV  500
              EA ++S ++ VVSVF + + +++TTRSWDFLG++ + + RNP  ES+LI+ + DTG+W+
Sbjct  89    HEATKISNEESVVSVFESRKKRVVTTRSWDFLGLNHRYSKRNPLIESNLIIAVFDTGIWI  148

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             +SPSF D+GYGPPP KWKGKC  G NFT CN KVIGA YF++   +   + S AD +GHG
Sbjct  149   DSPSFSDEGYGPPPPKWKGKCVTGPNFTACNNKVIGANYFDLAKVSSYPELSVADTEGHG  208

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SH AS  AG  V GASLYG+A+GTARGGVPSARIA YKVCW   C +MDVLA FD AIAD
Sbjct  209   SHTASTVAGSAVAGASLYGLAKGTARGGVPSARIAVYKVCWSIFCNEMDVLAAFDEAIAD  268

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+S+G     FF+D  AIG++HAMKK I+TTAAAGN+GP   T++NV+PW+MTVA
Sbjct  269   GVDLISVSIGSPAMDFFRDGQAIGAFHAMKKGILTTAAAGNDGPQLSTVENVAPWIMTVA  328

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNAT-YPGNYSACDY  1214
             AT+IDR F +  +LGNG  ++G SINTF   K MY L SG  A   NAT + GN SACD 
Sbjct  329   ATAIDRGFVTSFELGNGNKLTGGSINTFSPQKQMYSLTSGAKAASNNATPHQGNASACDP  388

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIEDGK  1391
              +I++  V+GKIVYCL + + D +IK + G GVI  + +  D     ++P   +    GK
Sbjct  389   NAINQSKVKGKIVYCLKTYT-DPSIKSLGGTGVIQLTTQQTDYSSILLLPGATIPSVSGK  447

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YIN+TK P A I++S  VK  APFV SFS+RGPQ IS NILKPDL+APG+ ILAAY
Sbjct  448   YIDLYINSTKNPKAVIYKSETVKIDAPFVASFSSRGPQRISSNILKPDLSAPGIDILAAY  507

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T LAT+TG   D+R   + V SGTSMA PHA  AAAYVK+FHPDWSPAA+KSALMTTA  
Sbjct  508   TKLATLTGDTSDSRYSFFTVMSGTSMACPHATAAAAYVKSFHPDWSPAAVKSALMTTATP  567

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
             MKIK   A L SGAG I PTKAV PGL+++I+ + Y+S+LCKE +N+ ++G L GSK   
Sbjct  568   MKIKSKDAMLGSGAGQINPTKAVHPGLVYNISFNSYISFLCKEGYNSTTIGLLGGSKKYN  627

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C  I  AQG DGLNYP+MH QL+ P ++T  A FYRTVT+VG G+++++A I +P  L+V
Sbjct  628   CTKIKPAQGTDGLNYPTMHKQLSGP-SSTIEAVFYRTVTHVGYGASLYRANISSPASLSV  686

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
              V P+ L+F + ++ +++KVVV GK     +  +S  L W D+ H VRS IL+YR L
Sbjct  687   KVFPDTLNFVKLHETKTFKVVVKGKPMPKGTQILSALLEWTDSKHIVRSNILIYRKL  743



>ref|XP_004494157.1| PREDICTED: xylem serine proteinase 1-like [Cicer arietinum]
Length=749

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/720 (56%), Positives = 521/720 (72%), Gaps = 15/720 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDE--HHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             +RKPYIVYMGELP     +   E  HHN+L  A+GD++LARE +IHSY +SF+GFVARLL
Sbjct  31    ERKPYIVYMGELPTATATTYTTEQHHHNMLETAIGDKQLARESKIHSYGKSFNGFVARLL  90

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P EA +L  +  VVSVF NT  +L TTRSWDFLGM  K  RNP  ES +IVG+LDTG+WV
Sbjct  91    PHEAEKLQGEKNVVSVFPNTYRRLHTTRSWDFLGMPLKVKRNPNIESHIIVGVLDTGIWV  150

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGH  677
             + PSF D+G+GPPP++WKGKC  G NFTGCN KVIGA+YFN++   P     SP D  GH
Sbjct  151   DCPSFNDEGFGPPPSRWKGKCVMGANFTGCNNKVIGAKYFNLDPDGPTIANPSPVDNQGH  210

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H AS AAG MV GASLYGI +GTARGGVPSARIA YKVCW  GC DMD+LAGFD AIA
Sbjct  211   GTHTASTAAGAMVRGASLYGIGKGTARGGVPSARIAMYKVCWSIGCSDMDMLAGFDEAIA  270

Query  858   DGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             DGV++IS+S+GG  R FF DPIAIG++HAMK+ ++T+ +AGN+GP   +++NV+PW++TV
Sbjct  271   DGVNLISVSIGGPSRDFFADPIAIGAFHAMKRGVLTSCSAGNDGPRPMSVENVAPWILTV  330

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDY  1214
             AA+++DR+F + V  G+ + ++G SINTF    KMYPL SG LA + +    GN S CDY
Sbjct  331   AASTVDRKFTTQVAFGDRKNVTGLSINTFSPEKKMYPLTSGLLAANLSGEGYGNPSGCDY  390

Query  1215  LSISEKLVRGKIVYCLS-SASQDYTIKWIHG----VGVIASDKLPDTVLPTMIPATIVDI  1379
              ++++  V GKIVYC   + S D TIK + G    VGV+  D   +    T+IP   VD+
Sbjct  391   GTLNKDKVIGKIVYCTEGTGSPDLTIKELGGAGTIVGVVDED---EASYATVIPGAYVDM  447

Query  1380  -EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLS  1556
                GK I+ YIN+TK P A I+++ +    AP++ SFS+RGPQ I+ NILKPDLAAPGL 
Sbjct  448   YTAGKNIELYINSTKNPQAVIYKTTSTNVPAPYLASFSSRGPQQITRNILKPDLAAPGLD  507

Query  1557  ILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALM  1736
             ILAAY+ LA++TG  +DTR   +N+ SGTSMA PHA  AAAYVK+FHPDWSPAAIKSALM
Sbjct  508   ILAAYSKLASITGYPEDTRFDVFNIISGTSMACPHATAAAAYVKSFHPDWSPAAIKSALM  567

Query  1737  TTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TTA  +K+    + L SG+G I P KA+ PGLI+DI  + Y+S+LCK+ +N+ S+G L G
Sbjct  568   TTATPLKVNGNFSELGSGSGQISPVKALHPGLIYDIRMNSYISFLCKQGYNSTSIGILIG  627

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             SK+  C ++  A G DGLNYP+MH+QL +P ++  SA FYRTVT VG G++ +KAK+ AP
Sbjct  628   SKNFNCTSVKPAPGTDGLNYPTMHIQLLSP-SSRISAVFYRTVTNVGYGASTYKAKVTAP  686

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              GL+V V+P+ L F + +Q  S+KVV+ G      +  +S SL W D+ HSVRSPI+V++
Sbjct  687   KGLSVEVIPDTLKFSRLHQDLSFKVVLKGPPMPDETQTLSASLEWNDSQHSVRSPIIVFK  746



>ref|XP_003537051.2| PREDICTED: xylem serine proteinase 1-like [Glycine max]
Length=738

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/714 (56%), Positives = 516/714 (72%), Gaps = 8/714 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +RKPYIVYMGELP D   +  D H+N+L  A+GD +LARE +IHSY +SF+GFVARLLP 
Sbjct  25    ERKPYIVYMGELPVDRAYAPEDHHNNLLATAIGDWQLARESKIHSYGKSFNGFVARLLPY  84

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +L E+D V+SVF NT+ KL TTRSWDFLG+  K NR+   ESD+IVG+LDTG+ ++ 
Sbjct  85    EAEKLLEEDNVLSVFPNTQNKLHTTRSWDFLGLPLKLNRHSNVESDIIVGVLDTGISLDC  144

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSH  686
             PSF D G+GPPP  WKGKC  G NFTGCN KVIGA+YFN++  APE   SPAD DGHG+H
Sbjct  145   PSFNDKGFGPPPPSWKGKCVTGANFTGCNNKVIGAKYFNLQN-APEQNLSPADDDGHGTH  203

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              +S AAG +V GASL GI  GTARGGV  ARIA YKVCW  GC DMD+LA FD AI DGV
Sbjct  204   TSSTAAGVVVRGASLDGIGVGTARGGVSRARIAMYKVCWSDGCSDMDLLAAFDEAIDDGV  263

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +VI++S+GG PR FF DP AIGS+HAMK+ I+T+ +AGN GP   T++NV+PW++TVAA+
Sbjct  264   NVITVSLGGTPRKFFSDPTAIGSFHAMKRGILTSCSAGNNGPSTMTVENVAPWILTVAAS  323

Query  1047  SIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
             + DR+F + V L +G+   G SINTF    KMYPLISG LA   +    GN SACD+ S+
Sbjct  324   NTDRQFTTAVHLADGKKARGMSINTFTPEKKMYPLISGALASKVSRDGYGNASACDHGSL  383

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPD--TVLPTMIPATIVDIE-DGKK  1394
             S++ V GKIVYCL + + DY IK + G G I     P+  + +P +IP   +D   DGK 
Sbjct  384   SQEKVMGKIVYCLGTGNMDYIIKELKGAGTIVGVSDPNDYSTIP-VIPGVYIDANTDGKA  442

Query  1395  IDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             ID YIN+TK   A I ++ + +  AP+V SFS+RGPQ+I++NILKPDL+APG+ ILA Y+
Sbjct  443   IDLYINSTKNAQAVIQKTTSTRGPAPYVASFSSRGPQSITVNILKPDLSAPGVDILAGYS  502

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              LAT+TG   D R   +N+ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSALMTTA  M
Sbjct  503   KLATLTGDPADNRRNVFNILSGTSMACPHAASAAAYVKSFHPDWSPAAIKSALMTTAIPM  562

Query  1755  KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
             +IK   A L SG+G I P  A+ PGL+++ +   Y+++LCKE +N++S+G L G+K   C
Sbjct  563   RIKDATAELGSGSGQINPVSALDPGLLYNSSMDSYIAFLCKEGYNSSSIGILIGTKGLNC  622

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
               I   QG DG+NYPSMH Q+   NA + SA FYR+VT VG+G++ +KAK++AP GL++ 
Sbjct  623   STISPPQGTDGINYPSMHTQIIPSNA-SISAIFYRSVTNVGSGNSTYKAKVRAPKGLSIE  681

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             V+P+ L+F   NQ+ S+KVV+ G      +   S SL W D+ H+VRSPI+VY+
Sbjct  682   VIPDTLNFGGVNQELSFKVVLKGPPMPKETKIFSASLEWNDSKHNVRSPIVVYK  735



>gb|AIC80770.1| subtilase [Cicer arietinum]
Length=814

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/718 (56%), Positives = 519/718 (72%), Gaps = 15/718 (2%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDE--HHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +PYIVYMGELP     +   E  HHN+L  A+GD++LARE +IHSY +SF+GFVARLLP 
Sbjct  98    QPYIVYMGELPTATATTYTTEQHHHNMLETAIGDKQLARESKIHSYGKSFNGFVARLLPH  157

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +L  +  VVSVF NT  +L TTRSWDFLGM  K  RNP  ES +IVG+LDTG+WV+ 
Sbjct  158   EAEKLQGEKNVVSVFPNTYRRLHTTRSWDFLGMPLKVKRNPNIESHIIVGVLDTGIWVDC  217

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGS  683
             PSF D+G+GPPP++WKGKC  G NFTGCN KVIGA+YFN++   P     SP D  GHG+
Sbjct  218   PSFNDEGFGPPPSRWKGKCVMGANFTGCNNKVIGAKYFNLDPDGPTIANPSPVDNQGHGT  277

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS AAG MV GASLYGI +GTARGGVPSARIA YKVCW  GC DMD+LAGFD AIADG
Sbjct  278   HTASTAAGAMVRGASLYGIGKGTARGGVPSARIAMYKVCWSIGCSDMDMLAGFDEAIADG  337

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             V++IS+S+GG  R FF DPIAIG++HAMK+ ++T+ +AGN+GP   +++NV+PW++TVAA
Sbjct  338   VNLISVSIGGPSRDFFADPIAIGAFHAMKRGVLTSCSAGNDGPRPMSVENVAPWILTVAA  397

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
             +++DR+F + V  G+ + ++G SINTF    KMYPL SG LA + +    GN S CDY +
Sbjct  398   STVDRKFTTQVAFGDRKNVTGLSINTFSPEKKMYPLTSGLLAANLSGEGYGNPSGCDYGT  457

Query  1221  ISEKLVRGKIVYCLS-SASQDYTIKWIHG----VGVIASDKLPDTVLPTMIPATIVDI-E  1382
             +++  V GKIVYC   + S D TIK + G    VGV+  D   +    T+IP   VD+  
Sbjct  458   LNKDKVIGKIVYCTEGTGSPDLTIKELGGAGTIVGVVDED---EASYATVIPGAYVDMYT  514

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
              GK I+ YIN+TK P A I+++ +    AP++ SFS+RGPQ I+ NILKPDLAAPGL IL
Sbjct  515   AGKNIELYINSTKNPQAVIYKTTSTNVPAPYLASFSSRGPQQITRNILKPDLAAPGLDIL  574

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AAY+ LA++TG  +DTR   +N+ SGTSMA PHA  AAAYVK+FHPDWSPAAIKSALMTT
Sbjct  575   AAYSKLASITGYPEDTRFDVFNIISGTSMACPHATAAAAYVKSFHPDWSPAAIKSALMTT  634

Query  1743  AKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             A  +K+    + L SG+G I P KA+ PGLI+DI  + Y+S+LCK+ +N+ S+G L GSK
Sbjct  635   ATPLKVNGNFSELGSGSGQISPVKALHPGLIYDIRMNSYISFLCKQGYNSTSIGILIGSK  694

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             +  C ++  A G DGLNYP+MH+QL +P ++  SA FYRTVT VG G++ +KAK+ AP G
Sbjct  695   NFNCTSVKPAPGTDGLNYPTMHIQLLSP-SSRISAVFYRTVTNVGYGASTYKAKVTAPKG  753

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             L+V V+P+ L F + +Q  S+KVV+ G      +  +S SL W D+ HSVRSPI+V++
Sbjct  754   LSVEVIPDTLKFSRLHQDLSFKVVLKGPPMPDETQTLSASLEWNDSQHSVRSPIIVFK  811



>ref|XP_004143378.1| PREDICTED: xylem serine proteinase 1-like [Cucumis sativus]
Length=744

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/715 (56%), Positives = 516/715 (72%), Gaps = 8/715 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             +RKPYIVYMG+LP   P+ +  D+HHN+L +A+GDE++ARE +I+SY +SF+GF ARLLP
Sbjct  29    ERKPYIVYMGDLPAGSPSTTVADDHHNLLLDAIGDEKIARESKIYSYGKSFNGFAARLLP  88

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWV  500
              EA +LS+++ VVSVF + + ++LTTRSW+FLG++ + + RNP  ES+LIV + DTG+W+
Sbjct  89    DEATKLSDEESVVSVFESRKKRVLTTRSWEFLGLNHQYSKRNPLIESNLIVAVFDTGIWI  148

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             +SPSF D+GYGPPP KWKGKC  G NFT CN KVIGA YF+++      + S AD DGHG
Sbjct  149   DSPSFSDEGYGPPPPKWKGKCVTGPNFTACNNKVIGANYFDLDKVTSYPELSVADTDGHG  208

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SHIAS  AG  V GASLYG+A+GTARGGVPSARIA YKVCW   C +MDVLA FD AIAD
Sbjct  209   SHIASTVAGSAVAGASLYGLAKGTARGGVPSARIAVYKVCWSVFCNEMDVLAAFDEAIAD  268

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+S+G  P  FF+D  AIG++HAMKK I+TT AAGN+GP   T++NV+PW+MTVA
Sbjct  269   GVDLISVSIGSPPMDFFRDGQAIGAFHAMKKGILTTTAAGNDGPELFTVENVAPWIMTVA  328

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNAT-YPGNYSACDY  1214
             AT IDR F +  +LGNG   +G SINTF   K M+ L SG  A   N T + GN SACD 
Sbjct  329   ATGIDRGFVTAFELGNGNKFTGGSINTFSPQKQMHSLTSGAKAAFNNGTPHQGNASACDP  388

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIEDGK  1391
              ++++  V+GKIVYCL + + D +IK + G GVI  + +  D     ++P   +    GK
Sbjct  389   NAMNQSKVKGKIVYCLKTYT-DPSIKSLGGTGVIQLTQQQTDYSSILLLPGATIPSVSGK  447

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YIN+TK P A I++S  VK  APFV SFS+RGPQ IS NILKPDL+APG+ ILAAY
Sbjct  448   YIDLYINSTKNPKAVIYKSETVKIDAPFVASFSSRGPQRISSNILKPDLSAPGIDILAAY  507

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T LAT+TG   D+R   + V SGTSMA  HA  AAAYVK+FHPDWSPAA+KSALMTTA  
Sbjct  508   TKLATLTGDTSDSRYSFFTVMSGTSMACSHATAAAAYVKSFHPDWSPAAVKSALMTTATP  567

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
             MKIK     L SGAG I PTKAV PGL+++I+   Y+S+LCKE +NN ++G L GSK   
Sbjct  568   MKIKSEDVVLGSGAGQINPTKAVHPGLVYNISFDSYISFLCKEGYNNTTIGLLGGSKKYN  627

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C  I  AQG DGLNYP+MH QL++P ++   A FYRTVT+VG G+++++A I +P  L+V
Sbjct  628   CSKIKPAQGTDGLNYPTMHKQLSDP-SSAIEAVFYRTVTHVGYGASLYRANISSPDSLSV  686

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              V P+ L+F + ++ R++KVVV GK     +  +S  L W D+ H VRS IL+YR
Sbjct  687   KVFPDTLNFVKLHETRTFKVVVKGKPMPKGTQILSALLEWTDSKHIVRSNILIYR  741



>ref|XP_007203669.1| hypothetical protein PRUPE_ppa026851mg [Prunus persica]
 gb|EMJ04868.1| hypothetical protein PRUPE_ppa026851mg [Prunus persica]
Length=746

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/731 (55%), Positives = 524/731 (72%), Gaps = 15/731 (2%)
 Frame = +3

Query  117   VRATLWPHDTQ-----RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHS  281
             V ATL    TQ     RKPYIVYMGELP   T SA+  HHN+L +A+GDE++AR  RIHS
Sbjct  16    VLATLAQETTQDGFEARKPYIVYMGELPGAET-SAMARHHNLLVQAIGDEKIARASRIHS  74

Query  282   YRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANR-NPKAE  458
             Y R+F+GF ARLLP EA+ L+E+D VVSVF NT  +L TTRSWDFL +  K  + N + +
Sbjct  75    YGRTFNGFAARLLPHEAKALAEEDSVVSVFPNTMRQLHTTRSWDFLDLPIKLKKGNAQIQ  134

Query  459   SDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA  638
             S+++VG+LDTG++++ PSF D GYGPPP+KWKGKC KG NF GCN KVIGA+YFN++   
Sbjct  135   SNIVVGVLDTGIYLDGPSFNDTGYGPPPSKWKGKCVKGDNFKGCNNKVIGAKYFNLDSNH  194

Query  639   P-EDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QG  812
             P   + SP D +GHG+H AS  AG  V+GAS+YGIA+GTARGG P +RIA YKVCW   G
Sbjct  195   PWSGKLSPVDDEGHGTHTASTIAGIPVQGASVYGIAKGTARGGAPLSRIAVYKVCWPFTG  254

Query  813   CQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGP  992
             C D+D+LA FD AIADGVD+ISIS+GG  RSF++DPIAIGS+HAMKK I  + +AGN+GP
Sbjct  255   CSDIDMLAAFDEAIADGVDLISISIGGPSRSFWEDPIAIGSFHAMKKGIFVSCSAGNDGP  314

Query  993   YFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQ  1169
               GT+QNV+PW+ TVAA +IDR  ++ VKLGNG+  SG ++NT+ L K MYPL SGTLA 
Sbjct  315   SEGTVQNVAPWVTTVAANTIDRELKTVVKLGNGKRFSGNALNTYTLKKQMYPLTSGTLAS  374

Query  1170  DKNATYPGNYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVL  1346
             +K+    GN SACD  +++   V+G+IVYCL S+ QD+TI+ + G G + +  +L D   
Sbjct  375   NKSENSYGNASACDSSTLNADKVKGRIVYCLGSSGQDFTIQRLRGAGTLMTQYELEDYAY  434

Query  1347  PTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNI  1523
               +IP T + ++DG KID+YIN+TK P A I+++R VKT  AP + SFSARGPQ I+ NI
Sbjct  435   SPVIPGTGILVKDGIKIDQYINSTKNPMAVIYKTRTVKTPDAPNIASFSARGPQRITPNI  494

Query  1524  LKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPD  1703
             LKPDL+APG++ILAAY+ L +++G  +D R   +N+ SGTSMA PH   AAAYVK+FHPD
Sbjct  495   LKPDLSAPGINILAAYSRLTSISGDPEDKRFSLFNMMSGTSMACPHVTAAAAYVKSFHPD  554

Query  1704  WSPAAIKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-  1880
             WSPAAIKSALMTTA  +  +  G+ L +GAG + P KA  PGLI+DI   +Y+S+LCK+ 
Sbjct  555   WSPAAIKSALMTTATPINTRVGGSTLGTGAGQVDPKKAAHPGLIYDITVDDYISFLCKQG  614

Query  1881  FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTG  2060
             +N+ ++G L G K+  C +    +G DGLNYPSMHL     N T   A FYR VT VG G
Sbjct  615   YNSTNIGILGGKKNVSCSDYKPPRGTDGLNYPSMHLH-QQANDTPVKAVFYRRVTNVGYG  673

Query  2061  STVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT  2240
             S+V+K  +  P   +++V P+ L F +++QKRS+KVVVSG    A    +S  L W D+ 
Sbjct  674   SSVYKVNLIMPKFFSITVTPSTLKFTRSHQKRSFKVVVSGGTPTA-GVPVSAVLEWGDHK  732

Query  2241  HSVRSPILVYR  2273
             HSVRS I +Y+
Sbjct  733   HSVRSLITLYK  743



>gb|KCW89325.1| hypothetical protein EUGRSUZ_A01616 [Eucalyptus grandis]
Length=689

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/716 (56%), Positives = 509/716 (71%), Gaps = 38/716 (5%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             +PYI+YMGELP+  T S  D+HH++L  A+GDEE+AR+ +I+SY +SF+GF ARLLP E 
Sbjct  2     QPYIIYMGELPEAKT-SVEDKHHSLLMAAIGDEEIARQAKIYSYGKSFNGFAARLLPHEV  60

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGVWVESP  509
             ++LS++D V+SVF N + KL TTRSWDFLGM  T  +RN K ESD+I+G+LDTG++V +P
Sbjct  61    QKLSDEDVVMSVFANKKRKLHTTRSWDFLGMPETSGSRNSKVESDIIIGILDTGIYVNAP  120

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D G+GP PAKWKGKC KG NFTGCN KVIGA+YFN+E  AP    +PAD  GHG+H 
Sbjct  121   SFDDKGFGPAPAKWKGKCVKGANFTGCNNKVIGAKYFNLEN-APTGSVTPADDIGHGTHT  179

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             +SIAAG  V+GAS YGIA+GTARGG  SA IA YKVC   GC DMD+LAGFD AIADGVD
Sbjct  180   SSIAAGVAVKGASFYGIAKGTARGGASSAHIAMYKVCSKNGCSDMDLLAGFDEAIADGVD  239

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +IS+S+GG    FF DP+AIGS+HAMK+ I+T+ + GN GP   TI+NV+PW+MTVAA+S
Sbjct  240   LISVSIGGPSTDFFSDPMAIGSFHAMKRGILTSCSGGNYGPTEYTIENVAPWIMTVAASS  299

Query  1050  IDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPG--NYSACDYLSI  1223
             IDR+F+++ KLGNG                             A+Y    N SACDY S+
Sbjct  300   IDRKFQTEFKLGNG-----------------------------ASYDSHLNASACDYGSL  330

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKID  1400
             S+  V+G++VYC    SQD TIK + GVG++AS D L D      +P T V  +DG+KID
Sbjct  331   SQHKVKGRVVYCEGYLSQDDTIKQLGGVGLVASGDSLADVAFVVSMPRTTVSNKDGEKID  390

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+TK P A I ++R  K  APF+ SFS+RGPQ I+LNILKPDLAAPGL ILAAY+ L
Sbjct  391   RYINSTKYPRAVISKTRTAKMNAPFIASFSSRGPQLIALNILKPDLAAPGLDILAAYSKL  450

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
               +T    D R   +N+ SGTSMA PHA  AAAYVK+FHP+WSPAAIKSALMTTA  MKI
Sbjct  451   PPVTEDPLDKRHATFNILSGTSMACPHAVAAAAYVKSFHPNWSPAAIKSALMTTAMPMKI  510

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCK  1934
             K   A L+SG+G I P KAV PGL++DI    Y+S+LCKE +N  ++  L G K    C 
Sbjct  511   KDEFAELSSGSGQINPVKAVHPGLVYDITMRSYISFLCKEGYNGTTIALLAGGKKKFNCS  570

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +   A G DGLNYPSMHLQLT+ +A + SA FYRTVT VG+  +++KAK+ AP G+++ V
Sbjct  571   SFRPAHGTDGLNYPSMHLQLTDTSA-SISAIFYRTVTNVGSAKSLYKAKVTAPEGVSIQV  629

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
             VP+ L F + ++ RS+KVVV G   K  +  MSGSL W D+ H V+SPIL++ + Q
Sbjct  630   VPDTLKFDKLHENRSFKVVVKGGRVKKGTHIMSGSLEWSDSRHRVKSPILIFTTDQ  685



>ref|XP_003625782.1| Xylem serine proteinase [Medicago truncatula]
 gb|AES82000.1| subtilisin-like serine protease [Medicago truncatula]
Length=746

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/716 (55%), Positives = 516/716 (72%), Gaps = 8/716 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             +RKPYIVYMGELP     I+    HHN+L  A+G++ LAR+  IHSY +SF+GFVARLLP
Sbjct  29    ERKPYIVYMGELPAPRAHITMEQRHHNMLEAAIGNKLLARKSIIHSYGKSFNGFVARLLP  88

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVE  503
              EA +L E++ VVSVF NT  KL TTRSWDFLGM  K  RNP  ES +I+G+LDTG+WV+
Sbjct  89    HEAEKLQEEENVVSVFPNTYHKLHTTRSWDFLGMPLKVKRNPNIESHIIIGVLDTGIWVD  148

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHG  680
              PSF D+G+GPPP +WKGKC +G NFTGCN KVIGA+YFN++   P  +  SP D  GHG
Sbjct  149   CPSFNDEGFGPPPRRWKGKCVQGGNFTGCNNKVIGAKYFNLDPSGPTIENPSPVDDQGHG  208

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H +S AAG +V GASLYGI +G ARGGVPSARIA YKVCW  GC DMD+LAGFD AIAD
Sbjct  209   THTSSTAAGSVVRGASLYGIGKGNARGGVPSARIAMYKVCWTIGCSDMDMLAGFDEAIAD  268

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GV+ IS+S+GG  R FF DPIAIG++HAMK+ ++T+ +AGN+GP   +++NV+PW+MTVA
Sbjct  269   GVNFISVSIGGPSRDFFSDPIAIGAFHAMKRGVLTSCSAGNDGPRPMSVENVAPWIMTVA  328

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+++DR+F + V  G+G+ I G SINTF   K MYPL SG+LA + +    GN S CDY 
Sbjct  329   ASTVDRQFTTQVAFGDGKKIRGLSINTFTPEKNMYPLTSGSLAANLSGDEYGNPSGCDYG  388

Query  1218  SISEKLVRGKIVYCL-SSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIED-G  1388
             ++ +  V G+IVYC   + SQD TIK + G G I   ++  D    T+IP   VD+   G
Sbjct  389   TLDKDKVMGRIVYCAGGTGSQDLTIKELGGAGTIVGLEEDEDASYTTVIPGAFVDMYTVG  448

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
             K I+ YIN+TK P A I++S + +  AP++ SFS+RGPQ I+ NILKPDLAAPGL ILAA
Sbjct  449   KNIEIYINSTKNPQAVIYKSASTRFPAPYLASFSSRGPQKITPNILKPDLAAPGLDILAA  508

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             Y+ LAT+TG  +DTR   +N+ SGTSMA PHA  AAAYVK+FHPDWSPAAIKSALMTTA 
Sbjct  509   YSKLATLTGYPEDTRFEVFNIVSGTSMACPHAIAAAAYVKSFHPDWSPAAIKSALMTTAT  568

Query  1749  AMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
              +K       L SG+G I P KA+ PGLI+DI  + Y+++LCK+ +N  S+G L GSK  
Sbjct  569   PIKGNDNFTELGSGSGQISPLKALHPGLIYDIRMNSYIAFLCKQGYNGTSIGILIGSKSF  628

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C  +  A G DG+NYP+MH+QL + ++++ SA FYRT+T VG G++ +KAK+ AP GL+
Sbjct  629   NCSGVKPAPGTDGINYPTMHIQLLS-SSSSISAVFYRTLTNVGYGTSTYKAKVTAPEGLS  687

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             V+V+P+ L F + +Q  S+KVV+ G         +S  L W D+ HSVRSPI+V++
Sbjct  688   VNVIPDTLKFTKLHQDLSFKVVLKGPPMSDEKITLSALLEWNDSKHSVRSPIVVFK  743



>ref|XP_009370679.1| PREDICTED: xylem serine proteinase 1-like [Pyrus x bretschneideri]
Length=720

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/717 (56%), Positives = 515/717 (72%), Gaps = 14/717 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIVYMGELP  P ISA+  HHN+L EA+GD ++ARE  IHSY R+F+GFVARLLP EA+ 
Sbjct  9     YIVYMGELPG-PEISAMSGHHNLLAEAIGDVKVARESIIHSYGRTFNGFVARLLPHEAQA  67

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVWVESPSF  515
             LS+ D VVSVF NT  KL TTRSWDFL +  K+  RN + ES+ IVG+LDTG+++++PSF
Sbjct  68    LSDDDSVVSVFPNTVRKLHTTRSWDFLELPLKSKKRNSQIESNTIVGVLDTGIYMQAPSF  127

Query  516   KDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGSHIA  692
              D GYGPPP KWKGKC KG NFTGCN KVIGA+YF +E   P     SP D DGHG+H +
Sbjct  128   NDKGYGPPPTKWKGKCMKGANFTGCNNKVIGAKYFKLETGRPYWGTHSPVDDDGHGTHTS  187

Query  693   SIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVD  869
             SI AG  V+GAS+YG+A+GTARGGV  +RIA YKVCW   GC D+D+LA FD AIADGVD
Sbjct  188   SIIAGAAVKGASVYGVAKGTARGGVSLSRIAVYKVCWITTGCLDVDILAAFDEAIADGVD  247

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +IS+S+GGH RSF  +PIAIGS+HAMKK I  + AAGNEG    +++NV+PW+MTVAA +
Sbjct  248   LISVSLGGHSRSFLDNPIAIGSFHAMKKGIFVSCAAGNEG-LPASVENVAPWVMTVAANT  306

Query  1050  IDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSIS  1226
             IDR+ ++ VKLGNG+ ISG S+NT+   K MYPLISGTLA +    + G+ SACD  ++ 
Sbjct  307   IDRQLQTVVKLGNGQRISGNSLNTYSPKKLMYPLISGTLAANTTMRFGGDASACDAWALD  366

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKKIDK  1403
                V G+IVYC    +QD T++ + G G + +  +L D     +IP T + ++DG KI+K
Sbjct  367   ANKVVGRIVYCQGFGTQDSTMQKLRGAGTLMTRYELDDYAYSPIIPGTEILVQDGIKIEK  426

Query  1404  YINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             YIN+TK PTA I+++R   TTAP V SFS+RGPQ +  NILKPD++APG++ILAAY  + 
Sbjct  427   YINSTKNPTAVIYKTRTPSTTAPIVASFSSRGPQHMHPNILKPDISAPGVNILAAYPKIQ  486

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK  1763
             ++TG  DD R   +N+ SGTSM+ PH   AAAYVK+FHPDWSPAAIKSALMTTA  MK +
Sbjct  487   SITGYSDDRRHNVFNMLSGTSMSCPHVTAAAAYVKSFHPDWSPAAIKSALMTTATPMKNE  546

Query  1764  PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKN  1937
                  LA+GAG + P KAV PGL++DI   +Y+S+LCKE FN+  +G L G K   KC +
Sbjct  547   TADTQLATGAGQVNPKKAVHPGLVYDITPDDYISFLCKEGFNDTDIGKLIGDKKKYKCSD  606

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
                 +G DGLNYPSMHLQL   +    SA F+R VT+VG G++V+KAK+    GL V V+
Sbjct  607   FKHPRGTDGLNYPSMHLQLFPNDNYGVSALFHRRVTHVGFGNSVYKAKVTNLNGLRVKVI  666

Query  2118  PNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
             P+ L+F + +QKRS+KVVV+G+    + +   M   L W D+ H+V+S I+VY+ L 
Sbjct  667   PSTLTFTKLHQKRSFKVVVTGRPAMNETV---MHALLQWDDSKHNVKSHIVVYKHLN  720



>ref|XP_007162881.1| hypothetical protein PHAVU_001G188400g [Phaseolus vulgaris]
 gb|ESW34875.1| hypothetical protein PHAVU_001G188400g [Phaseolus vulgaris]
Length=746

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/717 (55%), Positives = 505/717 (70%), Gaps = 7/717 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +RKPYIVYMGEL    T +    HHN+L  A+G+++LAR+ +IHSY +SF+GFVARLLP 
Sbjct  28    ERKPYIVYMGELQAGTTYAVESHHHNLLETAIGNKQLARQSKIHSYGKSFNGFVARLLPD  87

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA RL E+D VVSVF N   +L TTRSWDFLGM  K  RN   ES +IVG+LDTG+WV+ 
Sbjct  88    EAERLKEEDGVVSVFPNRVRQLHTTRSWDFLGMPLKVKRNSMIESHIIVGVLDTGIWVDC  147

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDGHGS  683
             PSF D GYGPPP +WKGKC  G NFTGCN KVIGA YFN+E   +  D  SPAD  GHG+
Sbjct  148   PSFNDTGYGPPPRRWKGKCVTGANFTGCNNKVIGANYFNLEDSNSTYDSMSPADDAGHGT  207

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H +S AAG +VEGASLYG+ +GTARGGVPSAR+A YKVCW  GC DMD+LAGFD AIADG
Sbjct  208   HTSSTAAGVVVEGASLYGVGKGTARGGVPSARLAVYKVCWTSGCSDMDMLAGFDQAIADG  267

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             V+ +S+S+GG  + F  DPIAIG++HAM + I+T+ +AGN GP   +++NV+PW++TVAA
Sbjct  268   VNFLSVSIGGPAQDFLTDPIAIGAFHAMTRGILTSCSAGNGGPRPLSVENVAPWILTVAA  327

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
             ++ DR+F +    G+G+  +G SIN F    KMYPL SG LA + +    G+   CDY +
Sbjct  328   STTDRQFITVAAFGDGKNATGMSINIFSPKKKMYPLTSGLLAANLSGDGYGSPRGCDYGT  387

Query  1221  ISEKLVRGKIVYCL-SSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED-GK  1391
             +S+  V+G+IVYC+  + +QD TIK + G G ++  ++  D    T+IPAT V+     +
Sbjct  388   LSKDKVKGRIVYCVGGTGTQDLTIKDLGGAGTIVVLEEDIDASFSTVIPATFVEASSVDE  447

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              I+ YIN+TK   A I+++      APF+ SFS+RGPQT++ NILKPDLAAPG+ ILAAY
Sbjct  448   TIEIYINSTKNAKAVIYKTTTKDVPAPFLVSFSSRGPQTVTPNILKPDLAAPGVDILAAY  507

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             + LA+ TG  +D R V +N+ SGTSM+ PH   AAAYVK+FHPDWSPAAIKSALMTTA  
Sbjct  508   SNLASFTGYREDNRHVVFNILSGTSMSCPHVTAAAAYVKSFHPDWSPAAIKSALMTTATP  567

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
             +KI      L SG+G I P KAV PGLI+DI    Y+S+LCKE FNN ++G L G K+  
Sbjct  568   IKISDNFTLLGSGSGQIDPVKAVHPGLIYDIGVDSYISFLCKEGFNNTNIGILIGVKNFN  627

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C  I    G DG+NYPSMH+QL +      SA FYRTVT VG GS+ +KAK+  P GL+V
Sbjct  628   CTTIKTEPGTDGINYPSMHIQLISAT-DRISAVFYRTVTNVGFGSSTYKAKVTVPEGLSV  686

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
              V+P+ L F Q +QKRS+KVV+ G      ++    SL W D+ H+VRSPILVY+ +
Sbjct  687   KVIPDTLHFSQLHQKRSFKVVLKGPPILDEAFVKFASLEWDDSKHTVRSPILVYKPM  743



>ref|XP_009366748.1| PREDICTED: xylem serine proteinase 1-like [Pyrus x bretschneideri]
Length=747

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/723 (55%), Positives = 517/723 (72%), Gaps = 14/723 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D  RK YIVYMGELP  P ISA+  HHN+L EA+GD ++ARE  IHSY R+F+GFVARLL
Sbjct  30    DDGRKTYIVYMGELPG-PEISAMSGHHNLLAEAIGDVKVARESIIHSYGRTFNGFVARLL  88

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVW  497
             P EA+ LS+ D VVSVF NT  KL TTRSWDFL +  K+  RN + ES+ IVG+LDTG++
Sbjct  89    PHEAQALSDDDSVVSVFPNTVRKLHTTRSWDFLELPLKSKKRNSQIESNTIVGVLDTGIY  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDG  674
             +++PSF D GYGPPP KWKGKC KG NFTGCN KVIGA+YF +E   P     SP D DG
Sbjct  149   MQAPSFNDKGYGPPPTKWKGKCMKGANFTGCNNKVIGAKYFKLETGRPYWGTHSPVDDDG  208

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAA  851
             HG+H +SI AG  V+GAS+YG+A+GTARGGV  +RIA YKVCW   GC D+D+LA FD A
Sbjct  209   HGTHTSSIIAGAAVKGASVYGVAKGTARGGVSLSRIAVYKVCWITTGCLDVDILAAFDEA  268

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             IADGVD+IS+S+GGH RSF  +PIAIGS+HAMKK I  + AAGNEG    +++NV+PW+M
Sbjct  269   IADGVDLISVSLGGHSRSFLDNPIAIGSFHAMKKGIFVSCAAGNEG-LPASVENVAPWVM  327

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSAC  1208
             TVAA +IDR+ ++ VKLGNG+ ISG S+NT+   K MYPLISGTLA + +     N SAC
Sbjct  328   TVAANTIDRQLQTVVKLGNGQRISGNSLNTYSPKKLMYPLISGTLAANLSNDENDNGSAC  387

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIED  1385
             D  ++    V G+IVYC    +QD T++ + G G + +  +L D     +IP T + ++D
Sbjct  388   DAWALDANKVVGRIVYCQGFGTQDSTMQKLRGAGTLMTRYELDDYAYSPIIPGTEILVQD  447

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G KI+KYIN+TK PTA I+++R   TTAP V SFS+RGPQ +  NILKPD++APG++ILA
Sbjct  448   GIKIEKYINSTKNPTAVIYKTRTPSTTAPIVASFSSRGPQHMHPNILKPDISAPGVNILA  507

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             AY  + ++TG  DD R   +N+ SGTSM+ P+   AAAYVK+FHPDWSPAAIKSALMTTA
Sbjct  508   AYPKIQSITGYSDDRRHNVFNMLSGTSMSCPNETAAAAYVKSFHPDWSPAAIKSALMTTA  567

Query  1746  KAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKD  1922
               MK +     LA+GAG + P KAV PGL++DI   +Y+S+LCKE FN+  +G L G K 
Sbjct  568   TPMKNETADTQLATGAGQVNPKKAVHPGLVYDITPDDYISFLCKEGFNDTDIGKLIGDKK  627

Query  1923  N-KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
               KC +    +G DGLNYPSMHLQL   +    SA F+R VT+VG G++V+KAK+    G
Sbjct  628   KYKCSDFKHPRGTDGLNYPSMHLQLFPNDNYGVSALFHRRVTHVGFGNSVYKAKVTNLNG  687

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             L V V+P+ L+F + +QKRS+KVVV+G+    + +   M   L W D+ H+V+S I+VY+
Sbjct  688   LRVKVIPSTLTFTKLHQKRSFKVVVTGRPAMNETV---MHALLQWDDSKHNVKSHIVVYK  744

Query  2274  SLQ  2282
              L 
Sbjct  745   HLN  747



>gb|KGN48248.1| hypothetical protein Csa_6G451510 [Cucumis sativus]
Length=740

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/715 (56%), Positives = 512/715 (72%), Gaps = 12/715 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             +RKPYIVYMG+LP   P+ +  D+HHN+L +A+GDE++ARE +I+SY +SF+GF ARLLP
Sbjct  29    ERKPYIVYMGDLPAGSPSTTVADDHHNLLLDAIGDEKIARESKIYSYGKSFNGFAARLLP  88

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWV  500
              EA +LS+++ VVSVF + + ++LTTRSW+FLG++ + + RNP  ES+LIV + DT    
Sbjct  89    DEATKLSDEESVVSVFESRKKRVLTTRSWEFLGLNHQYSKRNPLIESNLIVAVFDT----  144

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             +SPSF D+GYGPPP KWKGKC  G NFT CN KVIGA YF+++      + S AD DGHG
Sbjct  145   DSPSFSDEGYGPPPPKWKGKCVTGPNFTACNNKVIGANYFDLDKVTSYPELSVADTDGHG  204

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SHIAS  AG  V GASLYG+A+GTARGGVPSARIA YKVCW   C +MDVLA FD AIAD
Sbjct  205   SHIASTVAGSAVAGASLYGLAKGTARGGVPSARIAVYKVCWSVFCNEMDVLAAFDEAIAD  264

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+S+G  P  FF+D  AIG++HAMKK I+TT AAGN+GP   T++NV+PW+MTVA
Sbjct  265   GVDLISVSIGSPPMDFFRDGQAIGAFHAMKKGILTTTAAGNDGPELFTVENVAPWIMTVA  324

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNAT-YPGNYSACDY  1214
             AT IDR F +  +LGNG   +G SINTF   K M+ L SG  A   N T + GN SACD 
Sbjct  325   ATGIDRGFVTAFELGNGNKFTGGSINTFSPQKQMHSLTSGAKAAFNNGTPHQGNASACDP  384

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIEDGK  1391
              ++++  V+GKIVYCL + + D +IK + G GVI  + +  D     ++P   +    GK
Sbjct  385   NAMNQSKVKGKIVYCLKTYT-DPSIKSLGGTGVIQLTQQQTDYSSILLLPGATIPSVSGK  443

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YIN+TK P A I++S  VK  APFV SFS+RGPQ IS NILKPDL+APG+ ILAAY
Sbjct  444   YIDLYINSTKNPKAVIYKSETVKIDAPFVASFSSRGPQRISSNILKPDLSAPGIDILAAY  503

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T LAT+TG   D+R   + V SGTSMA  HA  AAAYVK+FHPDWSPAA+KSALMTTA  
Sbjct  504   TKLATLTGDTSDSRYSFFTVMSGTSMACSHATAAAAYVKSFHPDWSPAAVKSALMTTATP  563

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
             MKIK     L SGAG I PTKAV PGL+++I+   Y+S+LCKE +NN ++G L GSK   
Sbjct  564   MKIKSEDVVLGSGAGQINPTKAVHPGLVYNISFDSYISFLCKEGYNNTTIGLLGGSKKYN  623

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C  I  AQG DGLNYP+MH QL++P ++   A FYRTVT+VG G+++++A I +P  L+V
Sbjct  624   CSKIKPAQGTDGLNYPTMHKQLSDP-SSAIEAVFYRTVTHVGYGASLYRANISSPDSLSV  682

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              V P+ L+F + ++ R++KVVV GK     +  +S  L W D+ H VRS IL+YR
Sbjct  683   KVFPDTLNFVKLHETRTFKVVVKGKPMPKGTQILSALLEWTDSKHIVRSNILIYR  737



>ref|XP_010683779.1| PREDICTED: xylem serine proteinase 1 [Beta vulgaris subsp. vulgaris]
Length=711

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/705 (55%), Positives = 502/705 (71%), Gaps = 16/705 (2%)
 Frame = +3

Query  198   ISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRN  377
             ++ V  HH++L EA+GDE +AR  +IHSY +SF+GF ARLLP EA RLSEK  VVSVF N
Sbjct  11    LAVVKHHHSLLAEAIGDESIARVAKIHSYGKSFNGFAARLLPHEASRLSEKRNVVSVFPN  70

Query  378   TEMKLLTTRSWDFLGMSTKA-NRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWK  554
                KLLTTRSWD+LGM      RN + ES +I+GLLDTG+++++PSF D+GYGPPP+KWK
Sbjct  71    KMRKLLTTRSWDYLGMPEDLRQRNNQTESSIILGLLDTGIYIDAPSFSDEGYGPPPSKWK  130

Query  555   GKCQKGLNFTGCNRKVIGAQYFNVE---GFAPEDQESPADFDGHGSHIASIAAGRMVEGA  725
             G C+KGLNFTGCNRKVIGA+Y+N+    G  P    +P D DGHG+H +S AAGR V GA
Sbjct  131   GTCEKGLNFTGCNRKVIGARYYNLGPDIGMDP----TPVDTDGHGTHTSSTAAGRSVNGA  186

Query  726   SLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRS  905
             SL+G+AEGTARGGVP++RIA YKVC   GC DM +LAGFD AIADGVD+ISIS+GG  ++
Sbjct  187   SLFGVAEGTARGGVPNSRIAMYKVCGNFGCSDMSLLAGFDDAIADGVDIISISIGGPTKN  246

Query  906   FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLG  1085
             F  D +AIGS+HAMKK I+T  A GNEGP  G+I NV+PW++TV AT++DR F + V+LG
Sbjct  247   FMDDVVAIGSFHAMKKGILTVCAGGNEGPDEGSISNVAPWVLTVGATNVDREFRTVVELG  306

Query  1086  NGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRGKIVYCL  1262
             NG  + G SINTF   K MYPLIS   A +   +   N S CD  ++SE  V+GKIV CL
Sbjct  307   NGMKLQGMSINTFSPKKTMYPLISAASAFNGTESPFTNVSMCDAGTLSESKVKGKIVLCL  366

Query  1263  SSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEI  1439
               +S D+T++  HG G +IA D+L D    T++PA+ V  EDG  I  YINTTK+P A I
Sbjct  367   GLSSADWTVRSSHGAGTIIALDELQDMASTTLLPASFVSAEDGHLIGDYINTTKSPQATI  426

Query  1440  FRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRV  1616
             +++  +KTT AP V SFS+RGPQ ++ NILKPD++APG+ ILAAY+ L ++T +  D R 
Sbjct  427   YKTVTLKTTKAPVVASFSSRGPQLLARNILKPDISAPGMDILAAYSKLVSITNENLDNRF  486

Query  1617  VKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAYLASGAG  1796
               +N+ SGTSMA PH AGAAAYVKTFHPDWSPAAIKSALMTTAK +        L SG+G
Sbjct  487   SYFNIISGTSMACPHVAGAAAYVKTFHPDWSPAAIKSALMTTAKPVNGNGTENPLDSGSG  546

Query  1797  LIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNK----CKNIPAAQGADG  1964
             LI P  AV PGLI+D++ ++Y+ YLC+E  N +  SL      K    C  +   QGADG
Sbjct  547   LINPVAAVHPGLIYDLSGNDYIRYLCREGYNGTTLSLIQGLHKKVHYNCSKVKPGQGADG  606

Query  1965  LNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQT  2144
             LNYPS+H+QL   + T  S  F+R+VT+VG G  V+KA + +P GL + V+P++L+F + 
Sbjct  607   LNYPSLHVQLPTSD-TKISKVFHRSVTHVGYGPAVYKATVTSPRGLAIKVIPDVLTFTKP  665

Query  2145  NQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             +QK+S+KV+V G       + +S  L W D+ + VRSP+++YRS+
Sbjct  666   HQKQSFKVLVQGTITDDTPYTLSAFLEWNDSKYRVRSPVVIYRSI  710



>gb|KDP27283.1| hypothetical protein JCGZ_21014 [Jatropha curcas]
Length=749

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/722 (54%), Positives = 512/722 (71%), Gaps = 14/722 (2%)
 Frame = +3

Query  144   TQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             ++RK YIVYMG++P+  T S  D HH++L   + DE +A+E +IHSY +SF+GFVA LLP
Sbjct  27    SERKSYIVYMGDMPEAST-SVADHHHSLLLSTIRDESIAKESKIHSYGKSFNGFVANLLP  85

Query  324   REARRLSEKDKVVSVFRNTEM-KLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
              E  +L E+D VVSVF NT+  KL TTRSWDFLGM+    R  + ES++IVG+LD+G+ V
Sbjct  86    HEVEKLLEEDSVVSVFENTKNNKLHTTRSWDFLGMTQTVKRIARMESNIIVGVLDSGIDV  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG--FAPEDQESPADFDG  674
             +SPSF D G+GP PA+WKGKC  G NFT CN KVIGA+Y+N+    F  + ++S AD+ G
Sbjct  146   DSPSFSDKGFGPAPARWKGKCVTGGNFTACNNKVIGAKYYNLHNIDFGSDGEQSAADYSG  205

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ--GCQDMDVLAGFDA  848
             HG+H +SI AG  V+GASLYGIA+GTARGGVPSARIA YKV WG+  G  DMD+LA FD 
Sbjct  206   HGTHTSSILAGNSVQGASLYGIAKGTARGGVPSARIAMYKVSWGEEGGSTDMDILAAFDD  265

Query  849   AIADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
             AIA+GVD+IS+S+GG   R++F+DPIAIGS+HAMK+ I+T+ +AGN GP   T+ NV+PW
Sbjct  266   AIANGVDIISVSIGGERIRNYFEDPIAIGSFHAMKRGILTSCSAGNWGPEPSTVINVAPW  325

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYS  1202
             ++TVAA++IDR+F++  KLGNG    G SINTF    KMYPL +G  A +    + GN S
Sbjct  326   ILTVAASTIDRKFKTPFKLGNGMKAEGVSINTFSPRKKMYPLTNGAHATNVTMGFYGNIS  385

Query  1203  ACDYLSISEKLVRGKIVYCL--SSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIV  1373
             AC   ++ +  V+GKIVYCL       DYT+K + G G+I S DK       +++ ATIV
Sbjct  386   ACASGTLGKDKVQGKIVYCLLREGYHPDYTVKELKGAGIIMSIDKQEGGTYKSLVAATIV  445

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
             +++ G  ID YINTTK P A I+++R VK  AP + +FS RGPQ ++LNILKPDL APG+
Sbjct  446   NVKKGHDIDLYINTTKNPQAMIYKTRTVKARAPALATFSGRGPQVLNLNILKPDLVAPGV  505

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILAA + L ++TG+  D R   +N+ +GTSMA PHA+ AA YVKTFHPDWSPAAIKSAL
Sbjct  506   DILAASSKLTSVTGETIDNRHAPFNIMTGTSMACPHASAAAVYVKTFHPDWSPAAIKSAL  565

Query  1734  MTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             M+TA  + I+     L+SG+G I P  AV PGLI+DI+ S Y+S+LCKE +N+ ++G L 
Sbjct  566   MSTATPLTIRDKDTDLSSGSGQINPRSAVHPGLIYDISMSSYLSFLCKEGYNSTTIGILI  625

Query  1911  GSKDN-KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             G K    C N   AQG DGLNYPSMH QL + N ++ SA FYRTVT V  GS+V+KA + 
Sbjct  626   GGKRRYNCTNFRPAQGTDGLNYPSMHKQLESVN-SSISAVFYRTVTNVAYGSSVYKAIVT  684

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             A  GL+V VVP  L+F + +QK+++ V+V G   +     +S  L W D  HSVRSPI++
Sbjct  685   AEKGLSVKVVPETLTFTKRHQKQNFMVIVKGGVMRNGIQTLSALLEWNDTRHSVRSPIVI  744

Query  2268  YR  2273
             YR
Sbjct  745   YR  746



>ref|XP_008360563.1| PREDICTED: xylem serine proteinase 1-like [Malus domestica]
Length=947

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/720 (55%), Positives = 516/720 (72%), Gaps = 14/720 (2%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             R  ++    ++P  P ISA+  HHN+L EA+GD ++ARE  IHSYRRSF+GFVARLLP E
Sbjct  233   RDLWVRLQEQMPG-PEISAMSGHHNLLAEAIGDVKVARESIIHSYRRSFNGFVARLLPHE  291

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKAN-RNPKAESDLIVGLLDTGVWVES  506
             A+ LS+ D VVSVF NT  KL TTRSWDFLG+  K+  RN + ES++IVG+LDTG+++++
Sbjct  292   AQALSDDDSVVSVFPNTVRKLHTTRSWDFLGLPLKSKKRNSQIESNIIVGVLDTGIYMQA  351

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGS  683
             PSF D GYGPPPAKWKGKC KG NFTGCN KVIGA+YF +E   P     SP D DGHG+
Sbjct  352   PSFSDKGYGPPPAKWKGKCMKGANFTGCNNKVIGAKYFKLETGRPYWGTHSPVDDDGHGT  411

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIAD  860
             H +SI AG  V+GAS+YG+A+GTARGGV  +RIA YKVCW   GC D+D+LAGFD AIAD
Sbjct  412   HTSSIVAGAAVKGASVYGVAKGTARGGVSLSRIAVYKVCWITTGCLDVDILAGFDEAIAD  471

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+S+GGH RSF  +PIAIGS+HAMKK I  + AAGN+G    +++NV+PW+MTVA
Sbjct  472   GVDLISVSLGGHSRSFLDNPIAIGSFHAMKKGIFVSCAAGNDG-LPASVENVAPWVMTVA  530

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYL  1217
             A +IDR+ ++ VKLGNG+ ISG S+NT+   K MYPLISGTLA +    + G+ SACD  
Sbjct  531   ANTIDRQLQTVVKLGNGQRISGNSLNTYSPKKLMYPLISGTLAANMTMRFGGDASACDAW  590

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKK  1394
             ++    V G+IVYC    +QD T++ + G G + +  +L D     +IP T + ++DG K
Sbjct  591   ALDANKVVGRIVYCQGFGTQDSTMQKLKGAGTLMTRYELDDYAYSPIIPGTEILVQDGIK  650

Query  1395  IDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             I+KYIN+TK P A I+++R   TTAP V SFS+RGPQ +  NILKPD++APG++ILAAY 
Sbjct  651   IEKYINSTKNPMAVIYKTRTPXTTAPIVASFSSRGPQHMHPNILKPDISAPGVNILAAYP  710

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              + ++TG  DD R   +N+ SGTSM+ PH   AAAYVK+FHPDWSPAAIKSALMTTA  M
Sbjct  711   KIRSITGYSDDRRHNVFNMLSGTSMSCPHVTAAAAYVKSFHPDWSPAAIKSALMTTATPM  770

Query  1755  KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-K  1928
             K +     LA+GAG + P KAV PGL++DI   +Y+S+LCKE FN+  +G+L G K   K
Sbjct  771   KNETADTQLATGAGQVNPKKAVHPGLVYDITPDDYISFLCKEGFNDTDIGTLIGDKKKYK  830

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C +    +G DGLNYPSMHLQL   +    SA FYR VT+VG G++V+KA +    GL V
Sbjct  831   CSDFKHPRGTDGLNYPSMHLQLFPNDNYGVSAVFYRRVTHVGFGNSVYKAXVTNLNGLRV  890

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
              V+P+ L+F + +QKRS+KVVV+G+    + +   M   L W D+ H+V+S I+VY+ L 
Sbjct  891   KVIPSTLTFTKLHQKRSFKVVVTGRPAMNETV---MHALLQWDDSKHNVKSHIVVYKHLN  947



>ref|XP_007145330.1| hypothetical protein PHAVU_007G230000g [Phaseolus vulgaris]
 gb|ESW17324.1| hypothetical protein PHAVU_007G230000g [Phaseolus vulgaris]
Length=736

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/714 (56%), Positives = 507/714 (71%), Gaps = 9/714 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +RK YIVYMGELP     +  D HHN+L  A+GD++LAR+ +IHSY +SF+GF ARLLP 
Sbjct  24    ERKTYIVYMGELPVATAYAPEDHHHNLLATAIGDQQLARKSKIHSYGKSFNGFAARLLPH  83

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +L E++ VVSVF NT  KL TTRSW+FLG+  K NR+ + E  +IVG+ DTG+ ++ 
Sbjct  84    EAEKLLEEENVVSVFPNTHNKLHTTRSWNFLGLPLKNNRHSRVEKHMIVGVFDTGISLDC  143

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSH  686
             PSF D GYGPPP +WKGKC  G NFTGCN KVIGA++FN+E   P    SPAD DGHG+H
Sbjct  144   PSFNDSGYGPPPPRWKGKCVTGANFTGCNNKVIGAKFFNLENSEP--NLSPADEDGHGTH  201

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIADG  863
              +S AAG  V GASL GI  GTA GGV  ARIA YKVCWG  GC DMD+LA FD AIADG
Sbjct  202   TSSTAAGVPVRGASLEGIGGGTAHGGVARARIAMYKVCWGSSGCSDMDLLAAFDEAIADG  261

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             V+VIS+S+GG PR FF DP+AIG++HAMK+ IVT+ +AGN GP   T++NV+PW++TVAA
Sbjct  262   VNVISLSLGGTPRKFFSDPVAIGAFHAMKRGIVTSCSAGNSGPATMTVENVAPWILTVAA  321

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
             ++ DR F + V LG+G    G SINTF    KMYPLISG LA +      GN SACDY S
Sbjct  322   SNTDRLFTTVVDLGDGHKFKGMSINTFTPKKKMYPLISGALASNVTEGGYGNASACDYGS  381

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATIV-DIEDGKK  1394
             +S++ V  KIVYCL   S+DY IK ++G G I S   P D    T+IPA  V     GK 
Sbjct  382   LSKEKVMRKIVYCLGPGSKDYIIKELNGAGTIISLSYPLDYSTTTIIPAVYVYSNTAGKT  441

Query  1395  IDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             ID YIN+TK   A I + ++ +  APFV SFS+RGPQ+IS NILKPDL APG+ ILA Y+
Sbjct  442   IDLYINSTKDAKAVIQKVKSTRGPAPFVASFSSRGPQSISTNILKPDLTAPGVDILAGYS  501

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              LAT++G  DDTR   +N+ SGTSMA PHAA A AYVK+FHP WSPAAIKSALMTTA  M
Sbjct  502   KLATLSGDPDDTRRNVFNILSGTSMACPHAAAATAYVKSFHPHWSPAAIKSALMTTATPM  561

Query  1755  KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
             +I    A L SG+G I P KA+ PGL+++I+   Y+++LCKE +N++S+G + G+K   C
Sbjct  562   RINDNTAELGSGSGQINPVKALDPGLLYNISIDSYIAFLCKEGYNSSSIGIIIGTKGFDC  621

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
               I  AQG DG+NYPSMH Q+T PN  + SA FYR+VT VG G++ +KAK+ +P GL++ 
Sbjct  622   SGIDPAQGTDGINYPSMHTQIT-PNG-SISAIFYRSVTNVGLGNSTYKAKVTSPKGLSIK  679

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             V+P+ L+F   NQ+ S+KVV+ G      S  +S SL W D  H++RSPI+VY+
Sbjct  680   VIPDTLTFSGVNQELSFKVVLKGPPMPKDSKLLSASLEWSDCQHNIRSPIVVYK  733



>ref|NP_568124.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 emb|CAB82927.1| cucumisin precursor-like protein [Arabidopsis thaliana]
 gb|AED90634.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=766

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/735 (53%), Positives = 512/735 (70%), Gaps = 23/735 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              + +RKPYIVYMGE  ++  + A + HHN+L   +GDE  ARE +I+SY ++ +GFVARL
Sbjct  28    ENVERKPYIVYMGEATENSLVEAAENHHNLLMTVIGDESKARELKIYSYGKNINGFVARL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGV  494
              P EA +LS ++ VVSVF+NT+ +L TTRSWDFLG+  +K  R+   ES++IVG+LDTG+
Sbjct  88    FPHEAEKLSREEGVVSVFKNTQRQLHTTRSWDFLGLVESKYKRSVGIESNIIVGVLDTGI  147

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV--EGFAPEDQESPADF  668
              VESPSF D G GPPPAKWKGKC  G NFT CN KVIGA+YF++  EG    + ++ AD 
Sbjct  148   DVESPSFNDKGVGPPPAKWKGKCVTGNNFTRCNNKVIGAKYFHIQSEGLPDGEGDTAADH  207

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             DGHG+H +S  AG  V  ASL+GIA GTARGGVPSARIA+YKVCW  GC DMD+LA FD 
Sbjct  208   DGHGTHTSSTIAGVSVSSASLFGIANGTARGGVPSARIAAYKVCWDSGCTDMDMLAAFDE  267

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI+DGVD+ISIS+GG    FF+DPIAIG++HAMK+ I+TT +AGN GP   T+ N++PW+
Sbjct  268   AISDGVDIISISIGGASLPFFEDPIAIGAFHAMKRGILTTCSAGNNGPGLFTVSNLAPWV  327

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             MTVAA S+DR+FE+ VKLGNG   SG S+N F    KMYPL SG+LA + +A   G  S 
Sbjct  328   MTVAANSLDRKFETVVKLGNGLTASGISLNGFNPRKKMYPLTSGSLASNLSAGGYGEPST  387

Query  1206  CDYLSISEKLVRGKIVYC--------LSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMI  1358
             C+  ++ E  V GK+VYC             QD+ ++ + G GVI     P D    T+I
Sbjct  388   CEPGTLGEDKVMGKVVYCEAGREEGGNGGQGQDHVVRSLKGAGVIVQLLEPTDMATSTLI  447

Query  1359  PATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDL  1538
               + V  EDG KI +YIN+TK P A IF+++  K  AP + SFSARGPQ IS NILKPD+
Sbjct  448   AGSYVFFEDGTKITEYINSTKNPQAVIFKTKTTKMLAPSISSFSARGPQRISPNILKPDI  507

Query  1539  AAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAA  1718
             +APGL+ILAAY+ LA++TG  DD R   +++ SGTSMA PHAA AAAYVK+FHPDWSPAA
Sbjct  508   SAPGLNILAAYSKLASVTGYPDDNRRTLFSIMSGTSMACPHAAAAAAYVKSFHPDWSPAA  567

Query  1719  IKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNAS  1895
             IKSALMTTA  M+IK   A L+ G+G I P +A+ PGL++DI +  Y+ +LCKE +N+ S
Sbjct  568   IKSALMTTATPMRIKGNEAELSYGSGQINPRRAIHPGLVYDITEDAYLRFLCKEGYNSTS  627

Query  1896  LGSLTGSKDN-------KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVG  2054
             +G LTG   N        C+NI    G+DGLNYPS+H Q+ N      S  FYRTVT VG
Sbjct  628   IGLLTGDNSNNTTKKEYNCENIKRGLGSDGLNYPSLHKQV-NSTEAKVSEVFYRTVTNVG  686

Query  2055  TGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKD  2234
              G + + A++ AP GL V VVP ++SF +  +KR++KVV+ G + + +   +S S+ W D
Sbjct  687   YGPSTYVARVWAPKGLRVEVVPKVMSFERPKEKRNFKVVIDGVWDETMKGIVSASVEWDD  746

Query  2235  NT-HSVRSPILVYRS  2276
             +  H VRSPIL++RS
Sbjct  747   SRGHLVRSPILLFRS  761



>ref|XP_010242651.1| PREDICTED: xylem serine proteinase 1-like [Nelumbo nucifera]
Length=751

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/722 (55%), Positives = 524/722 (73%), Gaps = 17/722 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             +T R+PYIVYMG++ +     +V++HHN+LT+ +GDE +ARE R+HSY+RSF+GF A LL
Sbjct  28    NTGRQPYIVYMGDVQEHGF--SVEQHHNMLTDVIGDESIARESRLHSYKRSFNGFAAMLL  85

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P EA RL E++ VVSVF NT+ KL+TTRSWDFLGM    NRN ++ESD+IVGLLDTGV+ 
Sbjct  86    PHEANRLMEREGVVSVFPNTKRKLVTTRSWDFLGMPLTVNRNHQSESDIIVGLLDTGVYP  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             ESPSF D GYGPPP+KWKGKC+ G NFTGCN K+IGA+ ++++     DQ SPAD +GHG
Sbjct  146   ESPSFDDKGYGPPPSKWKGKCEVGANFTGCNNKLIGARSYSIQ-IKISDQ-SPADTEGHG  203

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H +S  AG  V  ASLYGI  GT RGGVPSARIA YKVCW   C D+D+LA FD  I+D
Sbjct  204   THTSSTVAGSAVNHASLYGIGRGTTRGGVPSARIAMYKVCW-YWCSDIDILAAFDDVISD  262

Query  861   GVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             GVDV+SIS+GG   R++F D +AIGS+HAMKK I T  AAGN+GPY  T+ NV+PW+MTV
Sbjct  263   GVDVLSISIGGSSIRNYFNDSLAIGSFHAMKKGIFTACAAGNQGPYALTVSNVAPWIMTV  322

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNY-SACD  1211
              AT IDR+F ++++LGNG  I G S+NT+   K MYPL SGT A +    Y   + S+C 
Sbjct  323   GATGIDRKFRTEIRLGNGMKIYGLSLNTYAPTKQMYPLTSGTKAANYTDGYEAYFASSCY  382

Query  1212  YLSISEKLVRGKIVYCLSSAS------QDYTIKWIHGVG-VIASDKLPDTVLPTMIPATI  1370
               ++ ++ V GKIVYC S         QD+T+K + GVG +IA  +L DT    ++PA+ 
Sbjct  383   SGTMGQEKVEGKIVYCASGQGMFLGDRQDHTVKELGGVGTIIAGSELNDTAFSYVLPASR  442

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             VD++ G +ID+YINTTK P A I++++ VK +APFV SFS+RGP  +S  ILKPD+ APG
Sbjct  443   VDLKSGDQIDRYINTTKNPQAIIYKTKEVKVSAPFVASFSSRGPNYLSPRILKPDITAPG  502

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             + ILAAYT LA++TGQ  D R   +N+ SGTSMA PHAA AAAYVK+FHP+WSPAAIKSA
Sbjct  503   VDILAAYTKLASVTGQPYDDRFSLFNIVSGTSMACPHAAAAAAYVKSFHPNWSPAAIKSA  562

Query  1731  LMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             LMTTA A+K++   A  A G+G I P KA+ PGL++D+  S Y+ +LC+E +N+ +L  +
Sbjct  563   LMTTATAIKVRNRDAEFAYGSGHINPVKALNPGLVYDLQISSYIRFLCREGYNSTNLHLI  622

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             TG     C+    A+G DG+NYP+M L L +P A  FSA F R VT VGT S+V+KA +K
Sbjct  623   TGWSHLDCQKFQPARGHDGINYPTMTLPLPHP-AKNFSAVFKRIVTNVGTNSSVYKATVK  681

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             +P GL++SV PN L+F +  Q++++KVV+ GK  +  + ++S SL W D+ H VRSPI+V
Sbjct  682   SPEGLSISVFPNTLAFNRVYQRKTFKVVIKGKPLRKETPFISASLEWSDSIHRVRSPIVV  741

Query  2268  YR  2273
             Y+
Sbjct  742   YK  743



>ref|XP_010423686.1| PREDICTED: xylem serine proteinase 1-like [Camelina sativa]
Length=763

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/732 (53%), Positives = 511/732 (70%), Gaps = 20/732 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              + +RKPYIVYMGE  ++  + A + HHN+L   +GDE  ARE +I+SY ++ +GF ARL
Sbjct  28    ENNERKPYIVYMGEATENSHVEAAENHHNLLLTVIGDESKAREVKIYSYGKNINGFAARL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGV  494
              P EA +LS +D VVSVF+NT+ +L TTRSWDFLG + +K  R+   ES++IVG+LDTG+
Sbjct  88    YPHEAEKLSREDGVVSVFKNTQRQLHTTRSWDFLGFVESKYKRSVALESNIIVGVLDTGI  147

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV--EGFAPEDQESPADF  668
              ++SPSF D G GPPPAKWKGKC  G NFT CN KVIGA+YF++  EG      +SPAD+
Sbjct  148   DIDSPSFDDKGVGPPPAKWKGKCVTGNNFTRCNNKVIGAKYFHIDQEGLPDGKGDSPADY  207

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             DGHG+H +S  AG  V  ASL+GIA GTARGGV SARIA+YKVCW  GC DMD+LA FD 
Sbjct  208   DGHGTHTSSTIAGVSVSNASLFGIANGTARGGVLSARIATYKVCWESGCTDMDMLAAFDE  267

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI+DGVDVISIS+GG    FF+DPIAIG++HAMKK I+T  +AGN GP   T+ N++PW+
Sbjct  268   AISDGVDVISISIGGSSLPFFEDPIAIGAFHAMKKGILTMCSAGNNGPGLFTVSNLAPWV  327

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYSA  1205
             MTVAA S+DR+FE+ VKLGNG   SG S+N F    KMYPL SGTLA + +A   G  S 
Sbjct  328   MTVAANSLDRKFETVVKLGNGLTASGISLNGFSPSEKMYPLTSGTLASNLSAGGYGEPST  387

Query  1206  CDYLSISEKLVRGKIVYCLSSAS-----QDYTIKWIHGVGVIASDKLP-DTVLPTMIPAT  1367
             C+  ++ E  V GK+VYC +        QD+ ++ + G GVI     P D    T+I  +
Sbjct  388   CESGTLGEDKVMGKVVYCEAGREEGGNGQDHVVRSLKGAGVIVQLLEPTDMATSTVIAGS  447

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAP  1547
              V  EDG KI +YIN+TK P A IF+++  K  AP + SFSARGPQ IS NILKPD++AP
Sbjct  448   YVFFEDGTKISEYINSTKNPQAVIFKTKTTKMVAPSIASFSARGPQRISPNILKPDISAP  507

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             GL+ILAAY+ LA++TG  DD R   + + SGTSMA PHAA AAAYVK+FHPDWSPAAIKS
Sbjct  508   GLNILAAYSKLASVTGYSDDNRKTLFTIMSGTSMACPHAAAAAAYVKSFHPDWSPAAIKS  567

Query  1728  ALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGS  1904
             ALMTTA  M+IK   A L+ G+G I P +A+ PGL++DI +  Y+ +LCKE +N+ ++G 
Sbjct  568   ALMTTATPMRIKGDEAELSYGSGQINPRRAIHPGLVYDIAEDAYLRFLCKEGYNSTTIGL  627

Query  1905  LTGSKDN-------KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGS  2063
             L   K N       +C+N     G+DGLNYPSMH Q+++ + T  S  FYR+VT VG G 
Sbjct  628   LIAGKKNNTTKTEYRCENYKRGLGSDGLNYPSMHKQVSSTD-TKVSEVFYRSVTNVGYGP  686

Query  2064  TVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT-  2240
             + + AK+ AP GL V VVP  +SF +  +K+++KV++ G + + +   +S S+ W D+  
Sbjct  687   SNYVAKVWAPKGLRVEVVPKAMSFERPGEKKNFKVMIDGVWDEIMRGIVSASVEWDDSRG  746

Query  2241  HSVRSPILVYRS  2276
             H VRSPIL++RS
Sbjct  747   HLVRSPILLFRS  758



>ref|XP_006289761.1| hypothetical protein CARUB_v10003361mg [Capsella rubella]
 gb|EOA22659.1| hypothetical protein CARUB_v10003361mg [Capsella rubella]
Length=765

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/734 (53%), Positives = 510/734 (69%), Gaps = 23/734 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + +RKPYIVYMGE  +   + A   HHN+L+  +GDE  ARE +I+SY ++ +GFVARL 
Sbjct  29    NNERKPYIVYMGEATESFHVEAAKNHHNLLSTVIGDESKAREVKIYSYGKNINGFVARLF  88

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGVW  497
             P EA +LS ++ VVSVF+NT+ +L TTRSWDFLG+  +K  R+   ES++IVG+LDTG+ 
Sbjct  89    PHEAEKLSREEGVVSVFKNTQRQLHTTRSWDFLGLVESKYKRSVAIESNIIVGVLDTGID  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV--EGFAPEDQESPADFD  671
             V+SPSF D G GPPPAKWKGKC  G NFT CN KVIGA+YF++  EG      +SPAD+D
Sbjct  149   VDSPSFDDKGVGPPPAKWKGKCVTGNNFTRCNNKVIGAKYFHLDQEGLPDGKGDSPADYD  208

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H +S  AG  +  ASL+GIA GTARGGVPSARIA+YKVCW  GC DMD+LA FD A
Sbjct  209   GHGTHTSSTIAGISISSASLFGIANGTARGGVPSARIATYKVCWQSGCTDMDMLAAFDEA  268

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I+DGVDVISIS+GG    FF+DPIAIG++HAMKK I+T  +AGN GP   T+ N++PW+M
Sbjct  269   ISDGVDVISISIGGASLPFFEDPIAIGAFHAMKKGILTMCSAGNNGPGLFTVSNLAPWVM  328

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSAC  1208
             TVAA S+DR+FE+ VKLGNG   SG S+N F    KMYPL SG+LA + +A   G  S C
Sbjct  329   TVAANSLDRKFETVVKLGNGLTASGISLNGFSPREKMYPLTSGSLASNLSAGGYGEPSTC  388

Query  1209  DYLSISEKLVRGKIVYC--------LSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIP  1361
             +  ++ E  V GK+VYC             QD+ ++ + G GVI     P D    T+I 
Sbjct  389   ESGTLGEDKVMGKVVYCEAGREEGGNGGQGQDHVVRSLKGAGVIVQLLQPTDMATSTLIA  448

Query  1362  ATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLA  1541
              + V  EDG KI +YIN+TK P A IF+++ +K  AP + SFSARGPQ IS NILKPD++
Sbjct  449   GSYVFFEDGTKISEYINSTKNPQAVIFKTKTIKMVAPSIASFSARGPQRISPNILKPDIS  508

Query  1542  APGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAI  1721
             APGL+ILAAY+ LA++TG  DD R   +++ SGTSMA PHAA AAAYVK+FHPDWSPAAI
Sbjct  509   APGLNILAAYSKLASVTGYSDDNRKTLFSIMSGTSMACPHAAAAAAYVKSFHPDWSPAAI  568

Query  1722  KSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             KSALMTTA  M+IK   A L+ G+G I P +A+ PGL+FDI +  Y+ +LCKE +N+ S+
Sbjct  569   KSALMTTATPMRIKGNEAELSYGSGQINPRRAIHPGLVFDITEDAYLRFLCKEGYNSTSI  628

Query  1899  GSLTGSKDN-------KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGT  2057
             G L G K N        C+N     G+DG+NYPSMH Q+++   T  S  FYR+V  VG 
Sbjct  629   GLLIGGKKNNTTKTEYNCENFRRGLGSDGINYPSMHKQVSS-TGTKVSEVFYRSVRNVGY  687

Query  2058  GSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDN  2237
             G + + AK+  P GL V VVP  +SF +  +K+++KV++ G + + +   +S S+ W D+
Sbjct  688   GPSNYVAKVWVPKGLKVEVVPKAMSFEKPGEKKNFKVMIDGVWDETMKGIVSASVEWDDS  747

Query  2238  T-HSVRSPILVYRS  2276
               H VRSPIL++RS
Sbjct  748   RGHLVRSPILLFRS  761



>ref|XP_002871048.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47307.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=767

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/736 (53%), Positives = 513/736 (70%), Gaps = 24/736 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              + +RKPYIVYMGE  ++  + A + HHN+L   +GDE  ARE +++SY ++ +GFVARL
Sbjct  28    ENNERKPYIVYMGEATENSHVEAAENHHNLLLTVIGDESKAREVKMYSYGKNINGFVARL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGV  494
              P EA +LS ++ VVSVF+NT+ +L TTRSWDFLG+  +K  R+   ES++IVG+LDTG+
Sbjct  88    FPHEAEKLSREEGVVSVFKNTQRQLHTTRSWDFLGLVESKYKRSVAIESNIIVGVLDTGI  147

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV--EGFAPEDQESPADF  668
              V+SPSF D G GPPPAKWKGKC  G NFT CN KV+GA+YF +  EG    + +S AD+
Sbjct  148   DVDSPSFNDKGVGPPPAKWKGKCVTGNNFTRCNNKVLGAKYFRLQQEGLPDGEGDSAADY  207

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             DGHG+H +S  AG  V  ASL+GIA GTARGGVPSARIA+YKVCW  GC DMD+LA FD 
Sbjct  208   DGHGTHTSSTIAGVSVSSASLFGIANGTARGGVPSARIAAYKVCWDSGCTDMDMLAAFDE  267

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI+DGVD+ISIS+GG    FF+DPIAIG++HAMK+ I+T  +AGN GP   T+ N++PW+
Sbjct  268   AISDGVDIISISIGGASLPFFEDPIAIGAFHAMKRGILTMCSAGNNGPGLFTVSNLAPWV  327

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             MTVAA S+DR+FE+ VKLGNG   SG S+N F    KMYPL SG+LA + +A   G  S 
Sbjct  328   MTVAANSLDRKFETVVKLGNGLTASGISLNGFNPRKKMYPLTSGSLASNLSAGGYGEPST  387

Query  1206  CDYLSISEKLVRGKIVYC--------LSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMI  1358
             C+  ++ E  V GK+VYC             QD+ ++ + G GVI     P D    T+I
Sbjct  388   CEPGTLGEDKVMGKVVYCEAGREEGGNGGQGQDHVVRSLKGAGVIVQLLEPTDMATSTLI  447

Query  1359  PATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDL  1538
               + V  EDG KI +YIN+TK P A IF+++  K  AP + SFSARGPQ IS NILKPD+
Sbjct  448   AGSYVFFEDGTKITEYINSTKNPQAVIFKTKTTKMLAPSISSFSARGPQRISPNILKPDI  507

Query  1539  AAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAA  1718
             +APGL+ILAAY+ LA++TG  DD R   +++ SGTSMA PHAA AAAYVK+FHPDWSPAA
Sbjct  508   SAPGLNILAAYSKLASVTGYPDDNRRTLFSIMSGTSMACPHAAAAAAYVKSFHPDWSPAA  567

Query  1719  IKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNAS  1895
             IKSALMTTA  M+IK   A L+ G+G I P +A+ PGL++DI +  Y+ +LCKE +N+ S
Sbjct  568   IKSALMTTATPMRIKGNEAELSYGSGQINPRRAIHPGLVYDITEDAYLRFLCKEGYNSTS  627

Query  1896  LGSLTG--------SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYV  2051
             +G L G         K+ KC+N     G+DGLNYPSMH Q+T+ + T  S  FYRTV  V
Sbjct  628   IGLLIGNNKNNTTTKKEYKCENFKRGLGSDGLNYPSMHKQVTSTD-TKVSEVFYRTVRNV  686

Query  2052  GTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWK  2231
             G G + + A++ AP GL V VVP ++SF +  +K+++KVV+ G + + +   +S S+ W 
Sbjct  687   GYGPSTYVARVWAPKGLRVEVVPKVMSFERPGEKKNFKVVIDGVWDETMKGIVSASVEWD  746

Query  2232  DNT-HSVRSPILVYRS  2276
             D+  H VRSPIL++RS
Sbjct  747   DSRGHVVRSPILLFRS  762



>ref|XP_010495057.1| PREDICTED: xylem serine proteinase 1 [Camelina sativa]
Length=765

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/734 (53%), Positives = 509/734 (69%), Gaps = 22/734 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              + +RKPYIVYMGE  ++  + A + HHN+L   +GDE  ARE +I+SY ++ +GF ARL
Sbjct  28    ENNERKPYIVYMGEATENSHVEAAENHHNLLLTVIGDESKAREVKIYSYGKNINGFAARL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGV  494
              P EA +LS +D VVSVF+N + +L TTRSWDFLG + +K  R+   ES++IVG+LDTG+
Sbjct  88    YPHEAEKLSREDGVVSVFKNIQRQLHTTRSWDFLGFVESKYKRSVALESNIIVGVLDTGI  147

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV--EGFAPEDQESPADF  668
              V+SPSF D G GPPPAKWKGKC  G NFT CN KVIGA+YF++  EG      +SPAD+
Sbjct  148   DVDSPSFDDKGVGPPPAKWKGKCVTGNNFTRCNNKVIGAKYFHLDQEGLPDGKGDSPADY  207

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             DGHG+H +S  AG  V  ASL+GIA GTARGGVPSARIA+YKVCW  GC DMD+LA FD 
Sbjct  208   DGHGTHTSSTIAGVSVSSASLFGIANGTARGGVPSARIATYKVCWESGCTDMDMLAAFDE  267

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI+DGVDVISIS+GG    FFQDPIAIG++HAMK+ I+T  +AGN GP   T+ N++PW+
Sbjct  268   AISDGVDVISISIGGASLPFFQDPIAIGAFHAMKRGILTMCSAGNNGPGLFTVSNLAPWV  327

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSA  1205
             MTVAA S+DR+FE+ VKLGNG   SG S+N F   + MYPL SGTLA + +A   G  S 
Sbjct  328   MTVAANSLDRKFETVVKLGNGLTASGISLNGFSPRETMYPLTSGTLASNLSAGGYGEPST  387

Query  1206  CDYLSISEKLVRGKIVYC-------LSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIP  1361
             C+  ++ E  V GK+VYC            QD+ ++ + G GVI     P D    T+I 
Sbjct  388   CESGTLGEDKVMGKVVYCEAGREEGGGGHGQDHVVRSLKGAGVIVQLLEPTDMATSTLIA  447

Query  1362  ATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLA  1541
              + V  EDG KI +YIN+TK P A IF+++     AP + SFSARGPQ IS NILKPD++
Sbjct  448   GSYVFFEDGTKISEYINSTKNPQAVIFKTKTTTMVAPSIASFSARGPQRISPNILKPDIS  507

Query  1542  APGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAI  1721
             APGL+ILAAY+ LA++TG  DD R   + + SGTSMA PHAA AAAYVK+FHPDWSPAAI
Sbjct  508   APGLNILAAYSKLASVTGYSDDNRKTLFTIMSGTSMACPHAAAAAAYVKSFHPDWSPAAI  567

Query  1722  KSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             KSALMTTA  M+IK   A L+ G+G I P +A+ PGL++DI +  Y+ +LCKE +N+ S+
Sbjct  568   KSALMTTATPMRIKGDEAELSYGSGQINPRRAIHPGLVYDITEDAYLRFLCKEGYNSTSI  627

Query  1899  GSLTGSKDN-------KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGT  2057
             G L  +  N       +C+N     G+DGLNYPSMH Q+++ + T  S  FYR+VT VG 
Sbjct  628   GLLIRNNKNNTTKTEYRCENFKRGLGSDGLNYPSMHKQVSSTD-TKVSEVFYRSVTNVGY  686

Query  2058  GSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDN  2237
             G + + AK+ AP GL V VVP  +SF +  +K+++KV++ G + + +   +S S+ W D+
Sbjct  687   GPSNYVAKVWAPKGLRVEVVPKAMSFERPGEKKNFKVMIDGVWDETMRGIVSASVEWDDS  746

Query  2238  T-HSVRSPILVYRS  2276
               H VRSPIL++RS
Sbjct  747   RGHLVRSPILLFRS  760



>gb|KFK24826.1| hypothetical protein AALP_AA8G030100 [Arabis alpina]
Length=763

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/732 (53%), Positives = 522/732 (71%), Gaps = 21/732 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMG--ELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVA  311
              + +R PYIVYMG   + ++  + A + HHN+L++ +GDE  ARE +++SY ++ +GFVA
Sbjct  28    ENNERTPYIVYMGAASVTENFHVQAAENHHNLLSKTIGDESKAREVKMYSYGKNINGFVA  87

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDT  488
             RL P EA +LS ++ VVSVF+NT+ +L TTRSWDFLG + +K  RN   ES++IVG+LDT
Sbjct  88    RLYPHEAEKLSREEGVVSVFKNTKQQLHTTRSWDFLGFVESKYKRNVAVESNIIVGVLDT  147

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPAD  665
             G++++SPSF D GYGPPPAKWKGKC  G+N T CN KVIGA+YF ++     ++ ++ AD
Sbjct  148   GIYIDSPSFDDKGYGPPPAKWKGKCVTGINLTHCNNKVIGAKYFQLDSPMLNNRGQTAAD  207

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
             +DGHG+HI+S  AG  +  ASL+GIA GTARGGVPSARIA+YKVCW  GC  MD+LA FD
Sbjct  208   YDGHGTHISSTIAGASISSASLFGIANGTARGGVPSARIATYKVCWDGGCTAMDMLAAFD  267

Query  846   AAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
              AI+DGVDVISIS+GG    FF+DPIAIG++HAMK+ I+TT +AGN GP   T+ N++PW
Sbjct  268   EAISDGVDVISISIGGASLPFFEDPIAIGAFHAMKRGILTTCSAGNNGPALFTVSNLAPW  327

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYS  1202
             +MTVAA SIDR+FE+ VKLGNG+  SG S+N F    KMYPL SG LA + +A    N S
Sbjct  328   VMTVAANSIDRKFETVVKLGNGQTTSGISLNGFSPKKKMYPLTSGLLASNVSAGSYENPS  387

Query  1203  ACDYLSISEKLVRGKIVYCLSS-----ASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPA  1364
             +C+  ++ E  V GK+VYC ++      SQD  +K + G G+I     P +    T+I  
Sbjct  388   SCEPGTMGEDKVMGKVVYCEAAREEGGTSQDLVVKNLKGAGLIVQLLEPTERASATIIAG  447

Query  1365  TIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAA  1544
             + V ++DG KI  YIN+TK P A IF+++  K  AP +PSFSARGPQ +S NILKPDL+A
Sbjct  448   SNVVMDDGTKISDYINSTKNPQAVIFKTKTSKMLAPSIPSFSARGPQRVSPNILKPDLSA  507

Query  1545  PGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             PGL+ILAA++ LAT+TG  +DTR   + + SGTSMA PHAA AAAYVK+FHPDWSPAAIK
Sbjct  508   PGLNILAAHSKLATVTGYPEDTRQTLFTIMSGTSMACPHAAAAAAYVKSFHPDWSPAAIK  567

Query  1725  SALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             SALMTTA  M+IK   A L+ GAG I P +A+ PGL++DI +++Y+ +LCKE +N+ S+G
Sbjct  568   SALMTTATPMRIKEQEAELSYGAGQINPRRAIHPGLVYDITETDYLQFLCKEGYNSTSIG  627

Query  1902  SLTGS------KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGS  2063
              L G       K+ KC       G+DGLNYPSMH Q+++ +  T    FYRTV  VG G 
Sbjct  628   LLVGDNNDNTKKEYKCVGHKQVLGSDGLNYPSMHKQVSSTDKGTH--IFYRTVRSVGYGP  685

Query  2064  TVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT-  2240
             + + AK+ AP GL+V V P ++SF +  + +S+KV+V+G + +++   MSGS+ W D+  
Sbjct  686   STYVAKVWAPKGLSVKVEPRVMSFVKAGEIKSFKVMVNGVWDESMKGIMSGSVEWDDSRG  745

Query  2241  HSVRSPILVYRS  2276
             H VRSPIL+++S
Sbjct  746   HLVRSPILLFQS  757



>ref|XP_006398815.1| hypothetical protein EUTSA_v10015584mg [Eutrema salsugineum]
 gb|ESQ40268.1| hypothetical protein EUTSA_v10015584mg [Eutrema salsugineum]
Length=766

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/737 (52%), Positives = 513/737 (70%), Gaps = 25/737 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D +RKPYIVYMG+  +   + A + HHN+L   +GDE  ARE +++SY ++  GFVARL
Sbjct  26    EDDERKPYIVYMGDAAEKSHVEAAENHHNLLVTVIGDESKAREVKMYSYGKNIDGFVARL  85

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGV  494
              P E  +LS ++ VVSVF+NT+ +L TTRSWDFLG + +K  R+   ES++IVG+LDTG+
Sbjct  86    CPHEVEKLSREEGVVSVFKNTQRQLHTTRSWDFLGFVESKYKRSLAVESNIIVGVLDTGI  145

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ--ESPADF  668
             ++++PSF D GYGPPPAKWKGKC  G N T CN KVIGA+YF+++  +  D   ++ AD+
Sbjct  146   YIDTPSFDDKGYGPPPAKWKGKCVTGNNLTHCNNKVIGAKYFHLKEESHFDSKGQTAADY  205

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             DGHG+HI+S  AG  V  ASL+GIA GTARGGVPSARIA+YKVCW +GC DMD++A FD 
Sbjct  206   DGHGTHISSTIAGVSVSDASLFGIANGTARGGVPSARIATYKVCWEEGCSDMDIMAAFDE  265

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI+DGVDVISIS+GG    FF+DPIAIG++HA K+ IVTT +AGN GP   T+ N++PW+
Sbjct  266   AISDGVDVISISIGGASLPFFEDPIAIGAFHATKRGIVTTCSAGNNGPALFTVSNLAPWV  325

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             +TVAA SIDR+FE+ VKLGNG   SG S+N F    KM+PL SG LA + +    G    
Sbjct  326   LTVAANSIDRKFETLVKLGNGLTASGISLNGFSPRKKMFPLTSGLLASNVSEGGYGEPRT  385

Query  1206  CDYLSISEKLVRGKIVYCLSSASQ-------DYTIKWIHGVGVIASDKLP-DTVLPTMIP  1361
             C+  +++E+ V GK+VYC +   +       D+ ++ + G GVI     P D    T+I 
Sbjct  386   CESETMAEEKVMGKVVYCEAGREEGGARGGPDHVVRSLKGAGVIVQLLEPTDMATSTLIS  445

Query  1362  ATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLA  1541
              + V  EDG KI  YIN+TK P A IF+++  K  AP + SFSARGPQ IS NILKPD++
Sbjct  446   GSYVFFEDGTKISDYINSTKNPQAVIFKTQTTKMLAPSIASFSARGPQRISPNILKPDIS  505

Query  1542  APGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAI  1721
             APGL+ILAAY+ L T+TG  DD R   Y++ SGTSMA PHAA AAAYVK+FHPDWSPAAI
Sbjct  506   APGLNILAAYSKLTTITGYPDDKRQTLYSIMSGTSMACPHAAAAAAYVKSFHPDWSPAAI  565

Query  1722  KSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             KSALMTTA  M+IK   A L+ G+G I P +A+ PGL++DI +S Y+++LCKE +N+ ++
Sbjct  566   KSALMTTATPMRIKGSEAELSYGSGQINPRRAIHPGLVYDITESSYLNFLCKEGYNSTTI  625

Query  1899  GSLTGS----------KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTY  2048
             G L G           K+ +C +     G+DGLNYPSMH Q+++   T  S  FYRTV  
Sbjct  626   GLLLGGNNKTVKEYTVKEYRCVDNKRGLGSDGLNYPSMHKQVSS-TETKVSEVFYRTVRN  684

Query  2049  VGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVW  2228
             VG G + + A++ AP GL V VVP ++SF +  ++R++KVV+ G +++ +   +S S+ W
Sbjct  685   VGYGPSTYVARVWAPKGLRVRVVPRVMSFVKPGEQRNFKVVIDGAWEETMRGILSASVEW  744

Query  2229  KDNT-HSVRSPILVYRS  2276
              D+  H VRSPIL+++S
Sbjct  745   DDSRGHLVRSPILLFQS  761



>emb|CDY04892.1| BnaAnng00740D [Brassica napus]
Length=755

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/728 (52%), Positives = 512/728 (70%), Gaps = 24/728 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +R+PYIVYMG+  +   + A + HHN+L++ +GDE  ARE R++SY ++  GFVARLLP 
Sbjct  31    KREPYIVYMGDAAEKYIVEASENHHNLLSKVIGDESKAREVRMYSYGKNIDGFVARLLPN  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGVWVE  503
             E   LS ++ V+SVF+NT+ +L TTRSWDFLG + +K  R+   ES++IVG+LDTG++++
Sbjct  91    EVEMLSREEGVISVFKNTQRQLHTTRSWDFLGFVESKYRRSEAIESNIIVGVLDTGIYID  150

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGS  683
             SPSF D G+GPPPAKWKGKC  G N T CN KVIGA+Y++++   P+  ++ AD+DGHG+
Sbjct  151   SPSFDDKGFGPPPAKWKGKCVTGNNLTRCNNKVIGARYYHLK--RPDYNDTAADYDGHGT  208

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             HI S  AG  V  A+L+GIA GTARGGVPSARIA+YKVCW +GC DMD+LA FD AI+DG
Sbjct  209   HITSTIAGVAVSNANLFGIANGTARGGVPSARIATYKVCWEEGCSDMDMLAAFDEAISDG  268

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             VD+ISIS+GG    FF+DPIAIGS+HAMK+ I+TT +AGN GP   T+ N++PW+MTVAA
Sbjct  269   VDMISISIGGASLPFFEDPIAIGSFHAMKRGILTTCSAGNNGPGLYTVSNLAPWVMTVAA  328

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
              S+DR+FE+ VKLGNG+  +G S+N F    KMYPL SG LA +  A   G  SAC+  +
Sbjct  329   NSVDRKFETVVKLGNGDTATGISVNGFNPKKKMYPLTSGFLASNVTAGDYGEPSACEPGT  388

Query  1221  ISEKLVRGKIVYCL--------SSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATIV  1373
             + E  V GK+VYC         SS  QD+ IK + G GVI     P D    T+IP + V
Sbjct  389   MGEDKVMGKVVYCEVGREEAGGSSEGQDHIIKSLKGAGVIVQLLEPTDMATSTLIPGSYV  448

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
               E G KI  YIN+TK P A I ++R  K  AP + SFSARGPQ IS NILKPD++APGL
Sbjct  449   LYEVGTKISDYINSTKNPQAVILKTRTTKMVAPSIASFSARGPQRISPNILKPDISAPGL  508

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             +ILAAY+ LAT+T   +DT    +++ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSAL
Sbjct  509   NILAAYSKLATVTVHAEDTL---FSIMSGTSMACPHAAAAAAYVKSFHPDWSPAAIKSAL  565

Query  1734  MTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             MTTA  M+ K I A L+ G+G I P +A+ PGL++DI ++ Y+S+LCKE +N+ S+G L 
Sbjct  566   MTTATPMRTKDIEAELSYGSGQINPRRAIHPGLVYDITETSYLSFLCKEGYNSTSIGLLL  625

Query  1911  G-----SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFK  2075
             G      K+ +C +     G+DGLNYPSMH Q+ +   T  S  FYRTV  VG G + + 
Sbjct  626   GGSNETKKEYRCVDHKQGLGSDGLNYPSMHKQVGS-KGTNVSETFYRTVRSVGYGPSTYV  684

Query  2076  AKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT-HSVR  2252
             A++ AP G+ V V P ++SF +  +++ +KVV+ G  ++A+   +S S+ W D+  H VR
Sbjct  685   ARVWAPKGVRVVVEPRVMSFVKPGEEKHFKVVIDGVMEEAMRGILSASVEWDDSRGHLVR  744

Query  2253  SPILVYRS  2276
             SPIL++++
Sbjct  745   SPILLFQA  752



>ref|XP_009125514.1| PREDICTED: xylem serine proteinase 1 [Brassica rapa]
Length=755

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/728 (52%), Positives = 511/728 (70%), Gaps = 24/728 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +R+PYIVYMG+  +   + A + HHN+L++ +GDE  ARE R++SY ++  GFVARLLP 
Sbjct  31    KREPYIVYMGDAAEKYNVEASENHHNLLSKVIGDESKAREVRMYSYGKNIDGFVARLLPN  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGVWVE  503
             E   LS ++ V+SVF+NT+ +L TTRSWDFLG + +K  R+   ES++IVG+LDTG++++
Sbjct  91    EVEMLSREEGVISVFKNTQRQLHTTRSWDFLGFVESKYRRSEAIESNIIVGVLDTGIYID  150

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGS  683
             SPSF D G+GPPPAKWKGKC  G N T CN KVIGA+Y++++   P   ++ AD+DGHG+
Sbjct  151   SPSFDDKGFGPPPAKWKGKCVTGNNLTRCNNKVIGARYYHLK--RPNYNDTAADYDGHGT  208

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             HI S  AG  V  A+L+GIA GTARGGVPSARIA+YKVCW +GC DMD+LA FD AI+DG
Sbjct  209   HITSTIAGVAVSNANLFGIANGTARGGVPSARIATYKVCWEEGCSDMDMLAAFDEAISDG  268

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             VD+ISIS+GG    FF+DPIAIGS+HAMK+ I+TT +AGN GP   T+ N++PW+MTVAA
Sbjct  269   VDMISISIGGASLPFFEDPIAIGSFHAMKRGILTTCSAGNNGPGLYTVSNLAPWVMTVAA  328

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
              S+DR+FE+ VKLGNG+  +G S+N F    KMYPL SG LA +  A   G  SAC+  +
Sbjct  329   NSVDRKFETVVKLGNGDTATGISVNGFNPKKKMYPLTSGFLASNVTAGDYGEPSACEPGT  388

Query  1221  ISEKLVRGKIVYCL--------SSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATIV  1373
             + E  V GK+VYC         SS  QD+ IK + G GVI     P D    T+IP + V
Sbjct  389   MGEDKVMGKVVYCEVGREEAGGSSEGQDHIIKSLKGAGVIVQLLEPTDMATSTLIPGSYV  448

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
               E G KI  YIN+TK P A I ++R  K  AP + SFSARGPQ IS NILKPD++APGL
Sbjct  449   LYEVGTKISDYINSTKNPQAVILKTRTTKMVAPSIASFSARGPQRISPNILKPDISAPGL  508

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             +ILAAY+ LAT+T   +DT    +++ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSAL
Sbjct  509   NILAAYSKLATVTVHAEDTL---FSIMSGTSMACPHAAAAAAYVKSFHPDWSPAAIKSAL  565

Query  1734  MTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             MTTA  M+ K I A L+ G+G I P +A+ PGL++DI ++ Y+S+LCKE +N+ S+G L 
Sbjct  566   MTTATPMRTKDIEAELSYGSGQINPRRAIHPGLVYDITETSYLSFLCKEGYNSTSIGLLL  625

Query  1911  G-----SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFK  2075
             G      K+ +C +     G+DGLNYPSMH Q+ +   T  S  FYRTV  VG G + + 
Sbjct  626   GGSNETKKEYRCVDHKQGLGSDGLNYPSMHKQVGS-KGTNVSETFYRTVRSVGYGPSTYV  684

Query  2076  AKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT-HSVR  2252
             A++ AP G+ V V P ++SF +  +++ +KVV+ G  ++A+   +S S+ W D+  H VR
Sbjct  685   ARVWAPKGVRVVVEPRVMSFVKPGEEKHFKVVIDGVMEEAMRGILSASVEWDDSRGHLVR  744

Query  2253  SPILVYRS  2276
             SPIL++++
Sbjct  745   SPILLFQA  752



>ref|XP_010242650.1| PREDICTED: xylem serine proteinase 1-like [Nelumbo nucifera]
Length=746

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/719 (55%), Positives = 510/719 (71%), Gaps = 12/719 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             +T R+PYIVYMGE+ +   +   ++H ++LTE + DE +ARE  +HSY+RSF+GFVA LL
Sbjct  28    NTGRQPYIVYMGEVLEHGLVPE-EQHRSLLTEIIEDESIARESILHSYKRSFNGFVAMLL  86

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P EA RL E+++VVSVF NT++KL TTRSWDFLGM    NR+ K E ++IVGLLDTGV+ 
Sbjct  87    PHEANRLMEREEVVSVFPNTKLKLHTTRSWDFLGMPLTVNRSYKIEREIIVGLLDTGVYP  146

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             ESPSF D GYGPPP+KWKGKC+ G+NFTGCN+K+IGA+ +++    P   +SPAD DGHG
Sbjct  147   ESPSFDDKGYGPPPSKWKGKCEVGVNFTGCNKKLIGARSYSIGHKTP--HQSPADTDGHG  204

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H AS   G  V  ASLYGI  GTARGGV SAR+A YKVCW  GC D D+LA FD AI+D
Sbjct  205   THTASTIVGSAVNNASLYGIGGGTARGGVSSARLAMYKVCWDNGCWDSDILAAFDDAISD  264

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVDV+SIS+GG  R F+ D ++IGS+HAMKK I+T  +AGNEGPY  T+ N++PW++TV 
Sbjct  265   GVDVLSISLGGVIRDFYNDSLSIGSFHAMKKGILTVCSAGNEGPYLLTVSNLAPWVLTVG  324

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNY-SACDY  1214
             AT IDR+F ++V+LGNG   SG +INT+   K MYPL SG  A   N + P  Y   CD+
Sbjct  325   ATGIDRQFRAEVRLGNGMKTSGLAINTYSPTKQMYPLTSGIKAA--NYSGPDAYPDTCDW  382

Query  1215  LSISEKLVRGKIVYCLSSA-SQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDG  1388
              S+ EK V+GKIVYC      QDYTIK + G G +IA     DT    ++P + VD + G
Sbjct  383   GSLGEKHVKGKIVYCAPGGIYQDYTIKVLGGAGTIIAGSDFNDTAFTFVLPTSYVDPKVG  442

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
               IDKYINTTK P A + +S+ VK +APFV SFS+RGP  +S  ILKPD+ APG+ ILAA
Sbjct  443   NLIDKYINTTKNPQAIVHKSKEVKVSAPFVASFSSRGPNYLSPRILKPDITAPGVDILAA  502

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             +T L ++TG+  D R   +N+ SGTSM+ PHAA AAAYVK+FHP WSPAAIKSALMTTA 
Sbjct  503   FTMLESITGEPHDNRFSLFNIISGTSMSCPHAAAAAAYVKSFHPHWSPAAIKSALMTTAT  562

Query  1749  AMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             AMK+K   A  A G+G I P +A+ PGL++D+  S Y+  LC+E +N+  L  LTG    
Sbjct  563   AMKVKTPDAEFAYGSGQINPVRALNPGLVYDLRASSYIRLLCREGYNDTKLRLLTGWNHL  622

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C+    A+G DG+NYP+M LQL +P    +SA F RTV  VGT ++V+KA +K+P GL+
Sbjct  623   DCRKFQPARGYDGINYPTMTLQLHHPTK-NYSAVFKRTVKNVGTKNSVYKAIVKSPKGLS  681

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             VSV P+ L+F +  Q++S+KV + G+      +  +S SL WKD+TH VRSPI+VY+ L
Sbjct  682   VSVFPSTLAFNRVYQRKSFKVELKGEPLISNGTGLISASLEWKDSTHRVRSPIVVYKVL  740



>ref|XP_008241424.1| PREDICTED: xylem serine proteinase 1 [Prunus mume]
Length=712

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/746 (52%), Positives = 510/746 (68%), Gaps = 49/746 (7%)
 Frame = +3

Query  72    MKTlfifslfifffsVRATLWPHDTQ-----RKPYIVYMGELPDDPTISAVDEHHNILTE  236
             M+TL    + +    V ATL    TQ     RKPYIVYMGELP   T SA+  HHN+L +
Sbjct  1     MRTLQNLLVIVLSTYVVATLAKETTQDGFDARKPYIVYMGELPGAET-SAMARHHNLLVQ  59

Query  237   ALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDF  416
             A+GDEE+AR  RIHSY R+F+GF ARLLP EA+ L+E+D VVSVF NT  KL TTRSWDF
Sbjct  60    AIGDEEIARASRIHSYGRTFNGFAARLLPHEAKALAEEDSVVSVFPNTMRKLHTTRSWDF  119

Query  417   LGMSTKANR-NPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCN  593
             LG+  K  + N + +S++IVG+LDTG++++ PSF D GYGPPP+KWKGKC KG NF GCN
Sbjct  120   LGLPIKLKKGNAQIQSNIIVGVLDTGIYLDGPSFNDTGYGPPPSKWKGKCVKGDNFKGCN  179

Query  594   RKVIGAQYFNVEGFAP-EDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVP  770
              KVIGA+YFN++   P   + SP D +GHG+H AS  AG  V+GAS+YGIA+GTARGG P
Sbjct  180   NKVIGAKYFNLDSNHPWPGKLSPVDDEGHGTHTASTIAGIPVQGASVYGIAKGTARGGAP  239

Query  771   SARIASYKVCWG-QGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAM  947
              +RIA YKVCW   GC D+D+LA FD AIADGVD+ISIS+GGH RSF++DPIAIGS+HAM
Sbjct  240   LSRIAVYKVCWPFNGCSDIDMLAAFDEAIADGVDLISISIGGHSRSFWEDPIAIGSFHAM  299

Query  948   KKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE  1127
             KK I  + +AGN+GP  GT+QNV+PW+ TVAA +IDR+ ++ VKLGNG+  SG ++NT+ 
Sbjct  300   KKGIFVSCSAGNDGPSEGTVQNVAPWVTTVAANAIDRKLKTVVKLGNGKRFSGNALNTYT  359

Query  1128  LGK-MYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHG  1304
             L K MYPL SGTLA +K+    GN SACD  ++    V+G+IVYCL S+ QD+TI+ + G
Sbjct  360   LKKQMYPLTSGTLASNKSENSYGNASACDSSTLDADKVKGRIVYCLGSSGQDFTIRRLQG  419

Query  1305  VGVIASD-KLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKT-TAPFV  1478
              G + +  +L D     +IP T + ++DG KID+YIN+TK P A I+++R VKT  AP +
Sbjct  420   AGTLMTQYELEDYAYSPVIPGTGILVKDGIKIDQYINSTKNPMAVIYKTRTVKTPDAPDI  479

Query  1479  PSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATP  1658
              SFSARGPQ I+ NILKPD++APG++ILAAY+ LA+++                      
Sbjct  480   ASFSARGPQRITPNILKPDISAPGINILAAYSRLASIS----------------------  517

Query  1659  HAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIF  1838
                          PDWSPAAIKSALMTTA  +  +  G  L +GAG + P KA  PGLI+
Sbjct  518   ------------DPDWSPAAIKSALMTTATPINTRVGGNTLGTGAGQVNPKKAAHPGLIY  565

Query  1839  DINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATT  2015
             DI   +Y+S+LCK+ +N+ ++G L G K+  C +    +G DGLNYPSMHL     + T+
Sbjct  566   DITVDDYISFLCKQGYNSTNIGILGGKKNVSCSDYKPPRGTDGLNYPSMHLH-QQASDTS  624

Query  2016  FSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKA  2195
               A FYR VT VG GS+V+K K+  P   +++V P+ L F +++QKRS+KVVVSG    A
Sbjct  625   VKAVFYRRVTNVGYGSSVYKVKLIMPKFFSITVTPSTLKFTRSHQKRSFKVVVSGGTPTA  684

Query  2196  ISWYMSGSLVWKDNTHSVRSPILVYR  2273
                 +S  L W D+ HSVRS I +YR
Sbjct  685   -GVPVSALLEWDDHKHSVRSLITLYR  709



>emb|CDY44378.1| BnaC02g02990D [Brassica napus]
Length=751

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/728 (53%), Positives = 507/728 (70%), Gaps = 24/728 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +R+PYIVYMG+  +     A + HHN+L++ +GDE  ARE R++SY ++  GFVARLLP 
Sbjct  27    KREPYIVYMGDAAEKYNAEASENHHNLLSKVIGDESKAREVRMYSYGKNIDGFVARLLPN  86

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGVWVE  503
             E   LS ++ VVSVF+NT+ +L TTRSWDFLG + +K  R+   ES++IVG+LDTG++++
Sbjct  87    EVEMLSREEGVVSVFKNTQRQLHTTRSWDFLGFVESKYRRSEAVESNIIVGVLDTGIYID  146

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGS  683
             SPSF D G+GPPPAKWKGKC  G N T CN KVIGA+Y++++   P   ++ AD+DGHG+
Sbjct  147   SPSFDDKGFGPPPAKWKGKCVTGNNLTRCNNKVIGARYYHLK--RPNYNDTAADYDGHGT  204

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             HI S  AG  V  A+L+GIA GTARGGVPSARIA+YKVCW +GC DMD+LA FD AI+DG
Sbjct  205   HITSTIAGVAVSNANLFGIANGTARGGVPSARIATYKVCWEEGCSDMDMLAAFDEAISDG  264

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             VD+ISIS+GG    FF+DPIAIGS+HAMK+ I+TT +AGN GP   T+ N++PW+MTVAA
Sbjct  265   VDMISISIGGASLPFFEDPIAIGSFHAMKRGILTTCSAGNNGPGLYTVSNLAPWVMTVAA  324

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
              S+DR+FE+ VKL NG   +G S+N F    KMYPL SG LA +  A   G  SAC+  +
Sbjct  325   NSVDRKFETVVKLENGYTATGISVNGFNPKKKMYPLTSGFLASNVTAGDYGEPSACEPGT  384

Query  1221  ISEKLVRGKIVYCL--------SSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATIV  1373
             + E    GKIVYC         SS  QD+ I+ + G GVI     P D    T+IP + V
Sbjct  385   MGEDKAMGKIVYCEVGREEAGGSSEGQDHIIRSLKGAGVIVQLLEPTDMATSTLIPGSYV  444

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
               E G KI  YIN+TK P A IF++R  K  AP + SFSARGPQ IS NILKPD++APGL
Sbjct  445   LYEVGTKISDYINSTKNPQAVIFKTRTTKMLAPSIASFSARGPQRISPNILKPDISAPGL  504

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             +ILAAY+ LAT+T    DT    +++ SGTSMA PHAA AAAYVK+FHPDWSPAAIKSAL
Sbjct  505   NILAAYSKLATVTVYAKDTL---FSIMSGTSMACPHAAAAAAYVKSFHPDWSPAAIKSAL  561

Query  1734  MTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             MTTA  M+ K I A L+ G+G I P +A+ PGL++DI +S Y+S+LCKE +N+ S+G L 
Sbjct  562   MTTATPMRTKDIEAELSYGSGQINPRRAIHPGLVYDITESSYLSFLCKEGYNSTSIGLLL  621

Query  1911  GS-----KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFK  2075
             G      K+ +C +     G+DGLNYPSMH Q+ +   T  S  FYRTV  VG G + + 
Sbjct  622   GGSNETKKEYRCVDHKQGLGSDGLNYPSMHKQVGS-KGTNVSETFYRTVRSVGYGPSTYV  680

Query  2076  AKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT-HSVR  2252
             A++ AP G+ V V P ++SF +  +++ +KVV+ G  ++A+   +S S+ W D+  H VR
Sbjct  681   ARVWAPKGVGVEVEPRVMSFVKPGEEKHFKVVIVGVMEEAMRGILSASVEWDDSRGHLVR  740

Query  2253  SPILVYRS  2276
             SPIL++++
Sbjct  741   SPILLFQA  748



>ref|XP_004149226.1| PREDICTED: LOW QUALITY PROTEIN: xylem serine proteinase 1-like 
[Cucumis sativus]
Length=741

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/721 (53%), Positives = 510/721 (71%), Gaps = 15/721 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAV-DEHHNILTEALGDEELAREYRIHSYRRSFSGFVAR  314
             ++  R+ Y+VYMG LP   +   + D HH++L  A+GDEE+AR+ +IHSY RSF+GF AR
Sbjct  26    NNADRQAYVVYMGALPKLESHEVLSDHHHSLLANAVGDEEMARKAKIHSYGRSFNGFAAR  85

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTG  491
             L P EA +L+++ KVVSVFR+   KL TTRSWDFLG+S   + RN  AES++IVGLLD+G
Sbjct  86    LSPHEANKLAKEKKVVSVFRSKTRKLHTTRSWDFLGLSEAVSRRNAAAESNVIVGLLDSG  145

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFD  671
             +W+E PSFKDDGYG  P+KWKGKC  G NFT CNRKVIGA++F++        +SPAD  
Sbjct  146   IWMEGPSFKDDGYGEIPSKWKGKCVTGRNFTSCNRKVIGARFFDIGQIDNSIDKSPADEI  205

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHGSH AS  AG  V+GAS YG+A GTARGGVP ARIA YKVCW  GC D+D+LAGFD A
Sbjct  206   GHGSHTASTIAGASVDGASFYGVAGGTARGGVPGARIAMYKVCWVDGCSDVDLLAGFDHA  265

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             IADGVD+IS+S+GG    FF DPIAIGS+HAM+K I+T+ +AGN GP   T++N +PW+M
Sbjct  266   IADGVDIISVSIGGESTEFFNDPIAIGSFHAMEKGILTSCSAGNSGPELKTVENTAPWIM  325

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPG-NYSA  1205
             TVAA++IDR F + VKLGN + +SG S+NTF   K MYPLISG+ A   N + P  + S 
Sbjct  326   TVAASTIDRDFSTVVKLGNNKKLSGVSVNTFTPKKQMYPLISGSNAALPNQSDPYLDPSW  385

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIE  1382
             CD  ++ EK V+GKIVYCL S  Q+YTI  + G GVI++   + +T + T IP+T +   
Sbjct  386   CDSGTLDEKKVKGKIVYCLGSMDQEYTISELGGKGVISNLMNVSETAITTPIPSTHLSST  445

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             +   ++ YIN+TK P A I+++   K  AP++ SFS++GPQTI+LNILKPD+AAPG++IL
Sbjct  446   NSDYVEAYINSTKNPKAVIYKTTTRKVDAPYLASFSSKGPQTIALNILKPDIAAPGVNIL  505

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AAY+ LA++T    + R   +N+ SGTSM  P  A AAAY+K FHP WSPAA+KSALMTT
Sbjct  506   AAYSNLASIT----NNRHSLFNLLSGTSM-XPQPAAAAAYLKAFHPTWSPAALKSALMTT  560

Query  1743  AKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLC--KEFNN--ASLGSLT  1910
             A  +KI      + +G G I P KAV PGLI+D+ ++ Y+S+LC  K +++  ++L  LT
Sbjct  561   ATPLKIGDKLDVIGAGTGQINPIKAVHPGLIYDLTRTSYLSFLCTNKRYSDSGSALAILT  620

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             G     C ++P A G D +NYPSM++ + + NAT+ SA F+RTVT+VG G + + AK+K+
Sbjct  621   GDTSLNCSDVPRASGFDAINYPSMYVPV-DRNATSVSAVFHRTVTHVGFGPSTYIAKVKS  679

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P GL+V V P+ L F +  +K S+KVVV G         ++ SL W D+ H VRSPILV+
Sbjct  680   PAGLSVKVSPDTLKFDRAYKKLSFKVVVKGAAPAVGQAPLTASLEWDDSKHYVRSPILVF  739

Query  2271  R  2273
             +
Sbjct  740   K  740



>ref|XP_010543901.1| PREDICTED: xylem serine proteinase 1 [Tarenaya hassleriana]
Length=756

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/721 (54%), Positives = 501/721 (69%), Gaps = 11/721 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + +RKPYIVYMGE       ++++ HHN+L  A+GDE  ARE RIHSY +S +GF ARLL
Sbjct  31    NEERKPYIVYMGEPVPGANPNSLEHHHNLLLTAIGDERRAREVRIHSYGKSINGFAARLL  90

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM-STKANRNPKAESDLIVGLLDTGVW  497
             P EA +LS ++ VVSVF +T  KL TTRSWDFLGM  +K  R    ES++IVG+LDTG++
Sbjct  91    PHEAEKLSREEGVVSVFESTRRKLHTTRSWDFLGMKESKYQRRIPFESNIIVGVLDTGIY  150

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQE--SPADFD  671
             +ESPSFKD+G+GPPPA+WKGKC  G N T CN KVIGA+YF +E   P ++   S AD D
Sbjct  151   MESPSFKDEGFGPPPARWKGKCVTGPNLTHCNNKVIGAKYFRLEYPNPGEKNKFSAADED  210

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H  S  AG  V  AS YGIA GTARGGVPSARIA+YKVCW  GC DMD+LA FD A
Sbjct  211   GHGTHTTSTVAGISVSAASFYGIANGTARGGVPSARIAAYKVCWEDGCSDMDLLAAFDEA  270

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVD+IS+S+GG   ++FQDPIAIG++HAMKK I+T+ +AGN GP   T+ N +PW+M
Sbjct  271   IWDGVDIISVSIGGASSTYFQDPIAIGAFHAMKKGILTSCSAGNNGPDLFTVANSAPWIM  330

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSAC  1208
             TVAA+S+DR+F++ VKLGNG    G S+NTF    KMYPL SG LA + +    GN S C
Sbjct  331   TVAASSLDRKFQTLVKLGNGLSAPGISLNTFSPKKKMYPLTSGFLASNVSEDDYGNPSLC  390

Query  1209  DYLSISEKLVRGKIVYCLS-SASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATIVDIE  1382
             DY ++ E  V+G++VYC   S+ QD  IK + G GVI   + P D    T+I AT V   
Sbjct  391   DYGTMGEDKVKGRVVYCEEGSSGQDSNIKNLRGEGVIIQLEEPTDIASATLISATYVSYG  450

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             DG  I +YIN+TK P A I ++ +V+T AP + SFS+RGPQ IS +ILKPDL+APGL+IL
Sbjct  451   DGAAISRYINSTKNPRAVIHKTTSVRTVAPSIASFSSRGPQLISPDILKPDLSAPGLNIL  510

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AAY+  A++TG  DD R   Y++ SGTSMA PHA  AAAYVK+FHP+WSPAAIKSALMTT
Sbjct  511   AAYSKFASITGYPDDKRQTLYSILSGTSMACPHATAAAAYVKSFHPNWSPAAIKSALMTT  570

Query  1743  AKAMKIKPIGAYLASGAGLIRPTKAV-APGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             AK M++K      AS A    P   +    +++D + S Y+ YLCKE +N+  +  L G 
Sbjct  571   AKPMRVKGKDICNASKAETFSPEPILRGREVVYDNSMSSYIRYLCKEKYNDTMIRVLVGG  630

Query  1917  -KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
              K+ KCK+     G DGLNYPSMH QL  P     +A FYRTVT VG G +V+ A+++AP
Sbjct  631   RKEYKCKDFKHGLGTDGLNYPSMHKQL-RPTDKRVNAVFYRTVTNVGFGYSVYVARVRAP  689

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKD-NTHSVRSPILVY  2270
              G+ V V P IL F +  ++RS+KVV++G + K  +  +SGSL W D   H VRSPIL++
Sbjct  690   KGMKVEVRPRILRFVRPGERRSFKVVINGVWVKNWTGVVSGSLQWNDLRGHRVRSPILLF  749

Query  2271  R  2273
             +
Sbjct  750   K  750



>gb|KDP39759.1| hypothetical protein JCGZ_02779 [Jatropha curcas]
Length=627

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/624 (57%), Positives = 455/624 (73%), Gaps = 6/624 (1%)
 Frame = +3

Query  423   MSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKV  602
             M+    R PK ES++IVGLLD+G++ +SPSF D G+GP P +WKGKC  G NFT CN+KV
Sbjct  1     MTETIKRVPKLESNIIVGLLDSGIYADSPSFSDKGFGPIPRRWKGKCITGANFTRCNKKV  60

Query  603   IGAQYFNVEGFAPEDQE-SPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSAR  779
             IGA+Y+N+E     D++ SPAD DGHG+H +SI  G  V GA+LYGIA GTARGGVPSAR
Sbjct  61    IGAKYYNLENIGNGDEDLSPADDDGHGTHTSSILGGVAVRGANLYGIANGTARGGVPSAR  120

Query  780   IASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKI  959
             IA YKVCW  GC D D+LA FD AIADGVD+IS+S+GG PR+FF+D IAIGS+HAMKK I
Sbjct  121   IAMYKVCWAGGCTDTDLLAAFDDAIADGVDIISVSIGGGPRAFFEDTIAIGSFHAMKKGI  180

Query  960   VTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGKM  1139
             +T+ +AGN GP   T+ N +PW+MTVAA++IDR F++  KLGNG +  G SINTF   KM
Sbjct  181   LTSCSAGNGGPSLSTVDNAAPWIMTVAASTIDREFQTAFKLGNGMIAQGISINTFSPNKM  240

Query  1140  YPLISGTLAQDKNATYP-GNYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVI  1316
             YPLISGTLA++  A  P GN SACD+ ++S   V+GKIVYCL +A QDYTIK + G+GVI
Sbjct  241   YPLISGTLAKNLTAEEPYGNASACDFGTLSMTKVKGKIVYCLDNAGQDYTIKELEGIGVI  300

Query  1317  AS-DKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSA  1493
             ++     DT   T+IPAT VD  DG KID+YIN+TK P A I+++R  + +AP + SFS+
Sbjct  301   STLTSFKDTAFTTVIPATSVDPNDGLKIDQYINSTKNPQAIIYKTRTAEISAPALASFSS  360

Query  1494  RGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGA  1673
             RGPQ+I+LNILKPD AAPG+ ILAAY+ L+++TG   D R   +N+ SGTSM+ PHA+ A
Sbjct  361   RGPQSITLNILKPDFAAPGVDILAAYSKLSSVTGDPTDARHTPFNIISGTSMSCPHASAA  420

Query  1674  AAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKS  1853
             AAYVK+FHPDWSP+AIKSALMTTA  MKIK +   L +G+G + P KAV PGL++DI+ S
Sbjct  421   AAYVKSFHPDWSPSAIKSALMTTATPMKIKDVDTDLGAGSGQMNPVKAVHPGLVYDISVS  480

Query  1854  EYMSYLCKE-FNNASLGSLT-GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAA  2027
              Y+S+LCKE +N+ ++G L  G K   C +   A+G DGLNYPSMHLQL N N T+ SA 
Sbjct  481   SYLSFLCKEGYNSTTIGKLIGGEKKYNCSSFKPAKGTDGLNYPSMHLQLKN-NMTSISAV  539

Query  2028  FYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWY  2207
             FYRTVT VG  ++V+KA +KAP  L+V V P  L+F    +K+ +KV+V G         
Sbjct  540   FYRTVTNVGYATSVYKATVKAPKHLSVKVEPETLTFTSLKEKKDFKVIVKGGPMPNEMES  599

Query  2208  MSGSLVWKDNTHSVRSPILVYRSL  2279
              S  L W DN H V+SPI++ + +
Sbjct  600   CSALLEWSDNMHCVKSPIVICKRI  623



>ref|XP_008442818.1| PREDICTED: xylem serine proteinase 1-like [Cucumis melo]
Length=659

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/660 (54%), Positives = 472/660 (72%), Gaps = 18/660 (3%)
 Frame = +3

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANR-NPKAESDLIVGLLDTGVWV  500
              E  + +E+ KVVSVFR+   KL TTRSWDFLG+S  A+R N  AES++IVGLLD+G+W+
Sbjct  7     NENVQNAEEKKVVSVFRSKTRKLHTTRSWDFLGLSEAASRRNAAAESNVIVGLLDSGIWM  66

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             E PSFKDDGYG  P+KWKGKC  G NFT CNRKVIGA++F++E     + +SP D  GHG
Sbjct  67    EGPSFKDDGYGEIPSKWKGKCVTGHNFTSCNRKVIGARFFDIEEIDNSNNKSPVDEIGHG  126

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SH AS  AG  V+GASLYG+A G ARGGVP+ARIA YKVCW  GC D+D+LAGFD AIAD
Sbjct  127   SHTASTIAGAFVDGASLYGVAGGKARGGVPAARIAMYKVCWAVGCSDVDLLAGFDHAIAD  186

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+S+GG    FF DPIAIGS+HAM+K I+T+ +AGN GP   T++N +PW+MTVA
Sbjct  187   GVDIISVSIGGESMEFFNDPIAIGSFHAMEKGILTSCSAGNSGPDLKTVENTAPWIMTVA  246

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNAT-----YPGNYS  1202
             A++IDR F + VKLGN + +SG S+NTF   K MYPLISG+ A   N +     YP   S
Sbjct  247   ASTIDRDFSTVVKLGNNKKLSGVSVNTFTPKKQMYPLISGSNAALPNQSSDLDLYP---S  303

Query  1203  ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDI  1379
              CDY S+ EK V+GKIVYCL S  Q+YTI  + GVGVI++   + +  + T IP+T +  
Sbjct  304   WCDYGSLDEKKVKGKIVYCLGSIDQEYTISDLGGVGVISNLLNITEMAITTPIPSTHLSS  363

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
              +   ++ YIN+TK P A I+++   K  APF+  FS++GPQTI+LNILKPD+AAPG++I
Sbjct  364   TNSDYVEAYINSTKNPKAVIYKTTTRKVDAPFLAYFSSKGPQTIALNILKPDIAAPGVNI  423

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAAY+ LA+    + D R   +N+ SGTSMA PHAA AAAY+K FHP WSPAA+KSALMT
Sbjct  424   LAAYSNLAS----IPDNRHSLFNLLSGTSMACPHAAAAAAYLKAFHPTWSPAALKSALMT  479

Query  1740  TAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLC--KEFNNASLGSLTG  1913
             TA  +KI      + +GAG I PTKAV PGLI+D++++ Y+S+LC  K +++++L  LTG
Sbjct  480   TATPLKIGDELDVIGAGAGQINPTKAVHPGLIYDLSRTSYLSFLCTNKRYSDSALAILTG  539

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
                  C ++P A G+D +NYPSM++ + + +AT+ SA F+RTVT+VG G + +KAKIK+P
Sbjct  540   DASLNCSDVPQASGSDAINYPSMYVPV-DRDATSVSAVFHRTVTHVGFGPSTYKAKIKSP  598

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              GL+V V P  L F +  +K S+KVVV G         ++ SL W D+ H VRSPILV++
Sbjct  599   AGLSVKVSPETLKFDRAYKKLSFKVVVKGAAPAVGQAPLTASLEWDDSKHYVRSPILVFK  658



>ref|XP_006857987.1| hypothetical protein AMTR_s00069p00181550 [Amborella trichopoda]
 gb|ERN19454.1| hypothetical protein AMTR_s00069p00181550 [Amborella trichopoda]
Length=750

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/722 (52%), Positives = 483/722 (67%), Gaps = 20/722 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDP--TISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
              +K YIVYMG+LPD    T+SA    HN L +  G   +A +  + SY  SF+ FVA+L 
Sbjct  33    DKKNYIVYMGDLPDSNFNTMSASMMQHNALADVTGSLAVAEQSMVRSYSNSFNAFVAKLT  92

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P EA++LS K+ V+SVF +   +L TTRSWDF+G S  ANRN K+ES +IVG+LDTG+  
Sbjct  93    PDEAKKLSSKEGVLSVFPSGYRQLHTTRSWDFIGFSQSANRNLKSESQIIVGVLDTGITP  152

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA--PEDQESPADFDG  674
             +S SF D G+ PPP KWKG C    NF+ CN K+IGA+YF  +G A  P + ESP D  G
Sbjct  153   DSESFSDKGFSPPPTKWKGSCGPFANFS-CNNKLIGAKYFRAQGEALDPSEIESPIDVVG  211

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAA  851
             HG+H AS  AG  VEGA+LYG+AEGTARGGVPSARIA+YK+CW   GC DMD+LAGFDAA
Sbjct  212   HGTHTASTVAGNSVEGANLYGLAEGTARGGVPSARIAAYKICWNNAGCSDMDILAGFDAA  271

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVD+IS+SVGG   S+  D IAIGS+HAMKK I+T  +AGN+GP   T++N +PW+ 
Sbjct  272   IGDGVDIISLSVGGPSTSYLTDVIAIGSFHAMKKGILTACSAGNDGPMPETVENYAPWIF  331

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTF-ELGKMYPLISGTLAQDKNATYPGNYSA-  1205
             T+AA+SIDR+F S + LG+G+  SG ++NTF  +   YPLI+G+ A D +A+    +S  
Sbjct  332   TIAASSIDRQFRSKLMLGDGQEFSGLALNTFPSMKSFYPLITGSSATDPSASDNIQFSKN  391

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIE  1382
             C   S+  K ++GKIV+C SS+  D TIK + GVG I S D   D  L    P T V+  
Sbjct  392   CILGSLLPKKIKGKIVFCESSS--DATIKALAGVGTIVSADDSLDVALMFADPGTTVNHS  449

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
                 I KYIN+TKAP A++ +S  ++   APF+ SFS+RGP+ +S  ILKPD+AAPGL I
Sbjct  450   HSDLILKYINSTKAPKAQLLKSDTLRMDDAPFIASFSSRGPKPVSPRILKPDIAAPGLDI  509

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAAY+ LA +     D RV K+ + SGTSMA PHAAGAAAYVK+F P WSPAAIKSA+MT
Sbjct  510   LAAYSPLAPVDRDSPDGRVAKFIIFSGTSMACPHAAGAAAYVKSFRPTWSPAAIKSAIMT  569

Query  1740  TAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSL---  1907
             TA  M   K   A  A GAG I PTKA+ PGLI+D++K  Y+ +LC+E  + S+ S+   
Sbjct  570   TATPMNASKSHDAEFAYGAGQINPTKALNPGLIYDLDKMAYLQFLCQEGYDGSMLSIIAG  629

Query  1908  -TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI  2084
               G K   C  +   +G DGLNYPSM L L N N   FS  F R VT V +  +V+ A +
Sbjct  630   DNGEKLPPCSKMHKPKGGDGLNYPSMQLTLNNTNP--FSTVFRRRVTNVDSKGSVYTASV  687

Query  2085  KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
              AP GL + V PN L F ++ +K+S+KVVV G     I+  +S SLVW D  HSVRSPI+
Sbjct  688   HAPAGLAIVVKPNKLVFTKSLEKKSFKVVVRGNLPVNITM-LSASLVWSDTVHSVRSPIV  746

Query  2265  VY  2270
             V+
Sbjct  747   VH  748



>ref|XP_007015871.1| Cucumisin protein [Theobroma cacao]
 gb|EOY33490.1| Cucumisin protein [Theobroma cacao]
Length=739

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/714 (49%), Positives = 469/714 (66%), Gaps = 12/714 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D++RK YIVYMG+  +  ++ AV+ HH++L+E   DEE+AR+  IHSY +SF+GF A L 
Sbjct  27    DSERKAYIVYMGDALESKSL-AVEHHHSLLSEVTQDEEVARQSIIHSYGKSFNGFAAYLT  85

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P EA RL E + VVSVF N+  +L TTRSWDF+ M     RN + ESD+IVG+LD+G+++
Sbjct  86    PDEAARLQENENVVSVFPNSFRQLQTTRSWDFIDMPLSVKRNTQKESDIIVGMLDSGIYI  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             ++PSF D G+GPPP+KWKG CQ G+NFTGCN KVIGA+ +++        ES AD  GHG
Sbjct  146   DAPSFDDKGFGPPPSKWKGVCQTGVNFTGCNNKVIGARAYSM---GSRKNESAADDVGHG  202

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SH ASI AG  V+ AS YG+ +GTARGGVPSARIA YKVC   GC D+ +LA FD AI D
Sbjct  203   SHTASIVAGVPVQDASFYGLGQGTARGGVPSARIAVYKVCDDSGCSDVAILAAFDDAIDD  262

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+SVGG    +F DPIAIGS+HAMKK I+T+ +AGN+GP   ++ N +PW++TV 
Sbjct  263   GVDIISMSVGGPAPDYFADPIAIGSFHAMKKGILTSCSAGNDGPQLSSLTNGAPWILTVG  322

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             AT+ DR   + V +G      G S NTF L  KMYPL SG L   K    P N+  CD  
Sbjct  323   ATATDRVLRTPVHIGKNIKTLGVSFNTFNLEKKMYPLTSG-LRAIKKGEEPNNFDTCDST  381

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVI--ASDKLPDTVLPTMIPATIVDIEDGK  1391
             ++ E  V+GKI+YC     Q  TIK +   G I        D      +P   V  E G 
Sbjct  382   TLDENKVKGKILYC-DGTFQHSTIKKMGATGAILRCGSSFFDAGSTYSLPVACVVDEIGS  440

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             +I++Y+N+TK P   I R+  +  TAPFV +FS+RGP   S + LKPD+ APG++ILAAY
Sbjct  441   RIEQYLNSTKDPQGVILRTIPINATAPFVAAFSSRGPYYRSHSFLKPDIVAPGVAILAAY  500

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T L +++G   D R   +   SGTSM+ PHA+ AAAYVK+FHP+WS +AIKSALMTTA  
Sbjct  501   TKLKSVSGSSLDDRFNVFKFLSGTSMSCPHASAAAAYVKSFHPEWSTSAIKSALMTTASE  560

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
             +++       A GAG I P +AV PGL+++++K++Y+ +LC E ++   L  + G   N 
Sbjct  561   IRVHDENVEFAYGAGQIDPQRAVNPGLVYELSKNDYIRFLCNEGYSGTRLRMVIGEHSN-  619

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C +IP   G D LNYPSM L +     +T SA F RTVTYVG G++ ++A +KAPT L +
Sbjct  620   CSSIPKFGGQDDLNYPSM-LIMQKDLVSTVSAVFNRTVTYVGNGTSTYQAFVKAPTSLKI  678

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              V P+ L F + N+K+S+ V V+G   K  S  +S SL W D+ H VRSPILVY
Sbjct  679   KVSPDTLVFNEVNEKKSFTVEVNGPPLKHKSTLLSASLEWTDSVHRVRSPILVY  732



>gb|KGN59114.1| hypothetical protein Csa_3G775270 [Cucumis sativus]
Length=656

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/652 (54%), Positives = 464/652 (71%), Gaps = 13/652 (2%)
 Frame = +3

Query  342   SEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWVESPSFK  518
             +E+ KVVSVFR+   KL TTRSWDFLG+S   + RN  AES++IVGLLD+G+W+E PSFK
Sbjct  9     AEEKKVVSVFRSKTRKLHTTRSWDFLGLSEAVSRRNAAAESNVIVGLLDSGIWMEGPSFK  68

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIASI  698
             DDGYG  P+KWKGKC  G NFT CNRKVIGA++F++        +SPAD  GHGSH AS 
Sbjct  69    DDGYGEIPSKWKGKCVTGRNFTSCNRKVIGARFFDIGQIDNSIDKSPADEIGHGSHTAST  128

Query  699   AAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVIS  878
              AG  V+GAS YG+A GTARGGVP ARIA YKVCW  GC D+D+LAGFD AIADGVD+IS
Sbjct  129   IAGASVDGASFYGVAGGTARGGVPGARIAMYKVCWVDGCSDVDLLAGFDHAIADGVDIIS  188

Query  879   ISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDR  1058
             +S+GG    FF DPIAIGS+HAM+K I+T+ +AGN GP   T++N +PW+MTVAA++IDR
Sbjct  189   VSIGGESTEFFNDPIAIGSFHAMEKGILTSCSAGNSGPELKTVENTAPWIMTVAASTIDR  248

Query  1059  RFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPG-NYSACDYLSISEK  1232
              F + VKLGN + +SG S+NTF   K MYPLISG+ A   N + P  + S CD  ++ EK
Sbjct  249   DFSTVVKLGNNKKLSGVSVNTFTPKKQMYPLISGSNAALPNQSDPYLDPSWCDSGTLDEK  308

Query  1233  LVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKIDKYI  1409
              V+GKIVYCL S  Q+YTI  + G GVI++   + +T + T IP+T +   +   ++ YI
Sbjct  309   KVKGKIVYCLGSMDQEYTISELGGKGVISNLMNVSETAITTPIPSTHLSSTNSDYVEAYI  368

Query  1410  NTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATM  1589
             N+TK P A I+++   K  AP++ SFS++GPQTI+LNILKPD+AAPG++ILAAY+ LA++
Sbjct  369   NSTKNPKAVIYKTTTRKVDAPYLASFSSKGPQTIALNILKPDIAAPGVNILAAYSNLASI  428

Query  1590  TGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPI  1769
             T    + R   +N+ SGTSMA PH+A AAAY+K FHP WSPAA+KSALMTTA  +KI   
Sbjct  429   T----NNRHSLFNLLSGTSMAFPHSAAAAAYLKAFHPTWSPAALKSALMTTATPLKIGDK  484

Query  1770  GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLC--KEFNN--ASLGSLTGSKDNKCKN  1937
                + +G G I P KAV PGLI+D+ ++ Y+S+LC  K +++  ++L  LTG     C +
Sbjct  485   LDVIGAGTGQINPIKAVHPGLIYDLTRTSYLSFLCTNKRYSDSGSALAILTGDTSLNCSD  544

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
             +P A G D +NYPSM++ + + NAT+ SA F+RTVT+VG G + + AK+K+P GL+V V 
Sbjct  545   VPRASGFDAINYPSMYVPV-DRNATSVSAVFHRTVTHVGFGPSTYIAKVKSPAGLSVKVS  603

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             P+ L F +  +K S+KVVV G         ++ SL W D+ H VRSPILV++
Sbjct  604   PDTLKFDRAYKKLSFKVVVKGAAPAVGQAPLTASLEWDDSKHYVRSPILVFK  655



>ref|XP_010456380.1| PREDICTED: xylem serine proteinase 1-like, partial [Camelina 
sativa]
Length=638

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/610 (56%), Positives = 431/610 (71%), Gaps = 14/610 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + +RKPYIVYMGE  ++  + A   HHN+L   +GDE   RE +I+SY ++ +GFVARL 
Sbjct  29    NNERKPYIVYMGEATENSHVEAAQHHHNLLLTVIGDESKTREVKIYSYGKNINGFVARLY  88

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG-MSTKANRNPKAESDLIVGLLDTGVW  497
             P EA +LS  D VVSVF+NT+ +L TTRSWDFLG + +K  R+   ES++IVG+LDTG+ 
Sbjct  89    PHEAEKLSRVDGVVSVFKNTQRQLHTTRSWDFLGFVESKYKRSVAIESNIIVGVLDTGID  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV--EGFAPEDQESPADFD  671
             V+SPSF D G GPPPAKWKGKC  G NFT CN KVIGA+YF++  EG      +SPAD+D
Sbjct  149   VDSPSFDDKGVGPPPAKWKGKCVTGNNFTRCNNKVIGAKYFHLDQEGLPDGKGDSPADYD  208

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H +S  AG  V  ASL+GIA GTARGGVPSARIA+YKVCW  GC DMD+LA FD A
Sbjct  209   GHGTHTSSTIAGVSVSSASLFGIANGTARGGVPSARIATYKVCWESGCTDMDMLAAFDEA  268

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I+DGVDVISIS+GG    FFQDPIAIG++HAMK+ I+T  +AGN GP   T+ N++PW+M
Sbjct  269   ISDGVDVISISIGGASLPFFQDPIAIGAFHAMKRGILTMCSAGNNGPGLFTVSNLAPWVM  328

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSAC  1208
             TVAA S+DR+FE+ VKLGNG   SG S+N F   K MYPL SG+LA + +A   G  S C
Sbjct  329   TVAANSLDRKFETVVKLGNGLTASGISLNGFSPRKTMYPLTSGSLASNLSAGGYGEPSTC  388

Query  1209  DYLSISEKLVRGKIVYCLSSAS--------QDYTIKWIHGVGVIASDKLP-DTVLPTMIP  1361
             +  ++ E  V GK+VYC +           QD+ ++ + G GVI     P D    T+I 
Sbjct  389   ESGTLGEDKVMGKVVYCEAGREEGGSGGHGQDHVVRSLKGAGVIVQLLEPSDMATSTLIA  448

Query  1362  ATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLA  1541
              + V  EDG KI +YIN+TK P A IF+++  K  AP + SFSARGPQ IS NILKPD++
Sbjct  449   GSYVFFEDGTKISEYINSTKNPQAVIFKTKTTKMVAPSIASFSARGPQRISPNILKPDIS  508

Query  1542  APGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAI  1721
             APGL+ILAAY+ LA++TG  DD R   + + SGTSMA PHAA AAAYVK+FHPDWSPAAI
Sbjct  509   APGLNILAAYSKLASVTGYSDDNRKTLFTIMSGTSMACPHAAAAAAYVKSFHPDWSPAAI  568

Query  1722  KSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             KSALMTTA  M+IK   A L+ G+G I P +A+ PGL++DI +  Y+ +LCKE +N+ S+
Sbjct  569   KSALMTTATPMRIKGDEAELSYGSGQINPRRAIHPGLVYDITEDAYLRFLCKEGYNSTSI  628

Query  1899  GSLTGSKDNK  1928
             G L  +  N 
Sbjct  629   GLLIRNNKNN  638



>ref|XP_011093181.1| PREDICTED: xylem serine proteinase 1-like [Sesamum indicum]
Length=742

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/713 (49%), Positives = 475/713 (67%), Gaps = 15/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTI--SAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             YIV+   L DD     S +  H N+L      E  A E  ++SY R+F+ F A+L   EA
Sbjct  31    YIVF---LRDDVVSGRSTLQTHLNVLASLKASEYDASESLVYSYTRNFNAFAAKLSEAEA  87

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
             R+LS+ D+V+S F N   K  TT+SWDF+G++  A RN K ES++IVGLLDTG+  +S S
Sbjct  88    RKLSDMDEVLSAFPNRYHKPHTTKSWDFIGLTPNAKRNLKVESNIIVGLLDTGITPQSES  147

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHI  689
             FKDDG GPPPAKWKG C    NF+GCN K+IGA+YF ++G   P D  SP D DGHG+H 
Sbjct  148   FKDDGLGPPPAKWKGSCGPFANFSGCNNKLIGAKYFKLDGNPDPADILSPVDVDGHGTHT  207

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGV  866
             +S  AG +V  A+LYG+A+GTARG VPSAR+A YKVCW   GC DMD+LA FDAAI+DGV
Sbjct  208   SSTLAGSLVPNANLYGLAKGTARGAVPSARVAMYKVCWASSGCADMDILAAFDAAISDGV  267

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             DVISIS+GG   S+  D IA+GS+HAM+K I+T A+AGN+GP + ++ N +PWL+TVAA+
Sbjct  268   DVISISIGGLTGSYTSDSIAVGSFHAMRKGILTVASAGNDGPGYASVSNHAPWLLTVAAS  327

Query  1047  SIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
               DR+  S V+LGNG  +SG  ++ FE   KMYPL SG      + T P +   C   S+
Sbjct  328   GTDRQLRSKVELGNGATVSGIGVSMFEPKEKMYPLASGVDVAKNSDTKPESM-YCLENSM  386

Query  1224  SEKLVRGKIVYC-LSSASQDYTIKWIHGVGV-IASDKLPDTVLPTMIPATIVDIEDGKKI  1397
               + V+GK++YC L S   D  +K + G+G+ + S+   D     M PAT+V+   GKKI
Sbjct  387   DPRKVKGKLIYCILGSWGADSVVKGLGGIGIFLESEVFLDAAQIYMAPATMVNASTGKKI  446

Query  1398  DKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
             + Y+++TK+P+A I +S  +K  APFV SFS+RGP + S+N+LKPD+ APG++ILA+YT 
Sbjct  447   NDYMHSTKSPSAAIHKSEEIKVPAPFVASFSSRGPNSGSINLLKPDITAPGINILASYTP  506

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
             L ++TG   D +  K+   SGTSMA PH  GAAAYVK+FHP+WSPAAIKSALMTTAK M 
Sbjct  507   LKSLTGLKGDKQYSKFTFMSGTSMACPHVGGAAAYVKSFHPNWSPAAIKSALMTTAKQMS  566

Query  1758  IK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
              K    A  A G+G + PT+AV PGL++D++   Y+ +LC E ++  S+GSL G     C
Sbjct  567   SKVDKDAEFAYGSGQLNPTRAVNPGLVYDMDDISYIQFLCHEGYDGTSIGSLVGQGTVNC  626

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
               +  +   D +NYP+M L LT+ N    +  F R VT VG   +V+ A IKAP G+ ++
Sbjct  627   SKLLPSNSVDAINYPTMQLTLTS-NKEPTAGVFRRRVTNVGPDESVYNATIKAPAGVEIA  685

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             V P  LSF +  ++RS+KVVV  K + ++   +SGS+ WK   +SVRSPIL++
Sbjct  686   VKPATLSFSKAARRRSFKVVVKAKPKNSV-LILSGSITWKSTRYSVRSPILIF  737



>dbj|BAJ53130.1| JHL05D22.1 [Jatropha curcas]
Length=743

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/721 (48%), Positives = 476/721 (66%), Gaps = 11/721 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D +++ YIVY+ +   + ++SAV+ H NIL+     E  A+E  ++SY +SF+ F A+L
Sbjct  26    EDGKKEFYIVYLEDHIVN-SVSAVETHVNILSSVKKSEFEAKESIVYSYTKSFNAFAAKL  84

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA  LS  D+V+SVF N   +L TT+SWDF+G+ +KA RN K E +++VGLLDTG+ 
Sbjct  85    SKAEAAELSRLDQVLSVFPNKYHRLHTTKSWDFIGLPSKARRNLKMERNIVVGLLDTGIT  144

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              ES SF+ DG+GPPP KW G C    NFTGCN K+IGA+YF ++G   P D  SP D DG
Sbjct  145   PESESFRGDGFGPPPKKWNGTCGHFANFTGCNNKLIGARYFKLDGNPDPNDIFSPVDVDG  204

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAA  851
             HG+H +S  AG ++  ASL+G+A G ARG VP+AR+A YKVCW   GC DMD+LA F+AA
Sbjct  205   HGTHTSSTVAGNLIPDASLFGLARGAARGAVPAARVAMYKVCWASSGCSDMDILAAFEAA  264

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVDVIS+S+GG    +  D +AIG++HAM+K I+TTA+AGN+GP  GT+ N +PWL+
Sbjct  265   ITDGVDVISVSIGGATADYVSDSLAIGAFHAMRKGIITTASAGNDGPSSGTVANHAPWLL  324

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSAC  1208
             TVAA+ IDR+F S ++LGNG+ +SG  +N+FE   ++YPL+SG     +N+    N   C
Sbjct  325   TVAASGIDRQFRSKIELGNGKTVSGVGVNSFESKQQLYPLVSGADVA-RNSANKDNARFC  383

Query  1209  DYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIE  1382
                S+    V+GK+VYC L     D  +K I G+G V+ S +  D     M P T+V++ 
Sbjct  384   LDGSMEPSKVKGKLVYCELQVWGSDSVVKGIGGIGAVVESAQFLDAAQIFMTPGTMVNVT  443

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
              G  I+ YI++TK+P+A I+RS  VK  APFV SFS+RGP  +S ++LKPD+AAPG+ IL
Sbjct  444   VGDAINDYIHSTKSPSAVIYRSHEVKIPAPFVASFSSRGPNPLSEHLLKPDVAAPGIDIL  503

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             A+YT L ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHP+WS A IKSA++TT
Sbjct  504   ASYTPLRSLTGLKGDTQYSKFTLMSGTSMAGPHVAGVAAYVKSFHPNWSAATIKSAILTT  563

Query  1743  AKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             AK M  +    A  A GAG + PT+A  PGL++D+++  Y+ +LC E +  +SL  L G 
Sbjct  564   AKPMSPRANNDAEFAYGAGQVNPTRARNPGLVYDMDEMSYIQFLCHEGYRGSSLAVLIGK  623

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
             K   C ++    G D LNYP+M L   N    T    F RTVT VG   ++F A IKAP 
Sbjct  624   KSINCSSLLPGFGYDALNYPTMQLSARNDKQPTV-GVFRRTVTNVGPSPSIFNATIKAPK  682

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             G+ ++V P  LSF    Q RS+KVVV  K   +    +SGSLVWK   H VRSPI+V++ 
Sbjct  683   GVEITVEPMSLSFSHALQNRSFKVVVKAKPMSS-GQLVSGSLVWKSFHHVVRSPIVVFKP  741

Query  2277  L  2279
             L
Sbjct  742   L  742



>ref|XP_007051972.1| Xylem serine peptidase 1 isoform 1 [Theobroma cacao]
 gb|EOX96129.1| Xylem serine peptidase 1 isoform 1 [Theobroma cacao]
Length=771

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/718 (50%), Positives = 480/718 (67%), Gaps = 12/718 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D  +  YIVY+G  P     SAV +H  +L+   G E  A+E  I+SY ++F+ F A+L 
Sbjct  54    DETKNFYIVYLGASPLSKD-SAVQKHIALLSYVKGSEHDAKESMIYSYTKTFNAFAAKLS  112

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA  L E D+VVSVF N   KL TTRSWDF+G+   A R  K E +++VGLLDTG+  
Sbjct  113   KDEADMLQEMDEVVSVFPNRYHKLHTTRSWDFIGLPQTARRKLKMERNIVVGLLDTGITP  172

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             +S SFKDDG+GPPP+KWKG C    NF+GCN K++GA+YF ++G A P D  SP D DGH
Sbjct  173   QSESFKDDGFGPPPSKWKGTCGHFANFSGCNNKIVGAKYFKLDGTADPADILSPIDVDGH  232

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAI  854
             G+H +S  AG +V  ASLYG+A+GTARG VPSARIA YKVCW   GC DMD+LA FD A 
Sbjct  233   GTHTSSTLAGNLVPNASLYGLAKGTARGAVPSARIAIYKVCWASSGCADMDILAAFDDAA  292

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             +DGVDVIS+S+GG  + F  D I++G++HA+KK I+T A+AGNEGP  G++ N SPWL+T
Sbjct  293   SDGVDVISVSIGGATQDFVTDSISVGAFHALKKGIITVASAGNEGPSLGSLSNYSPWLLT  352

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+ IDR+F S VKLGNG  +SG  IN FE   K+YP++SG      + +  G     D
Sbjct  353   VAASGIDRQFTSTVKLGNGRRVSGIGINAFEPKEKIYPIVSGADVPVNSQSKEGARFCYD  412

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVI-ASDKLPDTVLPTMIPATIVDIED  1385
               ++    V+G++VYC L     D  ++ I G+G I AS++  D     M PAT+V+   
Sbjct  413   N-TLDPGKVKGRLVYCILGQWGADSVVRGIGGIGTIIASEQYLDIAQIFMAPATMVNGTV  471

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G+ IDKYI++T++P+A I++S+AVK +APFV SFS+RGP   S ++LKPD+AAPG+ ILA
Sbjct  472   GETIDKYIHSTRSPSAVIYKSQAVKISAPFVASFSSRGPNPGSQHLLKPDIAAPGVDILA  531

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             AYT L ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHP WS AAIKSA+MTTA
Sbjct  532   AYTLLKSLTGLKGDTQHSKFTIMSGTSMACPHVAGVAAYVKSFHPSWSAAAIKSAIMTTA  591

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             K M  +    A  A G G + PT+A+ PGL++D+++  Y+ +LC E F+ +S+  L G+K
Sbjct  592   KPMSRRVNSDAEFAYGVGQLNPTRALNPGLVYDMDEMSYIQFLCHEGFSGSSIALLVGAK  651

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
                C ++    G D LNYPSM L + N    T    F+R VT VG  S V+ A IKAP G
Sbjct  652   SFNCSSLLPGLGYDALNYPSMQLSMKNGRPQTI-GVFHRRVTNVGPPS-VYNATIKAPQG  709

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISW-YMSGSLVWKDNTHSVRSPILVY  2270
             + +++ P  L F +  QKRS+KVVV  K   + ++  +S SLVWK   H+VRSPI++Y
Sbjct  710   VEITIKPTCLFFTRPLQKRSFKVVVKAKPVASTTFTILSASLVWKSTRHTVRSPIVIY  767



>ref|XP_011019233.1| PREDICTED: xylem serine proteinase 1-like, partial [Populus euphratica]
Length=572

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/574 (58%), Positives = 421/574 (73%), Gaps = 7/574 (1%)
 Frame = +3

Query  576   NFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTA  755
             NF  C  KVIGA+Y+N+E F  E+  SPAD DGHG+H +S AAG  V+ ASLYGIA+GTA
Sbjct  1     NFLTCGSKVIGARYYNLENFEVEN-PSPADLDGHGTHTSSTAAGIAVKDASLYGIAQGTA  59

Query  756   RGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGS  935
             RGGVPSARIA YKVCWG GC DMD+LA FD AI+DGVD+IS+S+GG  RSFFQDPIAIGS
Sbjct  60    RGGVPSARIAMYKVCWGSGCSDMDLLAAFDDAISDGVDIISVSIGGASRSFFQDPIAIGS  119

Query  936   YHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSI  1115
             +H+MKK I+T+ +AGN GPY G+++NV+PW+MT+AATSIDR+F + VKLGNG   +G SI
Sbjct  120   FHSMKKGILTSCSAGNNGPYPGSVENVAPWIMTIAATSIDRQFTTAVKLGNGMKATGISI  179

Query  1116  NTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRGKIVYCLSSASQDYTIK  1292
             NTF   K  YPLI G  A + +  + GN SACDY ++S   V+GK+VYCL S  QDYTIK
Sbjct  180   NTFSPKKETYPLIDGARASNSSGDHYGNISACDYGTLSMDKVKGKLVYCLGSNGQDYTIK  239

Query  1293  WIHGVGVIASDKLP-DTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTA  1469
              +HG GVI S   P DT  PT+IP T V ++DG +ID YIN+T+ P A I+++R    +A
Sbjct  240   ELHGAGVITSLDAPTDTAYPTVIPGTSVQLKDGYRIDVYINSTRNPRAVIYKTRTTYMSA  299

Query  1470  PFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSM  1649
             P V SFS+RGPQ I+LNILKPD+AAPGL ILAAY+ LAT+TG  +D+R   +N+ SGTSM
Sbjct  300   PSVASFSSRGPQLINLNILKPDIAAPGLGILAAYSKLATVTGDPNDSRYSPFNIISGTSM  359

Query  1650  ATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAYLASGAGLIRPTKAVAPG  1829
             + PHAA AAAYVKTFHPDWSPAAIKSALMTTA  +KIK + A L SG+G I P KAV PG
Sbjct  360   SCPHAAAAAAYVKTFHPDWSPAAIKSALMTTATTIKIKDVDAELGSGSGQINPLKAVHPG  419

Query  1830  LIFDINKSEYMSYLCKEFNNASLGSLT--GSKDNKCKNIPAAQGADGLNYPSMHLQLTNP  2003
             L++DI  S Y+ +LCKE  N++  SL   G K  +C N   AQG DGLNYPSMH QL + 
Sbjct  420   LVYDIPMSSYIRFLCKEGYNSTTISLLIGGKKKYRCSNFQPAQGTDGLNYPSMHAQLKSA  479

Query  2004  NATTFSAAFYRTVTYVGTG-STVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSG  2180
               +  SA FYRT+T VG G ++V+KA + +P  L++ +VPN L F + +QK+S+KV V G
Sbjct  480   E-SNISAVFYRTLTNVGYGNNSVYKATVTSPKDLSIKIVPNSLKFKRPHQKQSFKVFVEG  538

Query  2181  KFQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
                +  +  +S  L W D+ H VRSPI++Y S Q
Sbjct  539   GSMQNGTRILSALLEWSDSKHIVRSPIIIYNSSQ  572



>ref|XP_011093183.1| PREDICTED: xylem serine proteinase 1-like [Sesamum indicum]
Length=742

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/715 (49%), Positives = 473/715 (66%), Gaps = 17/715 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTI--SAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             YIV+   L DD     S +  H N+L    G E  A E  ++SY ++F+ F A+L   EA
Sbjct  31    YIVF---LRDDVVSGRSTLQTHLNVLASLKGSEYDASESLVYSYTKNFNAFAAKLSEAEA  87

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
             R+LS+ D+V+S F N   K  TT+SW+F+G++  A RN K ES++IVGLLDTG+  +S S
Sbjct  88    RKLSDMDEVLSAFPNRYHKPHTTKSWEFIGLTPNAKRNLKVESNIIVGLLDTGITPQSES  147

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHI  689
             FKDDG GPPPAKWKG C    NF+GCN K+IGA+YF ++G   P D  SP D DGHG+H 
Sbjct  148   FKDDGLGPPPAKWKGSCGPFANFSGCNNKLIGAKYFKLDGNPDPADILSPVDVDGHGTHT  207

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGV  866
             +S  AG +V  A+LYG+A+GTARG VPSAR+A YKVCW   GC DMD+LA FDAAI+DGV
Sbjct  208   SSTLAGSLVPNANLYGLAKGTARGAVPSARVAMYKVCWASSGCADMDILAAFDAAISDGV  267

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             DVISIS+GG   S+  D IA+GS+HAM+K I+T A+AGN+GP  G++ N +PWL+TVAA+
Sbjct  268   DVISISIGGLTGSYTSDSIAVGSFHAMRKGILTVASAGNDGPGHGSVSNHAPWLLTVAAS  327

Query  1047  SIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLS  1220
               DR+  S V+LGNG  +SG  ++ FE   KMYPL SG  +A++ +      Y  C   S
Sbjct  328   GTDRQLRSKVELGNGATVSGIGVSMFEPKEKMYPLASGVDVAKNSDTKEESRY--CLENS  385

Query  1221  ISEKLVRGKIVYC-LSSASQDYTIKWIHGVGV-IASDKLPDTVLPTMIPATIVDIEDGKK  1394
             +    V+GK++YC L S   D  +K + G+G+ I S+   D     M PAT+V+   GKK
Sbjct  386   MDPGKVKGKLIYCKLGSWGADSVVKGLGGIGIFIESEVFLDAAQLYMAPATMVNASTGKK  445

Query  1395  IDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             I+ Y+++TK+P+A I +S  +K  APFV SFS+RGP + S N+LKPD+ APG++ILA+YT
Sbjct  446   INDYMHSTKSPSAAIHKSEEIKVPAPFVASFSSRGPNSGSKNLLKPDITAPGINILASYT  505

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              L ++TG   D +  K+   SGTSMA PH  GAAAYVK+F P+WSPAAIKSALMTTAK M
Sbjct  506   PLKSLTGLKGDKQYSKFTFMSGTSMACPHVGGAAAYVKSFRPNWSPAAIKSALMTTAKQM  565

Query  1755  KIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
               K    A  A G+G + PT+AV PGL++D++   Y+ +LC E ++ AS+GSL G     
Sbjct  566   SSKVDKDAEFAYGSGQLNPTRAVNPGLVYDMDDISYIQFLCHEGYDGASIGSLIGQGTVN  625

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C  +  + G D +NYP+M L L + N    +  F R VT VG   +V+ A IKAP G+ +
Sbjct  626   CSKLLPSNGVDAINYPTMQLALKS-NKEPTAGVFRRRVTNVGPDESVYNATIKAPAGVEI  684

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             +V P  LSF +  ++RS+KVVV  K    +   +SGS+ WK   + VRSPI++Y 
Sbjct  685   AVKPATLSFSKAARRRSFKVVVKAKPMNNV-LILSGSITWKSTRYGVRSPIVIYN  738



>ref|XP_011023458.1| PREDICTED: xylem serine proteinase 1-like [Populus euphratica]
Length=746

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/726 (48%), Positives = 478/726 (66%), Gaps = 19/726 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D Q++ +IVY+G+ P    +SAV  H ++L+     +  A+E  I+SY + F+ F A+L
Sbjct  29    EDEQKEFFIVYLGDEPVINNVSAVQTHIDVLSSIKRSDLEAKESIIYSYTKIFNAFAAKL  88

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EAR+L+  D+V+SVF N   KL TT+SWDF+G+   A RN K E +++VGLLDTG+ 
Sbjct  89    SKEEARKLALLDEVLSVFPNRYHKLHTTKSWDFIGLPITAKRNLKMERNIVVGLLDTGIT  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              +S SFKDDG+GPPP KW+G C    NF+GCN K++GA+YF ++G   P D  SP D DG
Sbjct  149   PQSESFKDDGFGPPPRKWRGTCGHYANFSGCNNKLVGARYFKLDGNPDPSDILSPVDVDG  208

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAA  851
             HG+H +S  AG +V  ASL+G+A GTARG VP AR+A YKVCW   GC DMD+LA F+AA
Sbjct  209   HGTHTSSTLAGNLVPDASLFGLARGTARGAVPDARVAMYKVCWVSSGCSDMDLLAAFEAA  268

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVDVISIS+GG    +  + IAIG++HAMK  I+T A+ GN+GP   ++ N +PWL+
Sbjct  269   IHDGVDVISISIGGMSADYASNAIAIGAFHAMKNGIITVASGGNDGPSSSSVANHAPWLL  328

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLA----QDKNATYPGN  1196
             TVAA+ IDR F S V+LGNG+++SG  +NTFE   K+YP++SG  A     D  A +   
Sbjct  329   TVAASGIDREFRSKVELGNGKIVSGIGVNTFEPKQKLYPIVSGADAGYSRSDDGARF---  385

Query  1197  YSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVI-ASDKLPDTVLPTMIPATI  1370
                C   S+  K V+GK+V C L     D  +K I G G+I  S++  D     M PAT+
Sbjct  386   ---CADGSLDPKKVKGKLVLCELEVWGADSVVKEIGGKGIILESEQYLDAARIFMAPATV  442

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             V+      ++ YI++TK+P+A I+R++ VK  APF+ SFS+RGP   S  ILKPD+AAPG
Sbjct  443   VNATVSDTVNNYIHSTKSPSAVIYRTQEVKVPAPFIASFSSRGPNPGSERILKPDVAAPG  502

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             + ILA+YT L ++TG   DT+  ++++ SGTSMA PH AG AAY+K+FHP+W+ AAIKSA
Sbjct  503   IDILASYTPLRSLTGLKGDTQHSRFSLMSGTSMACPHVAGVAAYIKSFHPNWTAAAIKSA  562

Query  1731  LMTTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGS  1904
             ++TTAK M  +    A  A GAG + P KA  PGL++D+++  Y+ +LC E +N +SL  
Sbjct  563   ILTTAKPMSSRVNNDAEFAHGAGQVNPEKARNPGLVYDMDEMSYIQFLCHEGYNRSSLAV  622

Query  1905  LTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI  2084
             L GSK   C ++    G D LNYP+M L +      T    F RTVT VG   +++ A I
Sbjct  623   LVGSKSVNCSSLLPGIGYDALNYPTMQLSVKKKQEPTV-GVFVRTVTNVGPSPSIYNATI  681

Query  2085  KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
             +AP G+ + V P  LSF +++QKRS+KVV+  K   + S  +SGSLVWK N H VRSPI+
Sbjct  682   RAPRGVDIVVKPMSLSFSRSSQKRSFKVVIKAKPMPS-SQMLSGSLVWKSNRHIVRSPIV  740

Query  2265  VYRSLQ  2282
             +++ L 
Sbjct  741   IFKPLD  746



>ref|XP_002511771.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF50440.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/719 (48%), Positives = 476/719 (66%), Gaps = 11/719 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              ++ YIV++G+ P +  IS V +H +IL+     ++ A +  ++SY +SF+ F A+L   
Sbjct  31    DKEIYIVFLGDQPVN-HISTVQKHIDILSSVKRSDDDAVDSIVYSYTKSFNAFAAKLSKA  89

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +LS  D+V+SVF N   KL TT+SWDF+G+   A R  K E D+IVGLLDTG+  +S
Sbjct  90    EATKLSSLDQVLSVFPNRYHKLHTTKSWDFIGLPNTARRKLKMERDIIVGLLDTGITPQS  149

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGS  683
              SFK DG+GPPP KWKG C +  NF+GCN K+IGA+YF ++G   P D  SP D DGHG+
Sbjct  150   ESFKGDGFGPPPKKWKGTCGRFANFSGCNNKLIGARYFKLDGNPDPNDILSPVDVDGHGT  209

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIAD  860
             H +S  AG  +  ASL+G+A+G ARG VP++R+A YKVCW   GC DMD+LA F+AAI D
Sbjct  210   HTSSTLAGNEIPDASLFGLAKGAARGAVPASRVAMYKVCWASSGCSDMDILAAFEAAIND  269

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVDVIS+S+GG    +  D  AIG++HAM+K I+T A+AGN+GP  GT+ N +PWL+TVA
Sbjct  270   GVDVISVSIGGATADYATDTFAIGAFHAMRKGIITVASAGNDGPMSGTVANHAPWLLTVA  329

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+ IDR+F + V LGNG+ +SG  +N FE   K+YPL+SG  A   +A+       C   
Sbjct  330   ASGIDRQFRNKVVLGNGKTVSGVGVNAFEPNQKLYPLVSGADAATNSAS-KSRARFCLDE  388

Query  1218  SISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGK  1391
             S+    V+GK+VYC L     D  +K I GVG +I S +  D     M P T+V++  G 
Sbjct  389   SMDSNKVKGKLVYCELQMWGSDSVVKGIGGVGAIIESAQYLDAAQIFMTPGTMVNVTVGD  448

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              I+ YI++TK+P+A I+RS  VK  APF+ SFS+RGP   S  +LKPD+AAPG+ ILA+Y
Sbjct  449   TINDYIHSTKSPSAVIYRSHEVKIPAPFIASFSSRGPNPGSKLLLKPDIAAPGIDILASY  508

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T L ++TG   DT+  K+ + SGTSMA PH AG AAY+K+FHP+WS AAIKSA++TTAK 
Sbjct  509   TPLHSLTGLKGDTQYSKFTLMSGTSMACPHVAGVAAYIKSFHPNWSAAAIKSAILTTAKP  568

Query  1752  MKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             M  +    A  A GAG + P++A +PGL++D+++  Y+ +LC E +  +SL  L GSK  
Sbjct  569   MSARVNSEAEFAYGAGQLNPSRARSPGLVYDMDEMSYIQFLCHEGYTGSSLAVLIGSKSI  628

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++    G D +NYP+MHL   N    T    F RTVT VG  ++ + A IKAP G+ 
Sbjct  629   NCSSLLPGLGYDAINYPTMHLSARNDKQPTI-GVFRRTVTNVGPSTSFYNATIKAPKGVE  687

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
             ++VVP  LSF +T QKRS+KVVV  K   +    +SGS+ WK + H VRSPI+VY+ L 
Sbjct  688   ITVVPASLSFSRTLQKRSFKVVVKAKPMSS-GQILSGSVAWKSSRHVVRSPIVVYKPLD  745



>gb|KDP28708.1| hypothetical protein JCGZ_14479 [Jatropha curcas]
Length=746

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/723 (48%), Positives = 476/723 (66%), Gaps = 14/723 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALG---DEELAREYRIHSYRRSFSGFVA  311
             D +++ YIVY+ +   + ++SAV+ H NIL+        E  A+E  ++SY +SF+ F A
Sbjct  27    DGKKEFYIVYLEDHIVN-SVSAVETHVNILSSVKKRQVHEFEAKESIVYSYTKSFNAFAA  85

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTG  491
             +L   EA  LS  D+V+SVF N   +L TT+SWDF+G+ +KA RN K E +++VGLLDTG
Sbjct  86    KLSKAEAAELSRLDQVLSVFPNKYHRLHTTKSWDFIGLPSKARRNLKMERNIVVGLLDTG  145

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADF  668
             +  ES SF+ DG+GPPP KW G C    NFTGCN K+IGA+YF ++G   P D  SP D 
Sbjct  146   ITPESESFRGDGFGPPPKKWNGTCGHFANFTGCNNKLIGARYFKLDGNPDPNDIFSPVDV  205

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFD  845
             DGHG+H +S  AG ++  ASL+G+A G ARG VP+AR+A YKVCW   GC DMD+LA F+
Sbjct  206   DGHGTHTSSTVAGNLIPDASLFGLARGAARGAVPAARVAMYKVCWASSGCSDMDILAAFE  265

Query  846   AAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
             AAI DGVDVIS+S+GG    +  D +AIG++HAM+K I+TTA+AGN+GP  GT+ N +PW
Sbjct  266   AAITDGVDVISVSIGGATADYVSDSLAIGAFHAMRKGIITTASAGNDGPSSGTVANHAPW  325

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYS  1202
             L+TVAA+ IDR+F S ++LGNG+ +SG  +N+FE   ++YPL+SG     +N+    N  
Sbjct  326   LLTVAASGIDRQFRSKIELGNGKTVSGVGVNSFESKQQLYPLVSGADVA-RNSANKDNAR  384

Query  1203  ACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVD  1376
              C   S+    V+GK+VYC L     D  +K I G+G V+ S +  D     M P T+V+
Sbjct  385   FCLDGSMEPSKVKGKLVYCELQVWGSDSVVKGIGGIGAVVESAQFLDAAQIFMTPGTMVN  444

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLS  1556
             +  G  I+ YI++TK+P+A I+RS  VK  APFV SFS+RGP  +S ++LKPD+AAPG+ 
Sbjct  445   VTVGDAINDYIHSTKSPSAVIYRSHEVKIPAPFVASFSSRGPNPLSEHLLKPDVAAPGID  504

Query  1557  ILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALM  1736
             ILA+YT L ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHP+WS A IKSA++
Sbjct  505   ILASYTPLRSLTGLKGDTQYSKFTLMSGTSMAGPHVAGVAAYVKSFHPNWSAATIKSAIL  564

Query  1737  TTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             TTAK M  +    A  A GAG + PT+A  PGL++D+++  Y+ +LC E +  +SL  L 
Sbjct  565   TTAKPMSPRANNDAEFAYGAGQVNPTRARNPGLVYDMDEMSYIQFLCHEGYRGSSLAVLI  624

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             G K   C ++    G D LNYP+M L   N    T    F RTVT VG   ++F A IKA
Sbjct  625   GKKSINCSSLLPGFGYDALNYPTMQLSARNDKQPTV-GVFRRTVTNVGPSPSIFNATIKA  683

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P G+ ++V P  LSF    Q RS+KVVV  K   +    +SGSLVWK   H VRSPI+V+
Sbjct  684   PKGVEITVEPMSLSFSHALQNRSFKVVVKAKPMSS-GQLVSGSLVWKSFHHVVRSPIVVF  742

Query  2271  RSL  2279
             + L
Sbjct  743   KPL  745



>ref|XP_010255582.1| PREDICTED: xylem serine proteinase 1 [Nelumbo nucifera]
Length=750

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/724 (50%), Positives = 468/724 (65%), Gaps = 21/724 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTIS---AVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVA  311
             D Q+  YIVYMG    D TI+   A   H +IL++  G    A E  +HSY +SF+ F A
Sbjct  31    DEQKNFYIVYMG----DRTITKEAAAQRHIDILSDVTGSVVSATESIVHSYTKSFNAFAA  86

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTG  491
             +L P EA  L+  + V+SVF N   K  TTRSWDF+G      R    ES++IVGL+DTG
Sbjct  87    KLSPSEATMLATMNGVISVFPNRYHKPQTTRSWDFIGFPQTVRRRSNMESNIIVGLIDTG  146

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADF  668
             +  ES SF D G+GPPP KWKG C    NF+GCN K+IGA+YF ++G   P D  SP D 
Sbjct  147   INPESESFSDKGFGPPPVKWKGTCGPYANFSGCNNKLIGARYFKLDGEHDPSDILSPVDV  206

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFD  845
              GHGSH +S AAG  VE ASLYG+A GTARG VPSARIA+YK CW   GC DMD+LA FD
Sbjct  207   QGHGSHTSSTAAGNPVESASLYGLARGTARGAVPSARIAAYKACWVSTGCSDMDLLAAFD  266

Query  846   AAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
             AAI DGVDVISISVG    ++  + IAIGS+HAMK  I+TTA+AGNEGP  G++ N +PW
Sbjct  267   AAITDGVDVISISVGEDNPNYVSNAIAIGSFHAMKHGIITTASAGNEGPSPGSLSNHAPW  326

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGT-LAQDKNATYPGNY  1199
             ++TVAA+ +DR F S V LGNG+   G  +N F   +  YPL+SG   A +         
Sbjct  327   ILTVAASGMDRSFRSTVVLGNGKKFYGIGVNFFSPKRRFYPLVSGADAAMNSTPEVAEGA  386

Query  1200  SACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIV  1373
               C   ++    V+GK+V+C L     D  +K + G+G ++ S    D     M P T+V
Sbjct  387   RFCMDDALDPAKVKGKLVHCELMVWGADSVVKRLGGIGTILESSNAVDVAQIFMAPGTMV  446

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
             D   G+ +  YIN+T++P+A IF ++ V  +APFV SFS+RGP   S  ILKPD+AAPG+
Sbjct  447   DPIIGQDVSNYINSTRSPSAVIFPTQQVNISAPFVASFSSRGPNPGSKRILKPDIAAPGI  506

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILAAYT L ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHP WSPAAIKSA+
Sbjct  507   DILAAYTPLNSLTGLRGDTQYSKFTLMSGTSMACPHVAGVAAYVKSFHPTWSPAAIKSAI  566

Query  1734  MTTAKAMKIKPI---GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             +TTA AM   P+    A  A GAGL+ P +AV+PGL++D++   Y+ +LC+E +   SLG
Sbjct  567   ITTATAM--SPVVNNDAEFAYGAGLLNPIQAVSPGLVYDMDYFSYLPFLCEEGYGGPSLG  624

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
              + GSK   C ++P A+G D LNYP+M L +      T    F R VT VG  + V+KA 
Sbjct  625   IIVGSKAINCSSLPPARGTDALNYPTMQLSMKKGRLETV-GVFLRRVTNVGPPAIVYKAT  683

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             + AP G+ ++V P ILSF +TNQKRS+KVVV  K  +A +  +SGSLVW+ + H+VRSPI
Sbjct  684   VHAPYGVRITVKPTILSFSRTNQKRSFKVVVRAKPMRAAAM-LSGSLVWRSSYHTVRSPI  742

Query  2262  LVYR  2273
             +VY 
Sbjct  743   VVYE  746



>ref|XP_006490974.1| PREDICTED: xylem serine proteinase 1-like isoform X1 [Citrus 
sinensis]
 gb|KDO85942.1| hypothetical protein CISIN_1g004503mg [Citrus sinensis]
Length=748

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/720 (49%), Positives = 474/720 (66%), Gaps = 12/720 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDE-ELAREYRIHSYRRSFSGFVAR  314
              + Q+  Y+ Y+G+ P D  + AV  H  IL    G     A+E  ++SY  SF+ F A+
Sbjct  30    EENQKNFYVAYLGDQPVDEDL-AVQTHIQILASVKGGSYHDAKESIVYSYTESFNAFAAK  88

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             L   EA++L   D+V+SVF N   +L TTRSWDF+G+   A RN K ESD++VGL+DTG+
Sbjct  89    LSNDEAQKLQRMDRVLSVFPNRYHQLHTTRSWDFIGLPQTARRNLKIESDIVVGLMDTGI  148

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFD  671
               ES SFKD G+GPPPAKWKGKC    NF+GCN K+IGA+YF ++G   P D  SP D D
Sbjct  149   TPESESFKDSGFGPPPAKWKGKCDHFANFSGCNNKLIGARYFKLDGNPDPWDILSPIDVD  208

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDA  848
             GHG+H +S  AG +V  ASLYG+A G ARG VP+AR+A+YKVCW   GC DMD+LA FDA
Sbjct  209   GHGTHTSSTLAGNVVANASLYGLAWGAARGAVPNARVAAYKVCWVSSGCSDMDILAAFDA  268

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI DGV+VISIS+GG    +  D I++G++HA+KK IVT A+AGN+GP +GT+ N +PWL
Sbjct  269   AIHDGVNVISISIGGATEDYASDTISVGAFHALKKGIVTVASAGNDGPKWGTVSNHAPWL  328

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             +TVAA+ IDR+F+S VK GNG  +SG  +NTF+   K YPL+SG     KN+    +   
Sbjct  329   VTVAASGIDRQFKSKVKTGNGRSVSGVGVNTFDPKEKFYPLVSGADVA-KNSESRDSARF  387

Query  1206  CDYLSISEKLVRGKIVYC-LSSASQD-YTIKWIHGVGVIASDKLPDTVLPTMIPATIVDI  1379
             C   S+  K V+GK+VYC L +   D           ++ S++  D     M P T+V++
Sbjct  388   CFDDSLDPKKVKGKLVYCKLGTWGADSVIKGIGGVGIIVGSEQFLDVAQIYMAPGTMVNV  447

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
              DG  I  YI++T++P+A I++S+ VK  APF+ SFS+RGP   S ++LKPD+AAPG+ I
Sbjct  448   TDGDNITDYIHSTRSPSAVIYKSQEVKVRAPFIASFSSRGPNPGSKHLLKPDIAAPGIDI  507

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA+YT + ++TG   DT+  K+ + SGTSMA PH AG  AYVK+FHP WSPAAIKSA+MT
Sbjct  508   LASYTLMKSLTGLKGDTQYSKFTLMSGTSMACPHIAGVVAYVKSFHPSWSPAAIKSAIMT  567

Query  1740  TAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TAK M  +    A  A GAG + P KAV+PGL++D++   Y+ +LC E +N +SL  L G
Sbjct  568   TAKPMSQRVNNEAEFAYGAGQVNPQKAVSPGLVYDMDDMSYIQFLCHEGYNGSSLAVLVG  627

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             SK   C ++    G D LNYP+M + L + N    +A F R VT VG   +++ A IKAP
Sbjct  628   SKSINCTSLIPGVGYDALNYPTMQVSLKS-NGELTTAIFRRRVTNVGPRLSIYNATIKAP  686

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              G+ ++V P  LSF +T+ KRS+ VVV  K   + +  +SGSL WK   H VRSPI++YR
Sbjct  687   KGVNITVKPMSLSFSRTSHKRSFSVVVKAKPMSS-TQVLSGSLEWKSPRHVVRSPIVIYR  745



>ref|XP_010692331.1| PREDICTED: xylem serine proteinase 1 [Beta vulgaris subsp. vulgaris]
Length=749

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/725 (48%), Positives = 473/725 (65%), Gaps = 10/725 (1%)
 Frame = +3

Query  123   ATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSG  302
             AT+   D Q+K YIVY+G  P D   SA   H ++L+   G +  ARE  +HSY RSF+ 
Sbjct  26    ATINKDDDQKKFYIVYLGNHPPDDEASANRLHIDVLSNLKGSKSDARESIVHSYHRSFNA  85

Query  303   FVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLL  482
             F A+L   EA+ LSE+D+V+ +F N   KL TTRSWDF+     A R  K ES++IVGL 
Sbjct  86    FAAKLSNDEAQTLSERDEVLWIFENKYHKLHTTRSWDFIRFPQSAKRRLKIESNIIVGLF  145

Query  483   DTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESP  659
             DTG+  +S SFKDDG GPPPAKWKG C    NF+GCN K+IGA+YF ++    P D  SP
Sbjct  146   DTGITPQSQSFKDDGLGPPPAKWKGNCAHFANFSGCNNKIIGARYFKLDKVPDPSDILSP  205

Query  660   ADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLA  836
              D +GHG+H +S  AG ++  ASL G+A GTARG VPSARIA+YKVCW   GC DMD+LA
Sbjct  206   IDVEGHGTHTSSTLAGTLISNASLAGLAAGTARGAVPSARIATYKVCWASSGCSDMDILA  265

Query  837   GFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNV  1016
              FD AI+DGVD+ISIS+GG    +  D I+IGS+HA++K I+T  +AGN+GP  GT+ N 
Sbjct  266   AFDHAISDGVDLISISIGGPSPGYVSDSISIGSFHALRKGILTVGSAGNDGPTLGTVSNH  325

Query  1017  SPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPG  1193
             +PW+++VAA+ IDR F S V LGNG  +SG  I+ F+   K Y ++SG     KN+    
Sbjct  326   APWMLSVAASGIDRGFRSRVSLGNGNSVSGVGIDLFDPERKSYTIVSGGDVA-KNSENKE  384

Query  1194  NYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPAT  1367
             +   C   S+S   V+GK+V C L +   D  +K   G+G ++AS +  D  +  M P T
Sbjct  385   HARYCLDGSMSPSKVKGKLVLCKLENWGVDSVVKANGGIGAIVASPRFLDVAMIFMAPGT  444

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             IV+   G+KI  YI  + +PTA I+RS+ V  TAPF+ SFS+RGP   S+ +LKPD+AAP
Sbjct  445   IVNYTVGEKIYDYIRKSSSPTATIYRSQEVNVTAPFIGSFSSRGPNPGSVRLLKPDIAAP  504

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILA+YT L ++TG   D +  K+ + SGTSM+ PH AG AAYVK+FHP+WSPAAI+S
Sbjct  505   GVDILASYTPLKSLTGLKGDNQHSKFTLMSGTSMSCPHVAGVAAYVKSFHPNWSPAAIRS  564

Query  1728  ALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             A+MTTA+ M  +    A  A GAG + P KA +PGL++D+++  Y+ +LCKE ++ ASL 
Sbjct  565   AIMTTARPMSSRVNKDAEFAYGAGQVNPLKAKSPGLVYDMDEMPYIQFLCKEGYSGASLS  624

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
              L G+K   C  +  A G D LNYP+M L L N   +T +  F R VT VG   +V+KA 
Sbjct  625   VLVGTKSINCSTLLPAFGHDSLNYPTMQLNLKNKQKSTMT-VFRRRVTNVGQAQSVYKAI  683

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             I++P G+ ++V P  LSF +  + RS+KVVV        +  +S SL+WK + H VRSPI
Sbjct  684   IRSPKGVNITVKPTSLSFSRALEMRSFKVVVKANPISG-AKILSASLIWKSSRHVVRSPI  742

Query  2262  LVYRS  2276
             ++Y S
Sbjct  743   VIYTS  747



>ref|XP_004308419.1| PREDICTED: xylem serine proteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/715 (49%), Positives = 476/715 (67%), Gaps = 10/715 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             ++K YIVY+G+ P +   SA   H N+L+   G    A E  ++SY +SF+ F A+L   
Sbjct  31    RKKFYIVYLGDHPVNHEHSAAQTHMNVLSSVTGSYSDAAESMVYSYTKSFNAFAAKLSSH  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +LS  D+V+SV  N   KL TTRSW+F+G+   A RN K+ESD++VGL DTG+  ES
Sbjct  91    EAEKLSRMDQVLSVTPNRYHKLHTTRSWNFIGLPLTARRNLKSESDIVVGLFDTGITPES  150

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGS  683
              SFKD+G+GPPPAKWKG C +  NF+GCN K+IGA+YF ++G   P D  SP D DGHG+
Sbjct  151   QSFKDEGFGPPPAKWKGTCGQFANFSGCNNKIIGARYFKLDGTPDPADILSPVDVDGHGT  210

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIAD  860
             H +S  AG +V  A+LYG+A+GTARG VPSAR++ YKVCW   GC DMD+LA ++AAI D
Sbjct  211   HTSSTLAGNLVPNANLYGLAKGTARGAVPSARVSMYKVCWASFGCSDMDILAAYEAAIHD  270

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVDVISIS+GG   S+  D IA+G++HAMKK I+T A+AGN+GP  G+I N +PWL+TVA
Sbjct  271   GVDVISISIGGGGPSYGSDSIAVGAFHAMKKGIITVASAGNDGPSLGSIVNHAPWLVTVA  330

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+ IDR+F + V LGNG+ I G  ++TF    K+YPL+SG      + T   N   C   
Sbjct  331   ASGIDRQFINKVHLGNGKDILGVGVSTFNPKKKLYPLVSGVDVAQSSETKE-NARFCLGG  389

Query  1218  SISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGK  1391
             S+  K V+GKIV+C   S   D  IK   GVG ++ +D+  D     M P T+V+   G+
Sbjct  390   SLDPKRVKGKIVFCQFGSWGTDSVIKGNGGVGTIVENDQFLDAAQIFMAPGTMVNSTVGE  449

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YI++ K+P+A IF+S+  +  AP+V SFS+RGP   S ++LKPD+AAPG++ILA+Y
Sbjct  450   SIDAYIHSAKSPSAVIFKSQEAQRRAPYVASFSSRGPNPGSEHLLKPDIAAPGINILASY  509

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T L T+TG   DT+  ++ + SGTSMA PH AG AAYVK+FHP+WS AAI+SA++TTA  
Sbjct  510   TLLKTLTGLDGDTQYSEFTLMSGTSMACPHVAGVAAYVKSFHPNWSQAAIRSAILTTATP  569

Query  1752  MKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             M  +    A  A G G + P KAV PGLI+D+++  Y+ +LC E ++ +SL  L GSK  
Sbjct  570   MSQRVNAEAEFAYGVGQVNPRKAVNPGLIYDMDEMSYIQFLCHEGYSGSSLAPLVGSKSI  629

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++    G D +NYP+M L L +    T  A F RTVT VG  S+ + A I+AP G+ 
Sbjct  630   NCSSLIPGLGYDAINYPTMQLSLKSSKQPTV-AVFRRTVTNVGPASSTYNATIRAPKGVE  688

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             ++V P  L+F    QKRS++V V      +++  +SGSL WK + ++VRSPI+VY
Sbjct  689   ITVKPMSLTFSHALQKRSFQVEVKANPMDSMTM-VSGSLGWKSSRYTVRSPIVVY  742



>ref|XP_006490975.1| PREDICTED: xylem serine proteinase 1-like isoform X2 [Citrus 
sinensis]
Length=728

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/713 (49%), Positives = 471/713 (66%), Gaps = 12/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDE-ELAREYRIHSYRRSFSGFVARLLPREAR  335
             Y+ Y+G+ P D  + AV  H  IL    G     A+E  ++SY  SF+ F A+L   EA+
Sbjct  17    YVAYLGDQPVDEDL-AVQTHIQILASVKGGSYHDAKESIVYSYTESFNAFAAKLSNDEAQ  75

Query  336   RLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSF  515
             +L   D+V+SVF N   +L TTRSWDF+G+   A RN K ESD++VGL+DTG+  ES SF
Sbjct  76    KLQRMDRVLSVFPNRYHQLHTTRSWDFIGLPQTARRNLKIESDIVVGLMDTGITPESESF  135

Query  516   KDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIA  692
             KD G+GPPPAKWKGKC    NF+GCN K+IGA+YF ++G   P D  SP D DGHG+H +
Sbjct  136   KDSGFGPPPAKWKGKCDHFANFSGCNNKLIGARYFKLDGNPDPWDILSPIDVDGHGTHTS  195

Query  693   SIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVD  869
             S  AG +V  ASLYG+A G ARG VP+AR+A+YKVCW   GC DMD+LA FDAAI DGV+
Sbjct  196   STLAGNVVANASLYGLAWGAARGAVPNARVAAYKVCWVSSGCSDMDILAAFDAAIHDGVN  255

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             VISIS+GG    +  D I++G++HA+KK IVT A+AGN+GP +GT+ N +PWL+TVAA+ 
Sbjct  256   VISISIGGATEDYASDTISVGAFHALKKGIVTVASAGNDGPKWGTVSNHAPWLVTVAASG  315

Query  1050  IDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSIS  1226
             IDR+F+S VK GNG  +SG  +NTF+   K YPL+SG     KN+    +   C   S+ 
Sbjct  316   IDRQFKSKVKTGNGRSVSGVGVNTFDPKEKFYPLVSGADVA-KNSESRDSARFCFDDSLD  374

Query  1227  EKLVRGKIVYC-LSSASQD-YTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK+VYC L +   D           ++ S++  D     M P T+V++ DG  I 
Sbjct  375   PKKVKGKLVYCKLGTWGADSVIKGIGGVGIIVGSEQFLDVAQIYMAPGTMVNVTDGDNIT  434

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              YI++T++P+A I++S+ VK  APF+ SFS+RGP   S ++LKPD+AAPG+ ILA+YT +
Sbjct  435   DYIHSTRSPSAVIYKSQEVKVRAPFIASFSSRGPNPGSKHLLKPDIAAPGIDILASYTLM  494

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG  AYVK+FHP WSPAAIKSA+MTTAK M  
Sbjct  495   KSLTGLKGDTQYSKFTLMSGTSMACPHIAGVVAYVKSFHPSWSPAAIKSAIMTTAKPMSQ  554

Query  1761  KPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A GAG + P KAV+PGL++D++   Y+ +LC E +N +SL  L GSK   C 
Sbjct  555   RVNNEAEFAYGAGQVNPQKAVSPGLVYDMDDMSYIQFLCHEGYNGSSLAVLVGSKSINCT  614

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             ++    G D LNYP+M + L + N    +A F R VT VG   +++ A IKAP G+ ++V
Sbjct  615   SLIPGVGYDALNYPTMQVSLKS-NGELTTAIFRRRVTNVGPRLSIYNATIKAPKGVNITV  673

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
              P  LSF +T+ KRS+ VVV  K   + +  +SGSL WK   H VRSPI++YR
Sbjct  674   KPMSLSFSRTSHKRSFSVVVKAKPMSS-TQVLSGSLEWKSPRHVVRSPIVIYR  725



>emb|CDP08911.1| unnamed protein product [Coffea canephora]
Length=754

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/719 (48%), Positives = 471/719 (66%), Gaps = 11/719 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGE--LPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVAR  314
             D ++  YIV+M +  + D    +    H ++L    G E  AR   +HSY +SF+ F A+
Sbjct  32    DVKKDFYIVFMTDHSILDKEETAVQQTHVDLLASLKGSEADARGSLVHSYTKSFNAFAAK  91

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             L   E  +LS  D V SV  N   KL TT+SW+F+G+   A RN + ES++IVG+LDTG+
Sbjct  92    LSEDEVGKLSSLDGVGSVIPNRYHKLHTTKSWEFIGLPPTAKRNLQVESNIIVGVLDTGI  151

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFD  671
               +S SFKD G GPPPAKWKG C    NF+GCN K+IGA+YF ++ F  P+D  SP D D
Sbjct  152   TPQSQSFKDHGLGPPPAKWKGTCNHFANFSGCNNKLIGARYFKLDDFPDPDDILSPVDVD  211

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDA  848
             GHG+H +S  AG +V  A++YG+A+GTARG VPSAR+A YKVCW   GC DMD+LA FDA
Sbjct  212   GHGTHTSSTLAGSLVPNANVYGLAKGTARGAVPSARVAMYKVCWASTGCSDMDILAAFDA  271

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AIADGVD+ISIS+GG   ++  D I++GS++AM+K I+T A+AGNEGP   ++ N +PW+
Sbjct  272   AIADGVDIISISIGGLSGNYTTDSISMGSFYAMRKGILTVASAGNEGPNIASVTNHAPWV  331

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
              TVAA+ IDR F S + LGNG+ +SG  +NTFE   K YPL +G +   K++      S 
Sbjct  332   FTVAASGIDRGFRSKIALGNGQTVSGIGVNTFEPTQKSYPLTNG-MDVAKDSKRRNLSSL  390

Query  1206  CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDI  1379
             C   S+  K V+GKIVYC L+    D  +K + G+G ++ SD   DT    M PAT+V+ 
Sbjct  391   CIEESMDPKKVKGKIVYCKLAVWGVDSVVKALGGIGTIVESDLFLDTAQIFMAPATMVNS  450

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
               GK I  YI++T++P+A I+RS+ +K  APF  SFS+RGP   S  +LKPD++APG+ I
Sbjct  451   SKGKSITDYIHSTRSPSAVIYRSQELKIQAPFAASFSSRGPNPGSQRLLKPDISAPGIDI  510

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA+YT L ++TG   DT+   +   SGTSM+ PH +GAAAYVK+FHP+WSPAAIKSA+MT
Sbjct  511   LASYTRLRSLTGLKGDTQYSDFTFMSGTSMSCPHVSGAAAYVKSFHPNWSPAAIKSAIMT  570

Query  1740  TAKAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TA  M  K    A  A GAG + P KA++PGL++D++   Y+ +LC E +N++SL +L G
Sbjct  571   TATPMSSKTDRDAEFAHGAGQVNPVKALSPGLVYDMDDFSYIQFLCHEGYNDSSLANLAG  630

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
              +   C  +  A G D +NYP+M L L + N    +  F R VT VG   +V+ A IKAP
Sbjct  631   QQQINCSKLLPATGEDAINYPTMQLSLKS-NQEPTTGIFRRVVTNVGPSQSVYNATIKAP  689

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              G+ ++V P  LSF + +QKRS+KVVV      +    +SGSL W+   H+VRSPI+++
Sbjct  690   KGVVITVKPTSLSFSRVSQKRSFKVVVKANPMSSKVLMVSGSLTWRSPGHTVRSPIVIF  748



>ref|XP_011002076.1| PREDICTED: xylem serine proteinase 1-like [Populus euphratica]
Length=746

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/726 (47%), Positives = 477/726 (66%), Gaps = 19/726 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D Q++ +IVY+G+ P    +SAV  H ++L+     +  A+E  I+SY + F+ F A+L
Sbjct  29    EDEQKEFFIVYLGDEPVINNVSAVQTHIDVLSSIKRSDLEAKESIIYSYTKIFNAFAAKL  88

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EAR+L+  D+V+SVF N   KL TT+SWDF+G+   A RN K E +++VGLLDTG+ 
Sbjct  89    SKEEARKLALLDEVLSVFPNRYHKLHTTKSWDFIGLPITAKRNLKMERNIVVGLLDTGIT  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              +S SFKDDG+GPPP KW+G C    NF+GCN K++GA+YF ++G   P D  SP D DG
Sbjct  149   PQSESFKDDGFGPPPRKWRGTCGHYANFSGCNNKLVGARYFKLDGNPDPSDILSPVDVDG  208

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAA  851
             HG+H +S  AG +V  AS +G+A GTARG VP AR+A YKVCW   GC DMD+LA F+AA
Sbjct  209   HGTHTSSTLAGNLVPDASPFGLARGTARGAVPDARVAMYKVCWVSSGCSDMDLLAAFEAA  268

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVDVISIS+GG    +  + IAIG++HAMK  I+T A+ GN+GP   ++ N +PWL+
Sbjct  269   IHDGVDVISISIGGMSADYASNAIAIGAFHAMKNGIITVASGGNDGPSSSSVANHAPWLL  328

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLA----QDKNATYPGN  1196
             TVAA+ IDR F S V+LGNG+++SG  +NTFE   K+YP++SG  A     D  A +   
Sbjct  329   TVAASGIDREFRSKVELGNGKIVSGIGVNTFEPKQKLYPIVSGADAGYSRSDDGARF---  385

Query  1197  YSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATI  1370
                C   S+  K V+GK+V C L     D  +K I G G ++ S++  D     M PAT+
Sbjct  386   ---CADGSLDPKKVKGKLVLCELEVWGADSVVKEIGGKGTILESEQYLDAARIFMAPATV  442

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             V+      ++ YI++TK+P+A I+R++ VK  APF+ SFS+RGP   S  ILKPD+AAPG
Sbjct  443   VNATVSDTVNNYIHSTKSPSAVIYRTQEVKVPAPFIASFSSRGPNPGSERILKPDVAAPG  502

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             + ILA+YT L ++TG   DT+  ++++ SGTSMA PH AG AAY+K+FHP+W+ AAIKSA
Sbjct  503   IDILASYTPLRSLTGLKGDTQHSRFSLMSGTSMACPHVAGVAAYIKSFHPNWTAAAIKSA  562

Query  1731  LMTTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGS  1904
             ++TTAK M  +    A  A GAG + P KA  PGL++D+++  Y+ +LC E +N +SL  
Sbjct  563   ILTTAKPMSSRVNNDAEFAHGAGQVNPEKARNPGLVYDMDEMSYIQFLCHEGYNRSSLAV  622

Query  1905  LTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI  2084
             L GSK   C ++    G D LNYP+M L +      T    F RTVT VG   +++ A I
Sbjct  623   LVGSKSVNCSSLLPGIGYDALNYPTMQLSVKKKQEPTV-GVFVRTVTNVGPSPSIYNATI  681

Query  2085  KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
             +AP G+ + V P  LSF +++QKRS+KVV+  K   + S  +SGSLVWK N H VRSPI+
Sbjct  682   RAPRGVDIVVKPMSLSFSRSSQKRSFKVVIKAKPMPS-SQMLSGSLVWKSNRHIVRSPIV  740

Query  2265  VYRSLQ  2282
             +++ L 
Sbjct  741   IFKPLD  746



>ref|XP_004492669.1| PREDICTED: xylem serine proteinase 1-like [Cicer arietinum]
Length=742

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/715 (48%), Positives = 474/715 (66%), Gaps = 11/715 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             Q+  YIV++G  P    I A++ H N+L+   G    A+E  ++SY +SF+ F A+L   
Sbjct  32    QKNFYIVFLGAHPISRDI-AIEAHLNVLSSVKGSYHEAKESIVYSYTKSFNAFAAKLSED  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             E  +LS  D+V+ VF+N   KL TTRSW+F+G+   A R  K E D++V LLDTG+  ES
Sbjct  91    ETNKLSAMDEVLLVFKNQYRKLHTTRSWNFIGLPLTAKRRLKLERDIVVALLDTGITPES  150

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGS  683
              SFKDDG GPPP +WKG C    NF+GCN K+IGA+YF  +G   P D  SP D DGHG+
Sbjct  151   KSFKDDGLGPPPKRWKGTCGHYANFSGCNNKIIGAKYFKADGNPDPTDILSPIDVDGHGT  210

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIAD  860
             H AS AAG +V  ASL+G+A GTARG VPSAR+A YKVCW   GC DMD+LA FDAAI D
Sbjct  211   HTASTAAGDLVTNASLFGLANGTARGAVPSARLAIYKVCWSLNGCADMDILAAFDAAIHD  270

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVDVISIS+GG    +  DPI+IG++HAM+K I+T A+AGN+GP   ++ N +PW++TVA
Sbjct  271   GVDVISISIGGGNPDYAHDPISIGAFHAMRKGIITVASAGNDGPTMASVTNTAPWIVTVA  330

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+ IDR F+S V+LGNG+ +SG  IN F   +  YP+I+G  A  K++    +   C+  
Sbjct  331   ASGIDRAFKSTVQLGNGKNVSGVGINCFNPKQNQYPVINGIDAA-KDSKSKEDAKLCNPG  389

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKK  1394
             S+    V+GK+VYCL S   +  +K I G+G VI  D  PD    +M PATIV+   G+ 
Sbjct  390   SLLPNKVKGKLVYCLGSWGTEANVKEIGGIGSVIEYDDYPDVAQISMAPATIVNHSIGET  449

Query  1395  IDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
             +  YI +T++P+A I++SR  K  APF  SFS+RGP   S N+LKPD+AAPG+ ILA+YT
Sbjct  450   VTNYIQSTRSPSAVIYKSREEKIPAPFAASFSSRGPNPASKNVLKPDIAAPGIDILASYT  509

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
                ++TG   DT+  ++++ SGTSMA PH AG AAYVK+FHP+W+PAAI+SA++TTAK M
Sbjct  510   LRKSLTGLKGDTQFAEFSLISGTSMACPHVAGVAAYVKSFHPNWTPAAIRSAIITTAKPM  569

Query  1755  KIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
               +    A  A G+G + PT+AV+PGL++D+    Y+ +LC E +N + L +L GS  N 
Sbjct  570   SRRINNEAEFAFGSGQLNPTRAVSPGLVYDMEDFGYIQFLCHEGYNGSKLSALVGSPIN-  628

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C ++    G D +NYP+M L L +   T     F RTVT VG    ++ A +++P G+ +
Sbjct  629   CSSLLPGLGHDAINYPTMQLSLESKKDTR-EVVFRRTVTNVGPIPAIYNATVRSPKGVEI  687

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             +V P+ LSF +T QKRS++VVV      ++   +SGSL+W+   + VRSPI++Y+
Sbjct  688   TVKPSYLSFDKTKQKRSFEVVVKVNSIASME-ILSGSLIWRSPRYIVRSPIVIYK  741



>ref|XP_002272598.1| PREDICTED: xylem serine proteinase 1 [Vitis vinifera]
 emb|CBI38829.3| unnamed protein product [Vitis vinifera]
Length=736

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/718 (48%), Positives = 476/718 (66%), Gaps = 15/718 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISA-VDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             + ++K YIVY G+ P+  +I A V  H +IL++   D E   E  ++SY +SF+   A+L
Sbjct  26    NAEKKFYIVYFGDRPE--SIEATVQTHQDILSQCGVDTE---ESIVYSYTKSFNALAAKL  80

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA++LSE + VVSVF N   KL TT+SWDF+G+   A R  K ES++IVGLLDTG+ 
Sbjct  81    SEDEAQKLSEMEGVVSVFPNRYHKLHTTKSWDFIGLPQTARRQLKQESNIIVGLLDTGIT  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              +S SF D+G GPPPAKWKG C +  NF+GCN K+IGA+YF ++G + P+D  SP D +G
Sbjct  141   PQSESFADNGLGPPPAKWKGTCLRFANFSGCNHKLIGAKYFKLDGNSDPDDILSPVDVEG  200

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAA  851
             HG+H AS +AG +V+ A+L+G+A+GTARG VPSAR+A YKVCW + GC DMD+LA F+AA
Sbjct  201   HGTHTASTSAGNIVQNANLFGLAKGTARGAVPSARVAMYKVCWVRSGCSDMDILAAFEAA  260

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             IADGVD+ISIS+GG   ++ +D IAIG++HAMKK I+T A+AGN+GP   +I N +PW+ 
Sbjct  261   IADGVDIISISIGGVSPNYAEDSIAIGAFHAMKKGILTVASAGNDGPSQSSIVNHAPWIF  320

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSACD  1211
             TV A+SIDR F S V LGNG+  SG  ++TF+  +  PL+SG     K A    N   C 
Sbjct  321   TVGASSIDRGFRSKVVLGNGQTFSGIGVSTFDPKQQNPLVSGADVA-KTAADKENSRFCI  379

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               S+    V GK+VYC L     D  +K + G+G ++ S +  D     M P T+V+   
Sbjct  380   ENSLDPTKVNGKLVYCKLQMWGSDSVVKGLGGIGTIVESMEFLDAAQIFMAPGTMVNDTV  439

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G  I++YI++TK P+A I RS  VK  APFV SFS+RGP  ++ +ILKPD+ APG+ ILA
Sbjct  440   GYAINRYIHSTKTPSAVIQRSEEVKVPAPFVASFSSRGPNPMTQHILKPDIVAPGIDILA  499

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +YT L ++TG   DT+  K+ + SGTSMA PH +G AAYVK+FHP WSPAAI+SA+MTTA
Sbjct  500   SYTPLRSLTGLKGDTQFSKFTLLSGTSMACPHVSGVAAYVKSFHPKWSPAAIRSAIMTTA  559

Query  1746  KAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             K M  K    A  A G G + P +A++PGLI+D ++  Y+ +LC E ++  ++ ++ GSK
Sbjct  560   KPMSRKVNNDAEFAYGTGQVNPHRALSPGLIYDTDEMSYIQFLCHEGYSGKAIATIVGSK  619

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
                C ++   QG+D LNYP+M L L + N  T    F R VT VG   +V+ A IKAP G
Sbjct  620   SINCSSLLPGQGSDALNYPTMQLSLKDTNEPTV-GVFRRRVTNVGPAQSVYNATIKAPQG  678

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             + ++V P  L F +  Q RS+KVVV  K   A    +SGSL W+   H VRSPI++Y+
Sbjct  679   VEITVTPTRLVFSRALQARSFKVVVKAK-STAFKEMVSGSLTWRSPRHIVRSPIVIYK  735



>gb|EYU35056.1| hypothetical protein MIMGU_mgv1a002051mg [Erythranthe guttata]
Length=721

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/712 (48%), Positives = 471/712 (66%), Gaps = 11/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV++ + P +  ++  + H N+L+   G E  A +  ++SY +SF+ F A+L   EA +
Sbjct  10    YIVFLKDQPANHRLTH-ETHLNLLSSLKGSENDATKSLVYSYTKSFNAFAAKLSQDEATK  68

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  ++VVS+F N   KL TT+SW+F+G+   + RN + ES++IVGLLDTG+  ES SFK
Sbjct  69    LSNMEEVVSIFPNRYHKLDTTKSWEFIGLKPTSKRNLEIESNIIVGLLDTGITPESESFK  128

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             D+G+GPPPAKWKG C    NF+GCN K+IGA+YF ++    P D  SP D DGHG+H +S
Sbjct  129   DEGFGPPPAKWKGTCAHFANFSGCNNKLIGAKYFKLDKQPDPNDILSPIDVDGHGTHTSS  188

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  A+LYG+AEGTARG VPSAR+A YKVCW   GC DMD+LA FDAAI+DGVDV
Sbjct  189   TLAGALVPNANLYGLAEGTARGAVPSARVAMYKVCWATTGCADMDILAAFDAAISDGVDV  248

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   S+  D IA+G++HAM+K I+T A+AGN+GP  G++ N +PW++TVAA  I
Sbjct  249   ISISIGGLSGSYTSDSIAVGAFHAMRKGILTVASAGNDGPGHGSVANHAPWILTVAANGI  308

Query  1053  DRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISE  1229
             DR+  S V LGNG ++SG  ++ F+  + +YPL +G +   KN+    +   C   S+  
Sbjct  309   DRQLRSKVVLGNGAIVSGIGVSLFDPKQNLYPLANG-IDVAKNSDSKDSSRYCLENSMDP  367

Query  1230  KLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
             K V+GK+VYC L S   D  IK + GVG +I SD   D     M P T+++   GKKI  
Sbjct  368   KKVKGKLVYCKLGSWGTDSVIKGLGGVGTLIESDSFLDAAQIFMTPGTMINSTTGKKISD  427

Query  1404  YINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             YI++TK P+A I +S  +K  AP V SFS+RGP   S ++LKPD+ APG+ ILA+YT L 
Sbjct  428   YIHSTKTPSAVIHKSEEIKIAAPLVASFSSRGPNPGSHHLLKPDITAPGIDILASYTPLK  487

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK  1763
             ++TG   DT+  K+   SGTSMA PH  GAAAYVK+F P+WSPAAIKSALMTTA  M  K
Sbjct  488   SLTGLKGDTQYSKFTFMSGTSMACPHVGGAAAYVKSFRPNWSPAAIKSALMTTATPMSSK  547

Query  1764  -PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
                 A  A G+G + PTKA+ PGLI+D++   Y+ +LC E +N + +GSL       C N
Sbjct  548   VEKDAEFAYGSGQVNPTKAINPGLIYDMDDMSYIQFLCHEGYNGSLIGSLINQSPINCSN  607

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
             +  + G D +NYP+M L L +    T    F R VT VG   +VF A IKAP G+ +SV 
Sbjct  608   LLPSNGEDAINYPTMQLALKSDQEPTV-GVFRRRVTNVGPAESVFNATIKAPVGVEISVK  666

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             P  L F + N++RS++VVV  K  K+ +  +SGSL+W+ + +SVRSPI +Y 
Sbjct  667   PMSLFFSKGNRRRSFRVVVKAKPMKS-AVILSGSLIWRSSKYSVRSPIAIYN  717



>gb|AIC80768.1| subtilase [Cicer arietinum]
Length=717

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/711 (48%), Positives = 472/711 (66%), Gaps = 11/711 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV++G  P    I A++ H N+L+   G    A+E  ++SY +SF+ F A+L   E  +
Sbjct  11    YIVFLGAHPISRDI-AIEAHLNVLSSVKGSYHEAKESIVYSYTKSFNAFAAKLSEDETNK  69

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  D+V+ VF+N   KL TTRSW+F+G+   A R  K E D++V LLDTG+  ES SFK
Sbjct  70    LSAMDEVLLVFKNQYRKLHTTRSWNFIGLPLTAKRRLKLERDIVVALLDTGITPESKSFK  129

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             DDG GPPP +WKG C    NF+GCN K+IGA+YF  +G   P D  SP D DGHG+H AS
Sbjct  130   DDGLGPPPKRWKGTCGHYANFSGCNNKIIGAKYFKADGNPDPTDILSPIDVDGHGTHTAS  189

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIADGVDV  872
              AAG +V  ASL+G+A GTARG VPSAR+A YKVCW   GC DMD+LA FDAAI DGVDV
Sbjct  190   TAAGDLVTNASLFGLANGTARGAVPSARLAIYKVCWSLNGCADMDILAAFDAAIHDGVDV  249

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  DPI+IG++HAM+K I+T A+AGN+GP   ++ N +PW++TVAA+ I
Sbjct  250   ISISIGGGNPDYAHDPISIGAFHAMRKGIITVASAGNDGPTMASVTNTAPWIVTVAASGI  309

Query  1053  DRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISE  1229
             DR F+S V+LGNG+ +SG  IN F   +  YP+I+G  A  K++    +   C+  S+  
Sbjct  310   DRAFKSTVQLGNGKNVSGVGINCFNPKQNQYPVINGIDAA-KDSKSKEDAKLCNPGSLLP  368

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKY  1406
               V+GK+VYCL S   +  +K I G+G VI  D  PD    +M PATIV+   G+ +  Y
Sbjct  369   NKVKGKLVYCLGSWGTEANVKEIGGIGSVIEYDDYPDVAQISMAPATIVNHSIGETVTNY  428

Query  1407  INTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALAT  1586
             I +T++P+A I++SR  K  APF  SFS+RGP   S N+LKPD+AAPG+ ILA+YT   +
Sbjct  429   IQSTRSPSAVIYKSREEKIPAPFAASFSSRGPNPASKNVLKPDIAAPGIDILASYTLRKS  488

Query  1587  MTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP  1766
             +TG   DT+  ++++ SGTSMA PH AG AAYVK+FHP+W+PAAI+SA++TTAK M  + 
Sbjct  489   LTGLKGDTQFAEFSLISGTSMACPHVAGVAAYVKSFHPNWTPAAIRSAIITTAKPMSRRI  548

Query  1767  IG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNI  1940
                A  A G+G + PT+AV+PGL++D+    Y+ +LC E +N + L +L GS  N C ++
Sbjct  549   NNEAEFAFGSGQLNPTRAVSPGLVYDMEDFGYIQFLCHEGYNGSKLSALVGSPIN-CSSL  607

Query  1941  PAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVP  2120
                 G D +NYP+M L L +    T    F RTVT VG    ++ A +++P G+ ++V P
Sbjct  608   LPGLGHDAINYPTMQLSLES-KKDTREVVFRRTVTNVGPIPAIYNATVRSPKGVEITVKP  666

Query  2121  NILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             + LSF +T QKRS++VVV      ++   +SGSL+W+   + VRSPI++Y+
Sbjct  667   SYLSFDKTKQKRSFEVVVKVNSIASME-ILSGSLIWRSPRYIVRSPIVIYK  716



>ref|XP_007134940.1| hypothetical protein PHAVU_010G088400g [Phaseolus vulgaris]
 gb|ESW06934.1| hypothetical protein PHAVU_010G088400g [Phaseolus vulgaris]
Length=762

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/715 (49%), Positives = 473/715 (66%), Gaps = 12/715 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             Q+  YIV++G+      I A+D H NIL+   G    A+E  ++SY +SF+ F A L   
Sbjct  51    QKNFYIVFLGDHAGSRDI-ALDTHLNILSAVKGSHLEAKESMVYSYTKSFNAFAASLSED  109

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA+ LS  D+VVSV  N   KL TTRSWDF+G+   A R  K+ESD+IV LLDTGV  + 
Sbjct  110   EAKNLSAMDEVVSVIPNQYRKLHTTRSWDFIGLPLTAKRKLKSESDIIVALLDTGVTPQL  169

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGS  683
              SFKDDG+GPPPAKWKG C K  NF+GCN K+IGA+YF + G   P D  SP D  GHG+
Sbjct  170   QSFKDDGFGPPPAKWKGTCDKYANFSGCNNKLIGARYFKIGGKPDPSDILSPIDMVGHGT  229

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIAD  860
             H AS AAG +V  ASL+GIA+GTARG VPSAR+A YKVCW    C D D+LA F+AAI D
Sbjct  230   HTASTAAGNLVPDASLFGIAKGTARGAVPSARLAVYKVCWASDACADTDILAAFEAAIHD  289

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+ISIS+GG   ++ QD I IGS+HAM+K I+T A+ GN+GP   T+ N +PW++TVA
Sbjct  290   GVDIISISIGGGDPNYVQDSIGIGSFHAMRKGIITVASGGNDGPIMATVTNTAPWIVTVA  349

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+ IDR F+S ++LGNG+  SG  + TF    K YPL++GT A   + +   +   C   
Sbjct  350   ASGIDRDFKSTIQLGNGKNFSGGGLTTFNPKQKQYPLVNGTDAARSSGSKE-SARFCYED  408

Query  1218  SISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGK  1391
             S+    V+GK+VYC LSS   +  +K I G+G ++ SD++ +     M PATIV+   GK
Sbjct  409   SLDPNKVKGKLVYCSLSSWGSEAVVKKIGGIGSIMESDQVFEIAQIFMAPATIVNSSIGK  468

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              I  Y ++T++P+A I ++  VK  APF  SFS+RGP   S +ILKPD+ APGL+ILA+Y
Sbjct  469   IITNYTHSTRSPSAVIHKTHEVKIPAPFTASFSSRGPNPASKHILKPDVTAPGLNILASY  528

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T + ++TG+  DT+  ++ + SGTSM+ PH +G AAYVK+FHPDWSPAAI+SA++TTAK 
Sbjct  529   TPIKSITGEKGDTQFSEFTLMSGTSMSCPHVSGVAAYVKSFHPDWSPAAIRSAIITTAKP  588

Query  1752  MKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             M  +    A  A GAG + PT+AV PGL++D++   Y+ +LC E +N ++L  L GS  N
Sbjct  589   MSQRVNKEAEFAYGAGQVNPTRAVNPGLVYDVDDFAYIQFLCHEGYNGSTLSVLIGSPVN  648

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++    G D LNYP+M L + N + TT    F R VT VG   T+F A IK+P G+ 
Sbjct  649   -CTSLLPGLGHDALNYPTMQLSVENNSGTTV-GVFRRRVTNVGPAPTIFNATIKSPKGVE  706

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             ++V P  L F  T QK+S+KVVV  K   ++   +SGSL+W+   + VRSPI++Y
Sbjct  707   ITVKPASLVFSHTLQKKSFKVVVKAKSMASMK-IVSGSLIWRSTRYIVRSPIVIY  760



>emb|CBI31589.3| unnamed protein product [Vitis vinifera]
Length=731

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/717 (48%), Positives = 468/717 (65%), Gaps = 18/717 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D  RK YIVYMG+LP D  IS+    H  + +   D   + EY +HSY++SF+GFVA L 
Sbjct  24    DDDRKAYIVYMGDLPKDDVISSPSLLHTSMLQEAIDSSSSSEYLLHSYKKSFNGFVASLT  83

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               E ++LS  + +VSVF N +M+L TTRSWDF+G      R    ESD+IVG++D+G+W 
Sbjct  84    GEEVKKLSNMEGIVSVFPNEKMQLFTTRSWDFIGFPQDVERT-TTESDIIVGIIDSGIWP  142

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGH  677
             ES SF   G+ PPP KWKG CQ   NFT CN K+IGA+Y++      P + +SP D DGH
Sbjct  143   ESASFNAKGFSPPPRKWKGTCQTSSNFTSCNNKIIGARYYHTGAEVEPNEYDSPRDSDGH  202

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H ASI AG +V GASL G   GTARGGVPSARIA YKVCW +GC   DVLA FD AIA
Sbjct  203   GTHTASIVAGGLVSGASLLGFGSGTARGGVPSARIAVYKVCWSKGCYSADVLAAFDDAIA  262

Query  858   DGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             DGVD+IS+S+GG+  ++F++PIAIG++HA+K  I+T+ A GN G    TI N+ PW ++V
Sbjct  263   DGVDIISVSLGGYSPNYFENPIAIGAFHALKNGILTSTAVGNYGHNRATITNLWPWSLSV  322

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             AA++IDR+F + V+LGN ++  G SINTFE+  MYP+I G  AQ+         S CD  
Sbjct  323   AASTIDRKFVTKVQLGNNQVYEGVSINTFEMNDMYPIIYGGDAQNTTGGNSEYSSLCDKN  382

Query  1218  SISEKLVRGKIVYC--LSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDG  1388
             S+++ LV GKIV C  L+   +  T      VG+I  D  L D  L   +PA+ +D  +G
Sbjct  383   SLNKSLVNGKIVLCDALNWGEEATTAG---AVGMIMRDGALKDFSLSFSLPASYMDWSNG  439

Query  1389  KKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
              ++D+Y+N+T+ PTA+I RS  VK   APF+ SFS+RGP  I+ +ILKPDL+APG++ILA
Sbjct  440   TELDQYLNSTR-PTAKINRSVEVKDELAPFIVSFSSRGPNLITRDILKPDLSAPGVNILA  498

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             A++  +T+TG+  DTRVV YN+ SGTSMA PHA+GAAAY+K+FHP WSP+AIKSALMTTA
Sbjct  499   AWSEASTVTGKEWDTRVVPYNIMSGTSMACPHASGAAAYIKSFHPTWSPSAIKSALMTTA  558

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
               M+ +       + G+G + P KA  PGL++D  +++Y+ +LC E + NA L  +TG  
Sbjct  559   SPMRGEINTDLEFSYGSGQVDPVKAANPGLVYDAGETDYIKFLCGEGYGNAKLQLITG--  616

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             DN   +         LNYPS    ++     + +  F RTVT VGT ++ +KA +  P  
Sbjct  617   DNTSCSADTNGTVWALNYPS--FAVSTKYKVSITRNFTRTVTNVGTPASTYKANVTVPPR  674

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L V V P+ILSF    QK+++ V V  +     +  +SGSLVW D  + VRSPI+ Y
Sbjct  675   LCVQVEPSILSFKSLGQKKTFSVTV--RVPALDTAIISGSLVWNDGVYQVRSPIVAY  729



>ref|XP_010661610.1| PREDICTED: xylem serine proteinase 1 [Vitis vinifera]
Length=737

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/724 (48%), Positives = 479/724 (66%), Gaps = 25/724 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + ++K YIVY G  PDD   +A     ++L++   D     E  +HSY +SF+   A+L 
Sbjct  25    NAEKKVYIVYFGGRPDDRQ-AAAQTQQDVLSKC--DIVDTEESIVHSYTKSFNALAAKLS  81

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA++++  ++VVSVF N   KL TT+SWDF+G+   A R  K ES++IVGLLDTG+  
Sbjct  82    EDEAQKIAGMEEVVSVFPNRYHKLHTTKSWDFIGLPRTARRQLKQESNIIVGLLDTGITP  141

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             +S SF D+G+GPPPAKWKG C +  NF+GCN K+IGA+YF ++G   P+D  SP D +GH
Sbjct  142   QSESFADNGFGPPPAKWKGSCGRFANFSGCNNKLIGAKYFKLDGKPDPDDILSPVDVEGH  201

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAI  854
             G+H AS  AG +V+ A+L+G+A+GTARG VPSAR+A YKVCW   GC DMD+LAGF+AAI
Sbjct  202   GTHTASTVAGNIVKNANLFGLAKGTARGAVPSARVAMYKVCWVSTGCSDMDLLAGFEAAI  261

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGVDVISIS+GG   ++ +D IAIG++HAMKK I+T A+AGN+GP   TI N +PW++T
Sbjct  262   ADGVDVISISIGGFTFNYAEDIIAIGAFHAMKKGILTIASAGNDGPDESTIVNHAPWILT  321

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISG-----TLAQDKNATYPGN  1196
             V A+ IDR F S V LGNG+   G  ++ F+   K YPL+SG     T A  +N+ +   
Sbjct  322   VGASGIDRSFRSKVVLGNGKTFLGSGLSAFDPKQKNYPLVSGADIPKTKADKENSRF---  378

Query  1197  YSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATI  1370
                C   S+    V+GK+VYC L     +  +K + G+G ++ S    DT    M P T+
Sbjct  379   ---CIEDSLDPTKVKGKLVYCELEEWGVESVVKGLGGIGAIVESTVFLDTPQIFMAPGTM  435

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             ++   G+ ID YI++T+ P+  I R++ VK  APFV SFS+RGP  +S +ILKPD+ APG
Sbjct  436   INDTVGQAIDGYIHSTRTPSGVIQRTKEVKIPAPFVASFSSRGPNPVSQHILKPDVVAPG  495

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             + ILA+YT L ++TG   DT+  K+ + SGTSMA PH +G AAYVK+FHP WSPAAIKSA
Sbjct  496   VDILASYTPLKSLTGLKGDTQFSKFTIMSGTSMACPHVSGVAAYVKSFHPKWSPAAIKSA  555

Query  1731  LMTTAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             + TTAK M  ++   G + A GAG + P +A++PGL++D+N++ Y+ +LC E  +  S+G
Sbjct  556   ITTTAKPMSRRVNKDGEF-AYGAGQVNPLRALSPGLVYDMNETSYIQFLCHEGLSGKSIG  614

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
             ++ GSK   C ++    G D LNYP+M L L + N TT    F RTVT VG   +V+KA 
Sbjct  615   AIVGSKSVNCSSLLPGHGNDALNYPTMQLSLKDKNETTV-GVFRRTVTNVGPAQSVYKAT  673

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             I+AP G+ ++V P  L F  T Q R +KVVV  K   A    +SGSL W+ + H VRSPI
Sbjct  674   IEAPQGVKITVTPTTLVFSPTVQARRFKVVVKAK-PMASKKMVSGSLTWRSHRHIVRSPI  732

Query  2262  LVYR  2273
             ++Y+
Sbjct  733   VIYK  736



>ref|XP_007139965.1| hypothetical protein PHAVU_008G073700g, partial [Phaseolus vulgaris]
 gb|ESW11959.1| hypothetical protein PHAVU_008G073700g, partial [Phaseolus vulgaris]
Length=752

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/712 (48%), Positives = 475/712 (67%), Gaps = 16/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV++G   +    +A++ + N+L+   G    A+E  ++SY R+F+ F A+L   EA++
Sbjct  45    YIVFLGAHTESRG-NALETYLNVLSSVKGSYLEAKESMVYSYTRNFNAFAAKLSDDEAKK  103

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  D+V+ VF+N   +L TTRSW+F+G+   A R    ESD+IV LLDTG+  ES SFK
Sbjct  104   LSAMDEVLLVFQNQYRQLHTTRSWNFIGLPPTARRRLNVESDIIVALLDTGITPESKSFK  163

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIAS  695
             D+G+GPPPA+WKG C    NF+GCN+K++GA+YF  +G   P D  SP D DGHG+H AS
Sbjct  164   DNGFGPPPARWKGSCGHYANFSGCNKKILGAKYFKADGNLDPSDILSPVDTDGHGTHTAS  223

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  A+L+ +A GTARG VPSAR+A YKVCW   GC DMD+LA FDAAI DGVDV
Sbjct  224   TVAGNLVPNANLFELANGTARGAVPSARLAIYKVCWSSSGCADMDILAAFDAAIHDGVDV  283

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   S+ +D I+IG++HAM+K I+T A+AGN GP  GT+ N +PW++TVAA+ I
Sbjct  284   ISISIGGGNPSYVKDSISIGAFHAMRKGIITVASAGNAGPSLGTVTNTAPWIVTVAASGI  343

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S V+LGNG+  SG  ++ F+  GK YPL+SG   A+D        +  C   S+ 
Sbjct  344   DRAFKSTVQLGNGKNFSGVGVSCFDPKGKQYPLVSGIDAAKDSKDKEEARF--CFEGSLE  401

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
                V+GK+VYC L +   +  +K I G+G +I SD+ PD     M PATIV+   G  I 
Sbjct  402   PNKVKGKLVYCKLGTWGTEAVVKGIGGIGTLIESDQFPDVAQIFMAPATIVNSRQGDTIT  461

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             KYI ++++P+A I++S  VK  APF  +FS+RGP T+S N+LKPD+AAPG+ ILA+YT  
Sbjct  462   KYIQSSRSPSAMIYKSHEVKMPAPFTATFSSRGPNTVSQNVLKPDVAAPGIDILASYTLK  521

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM--  1754
              ++TG   DT+  ++ + SGTSMA PH +G AAYVK+FHP W+PAAI+S+++TTAK M  
Sbjct  522   KSLTGLKGDTQFSEFILMSGTSMACPHVSGVAAYVKSFHPHWTPAAIRSSIITTAKPMSK  581

Query  1755  KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
             ++   G + A GAG + PT+AV+PGL++D++   Y+ +LC E +  +SL +L GS  N C
Sbjct  582   RVNSEGEF-AYGAGQLNPTRAVSPGLVYDMDDLGYIQFLCHEGYKGSSLSALVGSPVN-C  639

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
              ++    G D +NYP+M L L +   T     F RTVT VG   T++ A I +P G+ ++
Sbjct  640   SSLLPGLGHDAINYPTMQLSLESSKGTKL-GVFRRTVTNVGPAPTIYNATIISPKGVEIT  698

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             V P  LSF +T QKRS+KVVV        S  +SGSL+W+   + VRSPI++
Sbjct  699   VKPTSLSFSKTKQKRSFKVVVKAT-SIGSSKIVSGSLIWRSPRYIVRSPIVI  749



>gb|KHF99410.1| Xylem serinease 1 -like protein [Gossypium arboreum]
Length=689

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/687 (50%), Positives = 458/687 (67%), Gaps = 11/687 (2%)
 Frame = +3

Query  234   EALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWD  413
             E L  E  A+E  I+SY +SF+ F A+L   EA  L   D+V SVF N   KL TT+SWD
Sbjct  2     ELLNSEHGAKESIIYSYTKSFNAFAAKLSENEAEMLKGLDEVASVFPNRYRKLHTTKSWD  61

Query  414   FLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCN  593
             F+G+   A RN K E ++IVGLLDTG+  +S SFKDDG+GPPP+KWKG C + +NF+GCN
Sbjct  62    FIGLPLTAKRNLKFERNIIVGLLDTGITPQSESFKDDGFGPPPSKWKGTCGRFMNFSGCN  121

Query  594   RKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVP  770
              K+IGA+Y+ ++G   P D  SP D DGHG+H +S  AG +V  A+LYG+A+GTARG VP
Sbjct  122   NKIIGAKYYKLDGNPDPADILSPIDMDGHGTHTSSTLAGNLVRDANLYGLAKGTARGAVP  181

Query  771   SARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAM  947
             SARIA YKVCW   GC DMD+LA  D A +DGVD+ISIS+GG  + F  D I++G++HA+
Sbjct  182   SARIAMYKVCWASSGCADMDILAALDDATSDGVDIISISIGGGTQDFVTDSISVGAFHAL  241

Query  948   KKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE  1127
             KK IVT  +AGN+GP   ++ N SPWL+TVAA+ IDR+F S VKLGNG+   G  INTFE
Sbjct  242   KKGIVTVTSAGNDGPSLSSVSNYSPWLLTVAASGIDRQFMSTVKLGNGKSFRGIGINTFE  301

Query  1128  LGK-MYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIH  1301
               + +YP++SG      N+   GN   C   ++    V+G++VYC LS    D  +K I 
Sbjct  302   SKEGLYPIVSGADVA-MNSESKGNARFCFDNTLDPSKVKGRLVYCTLSQWGVDSVVKGIG  360

Query  1302  GVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFV  1478
             G+G ++ S++  DT    M PAT+V+   G+ I  YI++T++PTA +++S  +K  AP V
Sbjct  361   GIGTIVESEQYLDTAQIFMAPATMVNSTVGETIQNYIHSTRSPTAVVYKSEEIKIPAPSV  420

Query  1479  PSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATP  1658
              SFS+RGP   S  ILKPD+AAPG+ ILAAYT + ++TG   DT+  K+ + SGTSMA P
Sbjct  421   ASFSSRGPNPGSHRILKPDIAAPGVDILAAYTLVKSLTGLKGDTQRSKFTLMSGTSMACP  480

Query  1659  HAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM-KIKPIGAYLASGAGLIRPTKAVAPGLI  1835
             H AG AAYVK+FHP W+PAAIKSA+MTTAK M K     A  A GAG + P +A+ PGL+
Sbjct  481   HVAGVAAYVKSFHPTWTPAAIKSAIMTTAKPMSKRVNKDAEFAYGAGQLNPARAINPGLV  540

Query  1836  FDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNAT  2012
             +DI++  Y+ +LC E ++ +S+  L G+K   C ++    G D LNYPSM L++ N    
Sbjct  541   YDIDEMSYVQFLCHEGYSGSSIAHLIGTKSVNCSSLLPGFGYDALNYPSMQLKMKNSQQP  600

Query  2013  TFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQK  2192
             T    F R VT VG  S V+ A IKAP GL ++V P  L F +  QKRS+KVVV  K + 
Sbjct  601   TV-GVFKRRVTNVGPPS-VYNATIKAPKGLQITVRPTSLLFTRLLQKRSFKVVVVAKPEL  658

Query  2193  AISW-YMSGSLVWKDNTHSVRSPILVY  2270
             +  +  +S SLVWK   H+VRSPI+VY
Sbjct  659   STKFRVLSASLVWKTTHHTVRSPIVVY  685



>ref|XP_010426748.1| PREDICTED: xylem serine proteinase 1 [Camelina sativa]
Length=752

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/712 (49%), Positives = 472/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PDD T  A+  H N+L+     +E AR+ ++HSY ++F+ F A+L P EA++
Sbjct  41    YIIYLGDGPDD-TDEAIKTHINLLSSLNISQEEARDRKVHSYTKAFNAFAAKLSPNEAKK  99

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++V  V+RN   +L TT+SWDF+G+   A R+ K E D+I+G+LDTG+  ES SF+
Sbjct  100   MMEMEEVFGVYRNEYRQLHTTKSWDFVGLPLTAKRHVKTERDVIIGVLDTGITPESESFQ  159

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  160   DHGLGPPPAKWKGSCGPYTNFTGCNNKIIGAKYFKHDGNVPTGEIRSPIDIDGHGTHTSS  219

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  220   TVAGVLVSNASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVDI  279

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  280   ISISIGGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  339

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F    K YPL+SG   A+  +  Y   Y   D  S+ 
Sbjct  340   DRTFKSKIDLGNGKSFSGMGISMFNPKAKSYPLVSGVDAAKTTDDKYLARYCFSD--SLD  397

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + T+K   G G +I SD+  D     M PAT V+   G  I 
Sbjct  398   RKKVKGKVMVCRMGGGGVESTVKSYGGAGAIIVSDQYLDNAQIFMAPATSVNSSIGDAIY  457

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++P+A I ++R V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+T  
Sbjct  458   RYINSTRSPSAVIQKTRQVTVPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFTLK  517

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  518   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISS  577

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  578   RVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGSRSVSCS  637

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+   +KAP G+ ++V
Sbjct  638   SIVPGLGHDSLNYPTIQLTLRSAKTSTL-AVFRRRVTNVGPASSVYNVTVKAPKGVEITV  696

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  L+F + +QKRS+KVVV GK Q +    +SG LVWK   HSVRSPI++Y
Sbjct  697   EPQSLTFSKVSQKRSFKVVVKGK-QMSPGKIVSGLLVWKSPRHSVRSPIVIY  747



>ref|XP_010496905.1| PREDICTED: xylem serine proteinase 1-like [Camelina sativa]
Length=752

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/712 (48%), Positives = 472/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PDD T  A+  H N+L+     +E AR+ ++HSY ++F+ F A+L P EA++
Sbjct  41    YIIYLGDGPDD-TDEAIKTHINLLSSLNISQEEARDRKVHSYTKAFNAFAAKLSPNEAKK  99

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++V  V+RN   +L TT+SWDF+G+   A R+ K E D+I+G+LDTG+  ES SF+
Sbjct  100   MMEMEEVFGVYRNEYRQLHTTKSWDFVGLPLTAKRHVKTERDVIIGVLDTGITPESESFQ  159

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  160   DHGLGPPPAKWKGSCGPYTNFTGCNNKIIGAKYFKHDGNVPTGEIRSPIDIDGHGTHTSS  219

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  220   TVAGVLVSNASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVDI  279

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  280   ISISIGGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  339

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F    K YPL+SG   A+  +  Y   Y   D  S+ 
Sbjct  340   DRTFKSKIDLGNGKSFSGMGISMFNPKAKSYPLVSGVDAAKTTDDKYLARYCFSD--SLD  397

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + T+K   G G +I SD+  D     M PAT V+   G  I 
Sbjct  398   RKKVKGKVMVCRMGGGGVESTVKSYGGAGAIIVSDQYLDNAQIFMAPATSVNSSIGDAIY  457

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++P+A I ++R V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+T  
Sbjct  458   RYINSTRSPSAVIQKTRQVTVPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFTLK  517

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  518   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISS  577

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  578   RVNKDAEFAYGGGQINPRRAASPGLVYDMDDMSYVQFLCGEGYNATTLAPLVGSRSVSCS  637

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+   ++AP G+ ++V
Sbjct  638   SIVPGLGHDSLNYPTIQLTLRSAKTSTL-AVFRRRVTNVGPASSVYNVTVRAPKGVEITV  696

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  L+F + +QKRS+KVVV GK Q +    +SG LVWK   HSVRSPI++Y
Sbjct  697   EPQSLTFSKVSQKRSFKVVVKGK-QMSPGKIVSGLLVWKSPRHSVRSPIVIY  747



>ref|XP_010456309.1| PREDICTED: xylem serine proteinase 1-like [Camelina sativa]
Length=752

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/712 (48%), Positives = 474/712 (67%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PD+ T  A+  H N+L+     +E AR+ ++HSY ++F+ F A+L P EA++
Sbjct  41    YIIYLGDGPDN-TDEAIKTHINLLSSLNISQEEARDRKVHSYTKAFNAFAAKLSPNEAKK  99

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++VV V+RN   +L TT+SWDF+G+   A R+ K E ++I+G+LDTG+  ES SF+
Sbjct  100   MMEMEEVVGVYRNEYRQLHTTKSWDFVGLPLTAKRHVKTERNVIIGVLDTGITPESESFQ  159

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  160   DHGLGPPPAKWKGSCGPYTNFTGCNNKIIGAKYFKHDGNVPTGEIRSPIDIDGHGTHTSS  219

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  220   TVAGVLVSNASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVDI  279

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  280   ISISIGGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  339

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F    K YPL+SG   A+ K+  Y   Y   D  S+ 
Sbjct  340   DRTFKSKIDLGNGKSFSGMGISMFNPKAKSYPLVSGVDAAKTKDDKYLARYCFSD--SLD  397

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + T+K   G G +I +D+  D     M PAT V+   G  I 
Sbjct  398   RKKVKGKVMVCRMGGGGVESTVKSYGGAGAIIVNDQYLDNAQIFMAPATSVNSSIGDAIY  457

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++P+A I ++R V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+T  
Sbjct  458   RYINSTRSPSAVIQKTRQVTVPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFTLK  517

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  518   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISS  577

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  578   RVNKDAEFAYGGGQINPRRAASPGLVYDMDDMSYVQFLCGEGYNATTLAPLVGSRSVSCS  637

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+   ++AP G+ ++V
Sbjct  638   SIVPGLGHDSLNYPTIQLTLRSAKTSTL-AVFRRRVTNVGPASSVYNVTVRAPKGVEITV  696

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  L+F + +QKRS+KVVV GK Q +    +SG LVWK   HSVRSPI++Y
Sbjct  697   EPQSLTFSKVSQKRSFKVVVKGK-QMSPGKIVSGLLVWKSPRHSVRSPIVIY  747



>ref|XP_006396223.1| hypothetical protein EUTSA_v10028458mg [Eutrema salsugineum]
 gb|ESQ37676.1| hypothetical protein EUTSA_v10028458mg [Eutrema salsugineum]
Length=751

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/712 (48%), Positives = 476/712 (67%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PDD    A+  H N+L+     +E A+E +++SY ++F+ F A+L P EA++
Sbjct  40    YIIYLGDQPDDGD-EAIKTHINLLSSLNISQEEAQERKVYSYTKAFNAFAAKLSPEEAKK  98

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++V+ VFRN   +L TT+SWDF+G+   A R+ KAE D+I+G+LDTG+  +S SF+
Sbjct  99    MMEMEEVLGVFRNRYRQLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPDSESFQ  158

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  159   DHGLGPPPAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVPNGEIRSPIDIDGHGTHTSS  218

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  219   TVAGVLVANASLYGIASGTARGAVPSARVAMYKVCWARSGCADMDILAGFEAAIHDGVDI  278

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HA++K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  279   ISISIGGPIADYSSDSISVGSFHAVRKGILTVASAGNDGPLSGTVTNHEPWILTVAASGI  338

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S++ LGNG+  SG  I+ F+   K YPL+SG   A+  +  Y   Y   D  S+ 
Sbjct  339   DRTFKSEIDLGNGKSFSGMGISMFKPKAKSYPLVSGVDAAKTTDDKYLARYCFSD--SLD  396

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + TIK   G G ++ SD+  D     M PAT V+   G+ I 
Sbjct  397   GKKVKGKVMVCRMGGGGVESTIKRYGGAGAILVSDQYLDNAQIFMAPATSVNSSIGETIY  456

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++P+A I ++R V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+T  
Sbjct  457   RYINSTRSPSAVIQQTRQVTIPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFTLK  516

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PHAAG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  517   RSLTGLDGDTQFSKFTILSGTSMACPHAAGVAAYVKSFHPDWTPAAIKSAIITSAKPISA  576

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G + P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  577   RVNKDAEFAYGGGQVNPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGSRSVNCS  636

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+ A ++AP G+ ++V
Sbjct  637   SIVPGLGHDSLNYPTIQLTLRSAKTSTM-AVFRRRVTNVGAPSSVYNATVRAPKGVEITV  695

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF + +QKRS+KVVV  K  K     +SG LVWK   HSVRSPI++Y
Sbjct  696   EPMSLSFSKASQKRSFKVVVKAKLMKP-GKIVSGLLVWKSQRHSVRSPIVIY  746



>ref|XP_006587877.1| PREDICTED: xylem serine proteinase 1-like [Glycine max]
Length=748

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/720 (48%), Positives = 477/720 (66%), Gaps = 20/720 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + Q+  YIV++G   +    +A+D + N+L+        A+E  ++SY ++ + F A+L 
Sbjct  35    NEQKNFYIVFLGAHTESRG-NALDTYLNVLSAVKESFLEAKESMVYSYTKTLNAFAAKLS  93

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA++LS  D+V+ VF+N   +L TTRSW+F+G+ T A R  K+ESD+IV LLDTG   
Sbjct  94    EDEAKKLSAMDEVLLVFQNQYRQLHTTRSWNFIGLPTTAKRRLKSESDIIVALLDTGFTP  153

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             ES SFKDDG+GPPPA+WKG C    NF+GCN+K+IGA+YF  +G   P D  SP D DGH
Sbjct  154   ESKSFKDDGFGPPPARWKGSCGHYANFSGCNKKIIGAKYFKADGNPDPSDILSPVDADGH  213

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAI  854
             G+H AS  AG +V  A+L+G+A GTARG VPSAR+A YKVCW   GC DMD+LA FDAAI
Sbjct  214   GTHTASTVAGNLVPNANLFGLANGTARGAVPSARLAIYKVCWSSSGCADMDILAAFDAAI  273

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVDVISIS+GG   S+ +  I+IG++HAM+K I+T A+AGN GP  GT+ N +PW++T
Sbjct  274   HDGVDVISISIGGGNPSYVEGSISIGAFHAMRKGIITVASAGNSGPSLGTVTNTAPWIVT  333

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+ IDR F S V+LGNG+ +SG  +N F+  GK YPLI+G  A  K++    +   C 
Sbjct  334   VAASGIDRTFRSTVQLGNGKNVSGVGVNCFDPKGKQYPLINGVDAA-KDSKDKEDAGFCY  392

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               ++    V+GK+VYC L +   +  +K I G+G +I SD+ PD     M PATIV    
Sbjct  393   EGTLQPNKVKGKLVYCKLGTWGTESVVKGIGGIGTLIESDQYPDVAQIFMAPATIVTSGT  452

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G  I KYI +T++P+A I++SR ++  APF  SFS+RGP   S N+LKPD+AAPGL ILA
Sbjct  453   GDTITKYIQSTRSPSAVIYKSREMQMQAPFTASFSSRGPNPGSQNVLKPDVAAPGLDILA  512

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +YT   ++TG   DT+  ++ + SGTSMA PH AG A+YVK+FHP W+PAAI+SA++TTA
Sbjct  513   SYTLRKSLTGLKGDTQFSEFILMSGTSMACPHVAGVASYVKSFHPHWTPAAIRSAIITTA  572

Query  1746  KAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             K M  +    A  A GAG + P  AV+PGL++D++   Y+ +LC E +  +SL +L GS 
Sbjct  573   KPMSKRVNNEAEFAYGAGQLNPRSAVSPGLVYDMDALGYIQFLCHEGYKGSSLSALVGSP  632

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
              N C ++    G D +NYP+M L L + N  T    F RTVT VG   T++ A +++P G
Sbjct  633   VN-CSSLLPGLGHDAINYPTMQLSLES-NKGTRVGVFRRTVTNVGPAPTIYNATVRSPKG  690

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISW----YMSGSLVWKDNTHSVRSPILV  2267
             + ++V P  L+F +T QKRS+KVVV     KA S      +SGSL+W+   + VRSPI++
Sbjct  691   VEITVKPTSLTFSKTMQKRSFKVVV-----KATSIGSEKIVSGSLIWRSPRYIVRSPIVI  745



>ref|XP_008232921.1| PREDICTED: xylem serine proteinase 1 [Prunus mume]
Length=751

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/718 (48%), Positives = 468/718 (65%), Gaps = 11/718 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + Q+K YIVY+G+   +    A   H +IL+        A+E  ++SY +SF+ F A+L 
Sbjct  35    NDQKKFYIVYLGDHAVNEDSEAAQTHIDILSSVKESYVEAKESMVYSYTKSFNAFAAKLS  94

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA RLS  D+V+SV  N   KL TT+SWDF+G+  KA RN K E D+IVGLLDTG+  
Sbjct  95    SDEAERLSGMDEVLSVLPNRYHKLHTTKSWDFIGLPLKARRNLKLERDIIVGLLDTGITP  154

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             ES SFK DG+GPPPAKWKG C    NF+GCN K+IGA+YF ++G   P D  SP D DGH
Sbjct  155   ESKSFKGDGFGPPPAKWKGTCGHFANFSGCNNKIIGAKYFKLDGNPDPADILSPIDVDGH  214

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAI  854
             G+H +S  AG  V  ASL+G+A GTARG VPSAR+A YKVCW   GC DMD+LA +DAAI
Sbjct  215   GTHTSSTLAGNQVPNASLFGLAMGTARGAVPSARVAMYKVCWASSGCTDMDILAAYDAAI  274

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVDVISIS+GG   ++ +D IAIG++HAMKK I+T A+AGN+GP  G++ N +PW +T
Sbjct  275   HDGVDVISISIGGGGPNYVRDSIAIGAFHAMKKGIITVASAGNDGPSLGSVVNHAPWFVT  334

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+ IDR+F S V LGNG+ +SG  +NTF   K +YPL+SG     +N+    +   C 
Sbjct  335   VAASGIDRQFISKVHLGNGKDVSGIGVNTFNPKKNLYPLVSGVDVA-RNSQTKESARFCL  393

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               S+    V+GK+V C L +   D  +K I GVG +I  D+L D     M P T+V+   
Sbjct  394   QDSLDPNKVKGKLVLCKLENWGADSVVKGIGGVGTIIEDDQLLDAAQIFMAPGTMVNDTI  453

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G+ ID+YI++T +P+A I +S   K  APF+ SFS+RGP   S  ILKPD+AAPG+ ILA
Sbjct  454   GEIIDEYIHSTGSPSAVISKSHEAKKRAPFIASFSSRGPNPGSERILKPDIAAPGVDILA  513

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +YT   ++TG   DT+  ++ + SGTSM+ PH AG  AYVK+FHP WSPAAI+SA++TTA
Sbjct  514   SYTLRKSLTGLEGDTQYSEFTIMSGTSMSCPHVAGVVAYVKSFHPHWSPAAIRSAILTTA  573

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKS-EYMSYLCKE-FNNASLGSLTGS  1916
             K M  +    A  + G G + PTKAV PGL++D++ +  Y+ +LC E +  +SL  L GS
Sbjct  574   KPMSQRVNSDAEFSYGVGQVNPTKAVNPGLVYDMDGTLSYIQFLCHEGYKGSSLAPLVGS  633

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
             K   C ++   QG D LNYP+M L L +    T    F RTVT VG   + + A I+AP 
Sbjct  634   KSVNCSSLLPGQGYDALNYPTMQLSLKSSKQPTV-GVFRRTVTNVGPAKSTYNATIRAPK  692

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             G+ + V P  LSF  T +KR+++VVV      ++   +SGSL WK + ++VRSPI+++
Sbjct  693   GVEIIVKPMSLSFSTTLEKRTFQVVVKANPMPSMR-MISGSLGWKSSRYTVRSPIVIH  749



>ref|XP_011076782.1| PREDICTED: cucumisin-like [Sesamum indicum]
Length=740

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/721 (49%), Positives = 477/721 (66%), Gaps = 23/721 (3%)
 Frame = +3

Query  138   HD-TQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVAR  314
             HD T  K Y+VYMG+ P     SA  +H ++L   +G +  A E  ++SY+RSF+GFVA+
Sbjct  31    HDGTDEKVYVVYMGDRPKG-EFSATAQHMSMLQATIGSKR-ASESWLYSYKRSFNGFVAK  88

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             L   E  +++  + VVSVF +T+ +L TTRSWDF+G    A R  K ESD+IVG+LDTG+
Sbjct  89    LTEEEKTKIASLEGVVSVFPSTKKQLHTTRSWDFMGFPVAAERT-KTESDVIVGMLDTGI  147

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFD  671
             W ESPSF D  +G PP KWKG CQ   NFT CN K+IGA+Y++ EG  +P D  SP D +
Sbjct  148   WPESPSFDDKDFGAPPTKWKGTCQSSSNFT-CNNKIIGARYYHSEGTISPPDFPSPRDSE  206

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHGSH AS AAG +V GA+LYG+  GTARGGVPSARIA YK+CW  GC D D+LA FD A
Sbjct  207   GHGSHTASTAAGGLVYGANLYGLGAGTARGGVPSARIAVYKICWSDGCSDADILAAFDDA  266

Query  852   IADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD+ISISVGG  P  +F DPIAIG++HAMK  ++T+ +AGN GP   +I N SPW 
Sbjct  267   IADGVDIISISVGGFFPSDYFADPIAIGAFHAMKNGVLTSNSAGNSGPDSASIVNFSPWS  326

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA  1205
             ++VAA++IDR+F ++V+LGN E   G S+NTF L  + YPL+ G    +    Y  + S 
Sbjct  327   LSVAASTIDRKFLTNVQLGNNESYVGVSVNTFVLENESYPLVYGGNVPNTAGGYDNSTSR  386

Query  1206  -CDYLSISEKLVRGKIVYC--LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVD  1376
              C++ S+  KLV G IV C  L+ A +  T+    G  ++  D   D      +PA+ + 
Sbjct  387   YCEFDSLDPKLVEGTIVLCDGLNDA-EPATVAGAAGT-IMHDDYFRDFAFSFPLPASYLG  444

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGL  1553
              +DG K+  YIN T  PTA IF+S  V  T APFV SFS+RGP  I+ ++LKPDL APG+
Sbjct  445   NDDGDKVHGYINGTSKPTATIFKSVEVNDTLAPFVVSFSSRGPNPITADLLKPDLTAPGV  504

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILAA++   T+TG  DD RVV YN+ SGTSM+ PHA+GAAAYVK+F+P WSP+AIKSAL
Sbjct  505   DILAAWSEATTVTGYPDDPRVVPYNIISGTSMSCPHASGAAAYVKSFNPTWSPSAIKSAL  564

Query  1734  MTTAKAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             MTTA +M++     A  A G+G I P KA +PGL++DI +++Y+S+LC + ++N +L  +
Sbjct  565   MTTAASMRVATNTDAEFAYGSGHIDPLKAKSPGLVYDIEEADYVSFLCGQGYSNKNLQLI  624

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             TG  +  C     A   D LNYPS    L+  +  + S  F+RTVT VG+ S+ ++A + 
Sbjct  625   TG-DNTTCTASNNATVYD-LNYPS--FTLSAASGASISRVFHRTVTNVGSASSTYRAAVV  680

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             AP  L++ V P+ILSF    +K+S+ V V+    +++   +S SLVW D  + VRSP++ 
Sbjct  681   APPALSIQVQPSILSFKSVGEKQSFAVTVTASVDESV---LSASLVWDDGEYKVRSPVVA  737

Query  2268  Y  2270
             Y
Sbjct  738   Y  738



>ref|XP_010419558.1| PREDICTED: xylem serine proteinase 1-like [Camelina sativa]
Length=753

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/712 (48%), Positives = 471/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PD+ T  A+  H N+L+     +E AR+ ++HSY ++F+ F A L P E+++
Sbjct  42    YIIYLGDGPDN-TDEAIKAHINLLSSLNISQEEARDRKVHSYTKAFNAFAANLSPNESKK  100

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++VV V+RN   +L TT+SWDF+G+   A R+ K E D+I+G+LDTG+  ES SF+
Sbjct  101   MMEMEEVVGVYRNEYRQLHTTKSWDFVGLPLTAKRHVKTERDVIIGVLDTGITPESESFQ  160

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  161   DHGLGPPPAKWKGSCGPYTNFTGCNNKIIGAKYFKHDGNVPTGEIRSPIDIDGHGTHTSS  220

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  221   TVAGVLVSNASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVDI  280

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  281   ISISIGGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  340

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F    K YPL+SG   A+ K+  Y   Y   D  S+ 
Sbjct  341   DRTFKSKIDLGNGKSFSGMGISMFNPKAKSYPLVSGVDAAKTKDDKYLARYCFSD--SLD  398

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + T+K   G G +I +D+  D     M PAT V+   G  I 
Sbjct  399   RKKVKGKVMVCRMGGGGVESTVKSYGGAGAIIVNDQYLDNAQIFMAPATSVNSSIGDAIY  458

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              YIN+T++P+A I ++R V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+   
Sbjct  459   GYINSTRSPSAVIQKTRQVTVPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFILK  518

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  519   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISS  578

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  579   RVNKDAEFAYGGGQINPRRAASPGLVYDMDDMSYIQFLCGEGYNATTLAPLVGSRSVSCS  638

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+   ++AP G+ ++V
Sbjct  639   SIVPGLGHDSLNYPTIQLTLRSAKTSTL-AVFRRRVTNVGPASSVYNVTVRAPKGVEITV  697

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  L+F + +QKRS+KVVV GK Q +    +SG LVWK   HSVRSPI++Y
Sbjct  698   EPQSLTFSKVSQKRSFKVVVKGK-QMSPGKIVSGLLVWKSPRHSVRSPIVIY  748



>ref|XP_008461729.1| PREDICTED: cucumisin-like isoform X1 [Cucumis melo]
Length=767

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/717 (49%), Positives = 475/717 (66%), Gaps = 21/717 (3%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG  P+D + S    H  +L E +G    A E  +HSY+RSF+GFV +L   E
Sbjct  57    RKIYIVYMGNKPED-SASTPSHHMRMLEEVVG-SSFAPEALLHSYKRSFNGFVVKLTEEE  114

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A+++S K+ VVSVF N +  L TTRSWDF+G +    R  + ES+++VG+LD+G+W ESP
Sbjct  115   AQKISAKENVVSVFPNEKKHLHTTRSWDFMGFTQNVPRVKQVESNIVVGVLDSGIWPESP  174

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQ-YFNVEGFAPEDQESPADFDGHGSH  686
             SF D GYGPPPAKWKG CQ   NF  CNRK+IGA+ Y + + F PED +SP D DGHG+H
Sbjct  175   SFSDVGYGPPPAKWKGACQTSANFR-CNRKIIGARAYRSDKFFPPEDIKSPRDSDGHGTH  233

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS  AG +V  ASLYG+A GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGV
Sbjct  234   TASTVAGGLVNQASLYGLASGTARGGVPSARIAVYKICWSDGCYDADILAAFDDAIADGV  293

Query  867   DVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+IS+SVGG+ P+ +F D IAIG++H+MK  I+T+ +AGN+GP + TI+N SPW ++VAA
Sbjct  294   DIISLSVGGNRPKYYFNDSIAIGAFHSMKHGILTSNSAGNDGPDYFTIRNFSPWSLSVAA  353

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYL  1217
             +SIDR+  S V+LGN  +  G++INTF+L GK YPLI    A + +  + G+ S  C   
Sbjct  354   SSIDRKLVSRVQLGNKNIYQGYTINTFDLKGKQYPLIYAGSAPNISGGFTGSSSRFCSRN  413

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKK  1394
             S+   LV+GKIV C S  S    +     +GV+ +D  + D      +P++ +   DG  
Sbjct  414   SVDRNLVKGKIVLCDSVLSPATFVSLNGAMGVVMNDLGVKDNARSYPLPSSYLKPVDGNN  473

Query  1395  IDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             I  Y++  K PTA I +S AV  T+AP++ SFS+RGP   + +ILKPDL APG+ ILAA+
Sbjct  474   IKTYMDRNKFPTATILKSNAVNDTSAPWIVSFSSRGPNPETYDILKPDLTAPGVEILAAW  533

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             + +AT++  V D+R   YN+ SGTSM+ PHA  AA YVKTFHP WSPAAIKSALMTTA  
Sbjct  534   SPIATVSSGVRDSRTTLYNIISGTSMSCPHATAAAVYVKTFHPTWSPAAIKSALMTTATP  593

Query  1752  MKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             +  K       A GAG I P KAV PGL++D  + +Y+ +LC + +  A +  L+G  DN
Sbjct  594   LNAKLNTQVEFAYGAGHINPLKAVHPGLLYDAYERDYVRFLCGQGYTTAMVRRLSG--DN  651

Query  1926  K-CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTG  2099
               C    + +  D LNYPS  L  T  +A +F+  F RTVT VG+  + ++AK + AP G
Sbjct  652   SFCSRANSGRVWD-LNYPSFALSST--SAQSFNQFFRRTVTNVGSKVSTYRAKVVGAPRG  708

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L+++V P +LSF    QK+S+ + + G  +++I   +S SL+W D  H+VRSPI V+
Sbjct  709   LSITVNPPVLSFNAIGQKKSFTLTIRGSIRQSI---VSASLMWSDGYHNVRSPITVF  762



>ref|XP_002301316.2| hypothetical protein POPTR_0002s15330g [Populus trichocarpa]
 gb|EEE80589.2| hypothetical protein POPTR_0002s15330g [Populus trichocarpa]
Length=709

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/689 (48%), Positives = 461/689 (67%), Gaps = 19/689 (3%)
 Frame = +3

Query  249   EELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMS  428
             E+  +E  I+SY + F+ F A+L   EAR+LS  D+V+SVF N   KL TT+SWDF+G+ 
Sbjct  29    EDEQKESIIYSYTKIFNAFAAKLSKAEARKLSLLDEVLSVFPNRYHKLHTTKSWDFIGLP  88

Query  429   TKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIG  608
             + A RN K E +++VGLLDTG+  +S SFKDDG+GPPP KW+G C    NF+GCN K++G
Sbjct  89    STAKRNLKMERNIVVGLLDTGITPQSESFKDDGFGPPPRKWRGTCSHYANFSGCNNKLVG  148

Query  609   AQYFNVEGFA-PEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIA  785
             A+YF ++G   P D  SP D DGHG+H +S  AG +V  ASL+G+A G ARG VP AR+A
Sbjct  149   ARYFKLDGNPDPSDILSPVDVDGHGTHTSSTLAGNLVPDASLFGLARGVARGAVPDARVA  208

Query  786   SYKVCW-GQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIV  962
              YKVCW   GC DMD+LA F+AAI DGVDV+SIS+GG    +  + IAIG++HAMK  I+
Sbjct  209   MYKVCWVSSGCSDMDLLAAFEAAIHDGVDVLSISIGGVSADYVSNAIAIGAFHAMKNGII  268

Query  963   TTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKM  1139
             T A+ GN+GP   ++ N +PWL+TVAA+ IDR F S V+LGNG+++SG  +NTFE   K+
Sbjct  269   TVASGGNDGPSSSSVANHAPWLLTVAASGIDREFRSKVELGNGKIVSGIGVNTFEPKQKL  328

Query  1140  YPLISGTLA----QDKNATYPGNYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHG  1304
             YP++SG  A     D+ A +      C   S+  K V+GK+V C L     D  +K I G
Sbjct  329   YPIVSGADAGYSRSDEGARF------CADGSLDPKKVKGKLVLCELEVWGADSVVKGIGG  382

Query  1305  VG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVP  1481
              G ++ S++  D     M PAT+V+     K++ YI++TK+P+A I+R++ VK  APF+ 
Sbjct  383   KGTILESEQYLDAAQIFMAPATVVNATVSDKVNNYIHSTKSPSAVIYRTQEVKVPAPFIA  442

Query  1482  SFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPH  1661
             SFS+RGP   S  ILKPD+AAPG+ ILA+YT L ++TG   DT+  ++++ SGTSMA PH
Sbjct  443   SFSSRGPNPGSERILKPDVAAPGIDILASYTPLRSLTGLKGDTQHSRFSLMSGTSMACPH  502

Query  1662  AAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIF  1838
              AG AAY+K+FHP+W+ AAIKSA++TTAK M  +    A  A GAG + P KA  PGL++
Sbjct  503   VAGVAAYIKSFHPNWTAAAIKSAILTTAKPMSSRVNNDAEFAYGAGQVNPDKARNPGLVY  562

Query  1839  DINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATT  2015
             D+++  Y+ +LC E +N +SL  L GSK   C ++    G D LNYP+M L + N +  T
Sbjct  563   DMDEMSYIQFLCHEGYNRSSLAVLVGSKSVNCSSLLPGIGYDALNYPTMQLSVKNKHEPT  622

Query  2016  FSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKA  2195
                 F RTVT VG   +++ A I+AP G+ + V P  LSF +++QKRS+KVVV  K   +
Sbjct  623   V-GVFIRTVTNVGPSPSIYNATIQAPKGVDIVVKPMSLSFSRSSQKRSFKVVVKAKPMPS  681

Query  2196  ISWYMSGSLVWKDNTHSVRSPILVYRSLQ  2282
              S  +SGSLVWK N H V+SPI++++ L 
Sbjct  682   -SQMLSGSLVWKSNQHIVKSPIVIFKPLD  709



>gb|KEH20533.1| subtilisin-like serine protease [Medicago truncatula]
Length=744

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/717 (48%), Positives = 473/717 (66%), Gaps = 12/717 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             Q+K YIV++G  P      +++ H NIL+        A+E  ++SY +SF+ F A+L   
Sbjct  33    QKKFYIVFLGAHPVSRE-GSIESHLNILSAVKQSHVEAKESIVYSYTKSFNAFAAKLSED  91

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +LS  ++V+SV  N   KL TTRSWDF+G+   A R  K ESD IV +LDTG+  E 
Sbjct  92    EANKLSAMNEVLSVLSNKYRKLHTTRSWDFIGLPLTAKRKLKQESDTIVAILDTGITPEF  151

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADFDGHGS  683
              SFKDDG GPPPAKW+G C K +NF+GCN K++GA+YF ++G +   D  SP D  GHG+
Sbjct  152   RSFKDDGLGPPPAKWRGTCDKYVNFSGCNNKIVGAKYFKLDGRSESSDILSPIDVSGHGT  211

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIAD  860
             H AS AAG +V  ASL+G+A GTARG VPSAR+A YKVCW + GC DMDVLAGF+AAI D
Sbjct  212   HTASTAAGNLVPNASLFGLANGTARGAVPSARLAIYKVCWKEDGCADMDVLAGFEAAIDD  271

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             G DVIS+S+GG   ++ QD I+IG++HAM+K I+T A+AGN+GP   T++N +PW++TVA
Sbjct  272   GADVISVSLGGENSNYLQDSISIGAFHAMRKGIITVASAGNDGPTMATVENHAPWVVTVA  331

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+ IDR F S V+LG    +SG  +NTF    K YPLI+G  A  +N++   N   C   
Sbjct  332   ASGIDRDFHSTVELGTRTNVSGEGVNTFSPKQKQYPLINGMDAA-RNSSSKDNAKFCAKG  390

Query  1218  SISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGK  1391
             S+    V+GKIVYC   + S +  +K + G+G I   D+  D+    M PAT V+   G+
Sbjct  391   SLEPNKVKGKIVYCKFRTWSTEAVVKAVGGIGTIVEYDEFQDSPETFMAPATFVNRSTGQ  450

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              I  YI +T++P+A I +S  VK  APFV SFS+RGP + S ++LKPD+ APG+SILA++
Sbjct  451   IITNYIQSTRSPSAVIHKSHEVKIPAPFVASFSSRGPNSGSQHVLKPDVTAPGISILASF  510

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T   ++T    DT+   + + SGTSMA PH +G AAYVK+FHP+W+PAAI+SA+MTTAK 
Sbjct  511   TLRHSITSIEGDTQFSVFTLMSGTSMACPHISGIAAYVKSFHPNWTPAAIRSAIMTTAKP  570

Query  1752  MKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             M  K    A  A GAGL+ PT+A+ PGLI+D+++  Y+ +LC E +N ++L  L GS  N
Sbjct  571   MSQKVNKEAEFAFGAGLVNPTRALNPGLIYDMDEFGYVQFLCHEGYNGSTLSILIGSPVN  630

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C ++    G D +NYPSM L +     +T    F R VT VG G T++ A IK+P G+ 
Sbjct  631   -CTSLLPGIGHDAINYPSMQLSVKRNTESTI-GVFRRRVTNVGPGPTMYNATIKSPKGVE  688

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             ++V P  L F  T QK+++KVVV  K   ++   +SGSL+W++  + VRSPI++Y S
Sbjct  689   ITVKPTSLIFYHTLQKKNFKVVVKAKSMASMK-IVSGSLIWRNPRYIVRSPIVIYSS  744



>ref|XP_002277563.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=742

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/716 (49%), Positives = 466/716 (65%), Gaps = 22/716 (3%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG+ P    ISAV  H N+L +  G   +A +  ++SY+RSF+GFV +L   E
Sbjct  35    RKEYIVYMGDKPSG-DISAVTAHTNMLQQVFG-SNIASDSLLYSYKRSFNGFVVKLTEEE  92

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
              + L   D VVS+F N + KL TTRSWDF+G   + NR    ESD+I+ +LDTG+W ES 
Sbjct  93    MKELEGMDGVVSIFPNEKKKLHTTRSWDFIGFPQQVNRT-SVESDVIIAVLDTGIWPESD  151

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSH  686
             SFKD G+GPPP+KWKG CQ   NFT CN K+IGA+Y+   G F+PED ++P D +GHG+H
Sbjct  152   SFKDKGFGPPPSKWKGICQGLSNFT-CNNKIIGARYYRSYGEFSPEDLQTPRDSEGHGTH  210

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGV
Sbjct  211   TASTAAGGLVSMASLLGFGLGTARGGVPSARIAVYKICWSDGCADADILAAFDDAIADGV  270

Query  867   DVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+IS+SVGG  P+++F D IAIG++HAMK  I+T+ +AGN+GP F +I N SPW ++VAA
Sbjct  271   DIISLSVGGSTPKNYFADSIAIGAFHAMKNGILTSTSAGNDGPNFASITNFSPWSLSVAA  330

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
             ++IDR+F + V+LG+ ++  G SINTFE   MYP I G  A +    +  N S  C   S
Sbjct  331   STIDRKFFTKVQLGDSKVYEGISINTFEPNGMYPFIYGGDAPNITGGFSANTSRFCTRNS  390

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHG-VGVIASDK-LPDTVLPTMIPATIVDIEDGKK  1394
             +   LV+GKIV C      + T  ++ G VG + +D+   D+  P  +PA+ +  +DG  
Sbjct  391   LDPNLVKGKIVLC--DIFSNGTGAFLAGAVGTVMADRGAKDSAWPFPLPASYLGAQDGSS  448

Query  1395  IDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             I  Y+ +T  PTA I +S  V  T APF+ SFS+RGP   +L+ILKPDLAAPG+ ILAA+
Sbjct  449   IAYYVTSTSNPTASILKSTEVNDTLAPFIVSFSSRGPNPATLDILKPDLAAPGVHILAAW  508

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
               ++ ++G   DTR V Y ++SGTSMA PHA GAAAY+K+FHP WSPAAIKSALMTTA  
Sbjct  509   PPISPISGVQGDTRAVLYTMQSGTSMACPHATGAAAYIKSFHPTWSPAAIKSALMTTALP  568

Query  1752  MKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             M   K   A  A GAG I P K+V PGL++D +K +Y+ +LC + +   +L  +TG  DN
Sbjct  569   MSAEKNPDAEFAYGAGQIDPLKSVNPGLVYDADKIDYVKFLCGQGYTTQTLQLVTG--DN  626

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK-APTGL  2102
                +         LNYPS    L++    + +  F RTVT VG+  + +KA +  AP GL
Sbjct  627   SVCSEATNGTVWDLNYPS--FALSSSTFESITGVFTRTVTNVGSPVSTYKATVTGAPIGL  684

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              + VVP+ILSF    QK S+ + V GK    I   +S SLVW D  H VRSPI+V+
Sbjct  685   QIQVVPDILSFTSLGQKLSFVLKVEGKVGDNI---VSASLVWDDGVHQVRSPIVVF  737



>ref|XP_009762586.1| PREDICTED: xylem serine proteinase 1 isoform X1 [Nicotiana sylvestris]
Length=749

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/713 (48%), Positives = 468/713 (66%), Gaps = 16/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV++ + P +   S    H  +L+   G +  A E  ++SY + F+ F A+L   E   
Sbjct  38    YIVFLKDHPVNEE-SLFQRHIIVLSSLKGSDGAATESHVYSYTKIFNAFAAKLSQHEVHM  96

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  D+VVSV  N   KL TTRSW+F+G+   A R  K ES++IVG+ DTG+  +S SFK
Sbjct  97    LSSMDEVVSVIPNRYRKLHTTRSWEFIGLPATAKRRLKRESNIIVGVFDTGITPQSKSFK  156

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             DDG GPPP KWKG C    NF+GCN K+IGA+YF ++    P D  SP D  GHG+H +S
Sbjct  157   DDGLGPPPVKWKGSCGHFANFSGCNNKLIGARYFKLDKVPDPNDILSPIDVHGHGTHTSS  216

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVDV  872
               AG MV  ASL+G+A GTARG VPSAR+A YKVCW   GC D+D+LA F+AAI+DGVD+
Sbjct  217   TLAGSMVPDASLFGLARGTARGAVPSARVAMYKVCWVTSGCADIDILAAFEAAISDGVDL  276

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   S+  D IAIGS+HAM+K I+T A+AGN+GP   T+ N +PW++TVAA+ I
Sbjct  277   ISISIGGLSGSYTTDVIAIGSFHAMRKGILTVASAGNDGPNLNTVANHAPWMLTVAASGI  336

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F S V LGNG ++SG  ++ F+   K+YPL +G  +A+  +      Y  C   S+ 
Sbjct  337   DREFRSKVALGNGRIVSGIGVSAFDPKKKLYPLTAGVDMAKSSDTRDSSRY--CGEGSMD  394

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              + V+GK+VYC L +   D  IK + G+G +I SD+  D+    M PATIV+   GK I+
Sbjct  395   PRKVKGKLVYCQLGTWGADSVIKELGGIGTIIESDQFLDSAPIFMAPATIVNSSIGKSIN  454

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              YI++ + P+A I++S+ VK  APF+ SFS+RGP   ++ +LKPD+AAPG+ ILA+YT+L
Sbjct  455   NYIHSERLPSAVIYKSQEVKIKAPFIASFSSRGPNPGTIRLLKPDIAAPGIDILASYTSL  514

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  ++ + SGTSM+ PH  GAAAYVK++HPDWSP+AIKSALMTTA+ M  
Sbjct  515   KSLTGLKGDTQYSEFTLMSGTSMSCPHVGGAAAYVKSYHPDWSPSAIKSALMTTARPMSS  574

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             K    A  A GAG + PTKA +PGLI+D++   Y+ +LC E +N++S+ SL   + N C 
Sbjct  575   KVDREAEFAYGAGQVNPTKARSPGLIYDMDDMSYIQFLCHEGYNSSSVSSLLRQRVN-CS  633

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
              +  A G D +NYP+M L L +    T    F R VT VG   +V+ A I+AP G+ ++V
Sbjct  634   TLIPANGEDAINYPTMQLGLKSNQEPTI-GIFRRKVTNVGQAISVYNATIRAPKGVDITV  692

Query  2115  VPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF +  Q RS+KVVV  K    A+   +SGSL+WK + H VRSPI++Y
Sbjct  693   KPTTLSFTRAMQTRSFKVVVKAKPMSNAV--ILSGSLIWKSSRHLVRSPIVIY  743



>ref|XP_009762587.1| PREDICTED: xylem serine proteinase 1 isoform X2 [Nicotiana sylvestris]
Length=748

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/713 (48%), Positives = 468/713 (66%), Gaps = 16/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV++ + P +   S    H  +L+   G +  A E  ++SY + F+ F A+L   E   
Sbjct  37    YIVFLKDHPVNEE-SLFQRHIIVLSSLKGSDGAATESHVYSYTKIFNAFAAKLSQHEVHM  95

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  D+VVSV  N   KL TTRSW+F+G+   A R  K ES++IVG+ DTG+  +S SFK
Sbjct  96    LSSMDEVVSVIPNRYRKLHTTRSWEFIGLPATAKRRLKRESNIIVGVFDTGITPQSKSFK  155

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             DDG GPPP KWKG C    NF+GCN K+IGA+YF ++    P D  SP D  GHG+H +S
Sbjct  156   DDGLGPPPVKWKGSCGHFANFSGCNNKLIGARYFKLDKVPDPNDILSPIDVHGHGTHTSS  215

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVDV  872
               AG MV  ASL+G+A GTARG VPSAR+A YKVCW   GC D+D+LA F+AAI+DGVD+
Sbjct  216   TLAGSMVPDASLFGLARGTARGAVPSARVAMYKVCWVTSGCADIDILAAFEAAISDGVDL  275

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   S+  D IAIGS+HAM+K I+T A+AGN+GP   T+ N +PW++TVAA+ I
Sbjct  276   ISISIGGLSGSYTTDVIAIGSFHAMRKGILTVASAGNDGPNLNTVANHAPWMLTVAASGI  335

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F S V LGNG ++SG  ++ F+   K+YPL +G  +A+  +      Y  C   S+ 
Sbjct  336   DREFRSKVALGNGRIVSGIGVSAFDPKKKLYPLTAGVDMAKSSDTRDSSRY--CGEGSMD  393

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              + V+GK+VYC L +   D  IK + G+G +I SD+  D+    M PATIV+   GK I+
Sbjct  394   PRKVKGKLVYCQLGTWGADSVIKELGGIGTIIESDQFLDSAPIFMAPATIVNSSIGKSIN  453

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              YI++ + P+A I++S+ VK  APF+ SFS+RGP   ++ +LKPD+AAPG+ ILA+YT+L
Sbjct  454   NYIHSERLPSAVIYKSQEVKIKAPFIASFSSRGPNPGTIRLLKPDIAAPGIDILASYTSL  513

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  ++ + SGTSM+ PH  GAAAYVK++HPDWSP+AIKSALMTTA+ M  
Sbjct  514   KSLTGLKGDTQYSEFTLMSGTSMSCPHVGGAAAYVKSYHPDWSPSAIKSALMTTARPMSS  573

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             K    A  A GAG + PTKA +PGLI+D++   Y+ +LC E +N++S+ SL   + N C 
Sbjct  574   KVDREAEFAYGAGQVNPTKARSPGLIYDMDDMSYIQFLCHEGYNSSSVSSLLRQRVN-CS  632

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
              +  A G D +NYP+M L L +    T    F R VT VG   +V+ A I+AP G+ ++V
Sbjct  633   TLIPANGEDAINYPTMQLGLKSNQEPTI-GIFRRKVTNVGQAISVYNATIRAPKGVDITV  691

Query  2115  VPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF +  Q RS+KVVV  K    A+   +SGSL+WK + H VRSPI++Y
Sbjct  692   KPTTLSFTRAMQTRSFKVVVKAKPMSNAV--ILSGSLIWKSSRHLVRSPIVIY  742



>emb|CBI31596.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/709 (49%), Positives = 461/709 (65%), Gaps = 20/709 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+LP    ISA   H N+L +  G    A EY +HSY+RSF+GFVA+L   E ++LS  
Sbjct  1     MGDLPKG-DISASTLHTNMLQQVFGSR--ASEYLLHSYQRSFNGFVAKLTMEEKKKLSGI  57

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             + VVSVF N + +L TTRSWDF+G   K  R    ESD+I+G+LDTG+W ES SF D+G+
Sbjct  58    EGVVSVFPNGKKQLHTTRSWDFMGFPQKVKRT-TTESDIIIGMLDTGIWPESASFSDEGF  116

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAG  707
             GP P+KWKG CQ   NFT CN K+IGA+Y+  +G   P D +SP D  GHG+H AS AAG
Sbjct  117   GPQPSKWKGTCQTSSNFT-CNNKIIGARYYRTDGKLGPTDIKSPRDSLGHGTHTASTAAG  175

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
             RMV GASL G+  G ARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SV
Sbjct  176   RMVRGASLLGLGSGAARGGVPSARIAVYKICWHDGCPDADILAAFDDAIADGVDIISLSV  235

Query  888   GGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG+ P  +F+D IAIG++H+MK  I+T+ +AGN GP   TI N SPW ++VAA++IDR+F
Sbjct  236   GGYDPYDYFEDSIAIGAFHSMKNGILTSNSAGNTGPDPATITNFSPWSLSVAASTIDRKF  295

Query  1065  ESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVR  1241
              + VKLGN ++  G S+NTFE+  MYP+I G  A +    Y  +YS  C   S+ + LV 
Sbjct  296   VTKVKLGNNKVYEGVSVNTFEMDDMYPIIYGGDAPNTTGGYDSSYSRYCYEDSLDKSLVD  355

Query  1242  GKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKKIDKYINTT  1418
             GKIV C    S    I     VG +  D    D+     +PA+ +D  DG K+  Y+N+T
Sbjct  356   GKIVLCDWLTSGKAAIA-AGAVGTVMQDGGYSDSAYIYALPASYLDPRDGGKVHHYLNST  414

Query  1419  KAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
               P A I +S  VK   APFV SFS+RGP  I+ +ILKPDL APG+ ILAA+T  +++TG
Sbjct  415   SKPMAIIQKSVEVKDELAPFVVSFSSRGPNPITSDILKPDLTAPGVDILAAWTEASSVTG  474

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP-IG  1772
             +  DTRVV Y++ SGTSM+ PHA+ AAAY+K+FHP WSPAAIKSALMTTA  M +K    
Sbjct  475   KEGDTRVVPYSIISGTSMSCPHASAAAAYIKSFHPTWSPAAIKSALMTTAARMSVKTNTD  534

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAA  1949
                A GAG I P KAV PGLI+D  ++ Y+++LC + ++   L  +TG K + C      
Sbjct  535   MEFAYGAGHIDPVKAVHPGLIYDAGEANYVNFLCGQGYSTKHLRLITGDK-STCSATMNG  593

Query  1950  QGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNIL  2129
                D LNYPS    ++  +  T +  F RTVT VG+  + +KA +  P+GL+V V P++L
Sbjct  594   TVWD-LNYPS--FTISTKSGVTVTRIFTRTVTNVGSAVSTYKAILAVPSGLSVKVEPSVL  650

Query  2130  SFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             SF    QK+++ + V     K +   +SGSLVW D  H VRSPI+ + S
Sbjct  651   SFKSLGQKKTFTMTVGTAVDKGV---ISGSLVWDDGIHQVRSPIVAFVS  696



>ref|XP_002875042.1| hypothetical protein ARALYDRAFT_490544 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51301.1| hypothetical protein ARALYDRAFT_490544 [Arabidopsis lyrata subsp. 
lyrata]
Length=752

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/712 (49%), Positives = 469/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+  DD T  A+  H N+L+     +E A+E +++SY ++F+ F A+L P EA++
Sbjct  41    YIIYLGDRLDD-TEEAIKRHINLLSSLNMSQEEAKERKVYSYTKAFNAFAAKLSPHEAKK  99

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++VV V RN   KL TT+SWDF+G+   A R+ KAE D+I+G+LDTG+  ES SF 
Sbjct  100   MMEMEEVVGVSRNQYRKLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPESESFH  159

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  160   DHGLGPPPAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVPTGEIRSPIDIDGHGTHTSS  219

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  220   TVAGVLVANASLYGIANGTARGAVPSARLAMYKVCWERSGCADMDILAGFEAAIHDGVDI  279

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  280   ISISIGGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  339

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F    K YPL+SG   A+  +  Y   Y   D  S+ 
Sbjct  340   DRTFKSKIDLGNGKSFSGMGISMFNPKAKSYPLVSGVDAAKTTDDKYLARYCFSD--SLD  397

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + T+K   G G +I SD+  D     M PAT V+   G  I 
Sbjct  398   RKKVKGKVMVCRMGGGGVESTVKSYGGAGAIIVSDQYQDNAQIFMAPATSVNSSVGDIIY  457

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++P+A I ++R V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+T  
Sbjct  458   RYINSTRSPSAVIQKTRQVTIPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFTLK  517

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  518   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISR  577

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  578   RVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGSRSVSCS  637

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+   ++AP G+ ++V
Sbjct  638   SIVPGLGHDSLNYPTIQLTLRSAKTSTL-AVFRRRVTNVGAPSSVYNVTVRAPKGVEITV  696

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF + +QKRS+KVVV  K Q      +SG LVWK   HSVRSPI++Y
Sbjct  697   EPRSLSFSKASQKRSFKVVVKAK-QMIPGKIVSGLLVWKSPRHSVRSPIVIY  747



>ref|XP_004510915.1| PREDICTED: xylem serine proteinase 1-like [Cicer arietinum]
Length=747

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/719 (48%), Positives = 472/719 (66%), Gaps = 16/719 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             Q+  YIV++G         AV+ H NIL+        A+E  ++SY +SF+ F A+L   
Sbjct  32    QKDFYIVFLGTHSVSRE-GAVETHLNILSTVKQSHHEAKESIVYSYTKSFNAFAAKLSED  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +LS  ++V+SVF N   KL TTRSWDF+G+   A R  K ESD IV LLDTG+  E 
Sbjct  91    EANKLSAMNEVLSVFLNQYRKLHTTRSWDFIGLPLTAKRKLKLESDTIVALLDTGITPEF  150

Query  507   PSF---KDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              SF   KDDG+GPPP KW+G C K +NF+GCN K+IGA+YF ++G + P D  SP D  G
Sbjct  151   HSFHSFKDDGFGPPPVKWRGTCDKYVNFSGCNNKIIGAKYFKLDGRSDPSDILSPIDVGG  210

Query  675   -HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDA  848
              HG+H AS AAG +V  ASL+G+A+GTARG VPSAR+A YKVCW Q GC DMD+LA F+A
Sbjct  211   GHGTHTASTAAGNLVPNASLFGLAKGTARGAVPSARLAIYKVCWKQDGCADMDILAAFEA  270

Query  849   AIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             AI DGV+VIS+S+GG   ++ QD +AIG++HAM+K I+T A+AGN+GP   T+ N +PW+
Sbjct  271   AIHDGVNVISVSLGGENANYLQDTLAIGAFHAMRKGIITVASAGNDGPTMATVVNNAPWI  330

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             +TVAA+ IDR F S ++LGN + +SG  I+TF    K YPL++G  A  ++A+   N   
Sbjct  331   VTVAASGIDRDFHSTIELGNRKNVSGLGISTFSPKQKQYPLVNGVDAA-RDASSKENAKF  389

Query  1206  CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDI  1379
             C   S+  K V+GKIVYC   + S +  +K I G+G I   D+  D     M PAT V+ 
Sbjct  390   CLEDSLEPKKVKGKIVYCRFKTWSTEAVVKAIGGIGTIVEYDQFLDVAEIFMAPATFVNK  449

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
               G+ I  YI TT++P+A I +S  VK  APFV SFS+RGP   S ++LKPD+ APG+SI
Sbjct  450   STGQIITNYIQTTRSPSAVIDKSHEVKIPAPFVASFSSRGPNPGSQHVLKPDVTAPGISI  509

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA+YT   ++TG   DT+  ++ + SGTSM+ PH +G AAYVK+FHPDWSPAAI+SA++T
Sbjct  510   LASYTLRTSITGLEGDTQFSEFTLMSGTSMSCPHVSGVAAYVKSFHPDWSPAAIRSAIIT  569

Query  1740  TAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TAK M  K    A  A GAG + PT+AV PGL++D++   Y+ +LC E +N ++L  L G
Sbjct  570   TAKPMSQKFNKEAEFAFGAGQVNPTRAVNPGLVYDMDDFAYIQFLCHEGYNGSTLSVLIG  629

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             S  N C ++    G D +NYPSM L + +   TT    F R VT VG G T++ + IK+P
Sbjct  630   SPIN-CTSLLPGIGHDAINYPSMQLSVKSNTETTI-GVFRRRVTNVGPGPTIYNSTIKSP  687

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              G+ ++V P  L F  T QKRS+KV V  K   ++   +SGSL+W+   + VRSPI++Y
Sbjct  688   KGVEITVKPTSLIFSHTLQKRSFKVSVKAKSMSSMQ-IVSGSLIWRSPRYIVRSPIVIY  745



>gb|KFK30606.1| hypothetical protein AALP_AA6G003600 [Arabis alpina]
Length=752

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/711 (48%), Positives = 472/711 (66%), Gaps = 12/711 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PDD    A+  H N+L+     +E A+E  ++SY ++F+ F A+L   E+++
Sbjct  42    YIIYLGDRPDDRD-EAIKTHINLLSSLDISQEEAKERMVYSYTKAFNAFAAKLSLHESKK  100

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++V+ VFRN   +L TT+SWDF+G+   A R+ K E D+I+G+LDTG+  +S SF+
Sbjct  101   MMEMEEVLGVFRNQYRQLHTTKSWDFVGLPLTAKRHLKTERDVIIGVLDTGITPDSESFQ  160

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  161   DHGLGPPPAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNIPTGETRSPLDIDGHGTHTSS  220

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQG-CQDMDVLAGFDAAIADGVDV  872
              AAG +V  ASL+GIA G ARG VPSAR+A YKVCW +G C DMD+LAGF+AAI DGVD+
Sbjct  221   TAAGVLVSNASLFGIANGIARGAVPSARLAMYKVCWSRGGCADMDILAGFEAAIHDGVDI  280

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   S+  D I++GS+HAM+K I+T A+AGN+GP   ++ N  PW++TVAA+ I
Sbjct  281   ISISIGGPIVSYSSDSISVGSFHAMRKGILTVASAGNDGPSSSSVTNHEPWILTVAASGI  340

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F+   K YPL++G   A+  +  Y   Y   D  S+ 
Sbjct  341   DRTFKSQIDLGNGKSFSGMGISMFKPNAKSYPLVTGVDAAKTSDDKYLARYCFTD--SLD  398

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
              K V+G++V C +    + T+K   G G ++ SD+  D     M PAT V+   G  I +
Sbjct  399   RKKVKGRVVVCRAGGGAESTVKRYGGAGAILVSDQYLDNAQIFMAPATAVNSSIGDAIYR  458

Query  1404  YINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             YIN+T++P+A I +SR V  +APFV SFS+RGP   S+ +LKPD+AAPG+ ILAA+T   
Sbjct  459   YINSTRSPSAVIQKSRQVTVSAPFVASFSSRGPNPASIRLLKPDIAAPGIDILAAFTLKR  518

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM-KI  1760
             ++TG   DT+  K+ + SGTSMA PHAAG AAYVK+FHPDWSPAAIKSA++T+AK + K 
Sbjct  519   SLTGLDGDTQFSKFTILSGTSMACPHAAGVAAYVKSFHPDWSPAAIKSAIITSAKPISKR  578

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
                 A  A G G I P +A +PGL++D++   Y+ +LC E +N+ +L  L GSK   C +
Sbjct  579   VNKDAEFAYGGGQINPRRAASPGLVYDMDDMSYVQFLCGEGYNSTTLAPLVGSKSVSCSS  638

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
             I    G D LNYP++ L L    ++T  A F R VT VG  S+V+ A + AP G+ ++V 
Sbjct  639   IVPGIGHDSLNYPTIQLTLKTAKSSTL-AVFRRRVTNVGPPSSVYNAIVTAPKGVEITVE  697

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P  LSF + +Q RS+KVVV  + Q      +SG LVWK   HSVRSPI++Y
Sbjct  698   PKTLSFTKASQTRSFKVVVKAQ-QMTPEKIVSGLLVWKSPRHSVRSPIVIY  747



>ref|XP_003623809.1| Xylem serine proteinase [Medicago truncatula]
 gb|AES80027.1| subtilisin-like serine protease [Medicago truncatula]
Length=900

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/712 (47%), Positives = 472/712 (66%), Gaps = 12/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV+ G  P +  I A++   N+L+   G    A+E  ++SY +SF+ F A+L   E  +
Sbjct  193   YIVFFGVQPVNRDI-ALETQLNVLSSVKGSYHEAKESIVYSYTKSFNAFAAKLSEDEVNK  251

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  D+V+ VF+N   KL TTRSW+F+G+   A R  K E D++V LLDTG+  ES SFK
Sbjct  252   LSAMDEVLLVFKNQYRKLHTTRSWNFIGLPLTAKRRLKLERDIVVALLDTGITPESKSFK  311

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             DDG GPPPAKWKG C+   NF+GCN K+IGA+YF  +G   P D  SP D DGHG+H AS
Sbjct  312   DDGLGPPPAKWKGTCKHYANFSGCNNKIIGAKYFKADGNPDPADILSPIDVDGHGTHTAS  371

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
              AAG +V+ A+L+G+A GT+RG VPSAR+A YKVCW   GC DMD+LA F+AAI DGVDV
Sbjct  372   TAAGDLVQNANLFGLANGTSRGAVPSARLAIYKVCWSSTGCADMDILAAFEAAIHDGVDV  431

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I+IG++HAM+K I+T A+AGN+GP  GT+ N +PW++T AA+ I
Sbjct  432   ISISIGGGSPDYVHDSISIGAFHAMRKGIITVASAGNDGPSMGTVTNTAPWIVTAAASGI  491

Query  1053  DRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISE  1229
             DR F+S V+LG+G+ +SG  I+ F+  +  YP+I+G  A  K++    +   C+  S+  
Sbjct  492   DRAFKSTVQLGSGKNVSGVGISCFDPKQNRYPIINGIDAA-KDSKSKEDAKFCNSGSLQA  550

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKY  1406
               V+GK+VYC+ S   + T+K I G+G VI  D  PD    ++ PA IV+   G+ I  Y
Sbjct  551   NKVKGKLVYCIGSWGTEATVKEIGGIGSVIEYDNYPDVAQISIAPAAIVNHSIGETITNY  610

Query  1407  INTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALAT  1586
             I +T++P+A I++S   K  APF  +FS+RGP   S ++LKPD+AAPG+ ILA+YT   +
Sbjct  611   IKSTRSPSAVIYKSHEEKVLAPFTATFSSRGPNPGSKHLLKPDIAAPGIDILASYTLRKS  670

Query  1587  MTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP  1766
             +TG   DT+  ++++ SGTSMA PH AG AAYVK+FHP W+PAAI+SA++TTAK M  K 
Sbjct  671   LTGLAGDTQFSEFSIISGTSMACPHVAGVAAYVKSFHPKWTPAAIRSAIITTAKPMS-KR  729

Query  1767  IG--AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
             I   A  A G+G + PT+AV+PGLI+D++   Y+ +LC E +  +SL +L GS  N C +
Sbjct  730   INNEAEFAFGSGQLNPTRAVSPGLIYDMDDLGYIQFLCHEGYKGSSLSALIGSPIN-CSS  788

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
             +    G D +NYP+M L L +   T     F RTVT VG     + A I++P G+ ++V 
Sbjct  789   LIPGLGYDAINYPTMQLSLESKKETQI-GVFRRTVTNVGPVPITYNATIRSPKGVEITVK  847

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             P++LSF +  QKRS+KV+V  K        +SGSL+W+   + VRSPI++Y+
Sbjct  848   PSVLSFDKKMQKRSFKVIVKVKSIITSMEILSGSLIWRSPRYIVRSPIVIYK  899



>ref|XP_007220705.1| hypothetical protein PRUPE_ppa021240mg [Prunus persica]
 gb|EMJ21904.1| hypothetical protein PRUPE_ppa021240mg [Prunus persica]
Length=751

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/718 (47%), Positives = 466/718 (65%), Gaps = 11/718 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + Q+K YIVY+G+   +    A   H +IL+        A E  ++SY +SF+ F A+L 
Sbjct  35    NDQKKFYIVYLGDHTVNEDSEAAQTHMDILSSVKESYVEAEESMVYSYTKSFNAFAAKLS  94

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA RLS  D+V+SV  N   KL TT+SWDF+G+  KA RN K E D+IVGL DTG+  
Sbjct  95    SDEAERLSGMDEVLSVLPNRYHKLHTTKSWDFIGLPLKARRNLKLERDIIVGLFDTGITP  154

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             ES SFK DG+GPPPAKWKG C    NF+GCN K+IGA+YF ++G   P D  SP D DGH
Sbjct  155   ESKSFKGDGFGPPPAKWKGTCGHFANFSGCNNKIIGAKYFKLDGNPDPTDILSPIDVDGH  214

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAI  854
             G+H +S  AG  V  ASL+G+A GTARG VPSAR+A YKVCW   GC DMD+LA +DAAI
Sbjct  215   GTHTSSTLAGNQVPNASLFGLAMGTARGAVPSARVAMYKVCWASSGCTDMDILAAYDAAI  274

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVDVIS S+ G   ++ +D +AIG++HAMKK I+T A+AGN+GP  G++ N +PW +T
Sbjct  275   HDGVDVISFSISGGVANYVRDSVAIGAFHAMKKGIITVASAGNDGPSLGSVVNHAPWFVT  334

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+ IDR+F S V LGNG+ +SG  +NTF   K +YPL+SG     +N+    +   C 
Sbjct  335   VAASGIDRQFISKVHLGNGKDVSGIGVNTFNPKKNLYPLVSGVDVA-RNSQTKESARFCV  393

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               S+    V+GK+V C L +   D  +K I GVG +I  D+L D     M P T+V+   
Sbjct  394   QDSLDPNKVKGKLVLCKLENWGADSVVKGIGGVGTIIEDDQLLDAAQIFMAPGTMVNDTI  453

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
              + ID+YI++T++P+A I +S+  K  APF+ SFS+RGP   S  ILKPD+AAPG+ ILA
Sbjct  454   AEIIDEYIHSTRSPSAVISKSQEAKKRAPFIASFSSRGPNPGSERILKPDIAAPGVDILA  513

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +YT   ++TG   DT+  ++ + SGTSM+ PH AG  AYVK+FHP WSPAA++SA++TTA
Sbjct  514   SYTLRKSLTGLEGDTQYSEFTLMSGTSMSCPHVAGVVAYVKSFHPHWSPAALRSAILTTA  573

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKS-EYMSYLCKE-FNNASLGSLTGS  1916
             K M  +    A L+ G G + PTKAV PGL++D++ +  Y+ +LC E +  +SL  L GS
Sbjct  574   KPMSQRGNSDAELSYGVGQVNPTKAVNPGLVYDMDGTLSYIQFLCHEGYKGSSLAPLVGS  633

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
             K   C ++   QG D LNYP+M L L +    T    F RTVT VG   + + A I+AP 
Sbjct  634   KSVNCSSLLPGQGYDALNYPTMQLSLKSSKQPTV-GVFRRTVTNVGPAKSTYNATIRAPK  692

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             G+ + V P  LSF  T +KR+++VVV      ++   +SGSL WK + ++VRSPI+++
Sbjct  693   GVEIIVKPMSLSFSTTLEKRTFQVVVKANPMPSMR-MISGSLGWKSSRYTVRSPIVIH  749



>gb|KHN29417.1| Xylem serine proteinase 1 [Glycine soja]
Length=672

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/676 (49%), Positives = 456/676 (67%), Gaps = 19/676 (3%)
 Frame = +3

Query  273   IHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPK  452
             ++SY ++ + F A+L   EA++LS  D+V+ VF+N   +L TTRSW+F+G+ T A R  K
Sbjct  2     VYSYTKTLNAFAAKLSEDEAKKLSAMDEVLLVFQNQYRQLHTTRSWNFIGLPTTAKRRLK  61

Query  453   AESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG  632
             +ESD+IV LLDTG   ES SFKDDG+GPPPA+WKG C    NF+GCN+K+IGA+YF  +G
Sbjct  62    SESDIIVALLDTGFTPESKSFKDDGFGPPPARWKGSCGHYANFSGCNKKIIGAKYFKADG  121

Query  633   FA-PEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ  809
                P D  SP D DGHG+H AS  AG +V  A+L+G+A GTARG VPSAR+A YKVCW  
Sbjct  122   NPDPSDILSPVDADGHGTHTASTVAGNLVPNANLFGLANGTARGAVPSARLAIYKVCWSS  181

Query  810   -GCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNE  986
              GC DMD+LA FDAAI DGVDVISIS+GG   S+ +D I+IG++HAM+K I+T A+AGN 
Sbjct  182   SGCADMDILAAFDAAIHDGVDVISISIGGGNPSYVEDSISIGAFHAMRKGIITVASAGNS  241

Query  987   GPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTL  1163
             GP  GT+ N +PW++TVAA+ IDR F S V+LGNG+ +SG  +N F+  GK YPLI+G  
Sbjct  242   GPSLGTVTNTAPWIVTVAASGIDRTFRSTVQLGNGKNVSGVGVNCFDPKGKQYPLINGVD  301

Query  1164  AQDKNATYPGNYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPD  1337
             A  K++    +   C   ++    V+GK+VYC L +   +  +K I G+G +I SD+ PD
Sbjct  302   AA-KDSKDKEDAGFCYEGTLQPNKVKGKLVYCKLGTWGTESVVKGIGGIGTLIESDQYPD  360

Query  1338  TVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISL  1517
                  M PATIV    G  I KYI +T++P+A I++SR ++  APF  SFS+RGP   S 
Sbjct  361   VAQIFMAPATIVTSGTGDTITKYIQSTRSPSAVIYKSREMQMQAPFTASFSSRGPNPGSQ  420

Query  1518  NILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFH  1697
             N+LKPD+AAPGL ILA+YT   ++TG   DT+  ++ + SGTSMA PH AG A+YVK+FH
Sbjct  421   NVLKPDVAAPGLDILASYTLRKSLTGLKGDTQFSEFILMSGTSMACPHVAGVASYVKSFH  480

Query  1698  PDWSPAAIKSALMTTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLC  1874
             P W+PAAI+SA++TTAK M  +    A  A GAG + P  AV+PGL++D++   Y+ +LC
Sbjct  481   PHWTPAAIRSAIITTAKPMSKRVNNEAEFAYGAGQLNPRSAVSPGLVYDMDALGYIQFLC  540

Query  1875  KE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYV  2051
              E +  +SL +L GS  N C ++    G D +NYP+M L L + N  T    F RTVT V
Sbjct  541   HEGYKGSSLSALVGSPVN-CSSLLPGLGHDAINYPTMQLSLES-NKGTRVGVFRRTVTNV  598

Query  2052  GTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISW----YMSGS  2219
             G   T++ A +++P G+ ++V P  L+F +T QKRS+KVVV     KA S      +SGS
Sbjct  599   GPAPTIYNATVRSPKGVEITVKPTSLTFSKTMQKRSFKVVV-----KATSIGSEKIVSGS  653

Query  2220  LVWKDNTHSVRSPILV  2267
             L+W+   + VRSPI++
Sbjct  654   LIWRSPRYIVRSPIVI  669



>gb|KGN49552.1| hypothetical protein Csa_5G000010 [Cucumis sativus]
Length=743

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/720 (49%), Positives = 465/720 (65%), Gaps = 13/720 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D ++  YIV++   P    +  V+ H N+L         A E  ++SY +SF+ F A+L
Sbjct  26    EDEEKNHYIVFLENKPVLNEVDVVETHLNLLMSVKKSHAEASESMVYSYTKSFNAFAAKL  85

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA+ LS +  V  V  N   KL TTRSWDF+G+S+ A R+ K ESD+IVGL DTG+ 
Sbjct  86    SDDEAKLLSTRKDVHHVIPNKYRKLQTTRSWDFIGLSSNARRSTKHESDIIVGLFDTGIT  145

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
               + SFKDDG+GPPP KWKG C    NFT CN+K+IGA+YF ++G   P D  SP D DG
Sbjct  146   PTADSFKDDGFGPPPKKWKGTCHHFANFTACNKKLIGARYFKLDGNPDPSDILSPVDTDG  205

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAA  851
             HG+H +S A G  + GASL G+AEGTARGGVPSAR+A YKVCW   GC DMD+LA FDAA
Sbjct  206   HGTHTSSTATGNAIAGASLSGLAEGTARGGVPSARVAMYKVCWTSSGCSDMDILAAFDAA  265

Query  852   IADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             I DGVDVISIS+GG    ++  D I+IG++HAMKK I+T  +AGN GP  G++ N +PW+
Sbjct  266   IQDGVDVISISIGGGGFNNYSDDSISIGAFHAMKKGIITVTSAGNGGPTAGSVVNHAPWI  325

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             +TVAA+SIDR+F S ++LGNG+ ISG  IN F    KMYPL+SG     +N+      S 
Sbjct  326   VTVAASSIDRKFISPLELGNGKNISGVGINIFNPKQKMYPLVSGGDVA-RNSESKDTASF  384

Query  1206  CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGV-IASDKLPDTVLPTMIPATIVDI  1379
             C   ++    V+G +V+C L +   D  IK I   GV I SD+  D     M PAT+V  
Sbjct  385   CLEGTLDPTKVKGSLVFCKLLTWGADSVIKSIGANGVIIQSDEFLDNADIFMAPATMVSS  444

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
               G  I  YI +T+ PTA I++++ +K  AP V SFS+RGP   S  ILKPD+AAPG+ I
Sbjct  445   LVGNIIYTYIKSTRTPTAVIYKTKQLKAKAPMVASFSSRGPNPGSHRILKPDIAAPGVDI  504

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAAYT L ++TGQ  DT+  K+ + SGTSMA PH A AAAYVK+FHP WSPAAI+SAL+T
Sbjct  505   LAAYTPLKSLTGQKGDTQYSKFTLMSGTSMACPHVAAAAAYVKSFHPLWSPAAIRSALLT  564

Query  1740  TAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             TA  +  ++ P G + A GAG + P++A++PGLI+D+N+  Y+ +LC E +  +S+  L+
Sbjct  565   TATPISRRLNPEGEF-AYGAGNLNPSRAISPGLIYDLNEISYIQFLCSEGYTGSSIAVLS  623

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             G+K   C N+   QG D LNYP+  L L + N    +  F R VT VG   +V+ A I A
Sbjct  624   GTKSINCSNLIPGQGHDSLNYPTFQLSLKSTN-QPMTTTFRRRVTNVGHPISVYNATINA  682

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P G+T++V P  LSF +  QKRS+KVVV      + +  +SGSL W    H VRSPI+VY
Sbjct  683   PPGVTITVTPPTLSFSRLLQKRSFKVVVKASPLPS-AKMVSGSLAWVGAQHVVRSPIVVY  741



>gb|KEH19005.1| subtilisin-like serine protease [Medicago truncatula]
Length=754

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/717 (48%), Positives = 472/717 (66%), Gaps = 15/717 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTI--SAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             Q+  YIV++G   D P     AV+ H NIL+        A+E  ++SY +SF+ F A+L 
Sbjct  42    QKNFYIVFLGG--DHPVSREGAVETHLNILSAVKESHVEAKESIVYSYTKSFNAFAAKLS  99

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA +LS  ++V+SV  N   KL TTRSWDF+G+   A R  K+E D IV LLDTG+  
Sbjct  100   EDEANKLSSMNEVLSVIPNQYRKLHTTRSWDFIGLPLTAKRKLKSEGDTIVALLDTGITP  159

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             E  SFKDDG+GPPPAKWKG C K +NF+GCN K+IGA+YF ++G + P D  SP D +GH
Sbjct  160   EFQSFKDDGFGPPPAKWKGTCDKYVNFSGCNNKIIGAKYFKLDGRSNPSDILSPIDVEGH  219

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAI  854
             G+H AS AAG +V  ASL+G+A+G ARG V SAR+A YK+CW + GC DMD+LA F+AAI
Sbjct  220   GTHTASTAAGNIVPNASLFGLAKGMARGAVHSARLAIYKICWTEDGCADMDILAAFEAAI  279

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVDVIS+S+GG   ++ QD IAIG++HAM+K I+T A+AGN GP   T+ N +PW++T
Sbjct  280   HDGVDVISVSLGGGNENYAQDSIAIGAFHAMRKGIITVASAGNGGPTMATVVNNAPWIVT  339

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+ IDR F+S ++LG+ + +SG  ++TF    K YPL++G  A  + ++   +   CD
Sbjct  340   VAASGIDRDFQSTIELGSRKNVSGEGVSTFSPKQKQYPLVNGMDAA-RASSSKEDAKFCD  398

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               S+  K V+GKIVYC   +   D  +K I G+G +I +D+  D       PAT V+   
Sbjct  399   GDSLEPKKVKGKIVYCRYRTWGTDAVVKAIGGIGTIIENDQFVDFAQIFSAPATFVNEST  458

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G+ I  YI +T++P+A I +S+ VK  APFV SFS+RGP   S  ILKPD+ APG++ILA
Sbjct  459   GQAITNYIKSTRSPSAVIHKSQEVKIPAPFVASFSSRGPNPGSQRILKPDITAPGINILA  518

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             AYT   +++G   DT+  ++ + SGTSM+ PH +G AAYVK+FHPDW+PAAI+SA++TTA
Sbjct  519   AYTLKTSISGLEGDTQFSEFTLMSGTSMSCPHVSGVAAYVKSFHPDWTPAAIRSAIITTA  578

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             K M  K    A  A GAG + PT+AV PGL++D++   Y+ +LC E +N ++L  L GS 
Sbjct  579   KPMSQKVNREAEFAFGAGQVNPTRAVNPGLVYDMDDFAYIQFLCHEGYNGSTLSVLIGSS  638

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
              N C ++    G D +NYPSM L +     TT    F R VT VG G T+F A IK+P G
Sbjct  639   IN-CTSLLPGIGHDAINYPSMQLNVKRNTDTTI-GVFRRRVTNVGPGQTIFNATIKSPKG  696

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             + ++V P  L F  T QKRS+KVVV  K   ++   +S SL+W+   + VRSPI++Y
Sbjct  697   VEITVKPTSLIFSHTLQKRSFKVVVKAKSMASMK-IVSASLIWRSPRYIVRSPIVIY  752



>ref|NP_567155.1| xylem serine proteinase 1 [Arabidopsis thaliana]
 sp|Q9LLL8.1|XSP1_ARATH RecName: Full=Xylem serine proteinase 1; Short=AtXSP1; AltName: 
Full=Cucumisin-like protein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF25830.1|AF190794_1 subtilisin-type serine endopeptidase XSP1 [Arabidopsis thaliana]
 gb|AEE81840.1| xylem serine proteinase 1 [Arabidopsis thaliana]
Length=749

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/712 (48%), Positives = 472/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PD+ T   +  H N+L+     +E A+E +++SY ++F+ F A+L P EA++
Sbjct  38    YIIYLGDRPDN-TEETIKTHINLLSSLNISQEEAKERKVYSYTKAFNAFAAKLSPHEAKK  96

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++VVSV RN   KL TT+SWDF+G+   A R+ KAE D+I+G+LDTG+  +S SF 
Sbjct  97    MMEMEEVVSVSRNQYRKLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPDSESFL  156

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  157   DHGLGPPPAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVPAGEVRSPIDIDGHGTHTSS  216

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGV++
Sbjct  217   TVAGVLVANASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVEI  276

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  277   ISISIGGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  336

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F    K YPL+SG   A++ +  Y   Y   D  S+ 
Sbjct  337   DRTFKSKIDLGNGKSFSGMGISMFSPKAKSYPLVSGVDAAKNTDDKYLARYCFSD--SLD  394

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+GK++ C +     + TIK   G G +I SD+  D     M PAT V+   G  I 
Sbjct  395   RKKVKGKVMVCRMGGGGVESTIKSYGGAGAIIVSDQYLDNAQIFMAPATSVNSSVGDIIY  454

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++ +A I ++R V   APFV SFS+RGP   S+ +LKPD+AAPG+ ILAA+T  
Sbjct  455   RYINSTRSASAVIQKTRQVTIPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLK  514

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  
Sbjct  515   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISR  574

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L G++   C 
Sbjct  575   RVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCS  634

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T  A F R VT VG  S+V+ A ++AP G+ ++V
Sbjct  635   SIVPGLGHDSLNYPTIQLTLRSAKTSTL-AVFRRRVTNVGPPSSVYTATVRAPKGVEITV  693

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF + +QKRS+KVVV  K Q      +SG LVWK   HSVRSPI++Y
Sbjct  694   EPQSLSFSKASQKRSFKVVVKAK-QMTPGKIVSGLLVWKSPRHSVRSPIVIY  744



>gb|KEH19004.1| subtilisin-like serine protease [Medicago truncatula]
Length=727

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/713 (48%), Positives = 470/713 (66%), Gaps = 15/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTI--SAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             YIV++G   D P     AV+ H NIL+        A+E  ++SY +SF+ F A+L   EA
Sbjct  19    YIVFLGG--DHPVSREGAVETHLNILSAVKESHVEAKESIVYSYTKSFNAFAAKLSEDEA  76

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
              +LS  ++V+SV  N   KL TTRSWDF+G+   A R  K+E D IV LLDTG+  E  S
Sbjct  77    NKLSSMNEVLSVIPNQYRKLHTTRSWDFIGLPLTAKRKLKSEGDTIVALLDTGITPEFQS  136

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHI  689
             FKDDG+GPPPAKWKG C K +NF+GCN K+IGA+YF ++G + P D  SP D +GHG+H 
Sbjct  137   FKDDGFGPPPAKWKGTCDKYVNFSGCNNKIIGAKYFKLDGRSNPSDILSPIDVEGHGTHT  196

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGV  866
             AS AAG +V  ASL+G+A+G ARG V SAR+A YK+CW + GC DMD+LA F+AAI DGV
Sbjct  197   ASTAAGNIVPNASLFGLAKGMARGAVHSARLAIYKICWTEDGCADMDILAAFEAAIHDGV  256

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             DVIS+S+GG   ++ QD IAIG++HAM+K I+T A+AGN GP   T+ N +PW++TVAA+
Sbjct  257   DVISVSLGGGNENYAQDSIAIGAFHAMRKGIITVASAGNGGPTMATVVNNAPWIVTVAAS  316

Query  1047  SIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
              IDR F+S ++LG+ + +SG  ++TF    K YPL++G  A  + ++   +   CD  S+
Sbjct  317   GIDRDFQSTIELGSRKNVSGEGVSTFSPKQKQYPLVNGMDAA-RASSSKEDAKFCDGDSL  375

Query  1224  SEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKI  1397
               K V+GKIVYC   +   D  +K I G+G +I +D+  D       PAT V+   G+ I
Sbjct  376   EPKKVKGKIVYCRYRTWGTDAVVKAIGGIGTIIENDQFVDFAQIFSAPATFVNESTGQAI  435

Query  1398  DKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
               YI +T++P+A I +S+ VK  APFV SFS+RGP   S  ILKPD+ APG++ILAAYT 
Sbjct  436   TNYIKSTRSPSAVIHKSQEVKIPAPFVASFSSRGPNPGSQRILKPDITAPGINILAAYTL  495

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
               +++G   DT+  ++ + SGTSM+ PH +G AAYVK+FHPDW+PAAI+SA++TTAK M 
Sbjct  496   KTSISGLEGDTQFSEFTLMSGTSMSCPHVSGVAAYVKSFHPDWTPAAIRSAIITTAKPMS  555

Query  1758  IK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
              K    A  A GAG + PT+AV PGL++D++   Y+ +LC E +N ++L  L GS  N C
Sbjct  556   QKVNREAEFAFGAGQVNPTRAVNPGLVYDMDDFAYIQFLCHEGYNGSTLSVLIGSSIN-C  614

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
              ++    G D +NYPSM L +     TT    F R VT VG G T+F A IK+P G+ ++
Sbjct  615   TSLLPGIGHDAINYPSMQLNVKRNTDTTI-GVFRRRVTNVGPGQTIFNATIKSPKGVEIT  673

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             V P  L F  T QKRS+KVVV  K   ++   +S SL+W+   + VRSPI++Y
Sbjct  674   VKPTSLIFSHTLQKRSFKVVVKAKSMASMK-IVSASLIWRSPRYIVRSPIVIY  725



>ref|XP_008454753.1| PREDICTED: xylem serine proteinase 1-like [Cucumis melo]
Length=746

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/724 (49%), Positives = 465/724 (64%), Gaps = 21/724 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              + ++  +IV++   P    + AV+ H ++L         A E  ++SY +SF+ F A+L
Sbjct  29    ENEEKNHFIVFLQNKPVLNEVDAVETHLSVLMSVKKSHAEASESMVYSYTKSFNAFAAKL  88

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA+ LS +  V  V  NT  KL TTRSWDF+G+S+ A R  K ESD+IVGL DTG+ 
Sbjct  89    SDHEAKLLSTRKDVHHVIPNTYRKLQTTRSWDFIGLSSNARRRTKHESDIIVGLFDTGIT  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
               + SF+DDG+GPPP KWKG C    NFT CN+K+IGA+YF ++G   P D  SP D DG
Sbjct  149   PTADSFRDDGFGPPPKKWKGTCHHFANFTACNKKLIGARYFKLDGNPDPSDILSPVDTDG  208

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAA  851
             HG+H +S A G  V GASL G+AEGTARGGVPSAR+A YKVCW   GC DMD+LA FDAA
Sbjct  209   HGTHTSSTATGNAVAGASLSGLAEGTARGGVPSARVAMYKVCWASSGCSDMDILAAFDAA  268

Query  852   IADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             I DGVDVISIS+GG    ++  D I+IG++HAMKK I+T  +AGN GP  G++ N +PW+
Sbjct  269   IQDGVDVISISIGGGGFNNYSDDSISIGAFHAMKKGIITVTSAGNGGPMAGSVVNHAPWI  328

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA  1205
             +TVAA+SIDR+F S ++LGNG+ ISG  IN F    KMYPL+SG     +N+      S 
Sbjct  329   VTVAASSIDRKFISPLELGNGKNISGVGINIFNPKKKMYPLVSGGDVA-RNSESKDTASF  387

Query  1206  CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVI-ASDKLPDTVLPTMIPATIVDI  1379
             C   S+    V+G +V+C L +   D  IK +   GVI  SD+  D     M PAT+V  
Sbjct  388   CLEDSLDPTKVKGSLVFCKLLTWGADSVIKSVGANGVIIQSDQFLDNADIFMAPATMVSS  447

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
               G  I  YI +T+ PTA I+++R +K  AP V SFS+RGP   S  ILKPD+AAPG++I
Sbjct  448   SVGTIIYTYIKSTRTPTAVIYKTRQLKAKAPMVASFSSRGPNPGSHRILKPDIAAPGVNI  507

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA YT L ++TGQ  DT+  K+ + SGTSMA PH A AAAYVK+FHP WSPAAI+SAL+T
Sbjct  508   LAGYTPLKSLTGQKGDTQYSKFTIMSGTSMACPHVAAAAAYVKSFHPLWSPAAIRSALLT  567

Query  1740  TAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             T + +  ++ P G + A GAG + P+KA++PGLI+D+N+  Y+ +LC E +  +S+  L 
Sbjct  568   TTRPISRRLNPEGEF-AYGAGNLNPSKAISPGLIYDLNEMSYIQFLCSEGYTGSSIAVLA  626

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTN---PNATTFSAAFYRTVTYVGTGSTVFKAK  2081
             G+K   C  +    G D LNYP+  L L +   P  TTF     R VT VG   +V+ A 
Sbjct  627   GTKSINCSTLIPGHGHDSLNYPTFQLSLRSTKQPMTTTFR----RQVTNVGQPVSVYNAT  682

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSP  2258
             IKAP G+ ++V P  LSF +  QKRS+KVVV     Q A    +SGSL W  + H VRSP
Sbjct  683   IKAPPGVKITVTPTTLSFSRLLQKRSFKVVVKASPLQSA--KMVSGSLAWVGDRHVVRSP  740

Query  2259  ILVY  2270
             I+VY
Sbjct  741   IVVY  744



>ref|XP_003636898.1| Xylem serine proteinase [Medicago truncatula]
Length=718

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/713 (48%), Positives = 470/713 (66%), Gaps = 15/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTI--SAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             YIV++G   D P     AV+ H NIL+        A+E  ++SY +SF+ F A+L   EA
Sbjct  10    YIVFLGG--DHPVSREGAVETHLNILSAVKESHVEAKESIVYSYTKSFNAFAAKLSEDEA  67

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
              +LS  ++V+SV  N   KL TTRSWDF+G+   A R  K+E D IV LLDTG+  E  S
Sbjct  68    NKLSSMNEVLSVIPNQYRKLHTTRSWDFIGLPLTAKRKLKSEGDTIVALLDTGITPEFQS  127

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHI  689
             FKDDG+GPPPAKWKG C K +NF+GCN K+IGA+YF ++G + P D  SP D +GHG+H 
Sbjct  128   FKDDGFGPPPAKWKGTCDKYVNFSGCNNKIIGAKYFKLDGRSNPSDILSPIDVEGHGTHT  187

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGV  866
             AS AAG +V  ASL+G+A+G ARG V SAR+A YK+CW + GC DMD+LA F+AAI DGV
Sbjct  188   ASTAAGNIVPNASLFGLAKGMARGAVHSARLAIYKICWTEDGCADMDILAAFEAAIHDGV  247

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             DVIS+S+GG   ++ QD IAIG++HAM+K I+T A+AGN GP   T+ N +PW++TVAA+
Sbjct  248   DVISVSLGGGNENYAQDSIAIGAFHAMRKGIITVASAGNGGPTMATVVNNAPWIVTVAAS  307

Query  1047  SIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
              IDR F+S ++LG+ + +SG  ++TF    K YPL++G  A  + ++   +   CD  S+
Sbjct  308   GIDRDFQSTIELGSRKNVSGEGVSTFSPKQKQYPLVNGMDAA-RASSSKEDAKFCDGDSL  366

Query  1224  SEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKI  1397
               K V+GKIVYC   +   D  +K I G+G +I +D+  D       PAT V+   G+ I
Sbjct  367   EPKKVKGKIVYCRYRTWGTDAVVKAIGGIGTIIENDQFVDFAQIFSAPATFVNESTGQAI  426

Query  1398  DKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
               YI +T++P+A I +S+ VK  APFV SFS+RGP   S  ILKPD+ APG++ILAAYT 
Sbjct  427   TNYIKSTRSPSAVIHKSQEVKIPAPFVASFSSRGPNPGSQRILKPDITAPGINILAAYTL  486

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
               +++G   DT+  ++ + SGTSM+ PH +G AAYVK+FHPDW+PAAI+SA++TTAK M 
Sbjct  487   KTSISGLEGDTQFSEFTLMSGTSMSCPHVSGVAAYVKSFHPDWTPAAIRSAIITTAKPMS  546

Query  1758  IK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
              K    A  A GAG + PT+AV PGL++D++   Y+ +LC E +N ++L  L GS  N C
Sbjct  547   QKVNREAEFAFGAGQVNPTRAVNPGLVYDMDDFAYIQFLCHEGYNGSTLSVLIGSSIN-C  605

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
              ++    G D +NYPSM L +     TT    F R VT VG G T+F A IK+P G+ ++
Sbjct  606   TSLLPGIGHDAINYPSMQLNVKRNTDTTI-GVFRRRVTNVGPGQTIFNATIKSPKGVEIT  664

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             V P  L F  T QKRS+KVVV  K   ++   +S SL+W+   + VRSPI++Y
Sbjct  665   VKPTSLIFSHTLQKRSFKVVVKAKSMASMK-IVSASLIWRSPRYIVRSPIVIY  716



>gb|KDP44852.1| hypothetical protein JCGZ_01352 [Jatropha curcas]
Length=706

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/714 (49%), Positives = 465/714 (65%), Gaps = 20/714 (3%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIVYMG+ P    I A D H N+L + LG +    +  I+SY+R F+GF A+L   E  +
Sbjct  4     YIVYMGDRPKS-EIFASDHHANMLQQVLGSD--GSDSMIYSYKRGFNGFAAKLTNEEMLK  60

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             L++ + VVSVF + + +L TTRSWDF+G S +  RN   ESD+I+G+LDTG+W ES SF 
Sbjct  61    LADMEGVVSVFPSEKKQLHTTRSWDFMGFSQQVRRNTIVESDIIIGMLDTGIWPESESFN  120

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D+ +GPPP KWKG CQK  NFT CN K+IGA+Y+  +G+ P D   SP D +GHG+H +S
Sbjct  121   DEQFGPPPTKWKGICQKSSNFT-CNNKIIGARYYRSDGYFPPDNIISPRDSEGHGTHTSS  179

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVI  875
             IAAG +V+ A++ G+A GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+I
Sbjct  180   IAAGNLVQKATMAGLAPGTARGGVPSARIAVYKICWSDGCADADILAAFDDAIADGVDII  239

Query  876   SISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             SISVGG +P  +F D IAIGS+HAMK  I T+A+AGN GPY  T+ N +PW ++VAA++I
Sbjct  240   SISVGGFYPVDYFNDTIAIGSFHAMKHNIFTSASAGNSGPYPATVTNFAPWFLSVAASTI  299

Query  1053  DRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQD-KNATYPGNYSACDYLSIS  1226
             DR+F ++VKLGNG    G SINT  L  K YP+I G  A D KN         C   S++
Sbjct  300   DRKFFTNVKLGNGATFQGVSINTKYLNHKKYPVIYGGNAPDIKNGFNVSISRYCVQHSLN  359

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATIVDIEDGKKIDK  1403
             ++LV+GKIV C    S   T      +G I  D     V     +PA+ +++ DG  + +
Sbjct  360   KELVKGKIVLC-DYISTGETASVAGAIGTIMQDGYSQDVAYNFPLPASHLNLNDGFDVSE  418

Query  1404  YINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             Y+N T+ PTA I +S A K   AP+V SFS+RGP  IS +IL PD+AAPG++ILAA+T  
Sbjct  419   YVNRTRKPTATISKSIAKKDELAPYVVSFSSRGPNPISKDILTPDIAAPGVNILAAWTEG  478

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              T+TG   D R++ +N  SGTSMA PHA  AAAY+K+FHP WSPAAIKSALMTTA  M  
Sbjct  479   NTITGIFGDDRILPFNTISGTSMACPHATAAAAYIKSFHPTWSPAAIKSALMTTAFPMSA  538

Query  1761  -KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
              K   A  A GAG I PT+A+ PGL++DI + +Y+ +LC + ++   L  +TG  +N C 
Sbjct  539   EKNPQAEFAYGAGHIDPTEAINPGLVYDIGEDQYIEFLCGQGYSTKQLQFVTG-DNNSCS  597

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
               P    A  LN PS    L+ P+  +    F+R VT VG+  + +KA +KAP  L ++V
Sbjct  598   EEPKTTSA-ALNCPS--FTLSAPSGQSVGRVFHRAVTNVGSAISTYKAIVKAPESLKINV  654

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
              PN+LSF    +K+ ++V V+ K   +    +SGSL+W D  H VRSPI+ Y S
Sbjct  655   SPNVLSFKNFGEKKLFRVTVTAKVGNS---SISGSLIWDDGEHKVRSPIVAYVS  705



>ref|XP_006339775.1| PREDICTED: xylem serine proteinase 1-like [Solanum tuberosum]
Length=746

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/719 (47%), Positives = 468/719 (65%), Gaps = 18/719 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D +   YIV++ + P +   SA   H ++L+   G +  A E  ++SY + F+ F A+L 
Sbjct  31    DRKEDFYIVFLKDNPANEE-SAFQRHIDVLSSLKGRD--ATESHVYSYTKIFNAFAAKLS  87

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               E  +LS  D+V SV  N   KL TTRSW+F+G+   A R  K ES++IVG+ DTGV  
Sbjct  88    QYEVHKLSSMDEVASVIPNRYRKLHTTRSWEFIGLPATAKRRLKGESNIIVGVFDTGVTP  147

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             +S SFKDDG GPPPAKWKG C    NF+GCN K+IGA+YF ++    P D  SP D  GH
Sbjct  148   QSKSFKDDGLGPPPAKWKGSCHHFANFSGCNNKLIGARYFKLDKVPDPNDIMSPIDVHGH  207

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAI  854
             G+H +S  AG MV  ASL+G+A GTARG VPSAR+A YKVCW   GC D+D+LA F+AAI
Sbjct  208   GTHTSSTLAGSMVPDASLFGLARGTARGAVPSARVAMYKVCWATSGCSDIDILAAFEAAI  267

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVD+ISIS+GG    +  D I++G++HAM+K I+T A+AGN+GP   T+ N +PW++T
Sbjct  268   IDGVDIISISIGGLTGGYTTDVISVGAFHAMRKGILTVASAGNDGPNLNTVANHAPWVLT  327

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSAC  1208
             VAA+ IDR F S V LGNG  +SG  +N F+   K+YPL  G  +A+  +      Y  C
Sbjct  328   VAASGIDREFRSKVLLGNGRTVSGIGVNAFDPKQKLYPLAMGVDIAKSSDTRESSRY--C  385

Query  1209  DYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIE  1382
                S+  + V+GK+VYC L S   D  +K + G+G +I SD+  D+    M PATIV+  
Sbjct  386   SEGSMDPRKVKGKLVYCQLGSWGVDSVVKELGGIGTIIESDQFLDSAPIFMAPATIVNSS  445

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
              GK ++ Y+++ + P+A I++S+ VK  APF+ SFS+RGP   + ++LKPD+AAPG+ IL
Sbjct  446   IGKSMNSYMHSDRLPSAVIYKSQEVKIKAPFIASFSSRGPNPGTKHLLKPDIAAPGIDIL  505

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             A+YT + ++TG   DT+  ++ + SGTSM+ PH  GAAAYVK+FHPDWSP+AIKSA+MTT
Sbjct  506   ASYTPMKSLTGLKGDTQYSEFTLMSGTSMSCPHVGGAAAYVKSFHPDWSPSAIKSAIMTT  565

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             A++M  K    A  A GAG + P KA +PGL++D++   Y+ +LC E +N++S+ SL   
Sbjct  566   ARSMSSKVDREAEFAYGAGQVNPMKARSPGLVYDMDDMGYIQFLCHEGYNSSSVSSLLRQ  625

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
             + N C  +  A G D +NYP+M L L +    T    F R VT VG   +V+ A I+AP 
Sbjct  626   QVN-CSTLIPATGEDAINYPTMQLGLKSDQEPTI-GIFRRRVTNVGQAKSVYNATIRAPK  683

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             G+ ++V P  LSF +  QKRS+KVVV  K    AI   +SGSL WK + H VRSPI++Y
Sbjct  684   GVDITVQPMTLSFTRPMQKRSFKVVVKAKPLSNAI--ILSGSLTWKSSRHIVRSPIVIY  740



>ref|XP_007009160.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY17970.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=739

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/720 (48%), Positives = 469/720 (65%), Gaps = 21/720 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              R+ YIVYMG+LP     SA   H N+L   +     A +  ++SY RSF+GF A+L  +
Sbjct  30    DRQLYIVYMGDLPKG-DFSASRLHTNMLQHVV--PSAASDALLYSYHRSFNGFAAKLTNK  86

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA++L  K+ VVSVF + + +L TTRSW+F+G S++       ESD++VG+LDTG+W ES
Sbjct  87    EAQKLRGKEGVVSVFLSQKKQLHTTRSWNFMGFSSRKVERSVIESDVVVGMLDTGIWPES  146

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGS  683
              SF D G+GP PAKWKG CQK  NFT CN+K+IGA+Y+  +G  +P+D +SP D +GHGS
Sbjct  147   ESFNDRGFGPLPAKWKGTCQKSSNFT-CNKKIIGARYYRADGVISPDDFKSPRDAEGHGS  205

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS AAG +V  ASLYG+A+GTARGGVPSARIA YK+CW  GC D D+LA FD AIADG
Sbjct  206   HTASTAAGGLVSKASLYGLAKGTARGGVPSARIAVYKICWSDGCYDADILAAFDDAIADG  265

Query  864   VDVISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             VD+IS+SVG    S +F D IAIG++H+MK  ++T+ +AGN GP   +I N SPW ++VA
Sbjct  266   VDIISLSVGASSASEYFHDSIAIGAFHSMKNGVLTSNSAGNSGPDPASIDNFSPWSLSVA  325

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYSA-CDY  1214
             A++IDR+F + VKLGNGE+  G SINTF+L  KMYP I G +A + +  +    S  C  
Sbjct  326   ASTIDRKFVTKVKLGNGEIYEGTSINTFDLKEKMYPFIFGGVAPNTSQGFTSEDSRYCLA  385

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVI---ASDKLPDTVLPTMIPATIVDIED  1385
              +++E LV+GKIV+C   + +D  I+    VG +     +K  D V    +P + ++++D
Sbjct  386   GTLNETLVKGKIVFCDYDSDRDGPIEGGGAVGAVYQYGGNK--DYVSSHPLPLSNLNMDD  443

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G+ +  Y+NTT+ PTA IF+S       AP+V SFS+RGP  ++ +ILKPDL APG+ IL
Sbjct  444   GRVVFNYVNTTENPTATIFKSYVESNEFAPYVVSFSSRGPNPVTADILKPDLTAPGVDIL  503

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++   ++T    D R+V YN+ SGTSM+ PHA GAAAYVK+FHP WSPAAIKSALMTT
Sbjct  504   AAWSEATSITETEYDNRIVPYNIISGTSMSCPHATGAAAYVKSFHPTWSPAAIKSALMTT  563

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSK  1919
             A  M  K  I    A GAG I P  A  PGLI+D  + +Y+ +LC +  + +   L    
Sbjct  564   AFQMSAKNNIEGEFAYGAGHINPALAAQPGLIYDAGEIDYIKFLCGQGYSPTYLKLITGN  623

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             ++ C         D LNYPS  L  T   + T    F+RTVT VG+  + +K+ +KAP G
Sbjct  624   NSSCSEETNGTVWD-LNYPSFALSATPGKSIT--RVFHRTVTNVGSAVSTYKSIVKAPPG  680

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             L + V P++LSF    QK+S+ V V  +   ++   +SGSL W D  H VRSPI+ Y SL
Sbjct  681   LIIQVQPSVLSFKSLGQKQSFVVTVGAEVGNSM---ISGSLTWDDGLHQVRSPIVAYASL  737



>gb|EPS71713.1| hypothetical protein M569_03043, partial [Genlisea aurea]
Length=712

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/715 (49%), Positives = 465/715 (65%), Gaps = 18/715 (3%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHH-NILTEALGDE-ELAREYRIHSYRRSFSGFVARLLPREA  332
             YIV++ + P D   S++ + H +ILT   G + + A EY IHSY R+ + FVA++   EA
Sbjct  5     YIVFLRDPPKDNESSSLSQKHLDILTSLRGKKRDDASEYLIHSYTRNINAFVAKISGDEA  64

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
               LSE ++V S+F N   +L TT+SWDF+G++   +RNPK E D+IVGLLDTGV  ES S
Sbjct  65    AELSEMEEVSSIFPNRYHELHTTKSWDFIGLTPNVSRNPKVEGDIIVGLLDTGVTPESES  124

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHI  689
             FKDDG GPPP+KWKG C    NF+GCN+K+IGA+YF ++G   P D  SP D +GHG+H 
Sbjct  125   FKDDGLGPPPSKWKGSCG---NFSGCNKKLIGAKYFKLDGEPDPNDILSPTDVEGHGTHT  181

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIADGV  866
             AS  AG  V  ASL+G A GTARGGVPSAR+A YKVCW   GC DMD+LA FDAAI+DGV
Sbjct  182   ASTMAGAPVSNASLFGFANGTARGGVPSARVAVYKVCWASSGCADMDILAAFDAAISDGV  241

Query  867   DVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             DV+S+S+GG    +  D I++GS+ AM+K I+T A+AGN GP  GT+ N +PW++TVAA+
Sbjct  242   DVVSVSLGGVASGYTSDAISVGSFRAMRKGILTVASAGNSGPNHGTVTNHAPWILTVAAS  301

Query  1047  SIDRRFESDVKLGNGELISGFSINTFELGKM-YPLISGT-LAQDKNATYPGNYSACDYLS  1220
                R F S V L NG  +SG  +N F+  K  YPL SGT LA +  A     Y  C   S
Sbjct  302   GTGREFRSKVALINGGTVSGVGLNDFDPKKKPYPLASGTDLAINPRAKDQSMY--CLQDS  359

Query  1221  ISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKK  1394
             +  + V+GK+V+C LSS   D  IK + GVG ++ SD   D     + PAT V+   GK+
Sbjct  360   MDPQKVKGKLVHCKLSSKGTDAIIKGLGGVGAILESDSFLDVSQIYVAPATHVNTSVGKQ  419

Query  1395  IDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             +  YI++T+ P+A I+RS  V T  AP+  SFS+RGP   S +ILKPD+AAPG++ILA+Y
Sbjct  420   VHDYIHSTRNPSAVIYRSEEVTTIPAPYTASFSSRGPNPGSKHILKPDIAAPGINILASY  479

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T L ++TG   D+R  K+ + SGTSMA PH  G AAYVK+FHPDWSPAAIKSA++TTAK 
Sbjct  480   TPLKSVTGFKGDSRHSKFTIMSGTSMACPHVGGVAAYVKSFHPDWSPAAIKSAILTTAKV  539

Query  1752  MKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             M  +    A  A G G + P KAV PGL++D++   Y+ +LC E ++ +S+GSL G    
Sbjct  540   MSSEVDKDAEFAFGTGQVNPIKAVKPGLVYDMDADSYIQFLCGEGYDGSSIGSLIGRGKI  599

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C       G D +NYP+M L L++ N    +  F R V  VG   +V+ A IKAP G+ 
Sbjct  600   NCSEWLPKNGEDAINYPTMQLTLSS-NRKQTTGVFLRRVKNVGAKESVYNATIKAPAGVE  658

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             ++V P+ L F  + +  S++VVV     K +    SGSL WK   HSVRSPI+++
Sbjct  659   ITVKPSTLVFSASVKNISFEVVVKATPVKNVV-ISSGSLTWKSAHHSVRSPIVIF  712



>ref|XP_004149947.1| PREDICTED: cucumisin-like [Cucumis sativus]
 gb|KGN50590.1| hypothetical protein Csa_5G187880 [Cucumis sativus]
Length=704

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/709 (49%), Positives = 469/709 (66%), Gaps = 19/709 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG   +D + S    H  +L E +G    A E  +HSY+RSF+GFV +L   EA+++S K
Sbjct  1     MGNKLED-SASTPSHHMRMLEEVVG-SSFAPEALLHSYKRSFNGFVVKLTEEEAQKISAK  58

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             + VVSVF N +  L TTRSWDF+G + KA R  + ES+++VG+LD+G+W ESPSF D GY
Sbjct  59    ENVVSVFPNEKKHLHTTRSWDFMGFTQKAPRVKQVESNIVVGVLDSGIWPESPSFSDVGY  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQ-YFNVEGFAPEDQESPADFDGHGSHIASIAAG  707
             GPPP KWKG CQ   NF  CNRK+IGA+ Y + + F PED +SP D DGHG+H AS  AG
Sbjct  119   GPPPPKWKGACQTSANFH-CNRKIIGARAYRSDKFFPPEDIKSPRDSDGHGTHTASTVAG  177

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V  ASLYG+A GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SV
Sbjct  178   GLVNQASLYGLALGTARGGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVDIISLSV  237

Query  888   GG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P+ +F D IAIG++H+MK  I+T+ +AGN+GP + TI+N SPW ++VAA+SIDR+ 
Sbjct  238   GGSKPKYYFNDSIAIGAFHSMKHGILTSNSAGNDGPDYFTIRNFSPWSLSVAASSIDRKL  297

Query  1065  ESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              S V+LGN     G++INTF+L GK +PLI    A + +A + G+ S  C   S+   LV
Sbjct  298   VSRVQLGNKNTFQGYTINTFDLKGKQHPLIYAGSAPNISAGFTGSSSRFCSRNSVDRNLV  357

Query  1239  RGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             +GKIV C S  S    +     VGV+ +D  + D      +P++ +D  DG  I  Y++ 
Sbjct  358   KGKIVLCDSVLSPATFVSLNGAVGVVMNDLGVKDNARSYPLPSSYLDPVDGDNIKTYMDR  417

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T+ PTA I +S AV  T+AP++ SFS+RGP   + +ILKPDL APG+ ILAA++ +AT++
Sbjct  418   TRFPTATILKSNAVNDTSAPWIVSFSSRGPNPETYDILKPDLTAPGVEILAAWSPIATVS  477

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PI  1769
               V D+R   YN+ SGTSM+ PHA  AA YVKTFHP WSPAAIKSALMTTA  +  K   
Sbjct  478   SGVRDSRTTLYNIISGTSMSCPHATAAAVYVKTFHPTWSPAAIKSALMTTATPLNAKLNT  537

Query  1770  GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPA  1946
                 A GAG I P +AV PGL++D  +S+Y+ +LC + +  A +  L+G  ++ C    +
Sbjct  538   QVEFAYGAGHINPLRAVHPGLLYDAYESDYVRFLCGQGYTTAMVRRLSG-DNSVCTRANS  596

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSVVPN  2123
              +  D LNYPS  L  T  ++ +F+  F RTVT VG+  + ++AK +  P GL+++V P 
Sbjct  597   GRVWD-LNYPSFALSST--SSQSFNQFFRRTVTNVGSKVSTYRAKVVGVPRGLSITVNPP  653

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             +LSF    QK+S+ + + G   ++I   +S SLVW D  H+VRSPI V+
Sbjct  654   VLSFNAIGQKKSFTLTIRGSISQSI---VSASLVWSDGHHNVRSPITVF  699



>ref|XP_009611955.1| PREDICTED: xylem serine proteinase 1 [Nicotiana tomentosiformis]
Length=748

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/713 (47%), Positives = 464/713 (65%), Gaps = 16/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIV++ + P +   S    H N+L+     +  A E  ++SY + F+ F A+L   E  +
Sbjct  37    YIVFLKDHPVNEE-SVFQRHINVLSSLKESDGDATESHVYSYTKIFNAFAAKLSQHEVHK  95

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  D+VVSV  N   KL TTRSW+F+G+   A R  K ES++IVG+ DTG+  +S SFK
Sbjct  96    LSSMDEVVSVIPNRYRKLHTTRSWEFIGLPATAKRRLKGESNIIVGVFDTGITPQSKSFK  155

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             DDG GPPP KWKG C    NF+GCN K+IGA+YF ++    P D  SP D  GHG+H +S
Sbjct  156   DDGLGPPPVKWKGSCGHFANFSGCNNKLIGARYFKLDKVPDPNDILSPIDVHGHGTHTSS  215

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASL+G+A GTARG VPSAR+A YKVCW   GC D+D+LA F+AAI+DGVD+
Sbjct  216   TLAGSLVPDASLFGLARGTARGAVPSARVAMYKVCWATSGCADIDILAAFEAAISDGVDL  275

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   S+  D IA+GS+HAM+K I+T A+AGN+GP   T+ N +PW++TVAA+ I
Sbjct  276   ISISIGGLSGSYTTDVIAVGSFHAMRKGILTVASAGNDGPNLNTVANHAPWMLTVAASGI  335

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F S V+LGNG ++SG  +N F+   K+YPL  G  +A+  +      Y  C   S+ 
Sbjct  336   DREFRSKVELGNGRIVSGIGVNAFDPKKKLYPLTMGVDMAKGSDTRDSSRY--CGEGSMD  393

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              + V+GK+VYC L +   D  IK + G+G +I SD+  D+    M PATIV+   GK I+
Sbjct  394   PRKVKGKLVYCQLGTWGADSVIKELGGIGTIIESDQFLDSAPIFMAPATIVNSSIGKSIN  453

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              Y++  + P+A I++S+ VK  APF+ SFS++GP   +  +LKPD+AAPG+ IL++YT L
Sbjct  454   NYMHLERLPSAVIYKSQEVKIKAPFIASFSSKGPNPGTKRLLKPDIAAPGIDILSSYTPL  513

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  ++ + SGTSMA PH  GAAAYVK++HPDWSP+AIKSALMTTA+ M  
Sbjct  514   KSLTGLKGDTQYSEFTLMSGTSMACPHVGGAAAYVKSYHPDWSPSAIKSALMTTARPMSS  573

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             K    A  A GAG + P KA +PGLI++++   Y+ +LC E +N++S+ SL   + N C 
Sbjct  574   KVDREAEFAYGAGQVNPAKARSPGLIYEMDDMSYIQFLCHEGYNSSSVSSLLRQRVN-CS  632

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
              +  A G D +NYP+M   L +    T    F R VT VG   +V+ A I+AP G+ ++V
Sbjct  633   TLIPANGEDAINYPTMQFGLKSNQEPTI-GIFRRKVTNVGQAISVYNATIRAPKGVDITV  691

Query  2115  VPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF +  Q RS+KVVV  K    A+   +SGSL+WK + H VRSPI++Y
Sbjct  692   KPMTLSFTRAMQTRSFKVVVKAKPMSNAV--ILSGSLIWKSSRHLVRSPIVIY  742



>ref|XP_010326073.1| PREDICTED: xylem serine proteinase 1 [Solanum lycopersicum]
Length=757

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/719 (47%), Positives = 467/719 (65%), Gaps = 18/719 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D +   YIV++ + P +   SA   H ++L+   G +  A E  ++SY + F+ F A+L 
Sbjct  42    DRKEDFYIVFLKDNPANEE-SAFQSHVDVLSSLKGRD--ATESHVYSYTKIFNAFAAKLS  98

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               E  +LS  D+V SV  N   KL TTRSW+F+G+   A R  K ES++IVG+ DTGV  
Sbjct  99    QYEVHKLSSMDEVASVIPNRYRKLHTTRSWEFIGLPATAKRRLKGESNIIVGVFDTGVTP  158

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             +S SFKDDG GPPPAKWKG C    NF+GCN K+IGA+YF ++    P D  SP D  GH
Sbjct  159   QSKSFKDDGLGPPPAKWKGSCHHFANFSGCNNKLIGARYFKLDKVPDPNDIMSPVDVHGH  218

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAI  854
             G+H +S  AG MV  ASL+G+A GTARG VPSAR+A YKVCW   GC D+D+LA F+AAI
Sbjct  219   GTHTSSTLAGSMVPDASLFGLARGTARGAVPSARVAMYKVCWATSGCSDIDILAAFEAAI  278

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVD+ISIS+GG    +  D I++G++HAM+K I+T A+AGN+GP   T+ N +PW++T
Sbjct  279   IDGVDIISISIGGLTGGYTTDVISVGAFHAMRKGILTVASAGNDGPNLKTVANHAPWVLT  338

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSAC  1208
             VAA+ IDR F S V LGNG  +SG  +N F+   K+YPL  G  +A+  +      Y  C
Sbjct  339   VAASGIDREFRSKVLLGNGRTVSGIGVNAFDPKQKLYPLAMGVDIAKSSDTRESSRY--C  396

Query  1209  DYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIE  1382
                S+  + V+GK+VYC L S   D  +K + G+G +I SD+  D+    M PATIV+  
Sbjct  397   SEGSMDPRKVKGKLVYCQLGSWGVDSVVKELGGIGTIIESDQFLDSAPIFMAPATIVNSS  456

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
              GK ++ Y+++ + P+A I++S+ V+  APF+ SFS+RGP   +  +LKPD+AAPG+ IL
Sbjct  457   IGKSMNSYMHSDRLPSAVIYKSQEVEIKAPFIASFSSRGPNPGTKRLLKPDIAAPGIDIL  516

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             A+YT + ++TG   DT+  ++ + SGTSM+ PH  GAAAYVK+FHPDWSP+AIKSA+MT+
Sbjct  517   ASYTPMKSLTGLKGDTQFSEFTLMSGTSMSCPHVGGAAAYVKSFHPDWSPSAIKSAIMTS  576

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             A++M  K    A  A GAG + P KA +PGL++D++   Y+ +LC E +N++S+ SL   
Sbjct  577   ARSMSSKVDREAEFAYGAGQVNPMKARSPGLVYDMDDMAYIQFLCHEGYNSSSVSSLLRQ  636

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
             + N C  +  A G D +NYP+M L L +    T    F R VT VG   +V+ A I+AP 
Sbjct  637   QVN-CSTLIPATGEDAINYPTMQLGLKSDQEPTI-GIFRRRVTNVGQAKSVYNATIRAPK  694

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGK-FQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             G+ +SV P  LSF +  QKRS+KVVV  K    AI   +SGSL WK + H VRSPI++Y
Sbjct  695   GVDISVQPMTLSFTRPMQKRSFKVVVKAKPMSNAI--ILSGSLTWKSSRHIVRSPIVIY  751



>ref|XP_009111502.1| PREDICTED: xylem serine proteinase 1 [Brassica rapa]
Length=755

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/712 (48%), Positives = 472/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+   +    A+  H N+L+      E A+E  ++SY + F+ F A+L P EA++
Sbjct  45    YIIYLGDQLGNGD-EAIKTHVNLLSSLDISLEEAQERMVYSYAKVFNAFAAKLSPHEAKK  103

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E  +V+ VFRN   +L TT+SWDF+G+   A R+ KAE D+I+G+LDTG+  +S SF+
Sbjct  104   MMEMKEVLGVFRNRYRQLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPDSESFE  163

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA++F  +G  P  +  SP D DGHG+H +S
Sbjct  164   DHGLGPPPAKWKGSCGPFKNFTGCNNKLIGAKFFKADGNLPNGEVRSPLDIDGHGTHTSS  223

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
              AAG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  224   TAAGVLVANASLYGIASGTARGAVPSARVAMYKVCWAKSGCADMDILAGFEAAIHDGVDI  283

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HA++K I+T A+AGN+GP  G++ N  PW++TVAA+ I
Sbjct  284   ISISIGGPIADYSSDSISVGSFHAVRKGILTVASAGNDGPSSGSVTNHEPWILTVAASGI  343

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F+   K YPL+SG   A+ K+  Y   Y   DYL   
Sbjct  344   DRTFKSQIDLGNGKSFSGMGISLFKPKAKSYPLVSGVDAAKTKDDQYLARYCFSDYLD--  401

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+G ++ C +  A  + TIK   G G ++ SD+  D     M PAT V+   G  I 
Sbjct  402   RKKVKGNVMVCKMGGAGVESTIKRYGGAGAILVSDQYLDNAQIFMSPATSVNSSIGDVIY  461

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +Y+N++++P+A I ++R V   APFV SFS+RGP   S+ +LKPD+AAPG+ ILAA+T  
Sbjct  462   RYVNSSRSPSAVIQKTREVTIPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLK  521

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSM+ PHAAG AAYVK+FHPDWSPAAIKSA++T+AK +  
Sbjct  522   RSLTGLDGDTQFSKFTILSGTSMSCPHAAGVAAYVKSFHPDWSPAAIKSAIITSAKPISR  581

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G + P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  582   RVNKDAEFAYGGGQVNPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGSRSINCS  641

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +  A+T  A F R VT VG  S+V+ A ++AP G+ ++V
Sbjct  642   SIVPGIGHDSLNYPTIQLTLRSAKASTM-AVFRRRVTNVGPPSSVYNATVRAPKGVEITV  700

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF + +QKRS+KVVV  K Q      +SG LVWK   HSVRSPI++Y
Sbjct  701   EPMSLSFTKASQKRSFKVVVKAK-QMTPGKIVSGLLVWKSQRHSVRSPIVIY  751



>ref|XP_006286453.1| hypothetical protein CARUB_v10000284mg [Capsella rubella]
 gb|EOA19351.1| hypothetical protein CARUB_v10000284mg [Capsella rubella]
Length=761

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/712 (48%), Positives = 472/712 (66%), Gaps = 12/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+ PD+   +    H N+L+     EE AR+ +++SY ++ + F A+L P EA++
Sbjct  37    YIIYLGDRPDNTDEAIKKTHINLLSFLNISEEEARDRKVYSYTKALNAFAAKLSPNEAKK  96

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E ++VV VFRN   +L TT+SWDF+G+   A R+ KAE D+I+G+LDTG+  ES SF+
Sbjct  97    MMEMEEVVGVFRNQYRQLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPESESFQ  156

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA+YF  +G  P  +  SP D DGHG+H +S
Sbjct  157   DHGLGPPPAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVPTGEIRSPIDIDGHGTHTSS  216

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
               AG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  217   TVAGVVVANASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVDI  276

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG  + +  D I++GS+HAM+K I+T A+AGN+GP  GT+ N  PW++TVAA+ I
Sbjct  277   ISISIGGPIKDYTSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGI  336

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S++ LGNG+  SG  I+ F    K YPL+SG   A+  +  Y   Y   D  S+ 
Sbjct  337   DRTFKSEIDLGNGKSFSGMGISMFNPKAKSYPLVSGVDAAKSTDDEYLARYCFSD--SLD  394

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
             +K V+GK++ C +     + T+K   G G +I SD   D     M PAT V+   G  I 
Sbjct  395   KKKVKGKVMVCRMGGGGVESTVKSYGGAGAIIVSDLYLDNAQVFMAPATSVNTSIGDVIY  454

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             +YIN+T++P+A I ++R V T APFV SFS+RGP   S  +LKPD+AAPG+ ILAA+T  
Sbjct  455   RYINSTRSPSAVIQKTRQVTTPAPFVASFSSRGPNPGSTRLLKPDIAAPGIDILAAFTLK  514

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+A  +  
Sbjct  515   RSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSATPISR  574

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    +  A G G I P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  575   RVNKDSEFAYGGGQINPRRAASPGLVYDMDDMSYVQFLCGEGYNATTLAPLVGSRSVSCS  634

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L +   +T    F R VT VG  S+V+   ++AP G+ ++V
Sbjct  635   SIVPGIGHDSLNYPTIQLTLRSAKTSTL-GVFRRRVTNVGPASSVYNVTVRAPKGVEITV  693

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF + +QKRS+KVVV GK Q +    +SG LVWK   HSVRSPI++Y
Sbjct  694   EPQSLSFSKASQKRSFKVVVKGK-QMSPGKIVSGMLVWKSPRHSVRSPIVIY  744



>ref|XP_011034996.1| PREDICTED: xylem serine proteinase 1-like [Populus euphratica]
Length=745

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/724 (47%), Positives = 472/724 (65%), Gaps = 18/724 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D Q++ YIVY+G+ P D  +SAV  H ++L      +  ARE  I+SY + F+ F A+L
Sbjct  29    EDEQKEFYIVYLGDQPVD-NVSAVQTHMDVLLSIKRSDVEARESIIYSYTKIFNAFAAKL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA +LS +++V+SVF N   KL TT+SWDF+G+   A RN K E +++VGLLDTG+ 
Sbjct  88    SKAEANKLSRREEVLSVFPNRYHKLHTTKSWDFIGLPNTAKRNLKMERNIVVGLLDTGIT  147

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              +S SFKDDG+GPPP KWKG C    NF+GCN K++GA++F ++G   P D  SP D DG
Sbjct  148   PQSESFKDDGFGPPPKKWKGTCGHYTNFSGCNNKLVGARFFKLDGNPDPSDILSPVDVDG  207

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAA  851
             HG+H +S  AG ++  ASL+G+A G ARG VP+AR+A YKVCW   GC DMD+LA F+AA
Sbjct  208   HGTHTSSTLAGNLIPDASLFGLAGGAARGAVPNARVAMYKVCWMSSGCSDMDLLAAFEAA  267

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVDV+S+S+GG   ++  D +AIG++HAMKK I+T A+ GN+GP  G++ N +PW++
Sbjct  268   IHDGVDVLSVSIGGVDANYVSDALAIGAFHAMKKGIITVASGGNDGPSSGSVANHAPWIL  327

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPG--NYS  1202
             TVAA+ I+R F S V+LGNG+++SG  +NTFE   K YPL+SG       A Y G  N++
Sbjct  328   TVAASGINREFRSKVELGNGKILSGVGVNTFEPKQKSYPLVSGA-----EAGYSGLQNHA  382

Query  1203  A-CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVI-ASDKLPDTVLPTMIPATIV  1373
               CD  S+    V+GK+V C L     D  +K I G G+I  S +  D     M PAT+V
Sbjct  383   RFCDAGSLDPNKVKGKLVLCELGEWGSDSVVKGIGGKGIILESQQYLDAAQIFMAPATMV  442

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
             +      ++ YI++T  P+A I RS+ V+  APFV SFS+RGP   S  +LKPD+AAPG+
Sbjct  443   NATVSGAVNDYIHSTTFPSAMIHRSQEVEVPAPFVASFSSRGPNPGSERLLKPDVAAPGI  502

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILA+YT L ++TG   DT+  ++++ SGTSMA PH +G AAY+K+FHP+W+ AAIKSA+
Sbjct  503   DILASYTPLRSLTGLKGDTQHSRFSLMSGTSMACPHVSGLAAYIKSFHPNWTAAAIKSAI  562

Query  1734  MTTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             +TTAK M  +    A  A GAG I P +A  PGL++D+++  Y+ +LC E ++ +S   L
Sbjct  563   LTTAKPMSSRVNNDAEFAYGAGQINPLRARNPGLVYDMDEMSYIQFLCHEGYDGSSFAVL  622

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
              GSK   C ++    G D LNYP+M L + N    T    F RTVT VG   +++ A IK
Sbjct  623   AGSKSINCSSLLPGLGYDALNYPTMQLNVKNEQEPTI-GVFTRTVTNVGPSRSIYNATIK  681

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             AP G+ + V P  LSF    QKRS+KVVV  K        +SGSL+WK   H VRSPI++
Sbjct  682   APEGVQIQVKPTSLSFSGAAQKRSFKVVVKAKPLSG-PQILSGSLLWKSKLHVVRSPIVI  740

Query  2268  YRSL  2279
             ++ L
Sbjct  741   FKPL  744



>ref|XP_008233510.1| PREDICTED: cucumisin-like [Prunus mume]
Length=752

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/723 (48%), Positives = 465/723 (64%), Gaps = 21/723 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELP--DDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFV  308
             H   RK YIVYMG+ P  D PT + +  H N+L   +G   + +E   +HSY+RSF+GF 
Sbjct  36    HPDTRKVYIVYMGDKPKLDIPTTTTLPLHVNMLQNVVGSSNIEQEPLLLHSYKRSFNGFA  95

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   EA++++    VVSVF + + KL TTRSW+F+G      R+   ESD+IVG++D+
Sbjct  96    AKLTEEEAQKMAGMAGVVSVFPSGKQKLHTTRSWNFIGFHENVKRS-TVESDIIVGVIDS  154

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYF-NVEGFAPEDQESPAD  665
             GVW ES SF D G+GPPP KWKG CQ   NFT CN K+IGA+Y+ N E F   D +SP D
Sbjct  155   GVWPESASFSDAGFGPPPKKWKGTCQGSSNFT-CNNKIIGARYYRNSEPFVKGDIKSPRD  213

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
               GHG+H AS AAG +V  ASL+G+  GTARGGVPSARIA YKVCW   C D D+LA FD
Sbjct  214   SGGHGTHTASTAAGNLVSKASLFGLGSGTARGGVPSARIAVYKVCWPSDCSDDDILAAFD  273

Query  846   AAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
              AIADGVD++S+S+GG    +F+D I+IG++HA++K I+T+ A GN GP   TI N +PW
Sbjct  274   DAIADGVDILSVSIGGAEDDYFRDSISIGAFHALRKGILTSTAVGNNGPRPKTIANFAPW  333

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS  1202
              ++VAA++IDR F + V+LGN ++  G   NTF+L GK YPLI    A ++ A Y G+ S
Sbjct  334   CLSVAASTIDREFVTKVQLGNQKIYEGIVTNTFDLKGKFYPLIHAGDAPNRKAGYDGSTS  393

Query  1203  A-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVD  1376
               C   ++   LV+GKIV C    +  Y   +   VGVI  ++ + D + P  +PA+ + 
Sbjct  394   MKCKPGTLDHNLVKGKIVLC--DGTNGYGAYFAGAVGVILQNRPVADVLDPLPMPASCLG  451

Query  1377  IEDGKKIDKYINTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
             ++ G  I  Y+N+T+ PTA IF+S   +   +P+VPSFS+RGP  ++ N+LKPD+AAPG 
Sbjct  452   LDSGNSIYHYMNSTRNPTATIFKSTEDIDKLSPYVPSFSSRGPNPVTPNLLKPDIAAPGA  511

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             SILAA+  +A ++    D RV  YN  SGTSMA PHA G AAYVK+FHP+WSPAAI+SA+
Sbjct  512   SILAAFPPIAPVSFVQGDDRVASYNFVSGTSMACPHATGVAAYVKSFHPNWSPAAIQSAI  571

Query  1734  MTTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGS  1904
             +TTAK +   + P  A  A GAG I P +A  PGL++D  + +Y+ +LC + ++   L S
Sbjct  572   ITTAKPLSPDLNP-EAEFAYGAGQIDPVRAPYPGLVYDATELDYIEFLCAQGYSTKLLQS  630

Query  1905  LTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-  2081
             +TG K +          +D LNYPS  L  +NPN  + S  F RT T VG+  + +KAK 
Sbjct  631   ITGHKSSCSSKTNYGALSDHLNYPSFALSSSNPN--SISGVFNRTATNVGSPRSTYKAKM  688

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             I A  GL + V P+ILSF    QK S++V V G      S  +S SLVW D T  VRSPI
Sbjct  689   IGATKGLEIKVNPSILSFSSLGQKLSFQVTVKGSIHHKSS--VSASLVWDDGTFQVRSPI  746

Query  2262  LVY  2270
             +VY
Sbjct  747   VVY  749



>ref|XP_004171206.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=683

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/686 (49%), Positives = 459/686 (67%), Gaps = 17/686 (2%)
 Frame = +3

Query  240   LGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFL  419
             +     A E  +HSY+RSF+GFV +L   EA+++S K+ VVSVF N +  L TTRSWDF+
Sbjct  1     MCSSSFAAEALLHSYKRSFNGFVVKLTEEEAQKISAKENVVSVFPNEKKHLHTTRSWDFM  60

Query  420   GMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRK  599
             G + KA R  + ES+++VG+LD+G+W ESPSF D GYGPPPAKWKG CQ   NF  CNRK
Sbjct  61    GFTQKAPRVKQVESNIVVGVLDSGIWPESPSFSDVGYGPPPAKWKGACQTSANFH-CNRK  119

Query  600   VIGAQ-YFNVEGFAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSA  776
             +IGA+ Y + + F PED +SP D DGHG+H AS  AG +V  ASLYG+A GTARGGVPSA
Sbjct  120   IIGARAYRSDKFFPPEDIKSPRDSDGHGTHTASTVAGGLVNQASLYGLALGTARGGVPSA  179

Query  777   RIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKK  953
             RIA YK+CW  GC D D+LA FD AIADGVD+IS+SVGG  P+ +F D IAIG++H+MK 
Sbjct  180   RIAVYKICWSDGCYDADILAAFDDAIADGVDIISLSVGGSKPKYYFNDSIAIGAFHSMKH  239

Query  954   KIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-  1130
              I+T+ +AGN+GP + TI+N SPW ++VAA+SIDR+  S V+LGN     G++INTF+L 
Sbjct  240   GILTSNSAGNDGPDYFTIRNFSPWSLSVAASSIDRKLVSRVQLGNKNTFQGYTINTFDLK  299

Query  1131  GKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGV  1307
             GK +PLI    A + +A + G+ S  C   S+   LV+GKIV C S  S    +     V
Sbjct  300   GKQHPLIYAGSAPNISAGFTGSSSRFCSRNSVDRNLVKGKIVLCDSVLSPATFVSLNGAV  359

Query  1308  GVIASD-KLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVP  1481
             GV+ +D  + D      +P++ +D  DG  I  Y++ T+ PTA I +S AV  T+AP++ 
Sbjct  360   GVVMNDLGVKDNARSYPLPSSYLDPVDGDNIKTYMDRTRFPTATILKSNAVNDTSAPWIV  419

Query  1482  SFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPH  1661
             SFS+RGP   + +ILKPDL APG+ ILAA++ +AT++  V D+R   YN+ SGTSM+ PH
Sbjct  420   SFSSRGPNPETYDILKPDLTAPGVEILAAWSPIATVSSGVRDSRTTLYNIISGTSMSCPH  479

Query  1662  AAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIF  1838
             A  AA YVKTFHP WSPAAIKSALMTTA  +  K       A GAG I P +AV PGL++
Sbjct  480   ATAAAVYVKTFHPTWSPAAIKSALMTTATPLNAKLNTQVEFAYGAGHINPLRAVHPGLLY  539

Query  1839  DINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATT  2015
             D  +S+Y+ +LC + +  A +  L+G  ++ C    + +  D LNYPS  L  T  ++ +
Sbjct  540   DAYESDYVRFLCGQGYTTAMVRRLSG-DNSVCTRANSGRVWD-LNYPSFALSST--SSQS  595

Query  2016  FSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQK  2192
             F+  F RTVT VG+  + ++AK +  P GL+++V P +LSF    QK+S+ + + G   +
Sbjct  596   FNQFFRRTVTNVGSKVSTYRAKVVGVPRGLSITVNPPVLSFNAIGQKKSFTLTIRGSISQ  655

Query  2193  AISWYMSGSLVWKDNTHSVRSPILVY  2270
             +I   +S SLVW D  H+VRSPI V+
Sbjct  656   SI---VSASLVWSDGHHNVRSPITVF  678



>ref|XP_010318121.1| PREDICTED: LOW QUALITY PROTEIN: cucumisin-like [Solanum lycopersicum]
Length=710

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/721 (47%), Positives = 454/721 (63%), Gaps = 23/721 (3%)
 Frame = +3

Query  144   TQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             T +  YIVYMG+ P D   +    H +IL EALG    A E  ++SY+RSF+GFVA+L  
Sbjct  2     TNKTEYIVYMGDCPKDDLSTTSSMHTSILQEALGSNRRASESLMYSYKRSFNGFVAKLTE  61

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVE  503
              E  R++  D VVSVF N   +L TTRSWDF+G+  +  R    ESDLI+G+LDTG+W E
Sbjct  62    EEKNRITNMDAVVSVFPNGIKELHTTRSWDFVGLPQQVTRRTSVESDLIIGMLDTGIWPE  121

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHG  680
             S SF D  +  PP KWKG CQ  LNFT CN+K+IGA+Y+ + G F   D +SP D +GHG
Sbjct  122   SQSFDDQYFSAPPTKWKGTCQSSLNFT-CNKKIIGAKYYRINGEFPSGDIQSPRDTEGHG  180

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SH ASIAAGR V  ASLYG+  G ARGGVPSARIA YK+CW   C D D+LA FD AIAD
Sbjct  181   SHTASIAAGRSVSNASLYGLGSGIARGGVPSARIAVYKICWSDSCYDADILAAFDDAIAD  240

Query  861   GVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             GVD+IS+SVGG  P  +F+D IAIG++H+MK  I+T  +AGN GP   T+ N+SPW ++V
Sbjct  241   GVDIISLSVGGSSPYQYFEDSIAIGAFHSMKNGILTWNSAGNSGPDPQTVTNLSPWSLSV  300

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDY  1214
             A ++IDRRF +DV LGNGE+  G SINTF+L   YPL+ G    +  A Y G+ S  C+ 
Sbjct  301   ADSTIDRRFVTDVXLGNGEVYEGVSINTFDLEDQYPLVYGGDVPNTEAGYSGSESRYCEE  360

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIK--WIHG-VGVIASDKLPDTVLPTMIPATIVDIED  1385
              S+ +  VRGKIV C      D+T     I G VG I  D   D      I +T +   D
Sbjct  361   NSLDKSKVRGKIVLC------DWTXNGTIIAGAVGAIMQDDFNDAAFSFPISSTYLRTND  414

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G ++  Y++ T+ PT  I +S      +APFV SFS+RGP  I+ +ILKPDL+APG+ IL
Sbjct  415   GTEVYNYLHKTRKPTGRILKSSEKGLESAPFVVSFSSRGPNAITSDILKPDLSAPGVDIL  474

Query  1563  AAYTALATMTGQVD-DTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             AA++   T+TG +  D RVV YN+ SGTSMA PHA  AA YVK+F+P  SP AIKSALMT
Sbjct  475   AAWSEGTTVTGNIHGDKRVVPYNIISGTSMACPHATAAAIYVKSFNPTMSPTAIKSALMT  534

Query  1740  TAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TA  M       A  A G+G I P KA  PGL++D+ +++Y+ +LC + ++  +L  +TG
Sbjct  535   TATPMISSANSEAEFAXGSGQINPIKAAHPGLVYDMVENDYVKFLCGQGYSTKNLRIITG  594

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
                + C           LNYPS    +++   +  +  F+RTVT VGT  + ++A I AP
Sbjct  595   DT-SSCSTSQTDATVWDLNYPS--FTISSSKNSKITRVFHRTVTNVGTPVSTYRATIVAP  651

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
               L V V P++++F    QK+ + V ++ +   ++   +SGSL+W D  H VRSPI+ Y 
Sbjct  652   ERLNVRVEPSLITFRSIGQKQLFVVSITAEINDSM---ISGSLLWDDGVHLVRSPIVAYA  708

Query  2274  S  2276
             S
Sbjct  709   S  709



>emb|CDY07233.1| BnaCnng02480D [Brassica napus]
Length=755

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/712 (48%), Positives = 470/712 (66%), Gaps = 13/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y+G+   +    A+  H N+L+      E A+E  ++SY + F+ F A+L P EA++
Sbjct  45    YIIYLGDQLGNGD-EAIKTHVNLLSSLDISLEEAQERMVYSYAKVFNAFAAKLSPHEAKK  103

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             + E  +V+ VFRN   +L TT+SWDF+G+   A R+ KAE D+I+G+LDTG+  +S SF+
Sbjct  104   MMEMKEVLGVFRNRYRQLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPDSESFE  163

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIAS  695
             D G GPPPAKWKG C    NFTGCN K+IGA++F  +G  P  +  SP D DGHG+H +S
Sbjct  164   DHGLGPPPAKWKGSCGPFKNFTGCNNKLIGAKFFKADGNLPNGEVRSPLDIDGHGTHTSS  223

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDV  872
              AAG +V  ASLYGIA GTARG VPSAR+A YKVCW + GC DMD+LAGF+AAI DGVD+
Sbjct  224   TAAGVLVANASLYGIASGTARGAVPSARVAMYKVCWAKSGCADMDILAGFEAAIHDGVDI  283

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG    +  D I++GS+HA++K I+T A+AGN+GP  G++ N  PW++TVAA+ I
Sbjct  284   ISISIGGPIADYSSDSISVGSFHAVRKGILTVASAGNDGPSSGSVTNHEPWILTVAASGI  343

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACDYLSIS  1226
             DR F+S + LGNG+  SG  I+ F+   K YPL+SG   A+ K+  Y   Y   DYL   
Sbjct  344   DRTFKSQIDLGNGKSFSGMGISMFKPKAKSYPLVSGVDAAKTKDDQYLARYCFSDYLD--  401

Query  1227  EKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
              K V+G ++ C +  A  + TIK   G G ++ SD+  D     M PAT V+   G  I 
Sbjct  402   RKKVKGNVMVCKMGGAGVESTIKRYGGAGAILVSDQYLDNAQIFMAPATSVNSSIGDVIY  461

Query  1401  KYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              Y+N++++P+A + ++R V   APFV SFS+RGP   S+ +LKPD+AAPG+ ILAA+T  
Sbjct  462   GYVNSSRSPSAVVQKTREVTIPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLK  521

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              ++TG   DT+  K+ + SGTSM+ PHAAG AAYVK+FHPDWSPAAIKSA++T+AK +  
Sbjct  522   RSLTGLDGDTQFSKFTILSGTSMSCPHAAGVAAYVKSFHPDWSPAAIKSAIITSAKPISR  581

Query  1761  K-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             +    A  A G G + P +A +PGL++D++   Y+ +LC E +N  +L  L GS+   C 
Sbjct  582   RVNKDAEFAYGGGQVNPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGSRSINCS  641

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
             +I    G D LNYP++ L L    A+T  A F R VT VG  S+V+ A ++AP G+ ++V
Sbjct  642   SIVPGIGHDSLNYPTIQLTLRTAKASTM-AVFRRRVTNVGPPSSVYNATVRAPKGVEITV  700

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P  LSF + +QKRS+KVVV  K Q      +SG LVWK   HSVRSPI++Y
Sbjct  701   EPMSLSFTKPSQKRSFKVVVKAK-QMTPGKIVSGLLVWKSQRHSVRSPIVIY  751



>emb|CBI31597.3| unnamed protein product [Vitis vinifera]
Length=787

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/720 (48%), Positives = 457/720 (63%), Gaps = 22/720 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D  RK YIVYMG  P     SA   H N+L +  G    A    + SY++SF+GFVA+L
Sbjct  78    EDDGRKEYIVYMGAKPAG-DFSASASHTNMLQQVFGSSR-ASTSLVRSYKKSFNGFVAKL  135

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVS+F N + +L TTRSWDF+G   +  R    ESD+I+G+LDTG+W
Sbjct  136   TEEEMQQMKGMDGVVSIFPNEKKQLHTTRSWDFVGFPQQVKRT-SFESDIIIGMLDTGIW  194

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D+G+GPPP KWKG C    NFT CN K+IGA+Y+  +G F  ED  SP D  G
Sbjct  195   PESDSFDDEGFGPPPRKWKGTCHGFSNFT-CNNKIIGAKYYRSDGEFGREDLRSPRDSLG  253

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC   DVLA FD AI
Sbjct  254   HGTHTASTAAGGLVSMASLMGFGLGTARGGVPSARIAVYKICWSDGCHGADVLAAFDDAI  313

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+ISIS G   P ++F+DPIAIG++HAMK  I+T+ +AGNEGP F +I N SPW +
Sbjct  314   ADGVDIISISAGSSTPSNYFEDPIAIGAFHAMKNGILTSTSAGNEGPRFISITNFSPWSL  373

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++IDR+F + VKLG+ ++  GFSINTFEL  MYPLI G  A +    + GN S  C
Sbjct  374   SVAASTIDRKFFTKVKLGDSKVYKGFSINTFELNDMYPLIYGGDAPNTRGGFRGNTSRFC  433

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATIVDIED  1385
                S++  LV+GKIV+C               +G +  DKLP     +  +PA+ + + D
Sbjct  434   KIKSLNPNLVKGKIVFCDGKGGGKAAF-LAGAIGTLMVDKLPKGFSSSFPLPASRLSVGD  492

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G++I  YIN+T  PTA I +S  V  T AP+VP FS+RGP  I+ ++LKPDL +PG+ I+
Sbjct  493   GRRIAHYINSTSDPTASILKSIEVNDTLAPYVPPFSSRGPNPITHDLLKPDLTSPGVHIV  552

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++ ++ ++    D RV +YN+ +GTSMA PHA GAAAY+K+FHP WSPAAIKSALMTT
Sbjct  553   AAWSPISPISDVKGDNRVAQYNIITGTSMACPHATGAAAYIKSFHPTWSPAAIKSALMTT  612

Query  1743  AKAMKIKPI-GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             A  M  K       A GAG I P KAV PGL++D N+ +++++LC + +   +L  +TG 
Sbjct  613   ATPMSAKKNPQVEFAYGAGNIDPVKAVHPGLVYDANEIDFVNFLCGQGYTAKALRQVTGD  672

Query  1917  KDNKCKNIPAAQGAD-GLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKA  2090
                  K   A  G    LNYPS    L+  N  +    F R+VT VG   + +KA  I A
Sbjct  673   HSVCSK---ATNGTVWNLNYPS--FALSTFNKESIVGTFNRSVTNVGLAVSTYKATIIGA  727

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P GL + V PNILSF    QK+S+ + V G+  + I   +S SLVW +  H VRSPI+VY
Sbjct  728   PKGLKIKVKPNILSFTSIGQKQSFVLKVEGRIVEDI---VSTSLVWDNGVHQVRSPIVVY  784



>ref|XP_011036040.1| PREDICTED: cucumisin-like [Populus euphratica]
Length=699

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/707 (48%), Positives = 454/707 (64%), Gaps = 22/707 (3%)
 Frame = +3

Query  171   MGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSE  347
             MGE P  D ++SA+  H ++L   +G    A +  +HSY RSF+GFVA+L   E  +++ 
Sbjct  1     MGERPKSDISVSAL--HISMLQNVVGSG--ASDSLLHSYHRSFNGFVAKLTKEEKEKMAG  56

Query  348   KDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDG  527
              D VVSVF + + KL TTRSWDF+G      R   +ESD+IV +LDTG+W ES SF D G
Sbjct  57    LDGVVSVFPSQKKKLHTTRSWDFMGFPQNVTR-ATSESDIIVAMLDTGIWPESESFNDQG  115

Query  528   YGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAA  704
             YGPPP+KWKG CQ   NF+ CN K+IGA+Y++ EG   P D  SP D +GHG+H AS AA
Sbjct  116   YGPPPSKWKGTCQASSNFS-CNNKIIGARYYHSEGKVYPGDFASPRDSEGHGTHTASTAA  174

Query  705   GRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISIS  884
             GR+V  ASL G+A GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+S
Sbjct  175   GRLVRDASLLGLATGTARGGVPSARIAVYKICWSNGCSDADILAAFDDAIADGVDIISLS  234

Query  885   VGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             VGG P  +F+D IAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA++IDR+F
Sbjct  235   VGGWPMDYFEDSIAIGAFHSMKNGILTSNSAGNSGPAPESISNCSPWSLSVAASTIDRKF  294

Query  1065  ESDVKLGNGELISGFSINTFELGKMY-PLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              + V LGNG +  G SINTFE G +  P I G  A +K A Y G+ S  C   S++  +V
Sbjct  295   VTPVILGNGAIYEGISINTFEPGNIVPPFIYGGDAPNKTAGYDGSESRYCRLDSLNSTMV  354

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
              GK+V C    S     +  H VG V+  D   D      +P + ++  D   + KY+N+
Sbjct  355   EGKVVLC-DQISGGEEARASHAVGSVMNGDAYSDVAFSFPLPVSYLNSSDRADLLKYLNS  413

Query  1416  TKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T  PTA I +S  +K  TAPFV SFS+RGP  I+ ++LKPDL APG+ ILAA++   T+T
Sbjct  414   TSEPTATIMKSIEIKDGTAPFVVSFSSRGPNPITSDLLKPDLTAPGVDILAAWSEATTVT  473

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPI-  1769
             G   DTRVVKYN+ SGTSM+ PHA+GAAAYVK F+P WSPAAIKSALMTT  A  +    
Sbjct  474   GSPGDTRVVKYNIISGTSMSCPHASGAAAYVKAFNPTWSPAAIKSALMTTGNASSMSSSI  533

Query  1770  --GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNIP  1943
                A  A G+G I P KA+ PGL++D  + +Y+ +LC +  NA+   L    ++ C +  
Sbjct  534   NNDAEFAYGSGHINPAKAIDPGLVYDAGEIDYVRFLCGQGYNATQLLLITGDNSTCSSET  593

Query  1944  AAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPN  2123
                  D LNYPS    L+  +  T +  F+RTVT VG+ S+ +K+   AP+GL + + P+
Sbjct  594   NGTVWD-LNYPS--FALSAKSGKTITRIFHRTVTNVGSASSTYKSITNAPSGLNIQIEPD  650

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
             +LSF    Q+ S+ V V     K +   +SGSLVW D  H VRSP++
Sbjct  651   VLSFQSLGQQLSFVVTVEATLGKTV---LSGSLVWDDGVHQVRSPVV  694



>ref|XP_002277115.3| PREDICTED: cucumisin [Vitis vinifera]
Length=1359

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/725 (48%), Positives = 470/725 (65%), Gaps = 18/725 (2%)
 Frame = +3

Query  117   VRATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSF  296
             +  +L   D   K YIVYMG+LP D  IS+    H  + +   D   + EY +HSY++SF
Sbjct  644   ISGSLVWDDGVYKAYIVYMGDLPKDDVISSPSLLHTSMLQEAIDSSSSSEYLLHSYKKSF  703

Query  297   SGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVG  476
             +GFVA L   E ++LS  + +VSVF N +M+L TTRSWDF+G      R    ESD+IVG
Sbjct  704   NGFVASLTGEEVKKLSNMEGIVSVFPNEKMQLFTTRSWDFIGFPQDVERT-TTESDIIVG  762

Query  477   LLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQE  653
             ++D+G+W ES SF   G+ PPP KWKG CQ   NFT CN K+IGA+Y++      P + +
Sbjct  763   IIDSGIWPESASFNAKGFSPPPRKWKGTCQTSSNFTSCNNKIIGARYYHTGAEVEPNEYD  822

Query  654   SPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVL  833
             SP D DGHG+H ASI AG +V GASL G   GTARGGVPSARIA YKVCW +GC   DVL
Sbjct  823   SPRDSDGHGTHTASIVAGGLVSGASLLGFGSGTARGGVPSARIAVYKVCWSKGCYSADVL  882

Query  834   AGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQN  1013
             A FD AIADGVD+IS+S+GG+  ++F++PIAIG++HA+K  I+T+ A GN G    TI N
Sbjct  883   AAFDDAIADGVDIISVSLGGYSPNYFENPIAIGAFHALKNGILTSTAVGNYGHNRATITN  942

Query  1014  VSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPG  1193
             + PW ++VAA++IDR+F + V+LGN ++  G SINTFE+  MYP+I G  AQ+       
Sbjct  943   LWPWSLSVAASTIDRKFVTKVQLGNNQVYEGVSINTFEMNDMYPIIYGGDAQNTTGGNSE  1002

Query  1194  NYSACDYLSISEKLVRGKIVYC--LSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPA  1364
               S CD  S+++ LV GKIV C  L+   +  T      VG+I  D  L D  L   +PA
Sbjct  1003  YSSLCDKNSLNKSLVNGKIVLCDALNWGEEATTAG---AVGMIMRDGALKDFSLSFSLPA  1059

Query  1365  TIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLA  1541
             + +D  +G ++D+Y+N+T+ PTA+I RS  VK   APF+ SFS+RGP  I+ +ILKPDL+
Sbjct  1060  SYMDWSNGTELDQYLNSTR-PTAKINRSVEVKDELAPFIVSFSSRGPNLITRDILKPDLS  1118

Query  1542  APGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAI  1721
             APG++ILAA++  +T+TG+  DTRVV YN+ SGTSMA PHA+GAAAY+K+FHP WSP+AI
Sbjct  1119  APGVNILAAWSEASTVTGKEWDTRVVPYNIMSGTSMACPHASGAAAYIKSFHPTWSPSAI  1178

Query  1722  KSALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNAS  1895
             KSALMTTA  M+ +       + G+G + P KA  PGL++D  +++Y+ +LC E + NA 
Sbjct  1179  KSALMTTASPMRGEINTDLEFSYGSGQVDPVKAANPGLVYDAGETDYIKFLCGEGYGNAK  1238

Query  1896  LGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFK  2075
             L  +TG  DN   +         LNYPS    ++     + +  F RTVT VGT ++ +K
Sbjct  1239  LQLITG--DNTSCSADTNGTVWALNYPS--FAVSTKYKVSITRNFTRTVTNVGTPASTYK  1294

Query  2076  AKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRS  2255
             A +  P  L V V P+ILSF    QK+++ V V  +     +  +SGSLVW D  + VRS
Sbjct  1295  ANVTVPPRLCVQVEPSILSFKSLGQKKTFSVTV--RVPALDTAIISGSLVWNDGVYQVRS  1352

Query  2256  PILVY  2270
             PI+ Y
Sbjct  1353  PIVAY  1357


 Score =   525 bits (1353),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 310/703 (44%), Positives = 420/703 (60%), Gaps = 60/703 (9%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+LP    +S    H NIL +  G    A EY +HSY+RSF+GFVA+L   E+++LS  
Sbjct  1     MGDLPKG-QVSVSSLHANILRQVTGS---ASEYLLHSYKRSFNGFVAKLTEEESKKLSSM  56

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D VVSVF N   KLLTTRSWDF+G   +ANR    ESD+IVG+LDTG+W ES SF D+G+
Sbjct  57    DGVVSVFPNGMKKLLTTRSWDFIGFPMEANRT-TTESDIIVGMLDTGIWPESASFSDEGF  115

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAG  707
             GPPP KWKG CQ   NFT CN K+IGA+Y+   G   PED  SP D +GHG+H AS AAG
Sbjct  116   GPPPTKWKGTCQTSSNFT-CNNKIIGARYYRSNGKVPPEDFASPRDSEGHGTHTASTAAG  174

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V GASL G+  GTARGG PS+RIA YK+CW  GC   D+LA FD AIADGVD+IS+SV
Sbjct  175   NVVSGASLLGLGAGTARGGAPSSRIAVYKICWAGGCPYADILAAFDDAIADGVDIISLSV  234

Query  888   GG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  PR +F+DPIAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA+ IDR+F
Sbjct  235   GGFFPRDYFEDPIAIGAFHSMKNGILTSNSAGNSGPDPASITNFSPWSLSVAASVIDRKF  294

Query  1065  ESDVKLGNGELISG-FSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              + + LGN     G   +NTFE+  M PLI G  A + +A    +YS  C   S++  LV
Sbjct  295   LTALHLGNNMTYEGELPLNTFEMNDMVPLIYGGDAPNTSAGSDASYSRYCYEGSLNMSLV  354

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
              GKIV C  + S          VG V+ SD   D      +P + +D      + +YIN+
Sbjct  355   TGKIVLC-DALSDGVGAMSAGAVGTVMPSDGYTDLSFAFPLPTSCLDSNYTSDVHEYINS  413

Query  1416  TKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T  PTA I ++   K   APFV  FS+RGP  I+ +IL PD+AAPG++ILAA+T  +++T
Sbjct  414   TSTPTANIQKTTEAKNELAPFVVWFSSRGPNPITRDILSPDIAAPGVNILAAWTEASSLT  473

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG  1772
             G   DTRVV YN+ SGTSMA PHA+GA   ++                            
Sbjct  474   GVPGDTRVVPYNIISGTSMACPHASGANTDLE----------------------------  505

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAA  1949
                A GAG + P +A  PGL++D+ +++Y+ +LC + +N+  L  +TG      +NI  +
Sbjct  506   --FAYGAGQLNPLQAANPGLVYDVGEADYVKFLCGQGYNDTKLQLVTG------ENITCS  557

Query  1950  QGADG----LNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
                +G    LNYPS    ++  +    +  F RTVT VG+  + +KA +  P  L++ V 
Sbjct  558   AATNGTVWDLNYPS--FAVSTEHGAGVTRTFTRTVTNVGSPVSTYKAIVVGPPELSIQVE  615

Query  2118  PNILSFPQTNQKRSYKVVVS-GKFQKAISWYMSGSLVWKDNTH  2243
             P +LSF    + +++ V V        +   +SGSLVW D  +
Sbjct  616   PGVLSFKSLGETQTFTVTVGVAALSNPV---ISGSLVWDDGVY  655



>ref|XP_007015872.1| Cucumisin protein [Theobroma cacao]
 gb|EOY33491.1| Cucumisin protein [Theobroma cacao]
Length=863

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/683 (49%), Positives = 449/683 (66%), Gaps = 12/683 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D++RK YIVYMG   +  ++ AV+ HH +L+    DEE+AR+  IHSY +SF+GF A L 
Sbjct  27    DSERKAYIVYMGNALESKSL-AVEHHHCLLSGVTQDEEVARQSIIHSYGKSFNGFAAYLT  85

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
             P EA RL E + VVSVF N+  +L TTRSWDFLGM     RN   ESD+IVG+LDTG+++
Sbjct  86    PDEAARLQENENVVSVFPNSFRQLQTTRSWDFLGMPLSVKRNTPKESDIIVGVLDTGIYI  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             ++PSF D G+GPPP+KWKG CQ G NFTGCN KVIGA+ +++         S AD  GHG
Sbjct  146   DAPSFDDKGFGPPPSKWKGVCQTGGNFTGCNNKVIGARAYSI---GEATNVSAADDVGHG  202

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SH ASI AG  V+ ASL+GI +GT RGGVPSARIA Y++C   GC D+ +LA FD AI D
Sbjct  203   SHTASIVAGVPVKDASLFGIGQGTVRGGVPSARIAVYRICNDIGCSDIKILAAFDDAIDD  262

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+SVGG  R +  D IAIGS+HAMKK ++T+ AAGN+GP   ++ N +PW++TV 
Sbjct  263   GVDIISMSVGGSARDYHSDSIAIGSFHAMKKGVLTSCAAGNDGPDLASLANGAPWILTVG  322

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
             AT+ DR F++ +++G      G S+NTF L KMYPL SG  A   N      Y +C+   
Sbjct  323   ATATDRLFKTPIEIGKDMKTLGVSLNTFNLEKMYPLTSGAKAAKANKK--DTYCSCEASL  380

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVL---PTMIPATIVDIEDGK  1391
             +    V+GKIVYC     QD  IK + G+G + S   P++++     ++P   V  +   
Sbjct  381   LDANKVKGKIVYC-DGGLQDSIIKDLGGIGAVMSCS-PNSLIGGTSYVLPGACVSRDTAL  438

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             +I +Y+N+TK P   I ++  V TTAPF  SFS+RGP   SL+ LKPD+ APG+ ILAAY
Sbjct  439   QILQYLNSTKNPQGVIHKTIPVDTTAPFAASFSSRGPYYTSLSFLKPDIVAPGVDILAAY  498

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             + L ++TG   D R   + + SGTSMA PHA+ AAAYVK+FHP+WS +AIKSALMTTA  
Sbjct  499   SKLKSVTGSEGDDRFNAFYIMSGTSMACPHASAAAAYVKSFHPEWSISAIKSALMTTASE  558

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKC  1931
             MK+       A G+G I P +AV PGL++++++ +Y+ YLCKE  + +   L   +D  C
Sbjct  559   MKVGDKFVEFAYGSGQIDPQRAVDPGLVYELSEIDYIRYLCKEGYSGTRLGLIIDEDVNC  618

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
              +IP   G D LNYPSM L   +P A   SA F R VT VG G++ +KA +K P GL ++
Sbjct  619   SSIPKFGGQDVLNYPSMALVHEDP-APNISAVFNRIVTNVGDGNSTYKAIVKGPAGLNIT  677

Query  2112  VVPNILSFPQTNQKRSYKVVVSG  2180
             V P+ L F + N+++S+ V + G
Sbjct  678   VSPDTLVFNKVNERKSFTVELKG  700



>ref|XP_004156322.1| PREDICTED: xylem serine proteinase 1-like [Cucumis sativus]
Length=580

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/543 (58%), Positives = 398/543 (73%), Gaps = 6/543 (1%)
 Frame = +3

Query  147   QRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             +RKPYIVYMG+LP   P+ +  D+HHN+L +A+GDE++ARE +I+SY +SF+GF ARLLP
Sbjct  29    ERKPYIVYMGDLPAGSPSTTVADDHHNLLLDAIGDEKIARESKIYSYGKSFNGFAARLLP  88

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTGVWV  500
              EA +LS+++ VVSVF + + ++LTTRSW+FLG++ + + RNP  ES+LIV + DTG+W+
Sbjct  89    DEATKLSDEESVVSVFESRKKRVLTTRSWEFLGLNHQYSKRNPLIESNLIVAVFDTGIWI  148

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             +SPSF D+GYGPPP KWKGKC  G NFT CN KVIGA YF+++      + S AD DGHG
Sbjct  149   DSPSFSDEGYGPPPPKWKGKCVTGPNFTACNNKVIGANYFDLDKVTSYPELSVADTDGHG  208

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SHIAS  AG  V GASLYG+A+GTARGGVPSARIA YKVCW   C +MDVLA FD AIAD
Sbjct  209   SHIASTVAGSAVAGASLYGLAKGTARGGVPSARIAVYKVCWSVFCNEMDVLAAFDEAIAD  268

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVD+IS+S+G  P  FF+D  AIG++HAMKK I+TT AAGN+GP   T++NV+PW+MTVA
Sbjct  269   GVDLISVSIGSPPMDFFRDGQAIGAFHAMKKGILTTTAAGNDGPELFTVENVAPWIMTVA  328

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNAT-YPGNYSACDY  1214
             AT+IDR F +  +LGNG   +G SINTF   K M+ L SG  A   N T + GN SACD 
Sbjct  329   ATAIDRGFVTAFELGNGNKFTGGSINTFSPQKQMHSLTSGAKAAFNNGTPHQGNASACDP  388

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIEDGK  1391
              ++++  V+GKIVYCL + + D +IK + G GVI  + +  D     ++P   +    GK
Sbjct  389   NAMNQSKVKGKIVYCLKTYT-DPSIKSLGGTGVIQLTQQQTDYSSILLLPGATIPSVSGK  447

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YIN+TK P A I++S  VK  APFV SFS+RGPQ IS NILKPDL+APG+ ILAAY
Sbjct  448   YIDLYINSTKNPKAVIYKSETVKIDAPFVASFSSRGPQRISSNILKPDLSAPGIDILAAY  507

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T LAT+TG   D+R   + V SGTSMA  HA  AAAYVK+FHPDWSPAA+KSALMTT + 
Sbjct  508   TKLATLTGDTSDSRYSFFTVMSGTSMACSHATAAAAYVKSFHPDWSPAAVKSALMTTGRV  567

Query  1752  MKI  1760
                
Sbjct  568   FHF  570



>ref|XP_008461730.1| PREDICTED: cucumisin-like isoform X2 [Cucumis melo]
Length=684

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/685 (49%), Positives = 457/685 (67%), Gaps = 19/685 (3%)
 Frame = +3

Query  246   DEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM  425
             +   A E  +HSY+RSF+GFV +L   EA+++S K+ VVSVF N +  L TTRSWDF+G 
Sbjct  4     ESSFAPEALLHSYKRSFNGFVVKLTEEEAQKISAKENVVSVFPNEKKHLHTTRSWDFMGF  63

Query  426   STKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVI  605
             +    R  + ES+++VG+LD+G+W ESPSF D GYGPPPAKWKG CQ   NF  CNRK+I
Sbjct  64    TQNVPRVKQVESNIVVGVLDSGIWPESPSFSDVGYGPPPAKWKGACQTSANFR-CNRKII  122

Query  606   GAQ-YFNVEGFAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARI  782
             GA+ Y + + F PED +SP D DGHG+H AS  AG +V  ASLYG+A GTARGGVPSARI
Sbjct  123   GARAYRSDKFFPPEDIKSPRDSDGHGTHTASTVAGGLVNQASLYGLASGTARGGVPSARI  182

Query  783   ASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKI  959
             A YK+CW  GC D D+LA FD AIADGVD+IS+SVGG+ P+ +F D IAIG++H+MK  I
Sbjct  183   AVYKICWSDGCYDADILAAFDDAIADGVDIISLSVGGNRPKYYFNDSIAIGAFHSMKHGI  242

Query  960   VTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GK  1136
             +T+ +AGN+GP + TI+N SPW ++VAA+SIDR+  S V+LGN  +  G++INTF+L GK
Sbjct  243   LTSNSAGNDGPDYFTIRNFSPWSLSVAASSIDRKLVSRVQLGNKNIYQGYTINTFDLKGK  302

Query  1137  MYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGV  1313
              YPLI    A + +  + G+ S  C   S+   LV+GKIV C S  S    +     +GV
Sbjct  303   QYPLIYAGSAPNISGGFTGSSSRFCSRNSVDRNLVKGKIVLCDSVLSPATFVSLNGAMGV  362

Query  1314  IASD-KLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSF  1487
             + +D  + D      +P++ +   DG  I  Y++  K PTA I +S AV  T+AP++ SF
Sbjct  363   VMNDLGVKDNARSYPLPSSYLKPVDGNNIKTYMDRNKFPTATILKSNAVNDTSAPWIVSF  422

Query  1488  SARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAA  1667
             S+RGP   + +ILKPDL APG+ ILAA++ +AT++  V D+R   YN+ SGTSM+ PHA 
Sbjct  423   SSRGPNPETYDILKPDLTAPGVEILAAWSPIATVSSGVRDSRTTLYNIISGTSMSCPHAT  482

Query  1668  GAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDI  1844
              AA YVKTFHP WSPAAIKSALMTTA  +  K       A GAG I P KAV PGL++D 
Sbjct  483   AAAVYVKTFHPTWSPAAIKSALMTTATPLNAKLNTQVEFAYGAGHINPLKAVHPGLLYDA  542

Query  1845  NKSEYMSYLCKE-FNNASLGSLTGSKDNK-CKNIPAAQGADGLNYPSMHLQLTNPNATTF  2018
              + +Y+ +LC + +  A +  L+G  DN  C    + +  D LNYPS  L  T  +A +F
Sbjct  543   YERDYVRFLCGQGYTTAMVRRLSG--DNSFCSRANSGRVWD-LNYPSFALSST--SAQSF  597

Query  2019  SAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKA  2195
             +  F RTVT VG+  + ++AK + AP GL+++V P +LSF    QK+S+ + + G  +++
Sbjct  598   NQFFRRTVTNVGSKVSTYRAKVVGAPRGLSITVNPPVLSFNAIGQKKSFTLTIRGSIRQS  657

Query  2196  ISWYMSGSLVWKDNTHSVRSPILVY  2270
             I   +S SL+W D  H+VRSPI V+
Sbjct  658   I---VSASLMWSDGYHNVRSPITVF  679



>ref|XP_008351270.1| PREDICTED: cucumisin-like isoform X1 [Malus domestica]
Length=742

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/724 (48%), Positives = 459/724 (63%), Gaps = 24/724 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDE---HHNILTEALGDEELARE-YRIHSYRRSFSGF  305
             H   RK YIVYMG+ P  P +S       H N+L   + D  +A E   +HSY+RSF+GF
Sbjct  27    HQDNRKDYIVYMGDKPK-PEVSTTTTSALHVNMLQNVVEDSNIAHESLLLHSYKRSFNGF  85

Query  306   VARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLD  485
              ARL   EA++L+  D VVSVF +   KL TTRSWDF+G      R+   E+D IVG++D
Sbjct  86    AARLTEEEAQKLAGMDGVVSVFPSETKKLQTTRSWDFIGFPEMVKRS-AIETDTIVGMID  144

Query  486   TGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE--DQESP  659
             +G+W ES SF D G+GPPP +WKG C+   NFT CN K+IGA+Y+  + +     D  SP
Sbjct  145   SGIWPESASFSDAGFGPPPKRWKGACKGEGNFT-CNNKIIGARYYRSQPYPKNSSDVMSP  203

Query  660   ADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAG  839
              D +GHG+H AS AAG +V  ASLYG+  GTARGGVPSARIA YKVCW  GC D D+LA 
Sbjct  204   RDTEGHGTHTASTAAGNLVSKASLYGLGLGTARGGVPSARIAVYKVCWSDGCPDADILAA  263

Query  840   FDAAIADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNV  1016
             FD AIADGVD++S+S+GG  P  +F++ I IG++HA++K I T+A+AGNEGP   TI N 
Sbjct  264   FDDAIADGVDILSVSLGGRKPLDYFRNAIDIGAFHALRKGIFTSASAGNEGPNLKTITNF  323

Query  1017  SPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG  1193
             +PW + VAA++IDR F++ V+LGN ++  G   NTFEL GK YP++      D+ A Y G
Sbjct  324   APWSLAVAASTIDRHFDTKVQLGNHKIYEGIVTNTFELKGKFYPIVYAGDVPDRAAGYNG  383

Query  1194  NYS-ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATI  1370
               S  C   ++  KLV  KIV C              G  V+ S    D + P  IPA  
Sbjct  384   ETSRLCQTGTLDTKLVEDKIVLCDGPTGDGALYAGAFGY-VLTSRNAADVIDPVPIPAAS  442

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             V    G +I  YIN+T+ PTA I++S       AP+VPSFS+RGP   + NILKPD+A+P
Sbjct  443   VWFHVGNEITHYINSTRNPTATIWKSTEGRDALAPYVPSFSSRGPNPNTPNILKPDIASP  502

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+SILAA+  +A ++G   D RV  YN+ SGTSMA PHAAG AAYVK+FHP+WSPAAI S
Sbjct  503   GVSILAAWPPIAPVSGVEGDDRVASYNIISGTSMACPHAAGVAAYVKSFHPNWSPAAILS  562

Query  1728  ALMTTAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             AL TTAK M   + P  A  A GAGLI P++A  PGL++D  + +Y+++LC   ++   L
Sbjct  563   ALTTTAKPMSANLNP-EAEFAYGAGLINPSRAPYPGLVYDAAEIDYVNFLCAHGYSTRLL  621

Query  1899  GSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKA  2078
              +LTG   +  ++      +D LNYPS+ L  +NP +   +  F RTVT VG+  + +KA
Sbjct  622   KALTGDSCSSSQSSHGTL-SDHLNYPSVALSTSNPKSV--NGIFNRTVTNVGSPKSTYKA  678

Query  2079  KIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
             K+ AP GL + V P+IL F    QK S++V V G  +K I   +SGSLVW D    VRSP
Sbjct  679   KVSAPPGLEIKVNPSILKFTSLGQKLSFQVTVKGLIEKTI---VSGSLVWDDGNFQVRSP  735

Query  2259  ILVY  2270
             I+VY
Sbjct  736   IVVY  739



>ref|XP_008461726.1| PREDICTED: cucumisin-like [Cucumis melo]
Length=744

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/717 (47%), Positives = 468/717 (65%), Gaps = 18/717 (3%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG   +D T SA   H  IL E       ARE+ +HSY+RSF+GFVA+L   E
Sbjct  33    RKVYIVYMGNKLED-TDSAPFHHMRIL-EKGTSSNFAREFLLHSYKRSFNGFVAKLTKEE  90

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A+++SE ++VVSVF N +  L TTRSWDF+G +    R  + ES+L+VG+ DTG+W E+P
Sbjct  91    AQKISEMEEVVSVFPNGKKHLHTTRSWDFIGFTKDVPRVNQIESNLVVGVFDTGIWPENP  150

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQ-YFNVEGFAPEDQESPADFDGHGSH  686
             SF D GYGP PAKWKG CQ   NFT CN K+IGA+ Y +   F PED +SP D DGHG+H
Sbjct  151   SFSDVGYGPIPAKWKGTCQTSANFT-CNNKIIGARAYRSDNNFPPEDIQSPRDSDGHGTH  209

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS   G +V  ASLYG+A GTARGGVPSARIA YK+CW  GC D D+LA FD +I DGV
Sbjct  210   TASTVVGGLVNEASLYGLAHGTARGGVPSARIAVYKICWFDGCDDADILAAFDDSIDDGV  269

Query  867   DVISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+IS+SVG    S +  DPIAIG++HAMK   +T+ +AGNEGP + ++ NV+PWL+++AA
Sbjct  270   DLISLSVGPSQSSPYIFDPIAIGAFHAMKNGKLTSTSAGNEGPNYFSVSNVAPWLLSMAA  329

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYL  1217
             ++IDR+  S+V+LGN  +  G++INTF+L GK YPLI    A +    + G+ S  C   
Sbjct  330   STIDRKLVSNVELGNRNIYQGYTINTFDLEGKQYPLIYARDAPNIAGGFTGSMSRFCSAN  389

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKK  1394
             S++  LV+GKI+ C S       + +    GVI +D +  D+     +P++ +   DG  
Sbjct  390   SVNGNLVKGKILVCDSVLPPSRFVNFSDAAGVIMNDGRAKDSSGSYPLPSSYLTTADGNN  449

Query  1395  IDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             I  Y+++ +APTA IF+S A+  T+AP V SFS+RGP   + +ILKPDL APG+ ILAA+
Sbjct  450   IKTYMSSNEAPTATIFKSNAINDTSAPLVASFSSRGPNPQTFDILKPDLTAPGVQILAAW  509

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
                A ++  V D+R   YN+ SGTSM+ PHA  AA YVKTFHP WSPAAIKSALMTTA  
Sbjct  510   PPNAPVSSGVIDSRKTMYNIISGTSMSCPHATAAAVYVKTFHPTWSPAAIKSALMTTATP  569

Query  1752  MKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN  1925
             +  +  + A  A G+G I P KA+ PGL++D ++S+Y+ +LC + +  + +   +  K+ 
Sbjct  570   LNAELNVQAEFAYGSGQINPVKAINPGLVYDASESDYVKFLCGQGYTTSMVQRFSNDKNT  629

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA-PTGL  2102
              C +    +  D LNYPS    L++     F+  F RT+T VG+ ++ + + ++  P GL
Sbjct  630   VCNSTNMGRVWD-LNYPS--FVLSSSPLRPFNQYFTRTLTNVGSNASTYTSTVRGTPQGL  686

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYR  2273
             T++V P  LSF    QKR++ + + G  + +++   S SLVW D +H+VRSPI V++
Sbjct  687   TITVNPTSLSFNSIGQKRNFTLTIRGTVRPSMA---SASLVWSDGSHNVRSPITVFK  740



>ref|XP_004149139.1| PREDICTED: xylem serine proteinase 1-like [Cucumis sativus]
Length=752

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/729 (48%), Positives = 461/729 (63%), Gaps = 22/729 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D ++  YIV++   P    +  V+ H N+L         A E  ++SY +SF+ F A+L
Sbjct  26    EDEEKNHYIVFLENKPVLNEVDVVETHLNLLMSVKKSHAEASESMVYSYTKSFNAFAAKL  85

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA+ LS +  V  V  N   KL TTRSWDF+G+S+ A R+ K ESD+IVGL DTG+ 
Sbjct  86    SDDEAKLLSTRKDVHHVIPNKYRKLQTTRSWDFIGLSSNARRSTKHESDIIVGLFDTGIT  145

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKV---------IGAQYFNVEGFA-PED  647
               + SFKDDG+GPPP KWKG C    NFT CN             GA+YF ++G   P D
Sbjct  146   PTADSFKDDGFGPPPKKWKGTCHHFANFTACNNSFSTFLVFLLFFGARYFKLDGNPDPSD  205

Query  648   QESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDM  824
               SP D DGHG+H +S A G  + GASL G+AEGTARGGVPSAR+A YKVCW   GC DM
Sbjct  206   ILSPVDTDGHGTHTSSTATGNAIAGASLSGLAEGTARGGVPSARVAMYKVCWTSSGCSDM  265

Query  825   DVLAGFDAAIADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFG  1001
             D+LA FDAAI DGVDVISIS+GG    ++  D I+IG++HAMKK I+T  +AGN GP  G
Sbjct  266   DILAAFDAAIQDGVDVISISIGGGGFNNYSDDSISIGAFHAMKKGIITVTSAGNGGPTAG  325

Query  1002  TIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKN  1178
             ++ N +PW++TVAA+SIDR+F S ++LGNG+ ISG  IN F    KMYPL+SG     +N
Sbjct  326   SVVNHAPWIVTVAASSIDRKFISPLELGNGKNISGVGINIFNPKQKMYPLVSGGDVA-RN  384

Query  1179  ATYPGNYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVI-ASDKLPDTVLPT  1352
             +      S C   ++    V+G +V+C L +   D  IK I   GVI  SD+  D     
Sbjct  385   SESKDTASFCLEGTLDPTKVKGSLVFCKLLTWGADSVIKSIGANGVIIQSDEFLDNADIF  444

Query  1353  MIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKP  1532
             M PAT+V    G  I  YI +T+ PTA I++++ +K  AP V SFS+RGP   S  ILKP
Sbjct  445   MAPATMVSSLVGNIIYTYIKSTRTPTAVIYKTKQLKAKAPMVASFSSRGPNPGSHRILKP  504

Query  1533  DLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSP  1712
             D+AAPG+ ILAAYT L ++TGQ  DT+  K+ + SGTSMA PH A AAAYVK+FHP WSP
Sbjct  505   DIAAPGVDILAAYTPLKSLTGQKGDTQYSKFTLMSGTSMACPHVAAAAAYVKSFHPLWSP  564

Query  1713  AAIKSALMTTAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-F  1883
             AAI+SAL+TTA  +  ++ P G + A GAG + P++A++PGLI+D+N+  Y+ +LC E +
Sbjct  565   AAIRSALLTTATPISRRLNPEGEF-AYGAGNLNPSRAISPGLIYDLNEISYIQFLCSEGY  623

Query  1884  NNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGS  2063
               +S+  L+G+K   C N+   QG D LNYP+  L L + N    +  F R VT VG   
Sbjct  624   TGSSIAVLSGTKSINCSNLIPGQGHDSLNYPTFQLSLKSTNQ-PMTTTFRRRVTNVGHPI  682

Query  2064  TVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTH  2243
             +V+ A I AP G+T++V P  LSF +  QKRS+KVVV      + +  +SGSL W    H
Sbjct  683   SVYNATINAPPGVTITVTPPTLSFSRLLQKRSFKVVVKASPLPS-AKMVSGSLAWVGAQH  741

Query  2244  SVRSPILVY  2270
              VRSPI+VY
Sbjct  742   VVRSPIVVY  750



>ref|XP_008391035.1| PREDICTED: cucumisin-like isoform X1 [Malus domestica]
Length=744

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/726 (47%), Positives = 464/726 (64%), Gaps = 26/726 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDE---HHNILTEALGDEELARE-YRIHSYRRSFSGF  305
             H   RK YIVYMG+ P  P +S       H N+L   + D  +A E   +HSY+R+F+GF
Sbjct  27    HQDTRKDYIVYMGDKPK-PEVSTTTTSAFHVNMLQNVIDDSNIAHESLLLHSYKRTFNGF  85

Query  306   VARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLD  485
              A+L   EA++L+  D VVSVF +   KL TTRSWDF+G      R+   E+D+IVG++D
Sbjct  86    AAKLTEEEAQKLAGMDGVVSVFPSETKKLQTTRSWDFIGFPKIVKRS-AIETDIIVGVID  144

Query  486   TGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQE--SP  659
             +G+W ES SF D G+GPPP +WKG C+   NFT CN K+IGA+Y+  + +     +  SP
Sbjct  145   SGIWPESASFSDAGFGPPPKRWKGACKGEGNFT-CNNKIIGARYYRXQPYPQNSSDILSP  203

Query  660   ADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAG  839
              D DGHG+H AS AAG +V  ASLYG+  GTARGGVPSARIA YKVCW  GC D D+LA 
Sbjct  204   RDTDGHGTHTASTAAGNLVSKASLYGLGLGTARGGVPSARIAVYKVCWXDGCPDADILAA  263

Query  840   FDAAIADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNV  1016
             FD AIADGVD++S+S+GG  P  +F++ I IG++HA++K I T+A+AGNEGP   TI N 
Sbjct  264   FDDAIADGVDILSVSLGGFKPLDYFRNSIDIGAFHALRKGIFTSASAGNEGPNLKTITNF  323

Query  1017  SPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG  1193
             +PW + VAA++IDR F++ V+LGN ++  G   NTFEL GK YP++      D  A Y G
Sbjct  324   APWYLAVAASTIDRHFDTKVQLGNHKIYEGIVTNTFELKGKFYPIVYAADVPDTAAGYDG  383

Query  1194  NYS-ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPAT  1367
               S  C   ++ +KLV GKIV C       Y   +    G V+ S    D + P   PA 
Sbjct  384   ETSRLCRIGTLDKKLVEGKIVLC--DGPTGYGAIYAGAFGYVLTSRXAADVIDPVPXPAA  441

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAA  1544
                   G +I  Y+N+T+ PTA I++S   +   AP+VPSFS+RGP   + NILKPD+A+
Sbjct  442   SXWFHXGNEIAHYLNSTRNPTATIWKSTEGMDALAPYVPSFSSRGPNPNTPNILKPDIAS  501

Query  1545  PGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             PG+SILAA+  +A ++G   D RV  YN+ SGTSMA PHAAG AAYVK+FHP+WSPAAI 
Sbjct  502   PGVSILAAWPPIAPVSGFEGDDRVTAYNILSGTSMACPHAAGVAAYVKSFHPNWSPAAIL  561

Query  1725  SALMTTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNAS  1895
             SAL TTAK M+  + P  A  A GAGLI P++A  PGL++D  + +Y+++LC   ++   
Sbjct  562   SALTTTAKPMRANLNP-EAEFAYGAGLINPSRAPYPGLVYDAAEIDYVNFLCAHGYSTRL  620

Query  1896  LGSLTGSKDNKCKNIPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVF  2072
             L +LTG+  +   +  +    +D LNYPS+ L  +NP +   +  F RTVT VG+  + +
Sbjct  621   LKALTGNSHSCSSSQSSHGTLSDHLNYPSVALSTSNPKSV--NGIFNRTVTNVGSPKSTY  678

Query  2073  KAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVR  2252
             KAK+ AP GL + V P++L F    QK S++V V G  +K I   +SGSLVW D    VR
Sbjct  679   KAKVSAPPGLEIKVNPSVLKFTSLGQKLSFQVTVKGLIEKTI---VSGSLVWDDGKFQVR  735

Query  2253  SPILVY  2270
             SPI+VY
Sbjct  736   SPIVVY  741



>ref|XP_002320085.1| hypothetical protein POPTR_0014s07050g [Populus trichocarpa]
 gb|EEE98400.1| hypothetical protein POPTR_0014s07050g [Populus trichocarpa]
Length=742

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/724 (47%), Positives = 467/724 (65%), Gaps = 21/724 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D Q++ YIVY+G+ P D  +SAV  H ++L      +  ARE  I+SY + F+ F A+L
Sbjct  29    EDEQKEFYIVYLGDQPVD-NVSAVQTHMDVLLSIKRSDVEARESIIYSYTKIFNAFAAKL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA +LS +++V+SVF N   KL TT+SWDF+G+   A RN K E +++VGLLDTG+ 
Sbjct  88    SKAEASKLSRREEVLSVFPNRYHKLHTTKSWDFIGLPNTAKRNLKMERNIVVGLLDTGIT  147

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              +S SFKDDG+GPPP KWKG C    NF+GCN K++GA+YF ++G   P D  SP D DG
Sbjct  148   PQSESFKDDGFGPPPKKWKGTCGHYTNFSGCNNKLVGARYFKLDGNPDPSDILSPVDVDG  207

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAA  851
             HG+H +S  AG ++  ASL+G+A G ARG VP+AR+A YKVCW   GC DMD+LA F+AA
Sbjct  208   HGTHTSSTLAGNLIPDASLFGLAGGAARGAVPNARVAMYKVCWISSGCSDMDLLAAFEAA  267

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVDV+SIS+GG   ++  D +AIG++HAMKK I+T A+ GN+GP  G++ N +PW++
Sbjct  268   IHDGVDVLSISIGGVDANYVSDALAIGAFHAMKKGIITVASGGNDGPSSGSVANHAPWIL  327

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA-  1205
             TVAA+ I+R F S V+LGNG++ SG  +NTFE   K YPL+SG       A Y G   + 
Sbjct  328   TVAASGINREFRSKVELGNGKIFSGVGVNTFEPKQKSYPLVSGA-----EAGYSGRQDSA  382

Query  1206  --CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGV-IASDKLPDTVLPTMIPATIV  1373
               CD  S+    V+GK+V C L     D  +K I G G+ + S +  D     M PAT+V
Sbjct  383   RFCDAGSLDPNKVKGKLVLCELGVWGADSVVKGIGGKGILLESQQYLDAAQIFMAPATMV  442

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
             +      ++ YI++T  P+A I+RS+ V+  APFV SFS+RGP   S  ILK   A+PG+
Sbjct  443   NATVSGAVNDYIHSTTFPSAMIYRSQEVEVPAPFVASFSSRGPNPGSERILK---ASPGI  499

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILA+YT L ++TG   DT+  ++++ SGTSMA PH +G AAY+K+FHP+W+ AAIKSA+
Sbjct  500   DILASYTPLRSLTGLKGDTQHSRFSLMSGTSMACPHVSGLAAYIKSFHPNWTAAAIKSAI  559

Query  1734  MTTAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             +TTAK M  +    A  A GAG I P +A  PGL++D+++  Y+ +LC E +N +S   L
Sbjct  560   LTTAKPMSSRVNNDAEFAYGAGQINPLRARNPGLVYDMDEMSYIQFLCHEGYNGSSFAVL  619

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
              GSK   C ++    G D LNYP+M L + N    T    F RTVT VG   +++ A IK
Sbjct  620   VGSKAINCSSLLPGLGYDALNYPTMQLNVKNEQEPTI-GVFTRTVTNVGPSPSIYNATIK  678

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             AP G+ + V P  LSF    QKRS+KVVV  K        +SGSLVWK   H VRSPI++
Sbjct  679   APEGVEIQVKPTSLSFSGAAQKRSFKVVVKAKPLSG-PQILSGSLVWKSKLHVVRSPIVI  737

Query  2268  YRSL  2279
             ++ L
Sbjct  738   FKPL  741



>gb|EYU19955.1| hypothetical protein MIMGU_mgv1a023738mg [Erythranthe guttata]
Length=699

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/709 (47%), Positives = 463/709 (65%), Gaps = 21/709 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+ P     SA  +H ++L   LG +  A++  +HSY+RSF+GFVA+L   E  +++  
Sbjct  1     MGDRPKG-EFSATSQHMSMLQATLGSQR-AKDSWLHSYKRSFNGFVAKLTEEEKNKIASL  58

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D VVS+FR+T+ +L TTRSWDFLG      R    ESD+++G+LDTG+W ES SF D GY
Sbjct  59    DGVVSIFRSTKKQLHTTRSWDFLGFPLNVQR-ATTESDVVIGMLDTGIWPESASFNDTGY  117

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAG  707
             GPPP+KWKG CQ   NF+ CN K+IGA+Y++ EG  +  D  SP D +GHG+H AS AAG
Sbjct  118   GPPPSKWKGSCQSSSNFS-CNNKIIGAKYYHSEGIISAPDVASPRDTEGHGTHTASTAAG  176

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
               V GA+LYG+A+GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SV
Sbjct  177   ASVAGANLYGLADGTARGGVPSARIAVYKICWSDGCSDADILAAFDDAIADGVDIISLSV  236

Query  888   GGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P  +F DPIAIG++H+MK  I+T+ + GN GP   +I NVSPW ++VAA++IDR+F
Sbjct  237   GGFAPSDYFDDPIAIGAFHSMKNGILTSNSGGNSGPDLESIVNVSPWSLSVAASTIDRKF  296

Query  1065  ESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              ++V+LGN +   G +INTF L    YPL+ G    +    + G+ S  C   S+  KLV
Sbjct  297   LANVQLGNSKTYEGRAINTFTLKNGTYPLVYGGNVPNTTGGFDGSISRYCYEGSLDAKLV  356

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG--VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYIN  1412
             +  IV C      D     + G    ++  +   D      +PA+ +   DG ++  YIN
Sbjct  357   KNTIVLC--DEINDGEAPALAGASGTIMQGEVFNDFAFSFPLPASYLGSTDGGQVYDYIN  414

Query  1413  TTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATM  1589
              T+ PTA IF+S  A +T+APFV SFS+RGP  I+  ILKPDL APG+ ILAA++   T+
Sbjct  415   KTRKPTATIFKSVEANETSAPFVVSFSSRGPNAITREILKPDLTAPGVDILAAWSEGTTV  474

Query  1590  TGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP-  1766
             TG  +D RVV YN+ SGTSM+ PH +GAAAYVK+F+P+WSP+AIKSALMTTA  M +K  
Sbjct  475   TGFPEDPRVVPYNIISGTSMSCPHVSGAAAYVKSFNPNWSPSAIKSALMTTASPMSVKTN  534

Query  1767  IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIP  1943
               A  A G+G I P KA +PGL++DI +S+Y+ +LC + +++ SL  +TG K   C    
Sbjct  535   TDAEFAYGSGQINPLKAKSPGLVYDIAESDYVKFLCGQGYSSKSLQLVTGDK-TTCTAAN  593

Query  1944  AAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPN  2123
              A   D LNYPS  +     +  + +  F+RTVT VG+ ++ +KA + A  GL++ V P+
Sbjct  594   NATVYD-LNYPSFSVSAA-ASGGSVTRVFHRTVTNVGSPNSTYKAVVAAAVGLSIQVQPS  651

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              L+F    +K+S+ V V+     A+   +SGSLVW D T+ VRSPI+ +
Sbjct  652   TLTFKSVLEKQSFAVTVTAAVSGAV---LSGSLVWDDGTYQVRSPIVAH  697



>ref|XP_008461725.1| PREDICTED: cucumisin-like [Cucumis melo]
Length=755

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/722 (47%), Positives = 460/722 (64%), Gaps = 22/722 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              +  RK YIVYMG  P D T S    H  +L E  G    A E  +HSY+RSF+GFV +L
Sbjct  42    ENVDRKIYIVYMGNKPQD-TASTPSHHMRMLREVTG-SNFAPESLLHSYKRSFNGFVVKL  99

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA R+S K+ VVSVF + +  L TTRSWDFLG +    R  + ESD++VG+LD+G+W
Sbjct  100   TEEEAHRISAKEGVVSVFPSGKKHLHTTRSWDFLGFTKDVPRVNQVESDIVVGVLDSGIW  159

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDG  674
              E+PSF D GYGP PAKWKG CQ   NFT CN+K+IGA+ +  +   P  D  SP D +G
Sbjct  160   PENPSFSDVGYGPIPAKWKGSCQTSANFT-CNKKIIGARAYRSDNVFPTADIPSPRDSNG  218

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS  AG +V  ASLYG+A GTARGGVPSARIA YK+CW  GC D D+LA FD AI
Sbjct  219   HGTHTASTVAGGLVSQASLYGLALGTARGGVPSARIAVYKICWSDGCSDADILAAFDDAI  278

Query  855   ADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS+SVGG   R +F D IAIG++H+MK  I+T+ +AGN+GP + TI+N SPW +
Sbjct  279   ADGVDIISLSVGGSEARYYFNDSIAIGAFHSMKHGILTSNSAGNDGPDYFTIRNFSPWSL  338

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA-  1205
             +VAA++ DR+  S V++GN  +  G++INTF+ LGK YPLI    A + +  + G+ S  
Sbjct  339   SVAASTTDRKLVSRVEIGNTNVYQGYTINTFDPLGKQYPLIYAGDAPNIDGGFTGSISRF  398

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD---KLPDTVLPTMIPATIVD  1376
             C   S+   LV GKI+ C+S  +    + +   VGV+ +D   K P    P  +P++ + 
Sbjct  399   CSEGSVDANLVSGKILLCVSIVAPSAFVYFSEAVGVVMNDDGVKYPSNSYP--LPSSYLQ  456

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGL  1553
               DG  I  Y+ +   PTA IF+S AV  + APFV SFS+RGP   +L+ILKPDL APG 
Sbjct  457   TVDGDAIKTYMASNGVPTATIFKSDAVNDSYAPFVVSFSSRGPNPETLDILKPDLTAPGA  516

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILA ++ +A ++  V D+R   YN+ SGTSM+ PHA  AA YVKTFHP WSPAAIKSAL
Sbjct  517   EILAGWSPIAPVSSGVIDSRTTMYNIISGTSMSCPHATAAAVYVKTFHPTWSPAAIKSAL  576

Query  1734  MTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             MTTA  +K    + A  A GAG I P KA+ PGL++D N+S+Y+ +LC + + +A + SL
Sbjct  577   MTTATPLKPDINVEAEFAYGAGQINPLKAINPGLVYDANESDYVKFLCGQGYTSAMVQSL  636

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI-  2084
               S DN   N         LNYPS  L  T   + + +  F RT+T V + ++ + + I 
Sbjct  637   --SNDNTLCNSANIGRVWDLNYPSFALSST--PSQSINQFFTRTLTSVDSNASTYTSTIL  692

Query  2085  KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
              AP GLT++V P +LSF    +K ++ + + G      +  +S SLVW D++H VRSPI 
Sbjct  693   GAPQGLTITVNPKVLSFSGMGEKNTFTLTIQGSIDP--TSIVSASLVWSDSSHDVRSPIT  750

Query  2265  VY  2270
             +Y
Sbjct  751   IY  752



>emb|CBI31599.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/726 (48%), Positives = 471/726 (65%), Gaps = 28/726 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVAR  314
              D  RK YIVYMG  P  D + SA+  H N+L +  G    A    + SY+RSF+GFVA+
Sbjct  31    EDDVRKEYIVYMGAKPAGDFSASAI--HTNMLEQVFGSGR-ASSSLVRSYKRSFNGFVAK  87

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             L   E +++   D VVSVF + + +L TTRSWDF+G   +  R    ESD+I+G+LD G+
Sbjct  88    LTEDEMQQMKGMDGVVSVFPSEKKQLHTTRSWDFVGFPRQVKRT-SFESDIIIGVLDGGI  146

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFD  671
             W ES SF D G+GPPP KWKG CQ   NFT CN K+IGA+Y+  +  F+PED +SP D D
Sbjct  147   WPESDSFDDKGFGPPPRKWKGTCQGFSNFT-CNNKIIGAKYYKSDRKFSPEDLQSPRDSD  205

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC D D+LA FD A
Sbjct  206   GHGTHTASTAAGGLVNMASLMGFGLGTARGGVPSARIAVYKICWSDGCDDADILAAFDDA  265

Query  852   IADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD+IS S+G  P R +F+D  AIG++HAMK  I+T+ +AGN+GP   ++ NV+PW 
Sbjct  266   IADGVDIISYSLGNPPSRDYFKDTAAIGAFHAMKNGILTSTSAGNDGPRLVSVVNVAPWS  325

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-  1205
             ++VAA++IDR+F ++V+LG+ ++  GFSIN FE   MYPLI G  A +    + GN S  
Sbjct  326   LSVAASTIDRKFLTEVQLGDKKVYKGFSINAFEPNGMYPLIYGGDAPNTRGGFRGNTSRF  385

Query  1206  CDYLSISEKLVRGKIVYCLSSAS---QDYTIKWIHGVGVIASD--KLP-DTVLPTMIPAT  1367
             C+  S++  LV+GKIV C+   +   + ++      VG +  D  +LP D+     +PA+
Sbjct  386   CEINSLNPNLVKGKIVLCIGLGAGFKEAWSAFLAGAVGTVIVDGLRLPKDSSNIYPLPAS  445

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAA  1544
              +   DGK+I  YI++T  PTA I +S  VK T AP+VPSFS+RGP  I+ ++LKPDL A
Sbjct  446   RLSAGDGKRIAYYISSTSNPTASILKSIEVKDTLAPYVPSFSSRGPNNITHDLLKPDLTA  505

Query  1545  PGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             PG+ ILAA++ ++ ++    D RV +YN+ SGTSMA PHA GAAAY+K+FHP WSPAAIK
Sbjct  506   PGVHILAAWSPISPISQMSGDNRVAQYNILSGTSMACPHATGAAAYIKSFHPTWSPAAIK  565

Query  1725  SALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             SALMTTA  M   K   A  A GAG I P +AV PGL++D ++ +++++LC E ++  +L
Sbjct  566   SALMTTATPMSARKNPEAEFAYGAGNIDPVRAVHPGLVYDADEIDFVNFLCGEGYSIQTL  625

Query  1899  GSLTGSKDNKCKNIPAAQGAD-GLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFK  2075
               +TG      K   A  GA   LNYPS  L +  P   + +  F R+VT VG   + +K
Sbjct  626   RKVTGDHSVCSK---ATNGAVWDLNYPSFALSI--PYKESIARTFKRSVTNVGLPVSTYK  680

Query  2076  AK-IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVR  2252
             A  I AP GL ++V PNILSF    QK S+ + V G+  K +   +S SLVW D  H VR
Sbjct  681   ATVIGAPKGLKINVKPNILSFTSIGQKLSFVLKVEGRIVKDM---VSASLVWDDGLHKVR  737

Query  2253  SPILVY  2270
             SPI+VY
Sbjct  738   SPIIVY  743



>ref|XP_010658506.1| PREDICTED: cucumisin isoform X2 [Vitis vinifera]
Length=745

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/719 (49%), Positives = 465/719 (65%), Gaps = 25/719 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YIVYMG  P  D + SA+  H ++L +  G    A    + SY+RSF+GFVA+L
Sbjct  38    DDGRKEYIVYMGAKPAGDFSASAI--HIDMLQQVFGSR--ASISLVRSYKRSFNGFVAKL  93

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVS+F N + +L TTRSWDF+G   +  R    ESD+I+G+LD+G+W
Sbjct  94    TEEEMQQMKGMDGVVSIFPNEKKQLHTTRSWDFVGFPQQVKRT-SIESDIIIGVLDSGIW  152

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D+G+GPPP+KW G CQ   NFT CN K+IGA+Y+   G F  ED +SP D +G
Sbjct  153   PESDSFDDEGFGPPPSKWIGTCQGFSNFT-CNNKIIGAKYYRSSGQFRQEDFQSPRDSEG  211

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC   D+LA FD AI
Sbjct  212   HGTHTASTAAGGLVSMASLMGFGLGTARGGVPSARIAVYKICWSDGCFGADILAAFDDAI  271

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+ISISVGG  P ++F+DPIAIG++HAMKK+I+T+A+AGN+GP   +I N SPW +
Sbjct  272   ADGVDIISISVGGKTPTNYFEDPIAIGAFHAMKKRILTSASAGNDGPVLASITNFSPWSL  331

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++IDR F + V+LG+  +  G SINTFEL  MYPLI G  A +  A + GN S  C
Sbjct  332   SVAASTIDRDFFTKVQLGDSNVFEGVSINTFELNDMYPLIYGGDAPNTAAGFSGNRSRFC  391

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHG-VGVIASDKLP-DTVLPTMIPATIVDIE  1382
                +++  LV+GKIV C      +    ++ G VG + +D LP D+     +PA+ +   
Sbjct  392   FPSTLNPNLVKGKIVLC--DVKTNGAGAFLAGAVGALMADTLPKDSSRSFPLPASHLSAR  449

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             DG  I  YIN+T  PTA IF+S  V    AP+V SFS+RGP   S ++LKPD+AAPG+ I
Sbjct  450   DGSSIANYINSTSNPTASIFKSTEVSDALAPYVVSFSSRGPNPASFDLLKPDIAAPGVRI  509

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAA+  +A ++G   D R V YN+ SGTSM+ PHA+GAAAY+K+F+P WSPAAIKSALMT
Sbjct  510   LAAWPPIAPVSGVKGDNREVLYNIISGTSMSCPHASGAAAYIKSFNPTWSPAAIKSALMT  569

Query  1740  TAKAMKIKPI-GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TA  M  K    A  A GAG I P KA+ PGL++D ++ +Y+ +LC + ++  +L  +TG
Sbjct  570   TATPMSAKKNPEAEFAYGAGNIDPVKAIDPGLVYDADEIDYVKFLCGQGYSTPALRLVTG  629

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKA  2090
               DN   +         LNYPS    L++    + +  F RTVT VG+  + +KA  I A
Sbjct  630   --DNSVCSAATNGTVWNLNYPS--FALSSLTKESITGMFNRTVTNVGSSVSTYKATVIGA  685

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             P GL + V P+ILSF    QK S+ + V GK    I   +S SLVW D  H VR+PI+V
Sbjct  686   PEGLEIQVEPSILSFTSLMQKLSFVLKVEGKVGDNI---VSASLVWDDGVHQVRTPIVV  741



>ref|XP_010658505.1| PREDICTED: cucumisin isoform X1 [Vitis vinifera]
Length=746

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/719 (49%), Positives = 465/719 (65%), Gaps = 24/719 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YIVYMG  P  D + SA+  H ++L +  G    A    + SY+RSF+GFVA+L
Sbjct  38    DDGRKEYIVYMGAKPAGDFSASAI--HIDMLQQVFGSSR-ASISLVRSYKRSFNGFVAKL  94

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVS+F N + +L TTRSWDF+G   +  R    ESD+I+G+LD+G+W
Sbjct  95    TEEEMQQMKGMDGVVSIFPNEKKQLHTTRSWDFVGFPQQVKRT-SIESDIIIGVLDSGIW  153

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D+G+GPPP+KW G CQ   NFT CN K+IGA+Y+   G F  ED +SP D +G
Sbjct  154   PESDSFDDEGFGPPPSKWIGTCQGFSNFT-CNNKIIGAKYYRSSGQFRQEDFQSPRDSEG  212

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC   D+LA FD AI
Sbjct  213   HGTHTASTAAGGLVSMASLMGFGLGTARGGVPSARIAVYKICWSDGCFGADILAAFDDAI  272

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+ISISVGG  P ++F+DPIAIG++HAMKK+I+T+A+AGN+GP   +I N SPW +
Sbjct  273   ADGVDIISISVGGKTPTNYFEDPIAIGAFHAMKKRILTSASAGNDGPVLASITNFSPWSL  332

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++IDR F + V+LG+  +  G SINTFEL  MYPLI G  A +  A + GN S  C
Sbjct  333   SVAASTIDRDFFTKVQLGDSNVFEGVSINTFELNDMYPLIYGGDAPNTAAGFSGNRSRFC  392

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHG-VGVIASDKLP-DTVLPTMIPATIVDIE  1382
                +++  LV+GKIV C      +    ++ G VG + +D LP D+     +PA+ +   
Sbjct  393   FPSTLNPNLVKGKIVLC--DVKTNGAGAFLAGAVGALMADTLPKDSSRSFPLPASHLSAR  450

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             DG  I  YIN+T  PTA IF+S  V    AP+V SFS+RGP   S ++LKPD+AAPG+ I
Sbjct  451   DGSSIANYINSTSNPTASIFKSTEVSDALAPYVVSFSSRGPNPASFDLLKPDIAAPGVRI  510

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAA+  +A ++G   D R V YN+ SGTSM+ PHA+GAAAY+K+F+P WSPAAIKSALMT
Sbjct  511   LAAWPPIAPVSGVKGDNREVLYNIISGTSMSCPHASGAAAYIKSFNPTWSPAAIKSALMT  570

Query  1740  TAKAMKIKPI-GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TA  M  K    A  A GAG I P KA+ PGL++D ++ +Y+ +LC + ++  +L  +TG
Sbjct  571   TATPMSAKKNPEAEFAYGAGNIDPVKAIDPGLVYDADEIDYVKFLCGQGYSTPALRLVTG  630

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKA  2090
               DN   +         LNYPS    L++    + +  F RTVT VG+  + +KA  I A
Sbjct  631   --DNSVCSAATNGTVWNLNYPS--FALSSLTKESITGMFNRTVTNVGSSVSTYKATVIGA  686

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             P GL + V P+ILSF    QK S+ + V GK    I   +S SLVW D  H VR+PI+V
Sbjct  687   PEGLEIQVEPSILSFTSLMQKLSFVLKVEGKVGDNI---VSASLVWDDGVHQVRTPIVV  742



>ref|XP_008351271.1| PREDICTED: cucumisin-like isoform X2 [Malus domestica]
Length=711

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/717 (48%), Positives = 456/717 (64%), Gaps = 24/717 (3%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDE---HHNILTEALGDEELARE-YRIHSYRRSFSGFVARLLPR  326
             YIVYMG+ P  P +S       H N+L   + D  +A E   +HSY+RSF+GF ARL   
Sbjct  3     YIVYMGDKPK-PEVSTTTTSALHVNMLQNVVEDSNIAHESLLLHSYKRSFNGFAARLTEE  61

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA++L+  D VVSVF +   KL TTRSWDF+G      R+   E+D IVG++D+G+W ES
Sbjct  62    EAQKLAGMDGVVSVFPSETKKLQTTRSWDFIGFPEMVKRS-AIETDTIVGMIDSGIWPES  120

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE--DQESPADFDGHG  680
              SF D G+GPPP +WKG C+   NFT CN K+IGA+Y+  + +     D  SP D +GHG
Sbjct  121   ASFSDAGFGPPPKRWKGACKGEGNFT-CNNKIIGARYYRSQPYPKNSSDVMSPRDTEGHG  179

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H AS AAG +V  ASLYG+  GTARGGVPSARIA YKVCW  GC D D+LA FD AIAD
Sbjct  180   THTASTAAGNLVSKASLYGLGLGTARGGVPSARIAVYKVCWSDGCPDADILAAFDDAIAD  239

Query  861   GVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             GVD++S+S+GG  P  +F++ I IG++HA++K I T+A+AGNEGP   TI N +PW + V
Sbjct  240   GVDILSVSLGGRKPLDYFRNAIDIGAFHALRKGIFTSASAGNEGPNLKTITNFAPWSLAV  299

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACD  1211
             AA++IDR F++ V+LGN ++  G   NTFEL GK YP++      D+ A Y G  S  C 
Sbjct  300   AASTIDRHFDTKVQLGNHKIYEGIVTNTFELKGKFYPIVYAGDVPDRAAGYNGETSRLCQ  359

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGK  1391
               ++  KLV  KIV C              G  V+ S    D + P  IPA  V    G 
Sbjct  360   TGTLDTKLVEDKIVLCDGPTGDGALYAGAFGY-VLTSRNAADVIDPVPIPAASVWFHVGN  418

Query  1392  KIDKYINTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
             +I  YIN+T+ PTA I++S       AP+VPSFS+RGP   + NILKPD+A+PG+SILAA
Sbjct  419   EITHYINSTRNPTATIWKSTEGRDALAPYVPSFSSRGPNPNTPNILKPDIASPGVSILAA  478

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             +  +A ++G   D RV  YN+ SGTSMA PHAAG AAYVK+FHP+WSPAAI SAL TTAK
Sbjct  479   WPPIAPVSGVEGDDRVASYNIISGTSMACPHAAGVAAYVKSFHPNWSPAAILSALTTTAK  538

Query  1749  AM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
              M   + P  A  A GAGLI P++A  PGL++D  + +Y+++LC   ++   L +LTG  
Sbjct  539   PMSANLNP-EAEFAYGAGLINPSRAPYPGLVYDAAEIDYVNFLCAHGYSTRLLKALTGDS  597

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
              +  ++      +D LNYPS+ L  +NP +   +  F RTVT VG+  + +KAK+ AP G
Sbjct  598   CSSSQSSHGTL-SDHLNYPSVALSTSNPKSV--NGIFNRTVTNVGSPKSTYKAKVSAPPG  654

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L + V P+IL F    QK S++V V G  +K I   +SGSLVW D    VRSPI+VY
Sbjct  655   LEIKVNPSILKFTSLGQKLSFQVTVKGLIEKTI---VSGSLVWDDGNFQVRSPIVVY  708



>ref|XP_002316252.2| cucumisin family protein [Populus trichocarpa]
 gb|EEF02423.2| cucumisin family protein [Populus trichocarpa]
Length=699

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/707 (48%), Positives = 452/707 (64%), Gaps = 22/707 (3%)
 Frame = +3

Query  171   MGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSE  347
             MG+ P  D ++SA+  H   L   +G    A +  ++SY RSF+GFVA+L   E  +++ 
Sbjct  1     MGDRPKSDISVSAL--HITRLQNVVGSG--ASDSLLYSYHRSFNGFVAKLTKEEKEKMAG  56

Query  348   KDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDG  527
              D VVSVF + + KL TTRSWDF+G      R   +ESD+IV +LDTG+W ES SF D+G
Sbjct  57    LDGVVSVFPSQKKKLHTTRSWDFMGFPKNVTR-ATSESDIIVAMLDTGIWPESESFNDEG  115

Query  528   YGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAA  704
             YGPPP+KWKG CQ   NFT CN K+IGA+Y++ EG   P D  SP D +GHG+H AS AA
Sbjct  116   YGPPPSKWKGTCQASSNFT-CNNKIIGARYYHSEGKVEPGDFASPRDSEGHGTHTASTAA  174

Query  705   GRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISIS  884
             GR+V  AS  G+A GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+S
Sbjct  175   GRLVSEASQLGLATGTARGGVPSARIAVYKICWSDGCSDADILAAFDDAIADGVDIISLS  234

Query  885   VGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             VGG P  +F+D IAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA+++DR+F
Sbjct  235   VGGWPMDYFEDSIAIGAFHSMKNGILTSNSAGNSGPDPESISNCSPWSLSVAASTMDRKF  294

Query  1065  ESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              + V LGNG +  G SINTFE G  M P I G  A +K A Y G+ S  C   S++  +V
Sbjct  295   VTPVMLGNGAIYEGISINTFEPGNIMPPFIYGGDAPNKTAGYNGSESRYCPLDSLNSTVV  354

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
              GK+V C    S     +  H VG ++  D   D      +P + +   DG  + KY+N+
Sbjct  355   EGKVVLC-DQISGGEEARASHAVGSIMNGDDYSDVAFSFPLPVSYLSSSDGADLLKYLNS  413

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T  PTA I +S  +K  TAPFV SFS+RGP  I+ ++LKPDL APG+ ILAA++   T+T
Sbjct  414   TSEPTATIMKSIEIKDETAPFVVSFSSRGPNPITSDLLKPDLTAPGVHILAAWSEATTVT  473

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPI-  1769
             G   DTRVVKYN+ SGTSM+ PHA+GAAAYVK F+P WSPAAIKSALMTT  A  +    
Sbjct  474   GSPGDTRVVKYNIISGTSMSCPHASGAAAYVKAFNPSWSPAAIKSALMTTGNASSMSSSI  533

Query  1770  --GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNIP  1943
                A  A G+G I P KA+ PGL++D  + +Y+ +LC +  NA+   L    ++ C    
Sbjct  534   NNDAEFAYGSGHINPAKAIDPGLVYDAGEIDYVRFLCGQGYNATQLLLITGDNSTCSAET  593

Query  1944  AAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPN  2123
                  D LNYPS    L+  +  T +  F+RTVT VG+ ++ +K+   AP+GL + + P+
Sbjct  594   NGTVWD-LNYPS--FALSAKSGKTITRVFHRTVTNVGSATSTYKSITNAPSGLNIQIEPD  650

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
             +LSF    Q+ S+ V V     K +   +SGSLVW+D  H VRSP++
Sbjct  651   VLSFQSLGQQLSFCVTVEATLGKTV---LSGSLVWEDGVHQVRSPVV  694



>ref|XP_004300747.1| PREDICTED: cucumisin-like [Fragaria vesca subsp. vesca]
Length=764

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/727 (49%), Positives = 471/727 (65%), Gaps = 26/727 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H  +RK +IVYMG       +SA   HH++L   LG+ ELA+E  I+SY +SF+GF A+L
Sbjct  20    HGEERKIHIVYMGGR-HHGDVSAQSTHHSVLQSVLGNIELAKESLIYSYGKSFNGFAAKL  78

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMS-TKANRNPKAESDLIVGLLDTGV  494
                E   L+E + +VSV  N  ++L TTRSWDF+G++ +K       E D+++GLLDTG+
Sbjct  79    SDEEVAELAEMEGIVSVIPNRRLELHTTRSWDFMGLTLSKGQLGASVEGDVVIGLLDTGI  138

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDG  674
             W ES SF DDG+GPPP KWKGKC KG NFT CN KVIGA+++N EG  P D +SP DF+G
Sbjct  139   WPESDSFNDDGFGPPPKKWKGKC-KGANFT-CNNKVIGARFYNSEG-DPTDIQSPRDFEG  195

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HGSH AS AAGR V  AS  G+A GTARGGVP+ARIA YKVCW  GC   D+LA FD AI
Sbjct  196   HGSHTASTAAGREVP-ASYLGLASGTARGGVPNARIAVYKVCWASGCYSSDILAAFDDAI  254

Query  855   ADGVDVISISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS+S+G G+P  + +D IAIGS+HAMK  IVT+++AGN GPY  ++ N +PW+M
Sbjct  255   ADGVDIISVSLGSGYPVQYLEDAIAIGSFHAMKYGIVTSSSAGNSGPYPLSLSNYAPWIM  314

Query  1032  TVAATSIDRRFESDVKLGNGELIS---GFSINTFEL-GKMYPLISGTLAQDKNA-TYPGN  1196
             TVAA++IDR+F +   LGNGE+ +   G SIN F+L GK +P+I G  A + +A      
Sbjct  315   TVAASTIDRKFVAKAVLGNGEVYTKNEGVSINNFDLNGKSHPIIWGGDAANFSAGANSET  374

Query  1197  YSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIV  1373
              S C    ++ +  +GKIV+C  +      +    GVG I +D    D      +PAT+V
Sbjct  375   ASFCLRGDLNSRKTKGKIVFC-ETIEDGSGVLLADGVGTIMADSSFSDVAYNFPLPATVV  433

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
              +EDG++I  YI +T  P A I  + A K   AP V SFS+RGP  I+ +ILKPDL APG
Sbjct  434   TLEDGQRILNYIRSTANPIATILVAEADKDVKAPTVVSFSSRGPNPITPDILKPDLTAPG  493

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             + ILAA++ +A  +  VDDTR V+YNV SGTSM+ PHA+GAAAYVK  HP+WSPAAIKSA
Sbjct  494   VDILAAWSPVAPPSSYVDDTRSVEYNVISGTSMSCPHASGAAAYVKAAHPNWSPAAIKSA  553

Query  1731  LMTTAKAMKIKPI-GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGS  1904
             LMTTA+ M  K       A G+G I P KAV PGLIFD + ++Y+ +LCK+ +N  +L  
Sbjct  554   LMTTARVMDPKKQEDLEFAYGSGHINPLKAVDPGLIFDAHVTDYVHFLCKQGYNTTTLKL  613

Query  1905  LTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI  2084
             +TG   + C      +  D LNYPS  L +   +    +A F RTVT VG+ ++ +  K 
Sbjct  614   ITGDSSSTCGRTKPGRAWD-LNYPSFSLAVE--DGQHINAVFTRTVTNVGSPNSTYTIKA  670

Query  2085  KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSP  2258
               P    VSV P+ +SF    +K+S+ V V+G    Q+ I   MSG++V  D  H VRSP
Sbjct  671   HTPFS-GVSVKPSSISFSYVGEKKSFTVKVTGPPIAQQPI---MSGAIVLTDGIHVVRSP  726

Query  2259  ILVYRSL  2279
             +++Y  L
Sbjct  727   LVIYTIL  733



>ref|XP_010658658.1| PREDICTED: cucumisin [Vitis vinifera]
Length=1430

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/729 (49%), Positives = 471/729 (65%), Gaps = 27/729 (4%)
 Frame = +3

Query  129   LWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFV  308
             +W +   ++ YIVYMG+LP    ISA   H N+L +  G    A EY +HSY+RSF+GFV
Sbjct  715   VWDNGVHQE-YIVYMGDLPKG-DISASTLHTNMLQQVFGSR--ASEYLLHSYQRSFNGFV  770

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   E ++LS  + VVSVF N + +L TTRSWDF+G   K  R    ESD+I+G+LDT
Sbjct  771   AKLTMEEKKKLSGIEGVVSVFPNGKKQLHTTRSWDFMGFPQKVKRT-TTESDIIIGMLDT  829

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPAD  665
             G+W ES SF D+G+GP P+KWKG CQ   NFT CN K+IGA+Y+  +G   P D +SP D
Sbjct  830   GIWPESASFSDEGFGPQPSKWKGTCQTSSNFT-CNNKIIGARYYRTDGKLGPTDIKSPRD  888

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
               GHG+H AS AAGRMV GASL G+  G ARGGVPSARIA YK+CW  GC D D+LA FD
Sbjct  889   SLGHGTHTASTAAGRMVRGASLLGLGSGAARGGVPSARIAVYKICWHDGCPDADILAAFD  948

Query  846   AAIADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSP  1022
              AIADGVD+IS+SVGG+ P  +F+D IAIG++H+MK  I+T+ +AGN GP   TI N SP
Sbjct  949   DAIADGVDIISLSVGGYDPYDYFEDSIAIGAFHSMKNGILTSNSAGNTGPDPATITNFSP  1008

Query  1023  WLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYS  1202
             W ++VAA++IDR+F + VKLGN ++  G S+NTFE+  MYP+I G  A +    Y  +YS
Sbjct  1009  WSLSVAASTIDRKFVTKVKLGNNKVYEGVSVNTFEMDDMYPIIYGGDAPNTTGGYDSSYS  1068

Query  1203  A-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVD  1376
               C   S+ + LV GKIV C    S    I     VG +  D    D+     +PA+ +D
Sbjct  1069  RYCYEDSLDKSLVDGKIVLCDWLTSGKAAIA-AGAVGTVMQDGGYSDSAYIYALPASYLD  1127

Query  1377  IEDGKKIDKYINTTK------APTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPD  1535
               DG K+  Y+N+T+       P A I +S  VK   APFV SFS+RGP  I+ +ILKPD
Sbjct  1128  PRDGGKVHHYLNSTRYFCINSKPMAIIQKSVEVKDELAPFVVSFSSRGPNPITSDILKPD  1187

Query  1536  LAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPA  1715
             L APG+ ILAA+T  +++TG+  DTRVV Y++ SGTSM+ PHA+ AAAY+K+FHP WSPA
Sbjct  1188  LTAPGVDILAAWTEASSVTGKEGDTRVVPYSIISGTSMSCPHASAAAAYIKSFHPTWSPA  1247

Query  1716  AIKSALMTTAKAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNN  1889
             AIKSALMTTA  M +K       A GAG I P KAV PGLI+D  ++ Y+++LC + ++ 
Sbjct  1248  AIKSALMTTAARMSVKTNTDMEFAYGAGHIDPVKAVHPGLIYDAGEANYVNFLCGQGYST  1307

Query  1890  ASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTV  2069
               L  +TG K + C         D LNYPS    ++  +  T +  F RTVT VG+  + 
Sbjct  1308  KHLRLITGDK-STCSATMNGTVWD-LNYPS--FTISTKSGVTVTRIFTRTVTNVGSAVST  1363

Query  2070  FKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSV  2249
             +KA +  P+GL+V V P++LSF    QK+++ + V     K +   +SGSLVW D  H V
Sbjct  1364  YKAILAVPSGLSVKVEPSVLSFKSLGQKKTFTMTVGTAVDKGV---ISGSLVWDDGIHQV  1420

Query  2250  RSPILVYRS  2276
             RSPI+ + S
Sbjct  1421  RSPIVAFVS  1429


 Score =   563 bits (1452),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 325/711 (46%), Positives = 434/711 (61%), Gaps = 45/711 (6%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVAR  314
              D  RK YIVYMG  P  D + SA+  H N+L +  G    A    + SY+RSF+GFVA+
Sbjct  47    EDDVRKEYIVYMGAKPAGDFSASAI--HTNMLEQVFGSGR-ASSSLVRSYKRSFNGFVAK  103

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             L   E +++   D VVSVF N + +L TTRSWDF+G   +  R    ESD+I+G+LDTG+
Sbjct  104   LTEDEMQQMKGMDGVVSVFPNEKKQLHTTRSWDFVGFPRQVKRT-SFESDIIIGVLDTGI  162

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFD  671
             W ES SF D G+GPPP KWKG C    NFT CN K+IGA+Y+  +G F  ED  SP D  
Sbjct  163   WPESDSFDDKGFGPPPRKWKGTCHGFSNFT-CNNKIIGAKYYRSDGEFGREDLRSPRDSL  221

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC   DVLA FD A
Sbjct  222   GHGTHTASTAAGGLVSMASLMGFGLGTARGGVPSARIAVYKICWSDGCHGADVLAAFDDA  281

Query  852   IADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD+ISIS G   P ++F+DPIAIG++HAMK  I+T+ +AGNEGP F +I N SPW 
Sbjct  282   IADGVDIISISAGSSTPSNYFEDPIAIGAFHAMKNGILTSTSAGNEGPRFISITNFSPWS  341

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-  1205
             ++VAA++IDR+F + VKLG+ ++  GFSINTFEL  MYPLI G  A +    + GN S  
Sbjct  342   LSVAASTIDRKFFTKVKLGDSKVYKGFSINTFELNDMYPLIYGGDAPNTRGGFRGNTSRF  401

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATIVDIE  1382
             C   S++  LV+GKIV+C               +G +  DKLP     +  +PA+ + + 
Sbjct  402   CKIKSLNPNLVKGKIVFCDGKGGGKAAF-LAGAIGTLMVDKLPKGFSSSFPLPASRLSVG  460

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             DG++I  YIN+T  PTA I +S  V  T AP+VP FS+RGP  I+ ++LKPDL +PG+ I
Sbjct  461   DGRRIAHYINSTSDPTASILKSIEVNDTLAPYVPPFSSRGPNPITHDLLKPDLTSPGVHI  520

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             +AA++ ++ ++    D RV +YN+ +GTSMA PHA GAAAY+                  
Sbjct  521   VAAWSPISPISDVKGDNRVAQYNIITGTSMACPHATGAAAYIN-----------------  563

Query  1740  TAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
               K  +++      A GAG I P KAV PGL++D N+ +++++LC + +   +L  +TG 
Sbjct  564   AKKNPQVE-----FAYGAGNIDPVKAVHPGLVYDANEIDFVNFLCGQGYTAKALRQVTGD  618

Query  1917  KDNKCKNIPAAQGAD-GLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKA  2090
                  K   A  G    LNYPS    L+  N  +    F R+VT VG   + +KA  I A
Sbjct  619   HSVCSK---ATNGTVWNLNYPS--FALSTFNKESIVGTFNRSVTNVGLAVSTYKATIIGA  673

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTH  2243
             P GL + V PNILSF    QK+S+ + V G+  + I   +S SLVW +  H
Sbjct  674   PKGLKIKVKPNILSFTSIGQKQSFVLKVEGRIVEDI---VSTSLVWDNGVH  721



>ref|XP_004145974.1| PREDICTED: cucumisin-like [Cucumis sativus]
 ref|XP_004166536.1| PREDICTED: cucumisin-like [Cucumis sativus]
 gb|KGN49930.1| hypothetical protein Csa_5G141040 [Cucumis sativus]
Length=744

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/722 (47%), Positives = 459/722 (64%), Gaps = 19/722 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHH-NILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YIVYMG      +      HH  IL EA+G    A    +HSY+RSF+GFVA+L
Sbjct  26    DQYRKTYIVYMGSHHQVSSAPLSSHHHMRILQEAVG-STFAPHCLLHSYKRSFNGFVAKL  84

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA+++SE + V+SVF N E++L TTRSWDF+GMS +  R P  ESD+IVG+ DTG+W
Sbjct  85    TEIEAKKVSEMEGVISVFPNGELQLHTTRSWDFMGMSEQVERVPSVESDIIVGVFDTGIW  144

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADFDG  674
              ESPSF D GYGPPP KWKG C+   NF+ CN K+IGA+ +  +G  P +D + P D +G
Sbjct  145   PESPSFLDHGYGPPPPKWKGSCEVSANFS-CNNKIIGARSYRSDGRYPIDDIKGPRDSNG  203

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS  AG +V  AS+ G+  GTARGGVPSARIA+YKVCW   C D DVLA FD AI
Sbjct  204   HGTHAASTVAGGLVRQASMLGLGMGTARGGVPSARIAAYKVCWSDTCSDADVLAAFDDAI  263

Query  855   ADGVDVISISVG-GHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             ADGVD+IS+SVG   PR ++FQDPIAIG++HAM+  I+T+ +AGNEGP   T+ N SPW 
Sbjct  264   ADGVDIISMSVGPKRPRPNYFQDPIAIGTFHAMRNGILTSTSAGNEGPLHFTVTNFSPWA  323

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA  1205
             ++VAA++ DRRF + V+LG+G   +G +INTF+L G  YPL+      +    + G++S 
Sbjct  324   LSVAASTSDRRFLTAVQLGDGRKFNGVTINTFDLNGTQYPLVYAGNIPNVTGGFNGSFSR  383

Query  1206  -CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATIVDI  1379
              C   S+  +LV+GKI  C S  S          VG+I  D+ P D      +PA+ + I
Sbjct  384   FCLRDSVDRELVKGKIAICDSFVSPSDVGSLESAVGIIMQDRSPKDLTFAFPLPASHLGI  443

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLS  1556
             +    I  Y+N+T+ PTA I +S  +K   AP V SFS+RGP   S  ILKPD+  PG+ 
Sbjct  444   QQRPLISSYLNSTRIPTATILKSTGLKLQVAPLVASFSSRGPNPTSPYILKPDVIGPGVE  503

Query  1557  ILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALM  1736
             ILAA++ L + +    D R + +N+ SGTSMA PHA   AAYVK+FHP WSPAA+KSAL+
Sbjct  504   ILAAWSPLRSPSNAKGDNRKLLFNIISGTSMACPHATAVAAYVKSFHPSWSPAALKSALI  563

Query  1737  TTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLT  1910
             TTA  M+  + P  A  A G+G I P  AV PGLI++ ++++Y+ +LC E  N +   + 
Sbjct  564   TTAFPMRGDLYP-EAEFAYGSGHINPLGAVNPGLIYNASETDYIRFLCDEGYNTTFLRII  622

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
                ++ C    + +  D LNYPS    L    +T FS    R VT VG+ ++ +KA I A
Sbjct  623   TKDNSTCSTTQSIRVYD-LNYPS--FALFTHISTPFSQTSKRRVTNVGSTNSTYKATISA  679

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P+GL ++V P+ILSF    ++ +++V   GK  ++I    S SLVW D  H VRSPI+V+
Sbjct  680   PSGLNITVNPSILSFKALEEELNFEVTFEGKIDRSIE---SASLVWDDGVHKVRSPIIVF  736

Query  2271  RS  2276
              S
Sbjct  737   DS  738



>ref|XP_002316254.1| hypothetical protein POPTR_0010s20420g [Populus trichocarpa]
 gb|EEF02425.1| hypothetical protein POPTR_0010s20420g [Populus trichocarpa]
Length=697

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/706 (48%), Positives = 456/706 (65%), Gaps = 22/706 (3%)
 Frame = +3

Query  171   MGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSE  347
             MG+ P  D ++SA+  H ++L   +G    A +  ++SY RSF+GFVA+L   E  +++ 
Sbjct  1     MGDRPKSDISVSAL--HISMLQNVVGSG--ASDSLLYSYHRSFNGFVAKLTKEEKEKMAG  56

Query  348   KDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDG  527
              D VVSVF + + KL TTRSWDF+G      R   +ESD+IV +LDTG+W ES SFK +G
Sbjct  57    LDGVVSVFPSQKKKLHTTRSWDFMGFPQNVTR-ATSESDIIVAMLDTGIWPESESFKGEG  115

Query  528   YGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAA  704
             YGPPP+KWKG CQ   NFT CN K+IGA+Y++ EG   P D  SP D +GHG+H AS AA
Sbjct  116   YGPPPSKWKGTCQASSNFT-CNNKIIGARYYHSEGKVDPGDFASPRDSEGHGTHTASTAA  174

Query  705   GRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISIS  884
             GR+V  ASL G+A GTARGGVPSARIA+YK+CW  GC D D+LA FD AIADGVD+IS+S
Sbjct  175   GRLVSEASLLGLATGTARGGVPSARIAAYKICWSDGCSDADILAAFDDAIADGVDIISLS  234

Query  885   VGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             VGG P  +F+D IAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA+++DR+F
Sbjct  235   VGGWPMDYFEDSIAIGAFHSMKNGILTSNSAGNSGPDPESISNCSPWSLSVAASTMDRKF  294

Query  1065  ESDVKLGNGELISGFSINTFELGKMY-PLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              + V LGNG +  G SINTFE G +  P I G  A +K A Y G+ S  C   S++  +V
Sbjct  295   VTPVTLGNGAIYEGISINTFEPGNIVPPFIYGGDAPNKTAGYDGSESRYCPLDSLNSTVV  354

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
              GK+V C    S     +  H VG ++  D   D      +P + +   DG  + KY+N+
Sbjct  355   EGKVVLC-DQISGGEEARASHAVGSIMNGDDYSDVAFSFPLPVSYLSSSDGADLLKYLNS  413

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T  PTA I +S   K  TAPFV SFS+RGP  I+ ++LKPDL APG+ ILAA++   T+T
Sbjct  414   TSEPTATIMKSIETKDETAPFVVSFSSRGPNPITSDLLKPDLTAPGVDILAAWSEATTVT  473

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG  1772
             G   DTRVVKYN+ SGTSM+ PHA+GAAAYVK F+P WSPAAIKSALMTTA +M      
Sbjct  474   GSPGDTRVVKYNIISGTSMSCPHASGAAAYVKAFNPTWSPAAIKSALMTTASSMSSSINN  533

Query  1773  -AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPA  1946
              A  A G+G I P KA+ PGL++D  + +Y+ +LC + +N   L  +TG  DN   +   
Sbjct  534   DAEFAYGSGHINPAKAIDPGLVYDAGEIDYVRFLCGQGYNATQLLIITG--DNSTCSAET  591

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNI  2126
                   LNYPS    L+  +  T +  F+RTVT VG+ ++ +K+   AP+GL + + P++
Sbjct  592   NGTVWDLNYPS--FALSAKSGLTITRIFHRTVTNVGSATSTYKSITNAPSGLNIQIEPDV  649

Query  2127  LSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
             LSF    Q+ S+ V V     + +   +SGSLVW D  H VRSP++
Sbjct  650   LSFQSLGQQLSFVVTVEATLGQTV---LSGSLVWDDEVHQVRSPVV  692



>ref|XP_004149953.1| PREDICTED: cucumisin-like [Cucumis sativus]
 gb|KGN50588.1| hypothetical protein Csa_5G187860 [Cucumis sativus]
Length=742

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/719 (47%), Positives = 461/719 (64%), Gaps = 22/719 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              RK YIVYMG  P D T S    H  +L E  G    A E  +HSY+RSF+GFV +L   
Sbjct  32    DRKIYIVYMGNKPQD-TASTPSHHMRMLREVTG-SNFAPESLLHSYKRSFNGFVVKLTEE  89

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA R+S K+ VVSVF + +  L TTRSWDF+G +    R  + ESD++VG+LD+G+W E+
Sbjct  90    EAHRISAKEGVVSVFPSGKKHLHTTRSWDFIGFTKDVPRVNQVESDIVVGVLDSGIWPEN  149

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADFDGHGS  683
             PSF D GYGP PAKWKG CQ   NFT CN+K+IGA+ +  +   P ED  SP D +GHG+
Sbjct  150   PSFSDAGYGPIPAKWKGICQNPTNFT-CNKKIIGARAYRSDNVFPTEDIPSPRDSNGHGT  208

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS  AG +V  ASLYG+A GTARGGVPSARIA YK+CW  GC D D+LA FD AIADG
Sbjct  209   HTASTVAGGLVSQASLYGLALGTARGGVPSARIAVYKICWSDGCSDADILAAFDDAIADG  268

Query  864   VDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             VD+IS+SVGG   R +F D IAIG++H+MK  I+T+ +AGN+GP + TI+N SPW ++VA
Sbjct  269   VDIISLSVGGSEARYYFNDSIAIGAFHSMKHGILTSNSAGNDGPDYFTIRNFSPWSLSVA  328

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA-CDY  1214
             A++ DR+  S V++GN  +  G++INTF+ LGK YPLI    A +    + G+ S  C  
Sbjct  329   ASTTDRKLVSRVEIGNTNVYQGYTINTFDPLGKQYPLIYAGDAPNLIGGFTGSISRFCSE  388

Query  1215  LSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD---KLPDTVLPTMIPATIVDIED  1385
              S+   LV GKI+ C S  +    + +   VGV+ +D   K P    P  +P++ ++  D
Sbjct  389   GSVDANLVSGKILLCDSILAPSAFVYFSDAVGVVMNDDGVKYPSNSYP--LPSSYLETVD  446

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G  I  Y+ +   PTA IF+S AV  ++APF+ SFS+RGP   +L+ILKPDL APG+ IL
Sbjct  447   GDAIKTYMASNGVPTATIFKSDAVNDSSAPFIVSFSSRGPNPETLDILKPDLTAPGVEIL  506

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++ +A ++  V D+R   YN+ SGTSM+ PH   AA YVKTFHP WSPAAIKSALMTT
Sbjct  507   AAWSPIAPVSSGVIDSRTTLYNIISGTSMSCPHVTAAAVYVKTFHPTWSPAAIKSALMTT  566

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             A  +K +  + A  A GAG I P KA++PGL++D N+ +Y+ +LC + + +  + SL  S
Sbjct  567   ATPLKPEINVEAEFAYGAGQINPLKAISPGLVYDANEFDYVKFLCGQGYTSDMVQSL--S  624

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI-KAP  2093
              DN   N         LNYPS  L  T   + + +  F RT+T V + ++ + + I  AP
Sbjct  625   NDNTICNSANIGRVWDLNYPSFALSST--PSQSINQFFTRTLTSVDSNASTYTSTILGAP  682

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              GLT++V P +LSF    +K+++ + + G         +S SLVW D++H VRSPI +Y
Sbjct  683   QGLTITVNPKVLSFSGIGEKKTFTLTIQGTIDPTT--IVSASLVWSDSSHDVRSPITIY  739



>emb|CBI31603.3| unnamed protein product [Vitis vinifera]
Length=999

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/708 (49%), Positives = 459/708 (65%), Gaps = 22/708 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+ P    ISAV  H N+L +  G   +A +  ++SY+RSF+GFV +L   E + L   
Sbjct  1     MGDKPSG-DISAVTAHTNMLQQVFG-SNIASDSLLYSYKRSFNGFVVKLTEEEMKELEGM  58

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D VVS+F N + KL TTRSWDF+G   + NR    ESD+I+ +LDTG+W ES SFKD G+
Sbjct  59    DGVVSIFPNEKKKLHTTRSWDFIGFPQQVNRT-SVESDVIIAVLDTGIWPESDSFKDKGF  117

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAG  707
             GPPP+KWKG CQ   NFT CN K+IGA+Y+   G F+PED ++P D +GHG+H AS AAG
Sbjct  118   GPPPSKWKGICQGLSNFT-CNNKIIGARYYRSYGEFSPEDLQTPRDSEGHGTHTASTAAG  176

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V  ASL G   GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SV
Sbjct  177   GLVSMASLLGFGLGTARGGVPSARIAVYKICWSDGCADADILAAFDDAIADGVDIISLSV  236

Query  888   GGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P+++F D IAIG++HAMK  I+T+ +AGN+GP F +I N SPW ++VAA++IDR+F
Sbjct  237   GGSTPKNYFADSIAIGAFHAMKNGILTSTSAGNDGPNFASITNFSPWSLSVAASTIDRKF  296

Query  1065  ESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVR  1241
              + V+LG+ ++  G SINTFE   MYP I G  A +    +  N S  C   S+   LV+
Sbjct  297   FTKVQLGDSKVYEGISINTFEPNGMYPFIYGGDAPNITGGFSANTSRFCTRNSLDPNLVK  356

Query  1242  GKIVYCLSSASQDYTIKWIHG-VGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             GKIV C      + T  ++ G VG + +D+   D+  P  +PA+ +  +DG  I  Y+ +
Sbjct  357   GKIVLC--DIFSNGTGAFLAGAVGTVMADRGAKDSAWPFPLPASYLGAQDGSSIAYYVTS  414

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T  PTA I +S  V  T APF+ SFS+RGP   +L+ILKPDLAAPG+ ILAA+  ++ ++
Sbjct  415   TSNPTASILKSTEVNDTLAPFIVSFSSRGPNPATLDILKPDLAAPGVHILAAWPPISPIS  474

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI-KPI  1769
             G   DTR V Y ++SGTSMA PHA GAAAY+K+FHP WSPAAIKSALMTTA  M   K  
Sbjct  475   GVQGDTRAVLYTMQSGTSMACPHATGAAAYIKSFHPTWSPAAIKSALMTTALPMSAEKNP  534

Query  1770  GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPA  1946
              A  A GAG I P K+V PGL++D +K +Y+ +LC + +   +L  +TG  DN   +   
Sbjct  535   DAEFAYGAGQIDPLKSVNPGLVYDADKIDYVKFLCGQGYTTQTLQLVTG--DNSVCSEAT  592

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK-APTGLTVSVVPN  2123
                   LNYPS    L++    + +  F RTVT VG+  + +KA +  AP GL + VVP+
Sbjct  593   NGTVWDLNYPS--FALSSSTFESITGVFTRTVTNVGSPVSTYKATVTGAPIGLQIQVVPD  650

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             ILSF    QK S+ + V GK    I   +S SLVW D  H VRSPI+V
Sbjct  651   ILSFTSLGQKLSFVLKVEGKVGDNI---VSASLVWDDGVHQVRSPIVV  695


 Score =   131 bits (330),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 111/209 (53%), Gaps = 46/209 (22%)
 Frame = +3

Query  1074  VKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRGKIV  1253
             VKLGN ++  G SINTFE+  MYP+I G  A +    Y          S S  LV GKI+
Sbjct  836   VKLGNNKVYEGVSINTFEMKGMYPIIYGGDATNTTGGYN---------SSSSSLVNGKIL  886

Query  1254  YCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTA  1433
             +C S      T  W   +     +        TMI   IV++ED                
Sbjct  887   FCDSD-----TDGWEQRILYFKMNA-------TMIFPPIVEVED----------------  918

Query  1434  EIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTR  1613
                        APFV SFS+RGP  ++ +ILKPDL APG+ I+AA+T  +T+TG   DTR
Sbjct  919   ---------KLAPFVASFSSRGPNPVTSDILKPDLTAPGVDIVAAWTKASTVTGYDWDTR  969

Query  1614  VVKYNVESGTSMATPHAAGAAAYVKTFHP  1700
             VV YN+ SG SMA P+A+GAAAYVK+FHP
Sbjct  970   VVPYNIVSGPSMACPNASGAAAYVKSFHP  998


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +3

Query  279  SYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAE  458
            +++R        +L    + L+  D VV+VF N + KLLTTRSWDF+G   +  R    E
Sbjct  703  TFQRVMCRLQPFILTCYIKCLTAMDGVVTVFPNGKKKLLTTRSWDFMGFPQEVKRT-ATE  761

Query  459  SDLIVGLLDTGVWVESPSFKD  521
            SD+I+G+LD+G+W      KD
Sbjct  762  SDIIIGMLDSGIWPLVSVMKD  782



>ref|XP_004159601.1| PREDICTED: LOW QUALITY PROTEIN: xylem serine proteinase 1-like, 
partial [Cucumis sativus]
Length=665

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/667 (51%), Positives = 441/667 (66%), Gaps = 12/667 (2%)
 Frame = +3

Query  294   FSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIV  473
             F+ F A+L   EA+ LS +  V  V  N   KL TTRSWDF+G+S+ A R+ K ESD+IV
Sbjct  1     FNAFAAKLSDDEAKLLSTRKDVHHVIPNKYRKLQTTRSWDFIGLSSNARRSTKHESDIIV  60

Query  474   GLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQ  650
             GL DTG+   + SFKDDG+GPPP KWKG C    NFT CN+K+IGA+YF ++G   P D 
Sbjct  61    GLFDTGITPTADSFKDDGFGPPPKKWKGTCHHFANFTACNKKLIGARYFKLDGNPDPSDI  120

Query  651   ESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMD  827
              SP D DGHG+H +S A G  + GASL G+AEGTARGGVPSAR+A YKVCW   GC DMD
Sbjct  121   LSPVDTDGHGTHTSSTATGNAIAGASLSGLAEGTARGGVPSARVAMYKVCWTSSGCSDMD  180

Query  828   VLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTI  1007
             +LA FDAAI DGVDVISIS+GG   ++  D I+IG++HAMKK I+T  +AGN GP  G++
Sbjct  181   ILAAFDAAIQDGVDVISISIGGGFNNYSDDSISIGAFHAMKKGIITVTSAGNGGPTAGSV  240

Query  1008  QNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNAT  1184
              N +PW++TVAA+SIDR+F S ++LGNG+ ISG  IN F    KMYPL+SG     +N+ 
Sbjct  241   VNHAPWIVTVAASSIDRKFISPLELGNGKNISGVGINIFNPKQKMYPLVSGGDVA-RNSE  299

Query  1185  YPGNYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVI-ASDKLPDTVLPTMI  1358
                  S C   ++    V+G +V+C L +   D  IK I   GVI  SD+  D     M 
Sbjct  300   SKDTASFCLEGTLDPTKVKGSLVFCKLLTWGADSVIKSIGANGVIIQSDEFLDNADIFMA  359

Query  1359  PATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDL  1538
             PAT+V    G  I  YI +T+ PTA I++++ +K  AP V SFS+RGP   S  ILKPD+
Sbjct  360   PATMVSSLVGNIIYTYIKSTRTPTAVIYKTKQLKAKAPMVASFSSRGPNPGSHRILKPDI  419

Query  1539  AAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAA  1718
             AAPG+ ILAAYT L ++TGQ  DT+  K+ + SGTSMA PH A AAAYVK+FHP WSPAA
Sbjct  420   AAPGVDILAAYTPLKSLTGQKGDTQYSKFTLMSGTSMACPHVAAAAAYVKSFHPLWSPAA  479

Query  1719  IKSALMTTAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNN  1889
             I+SAL+TTA  +  ++ P G + A GAG + P++A++PGLI+D+N+  Y+ +LC E +  
Sbjct  480   IRSALLTTATPISRRLNPEGEF-AYGAGNLNPSRAISPGLIYDLNEISYIQFLCSEGYTG  538

Query  1890  ASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTV  2069
             +S+  L+G+K   C N+   QG D LNYP+  L L + N    +  F R VT VG   +V
Sbjct  539   SSIAVLSGTKSINCSNLIPGQGHDSLNYPTFQLSLKSTNQ-PMTTTFRRRVTNVGHPISV  597

Query  2070  FKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSV  2249
             + A I AP G+T++V P  LSF +  QKRS+KVVV      + +  +SGSL W    H V
Sbjct  598   YNATINAPPGVTITVTPPTLSFSRLLQKRSFKVVVKASPLPS-AKMVSGSLAWVGAQHVV  656

Query  2250  RSPILVY  2270
             RSPI+VY
Sbjct  657   RSPIVVY  663



>emb|CBI38830.3| unnamed protein product [Vitis vinifera]
Length=1470

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/797 (44%), Positives = 497/797 (62%), Gaps = 62/797 (8%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             + ++K YIVY G  PDD   +A     ++L++   D     E  +HSY +SF+   A+L 
Sbjct  103   NAEKKVYIVYFGGRPDDRQ-AAAQTQQDVLSKC--DIVDTEESIVHSYTKSFNALAAKLS  159

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA++++  ++VVSVF N   KL TT+SWDF+G+   A R  K ES++IVGLLDTG+  
Sbjct  160   EDEAQKIAGMEEVVSVFPNRYHKLHTTKSWDFIGLPRTARRQLKQESNIIVGLLDTGITP  219

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             +S SF D+G+GPPPAKWKG C +  NF+GCN K+IGA+YF ++G   P+D  SP D +GH
Sbjct  220   QSESFADNGFGPPPAKWKGSCGRFANFSGCNNKLIGAKYFKLDGKPDPDDILSPVDVEGH  279

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAI  854
             G+H AS  AG +V+ A+L+G+A+GTARG VPSAR+A YKVCW   GC DMD+LAGF+AAI
Sbjct  280   GTHTASTVAGNIVKNANLFGLAKGTARGAVPSARVAMYKVCWVSTGCSDMDLLAGFEAAI  339

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             ADGVDVISIS+GG   ++ +D IAIG++HAMKK I+T A+AGN+GP   TI N +PW++T
Sbjct  340   ADGVDVISISIGGFTFNYAEDIIAIGAFHAMKKGILTIASAGNDGPDESTIVNHAPWILT  399

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISG-----TLAQDKNATYPGN  1196
             V A+ IDR F S V LGNG+   G  ++ F+   K YPL+SG     T A  +N+ +   
Sbjct  400   VGASGIDRSFRSKVVLGNGKTFLGSGLSAFDPKQKNYPLVSGADIPKTKADKENSRF---  456

Query  1197  YSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATI  1370
                C   S+    V+GK+VYC L     +  +K + G+G ++ S    DT    M P T+
Sbjct  457   ---CIEDSLDPTKVKGKLVYCELEEWGVESVVKGLGGIGAIVESTVFLDTPQIFMAPGTM  513

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
             ++   G+ ID YI++T+ P+  I R++ VK  APFV SFS+RGP  +S +ILKPD+ APG
Sbjct  514   INDTVGQAIDGYIHSTRTPSGVIQRTKEVKIPAPFVASFSSRGPNPVSQHILKPDVVAPG  573

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
             + ILA+YT L ++TG   DT+  K+ + SGTSMA PH +G AAYVK+FHP WSPAAIKSA
Sbjct  574   VDILASYTPLKSLTGLKGDTQFSKFTIMSGTSMACPHVSGVAAYVKSFHPKWSPAAIKSA  633

Query  1731  LMTTAKAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             + TTAK M  ++   G + A GAG + P +A++PGL++D+N++ Y+ +LC E  +  S+G
Sbjct  634   ITTTAKPMSRRVNKDGEF-AYGAGQVNPLRALSPGLVYDMNETSYIQFLCHEGLSGKSIG  692

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
             ++ GSK   C ++    G D LNYP+M L L + N TT    F RTVT VG   +V+KA 
Sbjct  693   AIVGSKSVNCSSLLPGHGNDALNYPTMQLSLKDKNETTV-GVFRRTVTNVGPAQSVYKAT  751

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             I+AP G+ ++V P  L F  T Q R +KVVV  K   A    +SGSL W+ + H +   I
Sbjct  752   IEAPQGVKITVTPTTLVFSPTVQARRFKVVVKAK-PMASKKMVSGSLTWRSHRHIIIKVI  810

Query  2262  LVYRSLQTD***YYFNll*c*vlavcllFGCELICKIT**HQF-CCLCKMLTAIHIYKRL  2438
                                          GC+        HQ   C  K+  ++ ++   
Sbjct  811   -----------------------------GCQQ-------HQLGSCFVKLCDSLFLWLYK  834

Query  2439  RLKTLNFSSVYYNKRKQ  2489
              L ++ +SS+++ ++K+
Sbjct  835   TLLSIGYSSLFWIEKKR  851


 Score =   235 bits (600),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 187/305 (61%), Gaps = 16/305 (5%)
 Frame = +3

Query  243   GDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLG  422
             G EE +    +++Y  + +GF ARL  ++   L++ +  +S   +  M L TT S  FLG
Sbjct  921   GGEEASDPELLYTYETAITGFAARLSTKQLESLNKVEGFLSAVPDEMMSLQTTYSPQFLG  980

Query  423   MS----TKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPP-PAKWKGKCQKGLNFTG  587
             +        +RN    +D+I+G++D+G+W E  SFKD G   P P++WKG C++G  FT 
Sbjct  981   LKFGRGLLTSRN--LANDVIIGIVDSGIWPEHDSFKDRGMTRPVPSRWKGVCEQGTKFTA  1038

Query  588   --CNRKVIGAQ--YFNVEGFAPE-----DQESPADFDGHGSHIASIAAGRMVEGASLYGI  740
               CN+K+IGA+  Y   E  A +     D  S  D  GHG+H AS AAG M++GAS +G+
Sbjct  1039  KNCNKKLIGARAYYKGYEATAGKIDETVDFRSARDSQGHGTHTASTAAGHMIDGASSFGM  1098

Query  741   AEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDP  920
             A+G A G   +ARIA+YK C+  GC   D+LA  D A++DGVDV+S+S+GG  + ++ D 
Sbjct  1099  AKGVAAGMSCTARIAAYKACYAGGCATSDILAAIDQAVSDGVDVLSLSIGGSSQPYYTDV  1158

Query  921   IAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELI  1100
             +AI S  A++  I   AAAGN GP   T+ N +PW+MTVAA+++DR F + V LGNGE  
Sbjct  1159  LAIASLGAVQHGIFVAAAAGNSGPSSSTVINTAPWMMTVAASTMDRSFTAIVNLGNGETF  1218

Query  1101  SGFSI  1115
              G S+
Sbjct  1219  DGESL  1223


 Score = 94.7 bits (234),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/317 (28%), Positives = 138/317 (44%), Gaps = 75/317 (24%)
 Frame = +3

Query  1368  IVDIEDGKKIDK---YINTTKAPTAEIFRSRAVKTTAPFVP-SFSARGPQTISLNILKPD  1535
             IV++ +G+  D    Y  T+    + ++   A    A +   SFS+RGP      ++KPD
Sbjct  1209  IVNLGNGETFDGESLYSGTSTEQLSLVYDQSAGGAGAKYCTTSFSSRGPAHTEPYVIKPD  1268

Query  1536  LAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPA  1715
             + APG++ILAA+    + +    D R                                  
Sbjct  1269  VTAPGVNILAAWPPTVSPSKTKSDNR----------------------------------  1294

Query  1716  AIKSALMTTAKAMKIK-----------PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYM  1862
                SALMT+A  +  K           P     A G+G + P +A  PGL++DI+  +Y+
Sbjct  1295  --SSALMTSAYTLDNKKAPISDTGSESPTATPFAYGSGHVDPERASNPGLVYDISYEDYL  1352

Query  1863  SYLCK-EFNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRT  2039
              YLC  +++++ + ++  S+ N                      L + N+   SA + RT
Sbjct  1353  YYLCSLKYSSSQMATI--SRGN--------------------FILFDGNSHNNSATYKRT  1390

Query  2040  VTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQK-AISWYMSG  2216
             VT VG  +T +  +   P G++V V P +L F Q  QK SY V      QK + S    G
Sbjct  1391  VTNVGYATTTYVVQAHEPEGVSVIVEPKVLKFKQNGQKLSYTVSFVQLGQKSSSSGTSFG  1450

Query  2217  SLVWKDNTHSVRSPILV  2267
             SLVW  + +SVRSPI V
Sbjct  1451  SLVWGSSRYSVRSPIAV  1467



>ref|XP_010540255.1| PREDICTED: xylem serine proteinase 1 [Tarenaya hassleriana]
Length=762

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/716 (47%), Positives = 459/716 (64%), Gaps = 17/716 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEA-LGDEELAREYRIHSYRRS--FSGFVARLLPRE  329
             YIVYMG   D+    A+  H NIL+      ++ A+E  ++SY +S  F+ F  +L P E
Sbjct  48    YIVYMGNQADNKD-EAMKAHINILSSVKQSSQKEAKESMVYSYTKSLSFNAFATKLSPDE  106

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A ++ E ++VV VFRN   KL TT+SWDF+G+   A R+   E D+I+G+LDTG+  +S 
Sbjct  107   ADQMMEMEEVVGVFRNRYHKLHTTKSWDFIGLPQSAKRHLNMERDVILGVLDTGITPDSE  166

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQE--SPADFDGHGS  683
             SFKD G GPPP+KW+G C    NF+GCN K+IGA+YF ++G  P + E  SP D DGHG+
Sbjct  167   SFKDTGLGPPPSKWRGSCGPFANFSGCNNKLIGAKYFKLDGSDPPEGEILSPIDIDGHGT  226

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAAIAD  860
             H +S AAG  V  ASL+G+A GT RG VPSAR+A YKVCW   GC DMD+LA FDAAI D
Sbjct  227   HTSSTAAGVPVANASLFGLANGTIRGAVPSARVAMYKVCWSTSGCSDMDILAAFDAAIHD  286

Query  861   GVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             GVDV+SIS+GG    +  D I++GS+HA+++ I+T A+AGN+GP  GT+ N +PW++TVA
Sbjct  287   GVDVVSISIGGPLADYSTDSISLGSFHALRRGILTVASAGNDGPDLGTVTNHAPWILTVA  346

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSA-CDY  1214
             A+ +DR F S + LGNG+ I G  I+ FE   K+YPL+SG  A      Y    S  C  
Sbjct  347   ASGMDRAFRSRIDLGNGKSIIGSGISMFEPKAKLYPLVSG--ADVAKPPYDNTSSMYCIS  404

Query  1215  LSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDG  1388
              S+  K V+GK+V C L     + T+K   GVG I +D    D     M  AT+++   G
Sbjct  405   DSLDAKKVKGKVVMCRLGGTGPESTVKSSGGVGTIIADGHYLDNAQIFMASATMINTSLG  464

Query  1389  KKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
               IDKYI++T++P+A I R++ V   APFV SFS+RGP   S  +LKPD+AAPG+ ILAA
Sbjct  465   DSIDKYIHSTRSPSAVIQRTQEVNVPAPFVASFSSRGPNPASKRLLKPDIAAPGVDILAA  524

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             +T   ++TG   DT+  KY++ SGTSMA PH AG AAYVK+FHP+W+ AAIKSA++T+AK
Sbjct  525   FTLKRSLTGLKGDTQFSKYSILSGTSMACPHVAGVAAYVKSFHPNWTIAAIKSAIITSAK  584

Query  1749  AMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKD  1922
              M  +    A    G G + P +A  PGL++D+ +  Y+ +LC+E + +A+L  L GS+ 
Sbjct  585   PMSRRVNSEAEFGYGGGQLNPRRAANPGLVYDMEEISYVQFLCREGYTSAALAKLVGSRS  644

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
               C +I      D LNYP+M L L +   TT  A F R VT VG   + +KA ++AP G+
Sbjct  645   VNCSSIVPGLSHDSLNYPTMQLALRSTKETT-EAVFRRRVTNVGPALSEYKATVRAPKGV  703

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              + V P ILSF +  QKRS+KVVV  K   A    +S  L+W+   H VRSPI+++
Sbjct  704   EIRVEPMILSFKKAGQKRSFKVVVKAK-PMAPGKMVSALLLWQSPRHVVRSPIVIH  758



>ref|XP_007009161.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY17971.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=751

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/713 (48%), Positives = 458/713 (64%), Gaps = 16/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIVYMG++P     SA + H ++L + +     A +  ++SY RSF+GF A+L   EA +
Sbjct  47    YIVYMGDIPKG-DFSAANLHTSMLQDVV-PSPAASDVLLYSYHRSFNGFAAKLTKDEAEK  104

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             L  K+ VVSVF + + +L T+ SWDF+G S K  R+   ESD+IVG+LDTG+W ES SF 
Sbjct  105   LRGKEGVVSVFLSQKKQLHTSWSWDFMGFSKKVKRS-VIESDIIVGMLDTGIWPESESFN  163

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIAS  695
             D G+GP PAKWKG CQK  NFT CN+K+I A+Y+   G F+P D  SP D +GHGSH AS
Sbjct  164   DTGFGPIPAKWKGTCQKSSNFT-CNKKIIAAKYYRANGDFSPGDFISPRDSEGHGSHTAS  222

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVI  875
              AAG +   ASLYG+A+GT RG VPSARIA YK+CW  GC D+D+LA FD AIADGVD+I
Sbjct  223   TAAGGLASRASLYGLAKGTVRGAVPSARIAVYKICWSDGCYDVDILAAFDDAIADGVDII  282

Query  876   SISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             S+SVG    S +F D IAIG++H+MK  ++T+ +AGN GP   +I N SPW ++VAA++I
Sbjct  283   SLSVGSFFSSDYFDDSIAIGAFHSMKNGVLTSNSAGNSGPRPASIVNFSPWSLSVAASTI  342

Query  1053  DRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYSA-CDYLSIS  1226
             DR+F + VKLGNGE+  G SINTF+L  KMYP I G +A + +  +    S  C   +++
Sbjct  343   DRKFVTKVKLGNGEIYEGTSINTFDLKEKMYPFIFGGVAPNTSQGFTSEDSRYCLPGTLN  402

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKY  1406
             E LV+GKIV+C   +  D  I+      V       D V    +P + ++++DG+ +  Y
Sbjct  403   ETLVKGKIVFCDYDSDGDGPIEGGAVGAVFQYGGKKDYVFSYPLPLSNLNLDDGRFVLNY  462

Query  1407  INTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             +NTT+ PTA IF+S       AP+V SFS+RGP  ++ +ILKPDL APG+ ILAA++  A
Sbjct  463   VNTTENPTATIFKSDVESNEFAPYVVSFSSRGPNPVTADILKPDLTAPGVDILAAWSEAA  522

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK  1763
              +T    D R+V YN+ SGTSM+ PHA GAAAYVK+FHP WSPAAIKSALMTTA  M  K
Sbjct  523   HVTESEYDNRIVPYNIISGTSMSCPHATGAAAYVKSFHPTWSPAAIKSALMTTAFQMSAK  582

Query  1764  -PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNI  1940
               I    A GAG I P  A  PGLI+D  + EY+ +LC +  + +   L    ++ C   
Sbjct  583   NNIEGEFAFGAGHINPALAAQPGLIYDAGEIEYIKFLCGQGYSPTYLQLITGNNSSCSEE  642

Query  1941  PAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVP  2120
                   D LNYPS  L  T   + T   AF+RTVT VG+  + +KA +KAP GL + V P
Sbjct  643   TNGTVWD-LNYPSFALSATPGKSIT--RAFHRTVTNVGSAVSTYKAVVKAPPGLIIQVQP  699

Query  2121  NILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             ++LSF    QK+S+ V V  +   ++   +SGSL W D  + VRSPI+ Y SL
Sbjct  700   SVLSFKSLGQKQSFVVTVGAEVGNSM---ISGSLTWDDGLYQVRSPIVAYASL  749



>ref|XP_007009170.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY17980.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=739

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/733 (47%), Positives = 463/733 (63%), Gaps = 29/733 (4%)
 Frame = +3

Query  117   VRATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSF  296
             +RA   P    RK YIVYMG+ P   + S    H+++L +A G  E   +  + +Y+RSF
Sbjct  23    IRAASQP---DRKSYIVYMGKKPSGGS-STSSLHNSMLQDAFG-SEFDMKSVLCTYKRSF  77

Query  297   SGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVG  476
              GFV +L   EA +++  + VVSVF N +  L TTRSWDF+G S +  R+  +ESD+I+G
Sbjct  78    DGFVVQLTEEEASKMAGMNGVVSVFPNEKRDLHTTRSWDFMGFSQQVERS-ASESDVIIG  136

Query  477   LLDTGVWVESPSFKDDGYGPPPAKWKGKCQK-GLNFTGCNRKVIGAQYFNVEG-FAPEDQ  650
             +LDTG+W ES SF D G+GPPP KWKG CQ  G NFT CN K+IGAQY+  +G F P+D 
Sbjct  137   VLDTGIWPESESFNDKGFGPPPRKWKGNCQTAGGNFT-CNNKIIGAQYYRSDGLFGPDDI  195

Query  651   ESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDV  830
              SP D  GHG+H AS AAG +V  ASL+G A GTARGGVPSARIA YK+CW  GC D D+
Sbjct  196   VSPRDASGHGTHTASTAAGGLVNRASLFGFASGTARGGVPSARIAVYKICWFDGCYDADI  255

Query  831   LAGFDAAIADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTI  1007
             LA FD AIADGVD+IS+SVG   P+ +F D IAIG++HAM+  ++T  +AGN+GP   TI
Sbjct  256   LAAFDDAIADGVDIISLSVGAATPKDYFNDSIAIGAFHAMRNGVLTVNSAGNQGPDRATI  315

Query  1008  QNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNAT  1184
              N SPW ++VAA++IDR+F + V+LGN  +  G SINTF+L  +MYP+I G  A +    
Sbjct  316   TNFSPWALSVAASTIDRKFFTKVQLGNNMIYEGVSINTFDLKNEMYPIIHGGSAPNTTGN  375

Query  1185  YP-GNYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDT---VLPT  1352
             +   +   C   S+   LV+GKIV C    S    ++    VG +  D  P+    + P 
Sbjct  376   FTWASSRNCFQNSLDRNLVKGKIVLCDRLVSGREPLR-AGAVGTVLRDNAPNDDARLFP-  433

Query  1353  MIPATIVDIEDGKKIDKYINTTKAPTAEIFRSR-AVKTTAPFVPSFSARGPQTISLNILK  1529
              +PA+ +D+ DG KI  Y+N+T  PTA IF+S+ A  + AP+V SFS+RGP  I+ +ILK
Sbjct  434   -LPASYLDLVDGSKIFVYVNSTSTPTATIFKSKEANDSLAPYVVSFSSRGPNPITPDILK  492

Query  1530  PDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWS  1709
             PD++APG+ ILAA++ ++ ++    D R V +N+ SGTSMA PH + AAAYVK+FHP WS
Sbjct  493   PDISAPGVHILAAWSLISPVSQTKGDNRFVPFNIISGTSMACPHVSAAAAYVKSFHPTWS  552

Query  1710  PAAIKSALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFN  1886
             PAAIKSALMTTA  M     + A  A G+G + P KAV PGL++D  + +Y+ +LC +  
Sbjct  553   PAAIKSALMTTAFPMSSGINLDAEFAYGSGHLNPIKAVDPGLVYDSEELDYIKFLCGQGY  612

Query  1887  NASLGSLTGSKDNKCKNIPAAQGAD-GLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGS  2063
                   L    +  C    A  G   GLNYPS    L    +TT S  F RTVT VG+  
Sbjct  613   GTQFLQLVTRDNTTCSE--ATNGTVWGLNYPS--FALFTSASTTVSRVFNRTVTNVGSPM  668

Query  2064  TVFKAKIKAPTG-LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT  2240
             ++++A + AP G L + V PN+LSF    QK S+ + + G   K+I   +S SL W D  
Sbjct  669   SIYRANVTAPAGALKIQVNPNVLSFKSLGQKLSFSLTIEGTIDKSI---VSASLEWDDGV  725

Query  2241  HSVRSPILVYRSL  2279
             H VRSPI  + S+
Sbjct  726   HKVRSPITAFVSI  738



>ref|XP_004168370.1| PREDICTED: LOW QUALITY PROTEIN: xylem serine proteinase 1-like, 
partial [Cucumis sativus]
Length=716

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/716 (48%), Positives = 457/716 (64%), Gaps = 14/716 (2%)
 Frame = +3

Query  153   KPYIVYMGELPDDPT-ISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             K +IV+M   P     +  +D + N+L         A++  +HSY  +F+ F A+L   E
Sbjct  1     KHFIVFMENRPTILNEVDGLDINLNVLMSVKESHVDAKDCMVHSYTNNFNAFAAKLTEAE  60

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A+ LSE+  V  V  N   KL TTRSWDFLG    A R  + ESD+IVGL DTG+   + 
Sbjct  61    AKTLSERGDVQHVIPNRYRKLQTTRSWDFLGFPINAKRKTRQESDIIVGLFDTGITPTAD  120

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSH  686
             SFKDDGYGPPP KWKG C    NF+GCN K+IGA+YF ++G   P D  SP D +GHG+H
Sbjct  121   SFKDDGYGPPPKKWKGTCDHFANFSGCNNKLIGARYFKLDGITEPFDVLSPVDVNGHGTH  180

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADG  863
              +S A G ++ GA+L G+A+GTARGGVPSAR+A YKVCW   GC DMD+LA FDAAI DG
Sbjct  181   TSSTATGNVITGANLSGLAQGTARGGVPSARLAMYKVCWMSNGCSDMDLLAAFDAAIQDG  240

Query  864   VDVISISVGGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             VDVISIS+ G    ++  DPI+IG++HAMKK I+T  AAGN GP  GT+ N +PW++TVA
Sbjct  241   VDVISISIAGIGYGNYTDDPISIGAFHAMKKGIITVTAAGNNGPSAGTVVNHAPWILTVA  300

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A+SIDRRF S V+LGNG+ ISG  IN F    KMY L+SG     KN     N   C+  
Sbjct  301   ASSIDRRFISPVELGNGKNISGVGINLFNPXEKMYKLVSGEDVA-KNIEGKDNAMYCEDK  359

Query  1218  SISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGK  1391
             S+    V+  +V+C L +   D T+K +   G ++ SD+  D     M P+ +V    G 
Sbjct  360   SLDPIKVKDSLVFCKLMTWGADSTVKSVGAAGAILQSDQFLDNTDIFMAPSALVSSFVGA  419

Query  1392  KIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
              ID YI++T+ PTA I+++R  +  AP +  FS+RGP   S +ILKPD+AAPG++ILA Y
Sbjct  420   TIDAYIHSTRTPTAVIYKTRQHRAAAPIIAPFSSRGPNPGSTHILKPDIAAPGVNILAGY  479

Query  1572  TALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKA  1751
             T L ++TG   DT+  K+ + SGTSMA PH A AAAYVK+FHP WSPAAI+SAL+TTAK 
Sbjct  480   TPLKSLTGLKGDTQFSKFTLMSGTSMACPHVAAAAAYVKSFHPLWSPAAIRSALLTTAKP  539

Query  1752  MKIK--PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKD  1922
             +  +  P G +   GAG + P KA  PGLI+D+N+  Y+ +LC+E ++ +S+  LTG+K 
Sbjct  540   ISRRGNPDGEF-GYGAGNLNPRKAKNPGLIYDLNEMSYIQFLCREGYSGSSIVILTGTKS  598

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
               C  I   QG D LNYP+  L L +    T +A F+R VT VG   +V+ A ++AP G+
Sbjct  599   INCATIIPGQGYDSLNYPTFQLSLQSSREPT-TAVFWREVTNVGKPVSVYNATVRAPPGV  657

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              ++V P  LSF   +QK  +KVVV      A +  +SGS+ W D  + VRSP++VY
Sbjct  658   EITVEPATLSFSYLHQKERFKVVVKANPLPA-NTMVSGSITWFDPRYVVRSPVVVY  712



>gb|AAC19302.1| contains similarity to the subtilase family of serine proteases 
(Pfam: subtilase.hmm, score: 47.57); strong similarity to 
Cucumis melo (muskmelon) cucumisin (GB:D32206) [Arabidopsis 
thaliana]
 emb|CAB80781.1| putative cucumisin protease [Arabidopsis thaliana]
Length=706

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/698 (48%), Positives = 456/698 (65%), Gaps = 25/698 (4%)
 Frame = +3

Query  240   LGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFL  419
             +  +E A+E +++SY ++F+ F A+L P EA+++ E ++VVSV RN   KL TT+SWDF+
Sbjct  8     MQSQEEAKERKVYSYTKAFNAFAAKLSPHEAKKMMEMEEVVSVSRNQYRKLHTTKSWDFV  67

Query  420   GMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRK  599
             G+   A R+ KAE D+I+G+LDTG+  +S SF D G GPPPAKWKG C    NFTGCN K
Sbjct  68    GLPLTAKRHLKAERDVIIGVLDTGITPDSESFLDHGLGPPPAKWKGSCGPYKNFTGCNNK  127

Query  600   VIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSA  776
             +IGA+YF  +G  P  +  SP D DGHG+H +S  AG +V  ASLYGIA GTARG VPSA
Sbjct  128   IIGAKYFKHDGNVPAGEVRSPIDIDGHGTHTSSTVAGVLVANASLYGIANGTARGAVPSA  187

Query  777   RIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKK  953
             R+A YKVCW + GC DMD+LAGF+AAI DGV++ISIS+GG    +  D I++GS+HAM+K
Sbjct  188   RLAMYKVCWARSGCADMDILAGFEAAIHDGVEIISISIGGPIADYSSDSISVGSFHAMRK  247

Query  954   KIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFE-L  1130
              I+T A+AGN+GP  GT+ N  PW++TVAA+ IDR F+S + LGNG+  SG  I+ F   
Sbjct  248   GILTVASAGNDGPSSGTVTNHEPWILTVAASGIDRTFKSKIDLGNGKSFSGMGISMFSPK  307

Query  1131  GKMYPLISGT-LAQDKNATYPGNYSACDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHG  1304
              K YPL+SG   A++ +  Y   Y   D  S+  K V+GK++ C +     + TIK   G
Sbjct  308   AKSYPLVSGVDAAKNTDDKYLARYCFSD--SLDRKKVKGKVMVCRMGGGGVESTIKSYGG  365

Query  1305  VG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTT-------------KAPTAEIF  1442
              G +I SD+  D     M PAT V+   G  I +YIN+T             K+ +A I 
Sbjct  366   AGAIIVSDQYLDNAQIFMAPATSVNSSVGDIIYRYINSTRSSLIFLGMILYYKSASAVIQ  425

Query  1443  RSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVK  1622
             ++R V   APFV SFS+RGP   S+ +LKPD+AAPG+ ILAA+T   ++TG   DT+  K
Sbjct  426   KTRQVTIPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLKRSLTGLDGDTQFSK  485

Query  1623  YNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIGAYLASGAGL  1799
             + + SGTSMA PH AG AAYVK+FHPDW+PAAIKSA++T+AK +  +    A  A G G 
Sbjct  486   FTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISRRVNKDAEFAYGGGQ  545

Query  1800  IRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYP  1976
             I P +A +PGL++D++   Y+ +LC E +N  +L  L G++   C +I    G D LNYP
Sbjct  546   INPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSSIVPGLGHDSLNYP  605

Query  1977  SMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKR  2156
             ++ L L +   +T  A F R VT VG  S+V+ A ++AP G+ ++V P  LSF + +QKR
Sbjct  606   TIQLTLRSAKTSTL-AVFRRRVTNVGPPSSVYTATVRAPKGVEITVEPQSLSFSKASQKR  664

Query  2157  SYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             S+KVVV  K Q      +SG LVWK   HSVRSPI++Y
Sbjct  665   SFKVVVKAK-QMTPGKIVSGLLVWKSPRHSVRSPIVIY  701



>ref|XP_004168804.1| PREDICTED: xylem serine proteinase 1-like, partial [Cucumis sativus]
Length=557

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/540 (57%), Positives = 398/540 (74%), Gaps = 9/540 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAV-DEHHNILTEALGDEELAREYRIHSYRRSFSGFVAR  314
             ++  R+ Y+VYMG LP   +   + D HH++L  A+GDEE+AR+ +IHSY RSF+GF AR
Sbjct  22    NNADRQAYVVYMGALPKLESHEVLSDHHHSLLANAVGDEEMARKAKIHSYGRSFNGFAAR  81

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTK-ANRNPKAESDLIVGLLDTG  491
             L P EA +L+++ KVVSVFR+   KL TTRSWDFLG+S   + RN  AES++IVGLLD+G
Sbjct  82    LSPHEANKLAKEKKVVSVFRSKTRKLHTTRSWDFLGLSEAVSRRNAAAESNVIVGLLDSG  141

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFD  671
             +W+E PSFKDDGYG  P+KWKGKC  G NFT CNRKVIGA++F++        +SPAD  
Sbjct  142   IWMEGPSFKDDGYGEIPSKWKGKCVTGRNFTSCNRKVIGARFFDIGQIDNSIDKSPADEI  201

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHGSH AS  AG  V+GAS YG+A GTARGGVP ARIA YKVCW  GC D+D+LAGFD A
Sbjct  202   GHGSHTASTIAGASVDGASFYGVAGGTARGGVPGARIAMYKVCWVDGCSDVDLLAGFDHA  261

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             IADGVD+IS+S+GG    FF DPIAIGS+HAM+K I+T+ +AGN GP   T++N +PW+M
Sbjct  262   IADGVDIISVSIGGESTEFFNDPIAIGSFHAMEKGILTSCSAGNSGPELKTVENTAPWIM  321

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPG-NYSA  1205
             TVAA++IDR F + VKLGN + +SG S+NTF   K MYPLISG+ A   N + P  + S 
Sbjct  322   TVAASTIDRDFSTVVKLGNNKKLSGVSVNTFTPKKQMYPLISGSNAALPNQSDPYLDPSW  381

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIE  1382
             CD  ++ EK V+GKIVYCL S  Q+YTI  + G GVI++   + +T + T IP+T +   
Sbjct  382   CDSGTLDEKKVKGKIVYCLGSMDQEYTISELGGKGVISNLMNVSETAITTPIPSTHLSST  441

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             +   ++ YIN+TK P A I+++   K  AP++ SFS++GPQTI+LNILKPD+AAPG++IL
Sbjct  442   NSDYVEAYINSTKNPKAVIYKTTTRKVDAPYLASFSSKGPQTIALNILKPDIAAPGVNIL  501

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AAY+ LA++T    + R   +N+ SGTSMA PHAA AAAY+K FHP WSPAA+KSALMTT
Sbjct  502   AAYSNLASIT----NNRHSLFNLLSGTSMACPHAAAAAAYLKAFHPTWSPAALKSALMTT  557



>ref|XP_008245946.1| PREDICTED: cucumisin-like [Prunus mume]
Length=708

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/713 (47%), Positives = 455/713 (64%), Gaps = 22/713 (3%)
 Frame = +3

Query  171   MGELP--DDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFVARLLPREARRL  341
             MG+ P  D PT + +  H ++L   +G   +A+E   +HSY+RSF+GF A+L   EA+++
Sbjct  1     MGDKPKLDIPTTTTLPLHVDMLQNVVGSSNIAQEPLLLHSYKRSFNGFAAKLTEEEAQKM  60

Query  342   SEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKD  521
             +    VVSVF N + KL TTRSW+F+G      R+   ESD+IVG++DTGVW ES SF D
Sbjct  61    AGMAGVVSVFPNEKQKLHTTRSWNFIGFHENVKRS-TVESDVIVGVIDTGVWPESASFSD  119

Query  522   DGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV-EGFAPEDQESPADFDGHGSHIASI  698
              G+GPPP KWKG CQ   NFT CN K+IGA+Y+ + E F   + +SP D +GHG+H AS 
Sbjct  120   AGFGPPPKKWKGTCQGSSNFT-CNNKIIGARYYRISEPFIKGEIKSPRDSEGHGTHTAST  178

Query  699   AAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVIS  878
             AAG +V  ASL+G+  G ARGGVPSARIA YK CW  GC   D LA FD AIADGVD+IS
Sbjct  179   AAGNLVSKASLFGLGSGRARGGVPSARIAVYKACWSTGCSFADTLAAFDDAIADGVDIIS  238

Query  879   ISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSID  1055
              S+G   P  +F+ P+ IG++HA +K I+T+ +AGN+GP   TI   +PWL++VAAT+ID
Sbjct  239   TSLGPRSPDDYFRTPVTIGAFHAFRKGILTSTSAGNDGPQLKTITVFAPWLLSVAATTID  298

Query  1056  RRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSISE  1229
             R F + V+LGN ++  G   NTF+L GK YPLI    A ++ A Y G+ S  C   ++  
Sbjct  299   REFVTKVQLGNQKIHEGIVTNTFDLKGKFYPLIYAGDAPNRKAGYDGSISKTCKPGTVDH  358

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKY  1406
              LV+GKIV C    +  Y   +   VGVI   + + D + P  +PA+ + ++ G  I  Y
Sbjct  359   NLVKGKIVLC--DGTTGYGAYFAGAVGVILQSRPVADVLDPLPMPASCLGLDSGNSIYYY  416

Query  1407  INTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             I +T+ PTA IF+S   + T +P+VPSFS+RGP  ++ NILKPD+AAPG SILAA+  +A
Sbjct  417   ITSTRNPTATIFKSTEDIDTLSPYVPSFSSRGPNPVTPNILKPDIAAPGASILAAWPPIA  476

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK--  1757
              ++    D RV  YNV SGTSMA PHA G AAYVK+FHP+WSPAAI+SA++TTAK +   
Sbjct  477   PVSDYPGDDRVASYNVISGTSMACPHATGVAAYVKSFHPNWSPAAIQSAIITTAKPLSPD  536

Query  1758  IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             + P  A  A GAG I P +A  PGL++D  + +Y+ +LC + ++   L S+TG K +   
Sbjct  537   LNP-EAEFAYGAGQIDPVRAPYPGLVYDATEQDYIEFLCAQGYSTKLLQSITGHKSSCSS  595

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVS  2111
                    +D LNYPS  L  +NPN  + S  F RT T VG+  + +KAK I A  GL + 
Sbjct  596   KTNYGALSDNLNYPSFALSSSNPN--SISGVFNRTATNVGSPRSTYKAKVIGATKGLEIK  653

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             V P+ILSF    QK S++V V G         +S SL+W D T  VRSPI+VY
Sbjct  654   VNPSILSFSSLGQKLSFQVTVKGSIHHKSR--VSASLMWDDGTFQVRSPIVVY  704



>ref|XP_008238771.1| PREDICTED: cucumisin-like [Prunus mume]
Length=769

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/730 (48%), Positives = 470/730 (64%), Gaps = 31/730 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H  +RK +IVYMG+ P     S    HH++L  ALG    A+E  I+SYR+SF+GF ARL
Sbjct  23    HGQERKVHIVYMGDRPQG-GFSVASTHHSMLQRALGSTLSAKESLIYSYRKSFNGFAARL  81

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
               +E  +LSE + VVSV  N ++KL TTRSWDF+G   K       E ++I+G++DTG+W
Sbjct  82    SDKEVAKLSEMEGVVSVIPNHKLKLHTTRSWDFMGFH-KGQLGASIEGEVIIGVIDTGIW  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D  +GPPP KWKG CQ G NFT CN K+IGA+++N E  +   +  SP D  G
Sbjct  141   PESDSFNDKDFGPPPPKWKGVCQ-GPNFT-CNNKLIGARFYNSEDEYDSSEFHSPRDSIG  198

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HGSH AS AAGR V  AS +G+A GTARGGVP ARIA YKVCW   C   D+LA FD AI
Sbjct  199   HGSHTASTAAGREV-AASYFGLANGTARGGVPGARIAVYKVCWLSDCATADILAAFDDAI  257

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD++S S+G   P  + +DPIAIGS+HAMKK I+T+++AGN GPY  T+ N +PW++
Sbjct  258   ADGVDIVSTSLGSDVPIQYLKDPIAIGSFHAMKKGILTSSSAGNSGPYPATVSNYAPWIL  317

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISG----TLAQDKNATYPGN  1196
             TVAA++IDRRF +   LGNG++ SGFSIN F+L GK YPLI G     +++  ++ + GN
Sbjct  318   TVAASTIDRRFTAKAVLGNGQVYSGFSINNFDLNGKSYPLIWGGDAANISKGASSEFAGN  377

Query  1197  YSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVD  1376
                C   ++S   ++GKIVYC  S S    I+   G+G+I  D   D      +P+T + 
Sbjct  378   ---CVPNTLSSDKIKGKIVYC-DSFSDGSDIRRAGGMGMIMVDFPTDVAFNYPLPSTQIT  433

Query  1377  IEDGKKIDKYINTTKAPTAEIFRS---RAVKTTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             IEDG+KI  YI +T+ P A I  S         AP + SFS+RGP  ++ +ILKPDL AP
Sbjct  434   IEDGQKILNYIRSTENPIATILVSDPEHDKDAMAPSIASFSSRGPNPLTPDILKPDLTAP  493

Query  1548  GLSILAAYTALATMTGQV-DDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             G+ ILAA++ +A  +    +DTR VKYN+ SGTSM+ PH +GAAAY+K  HP WS AAIK
Sbjct  494   GVDILAAWSPVAPPSETFYEDTRSVKYNIISGTSMSCPHVSGAAAYLKAAHPRWSAAAIK  553

Query  1725  SALMTTAKAMKIKPIGAY-LASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASL  1898
             SALMTTA  +  K       A G+G I P KAV PGLIFD ++++Y+++LCK+ +NN +L
Sbjct  554   SALMTTATVLDSKKHADLEFAYGSGQINPLKAVKPGLIFDTSEADYINFLCKQGYNNTTL  613

Query  1899  GSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKA  2078
               +TG K++ C +    +  D LNYPS  LQL   +     A F RTVT VG+ ++ +  
Sbjct  614   RIITGDKNSSCGSTKPGKAWD-LNYPSFSLQLE--DGQEIKAEFTRTVTNVGSPNSTYTI  670

Query  2079  KIKAP-TGLTVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSV  2249
                +P + +TVSV P+ LSF    +K+S+ V V+G    Q+ I   +SGS+V  D  H V
Sbjct  671   ASFSPLSTITVSVSPSTLSFSYVGEKKSFTVKVTGPKISQQPI---ISGSIVLSDGVHQV  727

Query  2250  RSPILVYRSL  2279
             R+P++VY  L
Sbjct  728   RAPLVVYTFL  737



>ref|XP_008779567.1| PREDICTED: cucumisin-like, partial [Phoenix dactylifera]
Length=710

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/683 (50%), Positives = 437/683 (64%), Gaps = 14/683 (2%)
 Frame = +3

Query  258   AREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKA  437
             A+E  ++SY RSF+GF ARL  +EA R+ E D VVSV  NT +KL TT+SWDF+G++   
Sbjct  8     AKESLVYSYGRSFNGFAARLTDKEATRIQEMDGVVSVLPNTIIKLHTTKSWDFMGLTLGG  67

Query  438   NRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQY  617
                  +E D+IVGLLDTG+W ES SF D   GPPPAKWKG CQ G NFT CN K+IG +Y
Sbjct  68    TVRFPSEGDVIVGLLDTGIWPESDSFSDKDMGPPPAKWKGICQ-GSNFT-CNNKIIGGRY  125

Query  618   FNVEG-FAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYK  794
             +N EG +A  D +SP D +GHG+H +S AAG +V   S +G+A GTARGGVP ARIA YK
Sbjct  126   YNSEGIYASTDFKSPRDSEGHGTHTSSTAAGALVPDTSYFGLAFGTARGGVPKARIAMYK  185

Query  795   VCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAA  974
             VCW  GC   D+LA FD AIADGVD++S+S+GG PR FF DPIAIGS+HAMK  I+T  +
Sbjct  186   VCWSFGCASADILAAFDDAIADGVDILSVSLGGPPRPFFDDPIAIGSFHAMKNGILTANS  245

Query  975   AGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLIS  1154
             AGN GP   T+ NV+PW +TVAA+SIDR+F + V LGNG++  G SIN F L   Y LI 
Sbjct  246   AGNSGPDPRTVTNVAPWTITVAASSIDRKFIAKVALGNGQIFIGNSINRFALVGTYSLIY  305

Query  1155  GTLAQDKNATYPGNYSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-K  1328
             G  A + +A   G+ S  C   S++      KIV C  S S    +   HG+GVI SD +
Sbjct  306   GGGAPNISAGASGDISKYCFPGSLNSYKTEHKIVLC-DSISDGSGVLMAHGLGVIMSDSE  364

Query  1329  LPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQ  1505
               D      +PAT++ +EDG +I  YI +T  P A I     ++   AP V SFS+RGP 
Sbjct  365   YSDLAFSYPLPATVISVEDGAQILAYIQSTSNPFATILMGETIEDVMAPTVVSFSSRGPN  424

Query  1506  TISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYV  1685
             T+  ++LKPDL APG+ ILAA++ +A  +   DD   VKYNV SGTSM+ PH +GAAAY+
Sbjct  425   TVVPDMLKPDLTAPGVDILAAWSPVAPPSVSEDDPLRVKYNVISGTSMSCPHVSGAAAYI  484

Query  1686  KTFHPDWSPAAIKSALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYM  1862
             K+ HP WSPAAIKSALMTTA  M   K   A  A GAG I P KA+ PGLIFD ++ +Y+
Sbjct  485   KSAHPGWSPAAIKSALMTTATVMDPRKNADAEFAYGAGQIDPRKALTPGLIFDASEKDYV  544

Query  1863  SYLCKEFNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTV  2042
              +LCK+  N S   L     + C N      A GLNYPS  L +   +       F RTV
Sbjct  545   DFLCKQGYNTSTLRLVTGDSSTCPNTTTIGNAWGLNYPSFALSVI--DGQRILGVFPRTV  602

Query  2043  TYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAIS-WYMSGS  2219
             T VG  ++ + A   AP  LTVSV P++LSF    + +S+ V V G    AIS  ++SG 
Sbjct  603   TNVGAPNSTYYASWAAPYPLTVSVTPSLLSFSSVGETKSFTVTVRG---GAISQQFISGY  659

Query  2220  LVWKDNTHSVRSPILVYRSLQTD  2288
             +VW+D TH+VR P++VY +L  D
Sbjct  660   IVWRDATHTVRMPLVVYTTLPPD  682



>ref|XP_004140478.1| PREDICTED: xylem serine proteinase 1-like [Cucumis sativus]
Length=746

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/718 (47%), Positives = 457/718 (64%), Gaps = 14/718 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPT-ISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
              +K +IV+M   P     +  +D + N+L         A++  +HSY  +F+ F A+L  
Sbjct  29    DKKHFIVFMENRPTILNEVDGLDTNLNVLMSVKESHVDAKDCMVHSYTNNFNAFAAKLTE  88

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVE  503
              EA+ LSE+  V  V  N   KL TTRSWDFLG    A R  + ESD+IVGL DTG+   
Sbjct  89    AEAKTLSERGDVQHVIPNRYRKLQTTRSWDFLGFPINAKRKTRQESDIIVGLFDTGITPT  148

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHG  680
             + SFKDDGYGPPP KWKG C    NF+GCN K+IGA+YF ++G   P D  SP D +GHG
Sbjct  149   ADSFKDDGYGPPPKKWKGTCDHFANFSGCNNKLIGARYFKLDGITEPFDILSPVDVNGHG  208

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIA  857
             +H +S A G ++ GA+L G+A+GTA GGVPSAR+A YKVCW   GC DMD+LA FDAAI 
Sbjct  209   THTSSTATGNVITGANLSGLAQGTAPGGVPSARLAMYKVCWMSNGCSDMDLLAAFDAAIQ  268

Query  858   DGVDVISISVGGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             DGVDVISIS+ G    ++  DPI+IG++HAMKK I+T  AAGN GP  GT+ N +PW++T
Sbjct  269   DGVDVISISIAGIGYGNYTDDPISIGAFHAMKKGIITVTAAGNNGPSAGTVVNHAPWILT  328

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+SIDRRF S V+LGNG+ ISG  IN F    KMY L+SG     KN     N   C+
Sbjct  329   VAASSIDRRFISPVELGNGKNISGVGINLFNPEKKMYKLVSGEDVA-KNIEGKDNAMYCE  387

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               S+    V+  +V+C L +   D T+K I   G ++ SD+  D     M P+ +V    
Sbjct  388   DKSLDPSKVKDSLVFCKLMTWGADSTVKSIGAAGAILQSDQFLDNTDIFMAPSALVSSFV  447

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G  ID YI++T+ PTA I+++R  +  AP +  FS+RGP   S +ILKPD+AAPG++ILA
Sbjct  448   GATIDAYIHSTRTPTAVIYKTRQHRAAAPIIAPFSSRGPNPGSTHILKPDIAAPGVNILA  507

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
              YT L ++TG   DT+  K+ + SGTSMA PH A AAAYVK+FHP WSPAAI+SAL+TTA
Sbjct  508   GYTPLKSLTGLKGDTQFSKFTLMSGTSMACPHVAAAAAYVKSFHPLWSPAAIRSALLTTA  567

Query  1746  KAMKIK--PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             K +  +  P G +   GAG + P KA  PGLI+D+N+  Y+ +LC+E ++ +S+  LTG+
Sbjct  568   KPISRRGNPDGEF-GYGAGNLNPRKAKNPGLIYDLNEMSYIQFLCREGYSGSSIIILTGT  626

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
             K   C  I   +G D LNYP+  L L +    T +A F+R VT VG   +V+ A ++AP 
Sbjct  627   KSINCATIIPGEGYDSLNYPTFQLSLQSSREPT-TAVFWREVTNVGKPVSVYNATVRAPP  685

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             G+ ++V P  LSF   +QK  +KVVV      A +  +SGS+ W D  + VRSP++VY
Sbjct  686   GVEITVEPATLSFSYLHQKERFKVVVKANPLPA-NKMVSGSITWFDPRYVVRSPVVVY  742



>ref|XP_007220224.1| hypothetical protein PRUPE_ppa002172mg [Prunus persica]
 gb|EMJ21423.1| hypothetical protein PRUPE_ppa002172mg [Prunus persica]
Length=706

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/712 (47%), Positives = 458/712 (64%), Gaps = 21/712 (3%)
 Frame = +3

Query  171   MGELP--DDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFVARLLPREARRL  341
             MG+ P  D PT + +  H N+L   +G   + +E   +HSY+RSF+GF A+L   EA+++
Sbjct  1     MGDKPKIDIPTTTTLPLHLNMLQNVVGSSNIEQEPLLLHSYKRSFNGFAAKLTEEEAQKM  60

Query  342   SEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKD  521
             +    VVSVF + + KL TTRSW+F+G      R+   ESD+IVG++D+GVW ES SF D
Sbjct  61    AGMAGVVSVFPSRKQKLHTTRSWNFIGFHENVKRS-TVESDIIVGMIDSGVWPESASFSD  119

Query  522   DGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYF-NVEGFAPEDQESPADFDGHGSHIASI  698
              G+GPPP KWKG CQ   NFT CN K+IGA+Y+ N   F   D +SP D DGHG+H AS 
Sbjct  120   AGFGPPPKKWKGTCQGLSNFT-CNNKIIGARYYHNGRPFIKGDIKSPRDSDGHGTHTAST  178

Query  699   AAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVIS  878
             AAG +V  ASL+ +  GTARGGVPSARIA YKV W  G  D D+LA FD AIADGVD++S
Sbjct  179   AAGNLVSKASLFVLGSGTARGGVPSARIAVYKVGWSDGISDDDILAAFDDAIADGVDILS  238

Query  879   ISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDR  1058
             +S+G     +F+D I+IG++HA++K I+T+ AAGN+GP   TI N +PW ++VAAT+IDR
Sbjct  239   LSLGKAEDDYFRDSISIGAFHALRKGILTSTAAGNDGPGPKTIANFAPWFLSVAATTIDR  298

Query  1059  RFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSISEK  1232
              F + V+LGN ++  G   NTF+L GK YPLI    A ++ A Y G+ S  C   ++   
Sbjct  299   EFVTKVQLGNQKIYEGIVTNTFDLKGKFYPLIHAGDAPNRKAGYDGSTSMKCKPGTLDHN  358

Query  1233  LVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKYI  1409
             LV+GKIV C       Y   +   VGVI  ++ + D + P  +PA+ + ++ G  I  YI
Sbjct  359   LVKGKIVLC--DGKNGYGAYFAGAVGVILQNRPVADVLDPLPMPASCLGLDSGNSIYHYI  416

Query  1410  NTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALAT  1586
             N+T+ PTA IF+S   + T +P+VPSFS+RGP  ++ NILKPD+AAPG SILAA+  +A 
Sbjct  417   NSTRNPTATIFKSTEDIDTLSPYVPSFSSRGPNPVTPNILKPDIAAPGASILAAWPPIAP  476

Query  1587  MTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK--I  1760
             ++    D RV  YNV SGTSMA PHA G AAYVK+FHP+W+PAAI+SAL+TTAK +   +
Sbjct  477   VSAYPGDDRVASYNVISGTSMACPHATGVAAYVKSFHPNWTPAAIQSALITTAKPLSPDL  536

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
              P  A  A GAG I P +A  PGL++D  + +Y+ +LC + ++   L S+TG K      
Sbjct  537   NP-EAEFAYGAGQIDPVRAPYPGLVYDATELDYIEFLCAQGYSTKLLQSITGHKSCCSSK  595

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSV  2114
                   +D LNYPS  L  +NPN  + S  F RT T VG+  + +KAK I A  GL + V
Sbjct  596   TNYGALSDNLNYPSFALSSSNPN--SISGVFNRTATNVGSPRSTYKAKVIGATKGLEIKV  653

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P+ILSF    QK S++V + G   +  S  +S SLV+ D T  VRSPI+VY
Sbjct  654   NPSILSFSSLGQKLSFQVTIKGSIHRKSS--VSASLVFDDGTFQVRSPIVVY  703



>emb|CBI31598.3| unnamed protein product [Vitis vinifera]
Length=858

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/723 (48%), Positives = 459/723 (63%), Gaps = 24/723 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YIVYMG  P  D + SA+  H N+L +  G    A    + SY+RSF+GFVA+L
Sbjct  144   DDVRKEYIVYMGAKPAGDLSASAI--HTNMLEQVFGSGR-ASSSLVRSYKRSFNGFVAKL  200

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVSVF N + +L TTRSWDF+G   +  R    ESD+I+G+LDTG+W
Sbjct  201   TEEEMQQMKGMDGVVSVFPNEKKQLHTTRSWDFVGFPRQVKRT-SFESDIIIGVLDTGIW  259

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D G+GPPP KWKG C    NFT CN K+IGA+Y+  +G F+P+D  SP D +G
Sbjct  260   PESDSFDDKGFGPPPRKWKGTCHGFSNFT-CNNKIIGAKYYKSDGKFSPKDLHSPRDSEG  318

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK CW  GC D D+LA FD AI
Sbjct  319   HGTHTASTAAGDLVSMASLMGFGLGTARGGVPSARIAVYKTCWSDGCHDADILAAFDDAI  378

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+ISISVGG  P+ +F+D  AIG++HAMK  I+T+ +AGNEGP   ++ NVSPW +
Sbjct  379   ADGVDIISISVGGKTPQKYFEDSAAIGAFHAMKNGILTSTSAGNEGPLLVSVTNVSPWSL  438

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++  R+F + V+LG+ ++  G SINTFEL  MYPLI G    +    + GN S  C
Sbjct  439   SVAASTTYRKFLTKVQLGDRKVYKGISINTFELHGMYPLIYGGDGPNTRGGFRGNTSRFC  498

Query  1209  DYLSISEKLVRGKIVYCL-----SSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPATI  1370
                S++  LV+GKIV C+     S A+    +    G  ++   +LP D      +PA+ 
Sbjct  499   QINSLNPNLVKGKIVLCIGHRGGSEAAWSAFLAGAVGTVIVDGLQLPRDFSRIYPLPASR  558

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             +   DGK+I  YI++T  PTA I +S  V  T AP+VP FS+RGP  I+ ++LKPDL AP
Sbjct  559   LGAGDGKRIAYYISSTSNPTASILKSIEVSDTLAPYVPPFSSRGPNPITHDLLKPDLTAP  618

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILAA++ ++ ++    D R+ +YN+ESGTSMA PHA GAAAY+K+FHP WSPAAIKS
Sbjct  619   GVHILAAWSPISPISKVPGDNRIAEYNIESGTSMACPHATGAAAYIKSFHPTWSPAAIKS  678

Query  1728  ALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGS  1904
             ALMTTA  M   K   A  A GAG I P +AV PGL++D ++ +++++LC E  +     
Sbjct  679   ALMTTATPMSARKNPEAEFAYGAGNIDPVRAVHPGLVYDADEIDFVNFLCGEGYSVQNLR  738

Query  1905  LTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-  2081
             L     + C         D LNYPS  L +  P   + +  F R+VT VG   + +KA  
Sbjct  739   LVTGDHSVCSKATNGTVWD-LNYPSFALSI--PYKESIARTFKRSVTNVGLPVSTYKATV  795

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             I AP GL V+V PNILSF    QK S+ + V G+  K +   +S SLVW D  + VRSPI
Sbjct  796   IGAPKGLKVNVQPNILSFTSIGQKLSFVLKVKGRIVKDM---VSASLVWDDGLYKVRSPI  852

Query  2262  LVY  2270
             +VY
Sbjct  853   IVY  855



>ref|XP_007221063.1| hypothetical protein PRUPE_ppa016501mg [Prunus persica]
 gb|EMJ22262.1| hypothetical protein PRUPE_ppa016501mg [Prunus persica]
Length=707

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/713 (47%), Positives = 455/713 (64%), Gaps = 22/713 (3%)
 Frame = +3

Query  171   MGELP--DDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFVARLLPREARRL  341
             MG+ P  D PT + +  H ++L   +G   +A+E   +HSY+RSF+GF A+L   EA+++
Sbjct  1     MGDKPKLDIPTTTTLPLHVDMLQNVVGSSNIAQEPLLLHSYKRSFNGFAAKLTEEEAQKM  60

Query  342   SEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKD  521
             +    VVSVF N + KL TTRSW+F+G      R+   ESD+IVG++DTGVW ES SF D
Sbjct  61    AGMAGVVSVFPNEKQKLHTTRSWNFIGFHENVKRS-TVESDIIVGVIDTGVWPESASFSD  119

Query  522   DGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV-EGFAPEDQESPADFDGHGSHIASI  698
              G+GPPP KWKG CQ   NFT CN K+IGA+Y+ + E F   + +SP D +GHG+H AS 
Sbjct  120   AGFGPPPKKWKGTCQGSSNFT-CNNKIIGARYYRISEPFVKGEIKSPRDSEGHGTHTAST  178

Query  699   AAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVIS  878
             AAG +V  ASL+G+  GTARGGVP+ARIA YK CW  GC   D LA FD AIADGVD+IS
Sbjct  179   AAGNLVSKASLFGLGLGTARGGVPAARIAVYKACWSTGCSFADTLAAFDDAIADGVDIIS  238

Query  879   ISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSID  1055
              S+G   P  +F+ P+ IG++HA++K I+T+ AAGN+GP   TI   +PW ++VAAT+ID
Sbjct  239   ASLGPTSPDDYFRTPVTIGAFHALRKGILTSTAAGNDGPALKTITVFAPWCLSVAATTID  298

Query  1056  RRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSISE  1229
             R F + V+LGN ++  G   NTF+L GK YPLI    A ++ A Y G+ S  C   ++  
Sbjct  299   REFVTKVQLGNQKIYEGIVTNTFDLKGKFYPLIYAGDAPNRTAGYGGSISKTCKPGTLDH  358

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKY  1406
              LV+GKIV C    +  Y   +   VGVI   + + D + P  +PA+ + ++ G  I  Y
Sbjct  359   NLVKGKIVLC--DGTTGYGAYFAGAVGVILQSRPVADVLDPLPMPASCLGLDSGNSIYYY  416

Query  1407  INTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             I +T+ PTA IF+S   + T +P+VPSFS+RGP  +S NILKPD+AAPG SILA++  +A
Sbjct  417   ITSTRNPTATIFKSTEDIDTLSPYVPSFSSRGPNPVSPNILKPDIAAPGASILASWPPIA  476

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK--  1757
              ++    D RV  YNV SGTSMA PHA G AAYVK+FHP+W+PAAI+SAL+TTAK +   
Sbjct  477   PVSDYPGDDRVASYNVISGTSMACPHATGIAAYVKSFHPNWTPAAIQSALITTAKPLSPD  536

Query  1758  IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             + P  A  A GAG I P +A  PGL++D  + +Y+ +LC + ++   L S+TG K     
Sbjct  537   LNP-EAEFAYGAGQIDPVRAPYPGLVYDATELDYIEFLCTQGYSTKLLQSITGHKSCCSS  595

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVS  2111
                    +D LNYPS  L  +NPN  + S  F RT T VG+  + +KAK I A  GL + 
Sbjct  596   KTNYGALSDNLNYPSFALSSSNPN--SISGVFNRTATNVGSPRSTYKAKVIGATKGLEIK  653

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             V P+ILSF    QK S++V V G         +S SLVW D T  VRSPI+VY
Sbjct  654   VNPSILSFSSLGQKLSFQVTVKGSIHHKSR--VSTSLVWDDGTFQVRSPIVVY  704



>ref|XP_008351272.1| PREDICTED: cucumisin-like isoform X3 [Malus domestica]
Length=705

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/706 (48%), Positives = 449/706 (64%), Gaps = 20/706 (3%)
 Frame = +3

Query  183   PDDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFVARLLPREARRLSEKDKV  359
             P+  T +    H N+L   + D  +A E   +HSY+RSF+GF ARL   EA++L+  D V
Sbjct  7     PEVSTTTTSALHVNMLQNVVEDSNIAHESLLLHSYKRSFNGFAARLTEEEAQKLAGMDGV  66

Query  360   VSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPP  539
             VSVF +   KL TTRSWDF+G      R+   E+D IVG++D+G+W ES SF D G+GPP
Sbjct  67    VSVFPSETKKLQTTRSWDFIGFPEMVKRS-AIETDTIVGMIDSGIWPESASFSDAGFGPP  125

Query  540   PAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE--DQESPADFDGHGSHIASIAAGRM  713
             P +WKG C+   NFT CN K+IGA+Y+  + +     D  SP D +GHG+H AS AAG +
Sbjct  126   PKRWKGACKGEGNFT-CNNKIIGARYYRSQPYPKNSSDVMSPRDTEGHGTHTASTAAGNL  184

Query  714   VEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGG  893
             V  ASLYG+  GTARGGVPSARIA YKVCW  GC D D+LA FD AIADGVD++S+S+GG
Sbjct  185   VSKASLYGLGLGTARGGVPSARIAVYKVCWSDGCPDADILAAFDDAIADGVDILSVSLGG  244

Query  894   H-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFES  1070
               P  +F++ I IG++HA++K I T+A+AGNEGP   TI N +PW + VAA++IDR F++
Sbjct  245   RKPLDYFRNAIDIGAFHALRKGIFTSASAGNEGPNLKTITNFAPWSLAVAASTIDRHFDT  304

Query  1071  DVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSISEKLVRG  1244
              V+LGN ++  G   NTFEL GK YP++      D+ A Y G  S  C   ++  KLV  
Sbjct  305   KVQLGNHKIYEGIVTNTFELKGKFYPIVYAGDVPDRAAGYNGETSRLCQTGTLDTKLVED  364

Query  1245  KIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKA  1424
             KIV C              G  V+ S    D + P  IPA  V    G +I  YIN+T+ 
Sbjct  365   KIVLCDGPTGDGALYAGAFGY-VLTSRNAADVIDPVPIPAASVWFHVGNEITHYINSTRN  423

Query  1425  PTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQV  1601
             PTA I++S       AP+VPSFS+RGP   + NILKPD+A+PG+SILAA+  +A ++G  
Sbjct  424   PTATIWKSTEGRDALAPYVPSFSSRGPNPNTPNILKPDIASPGVSILAAWPPIAPVSGVE  483

Query  1602  DDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM--KIKPIGA  1775
              D RV  YN+ SGTSMA PHAAG AAYVK+FHP+WSPAAI SAL TTAK M   + P  A
Sbjct  484   GDDRVASYNIISGTSMACPHAAGVAAYVKSFHPNWSPAAILSALTTTAKPMSANLNP-EA  542

Query  1776  YLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQ  1952
               A GAGLI P++A  PGL++D  + +Y+++LC   ++   L +LTG   +  ++     
Sbjct  543   EFAYGAGLINPSRAPYPGLVYDAAEIDYVNFLCAHGYSTRLLKALTGDSCSSSQSSHGTL  602

Query  1953  GADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILS  2132
              +D LNYPS+ L  +NP +   +  F RTVT VG+  + +KAK+ AP GL + V P+IL 
Sbjct  603   -SDHLNYPSVALSTSNPKSV--NGIFNRTVTNVGSPKSTYKAKVSAPPGLEIKVNPSILK  659

Query  2133  FPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             F    QK S++V V G  +K I   +SGSLVW D    VRSPI+VY
Sbjct  660   FTSLGQKLSFQVTVKGLIEKTI---VSGSLVWDDGNFQVRSPIVVY  702



>ref|XP_009375889.1| PREDICTED: xylem serine proteinase 1 [Pyrus x bretschneideri]
Length=743

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/720 (48%), Positives = 466/720 (65%), Gaps = 17/720 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDE-HHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D Q+K YIVY+G  P +   SA    H  IL+   G    A+E  ++SY++SF  F A+L
Sbjct  29    DDQKKFYIVYLGAHPVNNEDSAASHTHMKILSSLKGSYVDAQESMVYSYKKSFDAFAAKL  88

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA++L   D+V+SV  N   KL TTRSWDF+G+  KA RN K ESD+IVGLLDTG+ 
Sbjct  89    SSNEAKKLERMDEVLSVIPNRYHKLHTTRSWDFIGLPQKARRNLKTESDIIVGLLDTGIT  148

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDG  674
              ES SFK DG GPPPAKWKG C    NF+GCN K+IGA YF ++G   P D  SP D DG
Sbjct  149   PESKSFKGDGLGPPPAKWKGTCGHFANFSGCNNKIIGANYFKLDGNPDPADILSPLDVDG  208

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWG-QGCQDMDVLAGFDAA  851
             HG+H +S  AG  V  A+L+G+A+GTAR    SAR+A YKVCW   GC DMD+LA +DAA
Sbjct  209   HGTHTSSTLAGNQVPNANLFGLAKGTARA---SARVAMYKVCWASSGCSDMDILAAYDAA  265

Query  852   IADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             I DGVDVIS+S+GG   S+  D IAIG++HA+KK I+T A+AGN+GP   ++ N +PWL+
Sbjct  266   IHDGVDVISVSIGGGGSSYVSDIIAIGAFHAIKKGIITVASAGNDGPNLASVLNHAPWLV  325

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGT-LAQDKNATYPGNYSA  1205
             TVAA+ IDR F S V LGNG+ +SG  ++ F   K +YP++SG  +AQ         +  
Sbjct  326   TVAASGIDRDFISKVHLGNGKDVSGVGVSMFSPKKNLYPIVSGVDVAQSSQTKEGARFCV  385

Query  1206  CDYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDI  1379
              D L   +  V+GK+V+C L S   D  +K I G G+I   D+  D     M P T+V+ 
Sbjct  386   QDTLDPGK--VKGKLVFCKLGSWGADSVVKGIGGAGIIIEDDQFLDAAQIFMAPGTMVNS  443

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
               G  ID YI+TT++P+A I++S+  K  APF+ SFS+RGP   S  ILKPD+AAPG+ I
Sbjct  444   TIGDIIDAYIHTTRSPSAVIYKSQQTKKRAPFIASFSSRGPNQGSNRILKPDIAAPGVDI  503

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA+YT   ++TG   DT+  ++ + SGTSMA PH AG AAYVK+FHP+WSPAAI+SA++T
Sbjct  504   LASYTLRKSLTGLAGDTQFSEFTLMSGTSMACPHVAGVAAYVKSFHPNWSPAAIRSAILT  563

Query  1740  TAKAMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINK-SEYMSYLCKE-FNNASLGSLT  1910
             TAK M  +    A  A GAG + P KAV PGL++D+++   Y+ +LC E +  +SL  L 
Sbjct  564   TAKPMSQRVTSDAEFAYGAGQVNPAKAVNPGLVYDMDEILSYIQFLCHEGYKGSSLAPLV  623

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             GSK   C ++   QG D LNYP+M L L +    T    F RTVT VG   +++ A ++A
Sbjct  624   GSKTLNCSSLLPGQGYDALNYPTMQLSLISNKQPTV-GVFRRTVTNVGPAKSIYNATVRA  682

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P G+ ++V P  LSF  T +K++++VVV      ++   +SGSL WK   ++VRSPI++Y
Sbjct  683   PKGVEITVKPMSLSFSSTLEKKTFQVVVKANPMTSMR-MVSGSLGWKSTRYTVRSPIVIY  741



>ref|XP_010108377.1| hypothetical protein L484_010385 [Morus notabilis]
 gb|EXC19368.1| hypothetical protein L484_010385 [Morus notabilis]
Length=765

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/707 (48%), Positives = 461/707 (65%), Gaps = 18/707 (3%)
 Frame = +3

Query  150   RKPYIVYMGEL-PDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             RK YIVYMG++ P     ++   H ++L   +G  ++A    +HSY+RS +GFVA+L  +
Sbjct  27    RKAYIVYMGDITPQSEQSTSAPLHMSMLQNVVG-RDVAPGSLLHSYKRSLNGFVAKLTEK  85

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA+ ++ K+ VVSVF + + KL TTRSWDF+G   +  R    ESD+I+G+ DTG+W ES
Sbjct  86    EAQEMAGKEGVVSVFPSEKQKLHTTRSWDFIGFPQQVERC-TVESDIIIGVFDTGIWPES  144

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGS  683
              SF D G+GPPP+KWKG CQ   NFT CN K+IGA+Y+  +G F   D +SP D DGHG+
Sbjct  145   DSFDDKGFGPPPSKWKGSCQTS-NFT-CNNKIIGAKYYRSDGTFEDGDIKSPRDSDGHGT  202

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS AAG +V GASL G+  GTARG VPSAR+A YKVCW  GCQD D+LA FD AIADG
Sbjct  203   HTASTAAGVLVGGASLLGLGSGTARGAVPSARLAIYKVCWEDGCQDADILAAFDDAIADG  262

Query  864   VDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             VD+ISIS+      +F++ IAIGS+HAM+K I+T+ +AGN GP   T+ N SPW ++VAA
Sbjct  263   VDIISISLSSGLEDYFKNSIAIGSFHAMRKGILTSTSAGNGGPSLTTLTNFSPWTLSVAA  322

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYL  1217
             ++IDR F + V+LGN +   GFSINTF+L  KM+P+I G  A +  A    ++S  C   
Sbjct  323   STIDREFLTKVQLGNDKTFEGFSINTFDLKDKMFPIIYGGDAPNTTAGIEQSFSRYCTTG  382

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATIVDIEDGKK  1394
             S+ + LV+GKIV C  S ++         VG++ + +    V  T  +P + ++ +DG +
Sbjct  383   SLDQNLVKGKIVLC-DSFTRGRGAILAGAVGMVITGRESGEVSETFPLPTSYLNPDDGAQ  441

Query  1395  IDKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             I  YIN+T +P A I +S   K   AP++PSFS+RGP  IS NILKPDLAAPG++ILAA+
Sbjct  442   IYIYINSTGSPMASISKSNEAKDRLAPYIPSFSSRGPNPISPNILKPDLAAPGVNILAAW  501

Query  1572  TALA-TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             + +A  + G  DD RVV YN  SGTSM+ PHA+GAAAYVK+F+P WSPAAIKS+LMTTA 
Sbjct  502   SPIAPVLEGFEDDKRVVAYNFLSGTSMSCPHASGAAAYVKSFNPTWSPAAIKSSLMTTAN  561

Query  1749  AMKIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKD  1922
              M       A  A GAG I P  A  PGLI+D  + +Y+S+LC + +    L  +TG+ +
Sbjct  562   PMSADLNSEAEFAYGAGQINPLNAACPGLIYDAVEDDYISFLCGQGYTTKLLQIVTGNSN  621

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
             + C +  + +    LNYP+  L  T   + T +  F RTVT VG+ ++ +KA + AP GL
Sbjct  622   STCPDQGSHETTPDLNYPAFALSTT--PSQTINHVFNRTVTNVGSPTSSYKANLVAPPGL  679

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTH  2243
              ++V P++LSF    +K SY V V G   K +   +S SLVW D T+
Sbjct  680   KITVNPSVLSFKSLEEKLSYAVTVRGTVDKKV--VVSASLVWDDGTY  724



>ref|XP_004165285.1| PREDICTED: cucumisin-like, partial [Cucumis sativus]
Length=795

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/704 (47%), Positives = 454/704 (64%), Gaps = 13/704 (2%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+      ++A   H ++L + L   + ++   ++SY RSFSGF ARL   EAR+L+  
Sbjct  1     MGKPSGGGFLAASQLHTSMLQQVLTSSDASKSSLVYSYHRSFSGFAARLNEDEARKLAVM  60

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D VVSVF + + +L TTRSWDF+G    A    + ESD+I+G+LDTG+W ES SF D+G+
Sbjct  61    DGVVSVFPSEKKQLHTTRSWDFMGFFQDAPTT-RLESDIIIGMLDTGIWPESQSFSDEGF  119

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIASIAAGR  710
             GPPP+KWKG+C+  LNFT CN K+IGA++F  E F   D  SP D +GHG+H +S A G 
Sbjct  120   GPPPSKWKGECKPTLNFT-CNNKIIGARFFRSEPFVGGDLPSPRDVEGHGTHTSSTAGGN  178

Query  711   MVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVG  890
              V  A+L+G+A GT+RGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SVG
Sbjct  179   FVSNANLFGLAAGTSRGGVPSARIAVYKICWSDGCPDADILAAFDHAIADGVDIISLSVG  238

Query  891   GHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFE  1067
             G   S +  DPIAIG++HAMK  I+T+ + GN+GP  G+I NVSPW ++VAA++IDR+F 
Sbjct  239   GFGASDYLDDPIAIGAFHAMKNGILTSNSGGNDGPNLGSISNVSPWSLSVAASTIDRKFV  298

Query  1068  SDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYS-ACDYLSISEKLVR  1241
             ++V LGNGE I G S+NTF+LG K++PLI    A +  A + G+ S  C   S+ E  V+
Sbjct  299   TNVALGNGESIQGISVNTFDLGDKLFPLIHAGDAPNTTAGFNGSTSRLCFPGSLDEDKVQ  358

Query  1242  GKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIEDGKKIDKYINTT  1418
             GKIV C   +  + T +    VG I  +    D       P +++    G+K+ +Y+ + 
Sbjct  359   GKIVICDLISDGEVT-QSSGAVGTIMQNPNFQDVAFLFPQPVSLISFNTGEKLFQYLRSN  417

Query  1419  KAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
               P A I +S  ++  +AP V SFS+RGP  I+L+ILKPDLAAPG+ ILA+++   ++TG
Sbjct  418   SNPEAAIEKSTTIEDLSAPAVVSFSSRGPNLITLDILKPDLAAPGVDILASWSEGTSITG  477

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIG  1772
              V D R+  +N+ SGTSMA PHA GAAAYVK+FHP WSPAAIKSALMT+A  M  K    
Sbjct  478   LVGDKRIAPFNIISGTSMACPHATGAAAYVKSFHPTWSPAAIKSALMTSAFPMSPKLNTD  537

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAA  1949
             A L  GAG + P+ A+ PGL++D  + +Y+ +LC + ++   L  ++G   N C ++   
Sbjct  538   AELGYGAGHLNPSNAINPGLVYDAEELDYIKFLCGQGYSTKDLRLVSGDHSN-CSDVTKT  596

Query  1950  QGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNIL  2129
               +D LNYPS  L + + +    S  ++RTVT VG   + +KA IKAP GL V+V P  L
Sbjct  597   AASD-LNYPSFGLVINSTSQRLISRVYHRTVTNVGLPVSTYKAVIKAPPGLKVTVRPATL  655

Query  2130  SFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             SF    QK S+ V V  K    +   +SGSL W D  H VRSPI
Sbjct  656   SFRSLGQKISFTVTVRAK-ANVVGKVVSGSLTWDDGVHLVRSPI  698



>gb|AEM42989.1| cucumisin [Siraitia grosvenorii]
Length=735

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/719 (47%), Positives = 459/719 (64%), Gaps = 24/719 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             +D  RK YIVYMG   +D T SA   H  +L E +G    A E  I++Y+RSF+GF  +L
Sbjct  30    NDDGRKIYIVYMGSKLED-TASAHLYHRAMLEEVVG-STFAPESVIYTYKRSFNGFAVKL  87

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA +++ K+ VVSVF + +  L TTRSWDFLG+S    R  + ES+++VG+ D+G+W
Sbjct  88    TEEEALKIAAKEGVVSVFPSEKNHLHTTRSWDFLGISQNVPRVKQVESNIVVGVFDSGIW  147

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGH  677
              E+PSF DDG+GP PA W+G CQ   NF  CNRK+IGA+ +      P D  SP D DGH
Sbjct  148   PENPSFNDDGFGPAPANWRGTCQASTNFR-CNRKIIGARAYRSSTLPPGDVRSPRDTDGH  206

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H AS  AG +V  ASLYG+  GTARGGVP ARIA YK+CW  GC D D+LA FD AIA
Sbjct  207   GTHTASTVAGVLVSQASLYGLGVGTARGGVPPARIAVYKICWSDGCSDADILAAFDDAIA  266

Query  858   DGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             DGVD+IS+SVGG  P+ +  + IAIGS+HAMK+ I+T+ +AGN GP   T+ ++SPWL T
Sbjct  267   DGVDIISLSVGGKVPQPYLYNSIAIGSFHAMKRGILTSNSAGNNGPKSFTVTSLSPWLPT  326

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA---  1205
             VAA+S DR+F + V LGNG    G SINTF++   YPLI        NA   G  S+   
Sbjct  327   VAASSSDRKFVTQVLLGNGNTYQGVSINTFDMRNQYPLIYA-----GNAPSIGFNSSTSR  381

Query  1206  -CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIE  1382
              C   S+   LVRGKI+ C S+        +    GV+      D      +PA+++D  
Sbjct  382   YCYEDSVDPNLVRGKILLCDSTFGPTVFASFGGAAGVLMQSNTRDHASSYPLPASVLDPA  441

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
              G  I +Y+++T+APTA IF+S  V+ T+AP V SFS+RGP  ++ +ILKPD  APG+ I
Sbjct  442   GGNNIKRYMSSTRAPTATIFKSTVVRDTSAPVVVSFSSRGPNYVTHDILKPDSTAPGVEI  501

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAA+  +A ++G V D+R   YN+ SGTSM+ PH    A ++KTF+P WSPAAIKSALMT
Sbjct  502   LAAWPPVAPISG-VRDSRSALYNIISGTSMSCPHVTAIAVHIKTFYPSWSPAAIKSALMT  560

Query  1740  TAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             TA  M  +    A  A G+G + P KAV PGL++D ++S+Y+ +LC E +  A + S TG
Sbjct  561   TASPMNARFNSDAEFAYGSGHVNPLKAVDPGLVYDASESDYVKFLCGEGYTTAMVRSTTG  620

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
               ++ C +    +  D LNYPS  L ++   + T + +F RT+T V +G++ ++A I AP
Sbjct  621   -DNSACTSGNIGRVWD-LNYPSFALSIS--RSQTANQSFRRTLTNVVSGASTYRASISAP  676

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              GL++SV P++LSF     ++S+ + V G   +AI   +S SLVW D +H+VRSPI VY
Sbjct  677   QGLSISVNPSVLSFNGIGDQKSFTLTVRGTVSQAI---VSASLVWSDGSHNVRSPITVY  732



>ref|XP_002524250.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38174.1| Cucumisin precursor, putative [Ricinus communis]
Length=727

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/713 (47%), Positives = 455/713 (64%), Gaps = 23/713 (3%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIVYMG+ P     SA   H N+L E +G    A  Y + SY RSF+GFVA+L   E ++
Sbjct  23    YIVYMGDRPKG-EFSASALHTNMLQEVVGSG--ASAYLLRSYHRSFNGFVAKLTKEEKQK  79

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             L+    VVSVF + + KL TTRSWDF+G      R+   E D+I+G+LDTG+W ES SF 
Sbjct  80    LAGMQGVVSVFPSQKKKLHTTRSWDFMGFPVNVTRS-TYEGDIIIGMLDTGIWPESQSFN  138

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQE--SPADFDGHGSHIA  692
             D GYGPPPAKWKG CQ+  NFT CN K+IGA+Y++ +G      E  SP D +GHG+H A
Sbjct  139   DSGYGPPPAKWKGTCQESSNFT-CNNKIIGARYYHSDGKVDPRLEFDSPRDSEGHGTHTA  197

Query  693   SIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDV  872
             S AAG +V  ASL G+  GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+
Sbjct  198   STAAGDIVSQASLLGLGLGTARGGVPSARIAVYKICWSYGCTDADILAAFDDAIADGVDI  257

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             IS+SVGG P  +F+D IAIG++H+MK  I+T+ +AGNEGP   ++ N SPW ++VAA++I
Sbjct  258   ISLSVGGWPMDYFEDSIAIGAFHSMKNGILTSNSAGNEGPEPESVSNCSPWSLSVAASTI  317

Query  1053  DRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSACDYLSISE  1229
             DR+F + VKLGNG +  G SINTFE G  MYP+I    A ++ A +  + S C   S+++
Sbjct  318   DRKFATPVKLGNGAVYQGNSINTFEPGNAMYPIIYAGDAMNETARHDSSSSFCSQDSLNK  377

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKY  1406
              LV+GKIV C   + +D     I   G++A D    D     ++P +++   +   +  Y
Sbjct  378   TLVKGKIVVCDGFSEEDAVA--IGLAGIVAPDGYYTDVAFSYILPVSLISTYNQTDVLNY  435

Query  1407  INTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             +N+T  PTA I +S   K   AP+V SFS+RGP  I+ +ILKPDL APG+ ILAA++   
Sbjct  436   VNSTSEPTATILKSVENKDKLAPYVVSFSSRGPSPITKDILKPDLTAPGVDILAAWSEAT  495

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK-I  1760
             T++G   DTRV  YN+ SGTSM+ PHA+ AAAYVK+FHP WSP+AIKSALMTTA  M   
Sbjct  496   TVSGSKWDTRVAPYNIISGTSMSCPHASAAAAYVKSFHPTWSPSAIKSALMTTAYPMSPY  555

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
             K      A G+G I P KA+ PGL++D  + +Y+ +LC + +N + L  +TG  DN   +
Sbjct  556   KNTDQEFAYGSGQINPVKAMDPGLVYDAEEIDYVKFLCGQGYNASQLQLVTG--DNSTCS  613

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
             +        LNYPS    L+ P+  + +  F+RTVT VG+ S  + A   AP GL + V 
Sbjct  614   VETNGTVWDLNYPS--FALSAPSGLSVTRVFHRTVTNVGSPSISYNAITSAPAGLNIQVE  671

Query  2118  PNILSFPQTNQKRSYKVVVSGKF--QKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P++++F    +K+S+ V V      + AI   +SG LVW D  H VRSPI+ +
Sbjct  672   PDVITFQSLGEKQSFVVTVEATLPDKDAI---LSGLLVWYDQVHQVRSPIVAF  721



>ref|XP_008234049.1| PREDICTED: uncharacterized protein LOC103333026 [Prunus mume]
Length=1523

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/724 (48%), Positives = 467/724 (65%), Gaps = 22/724 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELP--DDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFV  308
             H   RK YIVYMG+ P  D PT + +  H N+L   +G   +A+E   +HSY+RSF+GF 
Sbjct  805   HTDTRKVYIVYMGDKPKLDIPTTTTLPLHVNMLQNVVGSSNIAQEPLLLHSYKRSFNGFS  864

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   EA++++    VVSVF + + KL TTRSW+F+G      R+   ESD+IVG++D+
Sbjct  865   AKLTEEEAQKMAGMAGVVSVFPSGKKKLHTTRSWNFIGFHENVKRS-TVESDIIVGVIDS  923

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYF-NVEGFAPEDQESPAD  665
             GVW ES SF D G+GPPP KWKG CQ   NFT CN K+IGA+Y+ N E F   D +SP D
Sbjct  924   GVWPESASFSDAGFGPPPKKWKGTCQGSSNFT-CNNKIIGARYYRNSEPFVKGDIKSPRD  982

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
               GHG+H AS AAG +V  ASL+G+  GTARGGVPSARIA YKVCW   C D D+LA FD
Sbjct  983   SGGHGTHTASTAAGNLVSKASLFGLGSGTARGGVPSARIAVYKVCWPSDCSDDDILAAFD  1042

Query  846   AAIADGVDVISISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSP  1022
              AIADGVD++S+S+G   P  +F+ PI IG++HA++K I+T+ AAGN+GP   TI N +P
Sbjct  1043  DAIADGVDILSVSLGPASPDDYFRTPITIGAFHALRKGILTSTAAGNDGPGPKTISNFAP  1102

Query  1023  WLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNY  1199
             W ++VAAT+IDR F + V+LGN ++  G   NTF+L GK YPLI    A ++ A Y  + 
Sbjct  1103  WFLSVAATTIDREFVTKVQLGNQKIYEGIVTNTFDLKGKFYPLIYAGDAPNRTAGYDEST  1162

Query  1200  S-ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIV  1373
             S  C+  ++   LV+GKIV C    +  Y   +   VGVI   + + D + P  +PA+ +
Sbjct  1163  SKTCEPGTLDHNLVKGKIVLC--DGTTGYGAYFAGAVGVILQSRPVADVLDPLPMPASCL  1220

Query  1374  DIEDGKKIDKYINTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPG  1550
              ++ G  I  YIN+T+ PTA IF+S   + T +P+VPSFS+RGP  ++ N+LKPD+AAPG
Sbjct  1221  GLDSGNSIYYYINSTRNPTATIFKSTEDIDTLSPYVPSFSSRGPNPVTPNLLKPDIAAPG  1280

Query  1551  LSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSA  1730
              SILAA+  +A ++    D RV  YN  SGTSMA PHA G AAYVK+FHP+WSPAAI+SA
Sbjct  1281  ASILAAFPPIAPVSFVQGDDRVASYNFVSGTSMACPHATGVAAYVKSFHPNWSPAAIQSA  1340

Query  1731  LMTTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ++TTAK +   + P  A  A GAG I P +A  PGL++D  + +Y+ +LC + ++   L 
Sbjct  1341  IITTAKTLSPDLNP-EAEFAYGAGQIDPVRAPYPGLVYDATELDYIEFLCAQGYSTKLLQ  1399

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
             S+TG K +          +D LNYPS  L  +NPN  + S  F RT T VG+  + +KAK
Sbjct  1400  SITGHKSSCSSKTNYGALSDNLNYPSFALSSSNPN--SISGVFNRTATNVGSPRSTYKAK  1457

Query  2082  -IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
              I A  GL + V P+ILSF    QK S++V V G      S  +S SLVW D T  VRSP
Sbjct  1458  VIGATKGLEIKVNPSILSFSSLGQKLSFQVTVKGSIHHKSS--VSASLVWDDGTFQVRSP  1515

Query  2259  ILVY  2270
             I+VY
Sbjct  1516  IVVY  1519


 Score =   435 bits (1119),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 261/633 (41%), Positives = 358/633 (57%), Gaps = 75/633 (12%)
 Frame = +3

Query  357   VVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGP  536
             VVSVF + + KL TTRSW+F+G      R+   ESD+IVG++D+GVW ES SF D G+GP
Sbjct  4     VVSVFPSGKKKLHTTRSWNFIGFHENVKRS-TIESDIIVGMIDSGVWPESASFSDAGFGP  62

Query  537   PPAKWKGKCQKGLNFTGCNRKVIGAQYF-NVEGFAPEDQESPADFDGHGSHIASIAAGRM  713
             PP KWKG CQ   NFT CN+K+IGA+Y+ N   F  +D +SP D  GHG+H AS AAG +
Sbjct  63    PPKKWKGTCQGSSNFT-CNKKIIGARYYHNGRPFVKDDIKSPRDLYGHGTHTASTAAGNL  121

Query  714   VEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGG  893
             V  ASL+G+  GTARGGVPSARIA YKV    G  D D+LA FD AIADGVD++S+S+GG
Sbjct  122   VSKASLFGLGSGTARGGVPSARIAVYKVGSSDGINDDDILAAFDDAIADGVDILSVSIGG  181

Query  894   HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESD  1073
                ++F+D I+IG++HA++K I+T+ A GN GP   TI N +PW ++VAAT+IDR F + 
Sbjct  182   PEDNYFRDSISIGAFHALRKGILTSTAVGNNGPGPKTIANFAPWCLSVAATTIDREFVTK  241

Query  1074  VKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSISEKLVRGK  1247
             V+LGN ++  G   NTF+L GK YPLI    A ++ A Y  + S  C+  ++   LV+GK
Sbjct  242   VQLGNQKIYEGIVTNTFDLKGKFYPLIYAGDAPNRTAGYDESTSKTCEPGTLDHNLVKGK  301

Query  1248  IVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKYINTTKA  1424
             IV C    +  Y   +   VGVI   + + D + P  +PA+ + ++ G  I  YIN+T+ 
Sbjct  302   IVLC--DGTTGYGAYFAGAVGVILQSRPVADVLDPLPMPASCLGLDSGNSIYYYINSTRN  359

Query  1425  PTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQV  1601
             PTA IF+S   + T +P+VPSFS+RGP                                 
Sbjct  360   PTATIFKSTEDIDTLSPYVPSFSSRGPNP-------------------------------  388

Query  1602  DDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAYL  1781
                 V ++ +     + T H      + K   PD +P                    A  
Sbjct  389   ----VTQFRLRDINGLPTCH------WAKPLSPDLNPE-------------------AEF  419

Query  1782  ASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGA  1958
             A GAG I P +A  PGL++D  + +Y+ +LC + ++   L S+TG K +          +
Sbjct  420   AYGAGQIDPVRAPYPGLVYDATELDYIEFLCAQGYSTKLLQSITGHKSSCSSKTNYGALS  479

Query  1959  DGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSVVPNILSF  2135
             D LNYPS  L  +NPN  + S  F RT T VG+  + +KAK I A  GL + V P+ILSF
Sbjct  480   DNLNYPSFALSSSNPN--SISGVFNRTATNVGSPRSTYKAKMIGATKGLEIKVNPSILSF  537

Query  2136  PQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKD  2234
                 QK S++V V G      S  +S SLVW D
Sbjct  538   SSLGQKLSFQVTVKGSIHHKSS--VSASLVWDD  568


 Score =   152 bits (385),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 115/183 (63%), Gaps = 6/183 (3%)
 Frame = +3

Query  1524  LKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPD  1703
              +PD+AAPG SILAA+  +A ++    D RV  YN  SGTSMA PHA G AAYVK+FHP+
Sbjct  571   FQPDIAAPGASILAAFPPIAPVSFVQGDDRVASYNFVSGTSMACPHATGVAAYVKSFHPN  630

Query  1704  WSPAAIKSALMTTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCK  1877
             WSPAAI+SA++TTAK +   + P  A  A GAG I P +A  PGL++D  K +Y+ +LC 
Sbjct  631   WSPAAIQSAIITTAKPLSPDLNP-EAEFAYGAGQIDPVRAPYPGLVYDATKLDYIEFLCA  689

Query  1878  E-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVG  2054
             + ++   L S+TG K +          +D LNYPS  L  +NPN  + S  F RT T VG
Sbjct  690   QGYSTKLLQSITGHKSSCSSKTNYGALSDNLNYPSFALSSSNPN--SISGVFNRTATNVG  747

Query  2055  TGS  2063
             + S
Sbjct  748   SPS  750



>gb|KCW78235.1| hypothetical protein EUGRSUZ_D02423 [Eucalyptus grandis]
Length=725

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/712 (47%), Positives = 469/712 (66%), Gaps = 15/712 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIVY+G+  ++  ++A   H  +L+   G +  A+E  ++SY +SF+ F A+L   EA  
Sbjct  5     YIVYLGDSHENEDLAA-QSHLQLLSSLKGSDNEAKESLVYSYTKSFNAFAAKLSQYEAEE  63

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             LS  ++VVSVF N   +L TT+SWDF+G    A RNPK ESD++V L DTG+  +S SF 
Sbjct  64    LSSLEEVVSVFPNRYHELHTTKSWDFIGFPQTARRNPKTESDIVVALFDTGITPQSESFA  123

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIAS  695
             D G+GPPP KWKG C    NF+GCN K+IGA+YF ++G   P D  SP D  GHG+H +S
Sbjct  124   DKGFGPPPPKWKGSCGHYANFSGCNNKLIGAKYFKLDGTRNPSDILSPVDVQGHGTHTSS  183

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVDV  872
               AG +V  A+L+G+A G ARG VP AR+A YKVCW G+GC DMD+LA FDAAI DGVDV
Sbjct  184   TLAGNLVPNANLFGLAGGAARGAVPWARVAMYKVCWVGEGCSDMDLLAAFDAAIHDGVDV  243

Query  873   ISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ISIS+GG   ++ +D IAIG++HAM++ I+T  +AGN+GP   ++ N +PWL+TVAA+ I
Sbjct  244   ISISIGGTMPNYTEDSIAIGAFHAMRRGILTVTSAGNDGPSLASVANHAPWLVTVAASGI  303

Query  1053  DRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSISE  1229
             DR+F S V+LG+G  + G  +N F+   K+YPL+SG  A   ++ +  +Y  C   S+  
Sbjct  304   DRQFRSKVQLGDGRTLWGVGVNMFDPKEKLYPLVSGADAGANSSKWSASY--CMDNSLDR  361

Query  1230  KLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
               V+GK+VYC  S    D  +K   G+G +I S +  DT    M P+T+V+   G+ IDK
Sbjct  362   VKVKGKLVYCKFSMPGGDSVVKGSGGIGAIIESLQFLDTARIFMAPSTMVNGTLGEAIDK  421

Query  1404  YINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
             YI++T++P+A I R+  VK  APF+ SFS+RGP   S +ILKPD+AAPG++ILA++T + 
Sbjct  422   YIHSTRSPSAVIHRTEEVKIPAPFIASFSSRGPNPGSQHILKPDIAAPGINILASFTPMR  481

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM--K  1757
             ++TG   DT+  K+N+ SGTSMA PH AG AAYVK+FHP W+PAAIKSA+MTTAK M  +
Sbjct  482   SLTGLKGDTQYSKFNLMSGTSMACPHVAGIAAYVKSFHPSWTPAAIKSAIMTTAKPMSRR  541

Query  1758  IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG-SKDNKC  1931
               P G + A GAG + PT+A+ PGL++D+ +  Y+ +LC E +  +SL  L G  +   C
Sbjct  542   TNPDGEF-AYGAGQLNPTRALNPGLVYDVGEMSYIQFLCSEGYPGSSLRVLLGPDRPVNC  600

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
              ++    G D LNYP+M L L N    T    F RTVT VG   +V+ A ++AP G+ ++
Sbjct  601   SSLVPGVGYDSLNYPTMQLTLRNARERTV-GVFVRTVTNVGPARSVYNATVRAPKGVKIA  659

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             V P  LSF +  QKRS+KV+V  +     +  +SGSL WK     VRSPI++
Sbjct  660   VKPMSLSFTRAMQKRSFKVIVEAE-PTLENQVVSGSLAWKGLHRVVRSPIVI  710



>ref|XP_004149951.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=866

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/715 (47%), Positives = 462/715 (65%), Gaps = 16/715 (2%)
 Frame = +3

Query  144   TQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             ++++ Y+VYMG+      ++A   H ++L + L   + ++   ++SY RSFSGF ARL  
Sbjct  35    SRKQVYVVYMGKPSGGGFLAASQLHTSMLQQVLTSSDASKSL-VYSYHRSFSGFAARLND  93

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVE  503
              EAR+L+E D+VVSVF + + +L TTRSWDF+G   +A+R    ESDLI+G+LDTG+W E
Sbjct  94    DEARKLAEMDEVVSVFPSEKHQLHTTRSWDFMGFFQQASRT-TLESDLIIGMLDTGIWPE  152

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP--EDQESPADFDGH  677
             S SF D+G+GPPP+KWKG+C+  LNFT CN K+IGA++F  +  +P   D  SP D  GH
Sbjct  153   SQSFSDEGFGPPPSKWKGECKPSLNFT-CNNKIIGARFFRSQPPSPGGADILSPRDTIGH  211

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H +S A G  V  A+L+G+A GT+RGGVPSARIA YK+CW  GC   D+LA FD AIA
Sbjct  212   GTHTSSTAGGNFVSDANLFGLAAGTSRGGVPSARIAVYKICWPDGCFGADILAAFDHAIA  271

Query  858   DGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             DGVD+ISISVG   PR++F D IAIG++HAMK  I+T+ + GN GP  G+I NVSPW ++
Sbjct  272   DGVDIISISVGSIFPRNYFNDSIAIGAFHAMKNGILTSNSGGNSGPSIGSISNVSPWSLS  331

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYS-AC  1208
             VAA++IDR+F + V LGNGE   G S+NTF+ G K++PLI    A +  A + G+ S  C
Sbjct  332   VAASTIDRKFVTKVTLGNGESFHGISLNTFDAGDKLFPLIHAGEAPNTTAGFNGSISRLC  391

Query  1209  DYLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIED  1385
                S+    V+GKIV C L S  +   I    G  ++    LP+      +P ++++   
Sbjct  392   FPGSLDMNKVQGKIVLCDLISDGEAALISGAVGT-IMQGSTLPEVAFLFPLPVSLINFNA  450

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             GK I +Y+ +   P A I +S  ++  +AP V SFS+RGP  I+L+ILKPDLAA G+ IL
Sbjct  451   GKNIFQYLRSNSNPEAAIEKSTTIEDLSAPAVVSFSSRGPNLITLDILKPDLAASGVDIL  510

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             A+++   ++TG V D R+  +N+ SGTSMA PHA GAAAYVK+FHP WSPAAIKSALMT+
Sbjct  511   ASWSEGTSITGLVGDKRIAPFNIISGTSMACPHATGAAAYVKSFHPTWSPAAIKSALMTS  570

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             A  M  K    A L  GAG + P+ A+ PGL++D  + +Y+ +LC + ++   L  ++G 
Sbjct  571   AFPMSPKLNTDAELGYGAGHLNPSNAINPGLVYDAEELDYIKFLCGQGYSTKDLRLVSGD  630

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
               N C ++     +D LNYPS  L + + +    S  ++RTVT VG   + +KA IKAP 
Sbjct  631   HSN-CSDVTKTAASD-LNYPSFGLVINSTSQRLISRVYHRTVTNVGLPVSTYKAVIKAPP  688

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             GL V+V P  LSF    QK S+ V V  K    +   +SGSL W D  H VRSPI
Sbjct  689   GLKVTVRPATLSFRSLGQKISFTVTVRAK-ANVVGKVVSGSLTWDDGVHLVRSPI  742



>ref|XP_007145475.1| hypothetical protein PHAVU_007G242100g [Phaseolus vulgaris]
 gb|ESW17469.1| hypothetical protein PHAVU_007G242100g [Phaseolus vulgaris]
Length=733

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/720 (46%), Positives = 460/720 (64%), Gaps = 29/720 (4%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG+      + + +  H  + + +   +   +  +HSY++SF+GFVA+L    
Sbjct  28    RKSYIVYMGDC--HKGVESTESLHISMVQNILGSKFPADTLLHSYKKSFNGFVAKLTEEA  85

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A R++  D VVSVF N + +L TTRSWDF+G+S    R    ESD+I+G++D+G+W ES 
Sbjct  86    AVRMAGLDGVVSVFPNKKNELHTTRSWDFIGLSQSVERT-STESDIIIGVIDSGIWPESD  144

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNV-EGFAPEDQESPADFDGHGSH  686
             SF D G+GPPP KWKG C    NFT CN K+IGA+YFN+ + +  +D  SP D DGHG+H
Sbjct  145   SFNDQGFGPPPKKWKGSCH---NFT-CNNKIIGAKYFNMRDSYEKDDFISPRDADGHGTH  200

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG  V+  S +G+A GTARGGVPSARIA YK CW  GC+D D+L  +D AI DGV
Sbjct  201   CASTAAGNSVKSTSFFGLASGTARGGVPSARIAVYKPCWSSGCEDADILQAYDEAIEDGV  260

Query  867   DVISISVGGHP---RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             D+ISIS+G       S+F D  AIGS+HAMKK I+T+ +AGN+GP   TI   +PW ++V
Sbjct  261   DIISISLGPSEVVHNSYFNDTFAIGSFHAMKKGILTSTSAGNKGPELYTISKNAPWSLSV  320

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACD  1211
             AA++IDR+F + V+LG+G +  G S+NTF+L  + YP I G  A + +  Y  + S  C 
Sbjct  321   AASTIDRKFFTSVQLGDGTVYQGVSVNTFDLKNESYPFIYGRNAPNISGGYNSSISRLCL  380

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGV-GVIASDKLP-DTVLPTMIPATIVDIED  1385
               S+ E LV+GKIV C        ++  + G  G++    +P D      +PA ++ + D
Sbjct  381   ENSLDENLVKGKIVLC-DGFQGPSSLGLVSGAAGILLRSSVPKDVAFIYALPAVVIGLVD  439

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G  I  YIN +  PTA IF+S  +K + AP++ SFS+RGP  I+ NILKPDLAAPG++IL
Sbjct  440   GAIIQSYINLSSNPTATIFKSNELKDSLAPYIVSFSSRGPNAITPNILKPDLAAPGVNIL  499

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++ ++ ++    DTR+  YN+ SGTSMA PHA  AA YVK+FHPDWSPAAIKSALMTT
Sbjct  500   AAWSPVSPVSDVKGDTRIADYNILSGTSMACPHATAAAVYVKSFHPDWSPAAIKSALMTT  559

Query  1743  AKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG  1913
             A  M   + P  A  A GAG I P KA+ PGL++D N+S+Y+++LC + ++   L ++T 
Sbjct  560   ATPMSALLNP-EAEFAYGAGQINPMKALNPGLVYDANESDYVNFLCGQGYDTKKLRTIT-  617

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
               D+     P       LN PS  L ++   +T FS  F+RTVT VGT ++ +KA+I AP
Sbjct  618   -NDHSSCTQPKNGMVWDLNLPSFALSMS--TSTPFSHTFHRTVTNVGTNTSTYKARITAP  674

Query  2094  TG-LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
                L   V P+++SF    QK+S+ +V+ G     I   +S SL+W D T  VRSPI+V+
Sbjct  675   PSLLKFKVEPDVISFSSVGQKKSFTLVIEGTLNAEI---VSSSLIWDDGTFQVRSPIVVF  731



>ref|XP_007219696.1| hypothetical protein PRUPE_ppa023961mg [Prunus persica]
 gb|EMJ20895.1| hypothetical protein PRUPE_ppa023961mg [Prunus persica]
Length=707

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/712 (47%), Positives = 456/712 (64%), Gaps = 21/712 (3%)
 Frame = +3

Query  171   MGELP--DDPTISAVDEHHNILTEALGDEELARE-YRIHSYRRSFSGFVARLLPREARRL  341
             MG+ P  D PT + +  H N+L   +G   + +E + +HSY+RSF+GF A+L   EA+++
Sbjct  1     MGDKPKLDIPTTTTLPLHVNMLQNVVGSSNIEQEPHLLHSYKRSFNGFAAKLTEEEAQKM  60

Query  342   SEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKD  521
             +    VVSVF + + KL TTRSW+F+G      R+   ESD+IVG++D+GVW ES SF D
Sbjct  61    AGMAGVVSVFPSRKQKLHTTRSWNFIGFHENVKRS-TVESDIIVGMIDSGVWPESASFSD  119

Query  522   DGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYF-NVEGFAPEDQESPADFDGHGSHIASI  698
              G+GPPP KWKG CQ   NFT CN+K+IGA+Y+ N   F   D +SP D +GHG+H AS 
Sbjct  120   AGFGPPPKKWKGTCQGSSNFT-CNKKIIGARYYHNGRPFVKGDIKSPRDSNGHGTHTAST  178

Query  699   AAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVIS  878
             AAG +V  ASL+G+  G ARGGVPSARIA YKV W  G  D D+LA FD AIADGVD++S
Sbjct  179   AAGNLVSKASLFGLGSGRARGGVPSARIAVYKVGWSDGISDDDILAAFDDAIADGVDILS  238

Query  879   ISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDR  1058
             +S+G     +F+D I+IG++HA++K I+T+ AAGN+GP   TI N +PW ++VAAT+IDR
Sbjct  239   LSLGKAEDDYFRDSISIGAFHALRKGILTSTAAGNDGPGPKTIANFAPWFLSVAATTIDR  298

Query  1059  RFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSISEK  1232
              F + V+LGN ++  G   NTF+L GK YPLI    A ++ A Y  + S  C+  ++   
Sbjct  299   EFVTKVQLGNQKIYEGIVTNTFDLKGKFYPLIYAGDAPNRTAGYDESTSKTCEPGTLDHN  358

Query  1233  LVRGKIVYCLSSASQDYTIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKYI  1409
             LV+GKIV C    +  Y   +   VGVI   + + D + P  +PA+ + ++ G  I  YI
Sbjct  359   LVKGKIVLC--DGTTGYGAYFAGAVGVILQSRPVADVLDPLPMPASCLGLDSGNSIYYYI  416

Query  1410  NTTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALAT  1586
              +T+ PTA IF+S   + T +P+VPSFS+RGP  ++ NILKPD+AAPG SILAA+  +A 
Sbjct  417   TSTRNPTATIFKSTEDIDTLSPYVPSFSSRGPNPVTPNILKPDIAAPGASILAAFPPIAP  476

Query  1587  MTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK--I  1760
             ++    D RV  YN  SGTSMA PHA G AAYVK+FHP+WSPAAI+SA++TTAK +   +
Sbjct  477   VSFVQGDDRVASYNFVSGTSMACPHATGVAAYVKSFHPNWSPAAIQSAIITTAKPLSPDL  536

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
              P  A  A GAG I P +A  PGL++D  + +Y+ +LC + ++   L S+TG K +    
Sbjct  537   NP-EAEFAYGAGQIDPVRAPYPGLVYDATELDYIEFLCAQGYSTKLLQSITGHKSSCSSK  595

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSV  2114
                   +D LNYPS  L  +NPN    S  F RT T VG+  + +KAK I A  GL + V
Sbjct  596   TNYGALSDNLNYPSFALSSSNPNC--ISGVFNRTATNVGSPRSAYKAKVIGATKGLEIKV  653

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              P+ILSF    QK S++V V G         +S SLVW D T  VRSPI+VY
Sbjct  654   NPSILSFSSLGQKLSFQVTVKGSIHHKSR--VSASLVWDDGTFQVRSPIVVY  703



>ref|XP_002275807.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=766

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/721 (48%), Positives = 459/721 (64%), Gaps = 23/721 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELP--DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             ++K ++VYMG  P  D+P       HH++L   LG    A+E  ++SY RSF+GF ARL 
Sbjct  27    EKKIHVVYMGGRPLGDEPLRPI---HHSMLETVLGSTSSAKESLVYSYGRSFNGFAARLS  83

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               E  RLSE + VVSV  N  +KL TTRSWDF+G S K       E ++IV LLDTG+W 
Sbjct  84    DEEVGRLSEMEGVVSVTPNHILKLHTTRSWDFMGFS-KGTVGGSEEGEIIVALLDTGIWP  142

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADFDGH  677
             ES SF D+G+G PP+KW G CQ G NFT CN K+IGA+Y+N EG+    D +SP D  GH
Sbjct  143   ESESFNDEGFGSPPSKWNGTCQ-GANFT-CNNKIIGARYYNSEGYYDISDFKSPRDSLGH  200

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H AS AAGR V+GAS +G+A+GTARG VP+ARIA YKVCW  GC   D+ A FD AIA
Sbjct  201   GTHTASTAAGREVDGASYFGLAKGTARGAVPNARIAVYKVCWYYGCAVADIFAAFDDAIA  260

Query  858   DGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
             DGVD+IS+S+G   P  + QDPIAIGS+HAMK  I+T+++AGN GP+  T+ N +PW++T
Sbjct  261   DGVDIISVSLGADFPLEYLQDPIAIGSFHAMKYGILTSSSAGNSGPFPVTVSNYAPWILT  320

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-C  1208
             VAA+SIDR+F + V L NG++ +G S+N+FEL G  +PLI G  A + +A Y  ++S  C
Sbjct  321   VAASSIDRKFVAQVVLSNGQVYTGLSVNSFELNGTTFPLIWGGDAANVSAGYSSDFSRYC  380

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDG  1388
                ++    ++GKIV C  +     T+    GVG I +D + D      +PAT + +EDG
Sbjct  381   LPDTLDSYKIKGKIVLC-DTLWDGSTVLLADGVGTIMADLITDYAFNYPLPATQISVEDG  439

Query  1389  KKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
               I  YI T K P A I  S       AP V SFS+RGP  I+ +ILKPD+ APG+ ILA
Sbjct  440   LAILDYIRTAKNPLATILFSETWNDVMAPNVVSFSSRGPNPITPDILKPDITAPGVDILA  499

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             A++ +A  +    DTR V YN+ SGTSM+ PHA+GAAAYVK  HP+WSPAAIKSALMTTA
Sbjct  500   AWSPVAPPSIYYLDTRSVDYNIISGTSMSCPHASGAAAYVKAAHPNWSPAAIKSALMTTA  559

Query  1746  KAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKD  1922
               M   K      A G+G I P  A  PGL++D ++++Y+S+LCK+  N S   L    D
Sbjct  560   HVMDPRKHEDLEFAYGSGHINPLNATDPGLVYDASEADYISFLCKQGYNTSTLRLVTGDD  619

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
             + C +    +  D LNYPS  L + + N       F RTVT VG+ ++ + A +  PT L
Sbjct  620   SVCNSTEPGRAWD-LNYPSFSLAVEDGNQIM--GVFTRTVTNVGSPNSTYTAGMYVPTTL  676

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             +V+V P+++SF    +K+S+ V V G    Q+ I   MSG++ W D  H VRSP++VY  
Sbjct  677   SVTVEPSVISFSAIGEKKSFTVKVYGPKISQQPI---MSGAIWWTDGVHEVRSPLVVYTV  733

Query  2277  L  2279
             L
Sbjct  734   L  734



>ref|XP_010053873.1| PREDICTED: xylem serine proteinase 1 [Eucalyptus grandis]
Length=757

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/718 (47%), Positives = 472/718 (66%), Gaps = 15/718 (2%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             +  ++ YIVY+G+  ++  ++A   H  +L+   G +  A+E  ++SY +SF+ F A+L 
Sbjct  31    NKNKEFYIVYLGDSHENEDLAA-QSHLQLLSSLKGSDNEAKESLVYSYTKSFNAFAAKLS  89

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA  LS  ++VVSVF N   +L TT+SWDF+G    A RNPK ESD++V L DTG+  
Sbjct  90    QYEAEELSSLEEVVSVFPNRYHELHTTKSWDFIGFPQTARRNPKTESDIVVALFDTGITP  149

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGH  677
             +S SF D G+GPPP KWKG C    NF+GCN K+IGA+YF ++G   P D  SP D  GH
Sbjct  150   QSESFADKGFGPPPPKWKGSCGHYANFSGCNNKLIGAKYFKLDGTRNPSDILSPVDVQGH  209

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAI  854
             G+H +S  AG +V  A+L+G+A G ARG VP AR+A YKVCW G+GC DMD+LA FDAAI
Sbjct  210   GTHTSSTLAGNLVPNANLFGLAGGAARGAVPWARVAMYKVCWVGEGCSDMDLLAAFDAAI  269

Query  855   ADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMT  1034
              DGVDVISIS+GG   ++ +D IAIG++HAM++ I+T  +AGN+GP   ++ N +PWL+T
Sbjct  270   HDGVDVISISIGGTMPNYTEDSIAIGAFHAMRRGILTVTSAGNDGPSLASVANHAPWLVT  329

Query  1035  VAATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACD  1211
             VAA+ IDR+F S V+LG+G  + G  +N F+   K+YPL+SG  A   ++ +  +Y  C 
Sbjct  330   VAASGIDRQFRSKVQLGDGRTLWGVGVNMFDPKEKLYPLVSGADAGANSSKWSASY--CM  387

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIED  1385
               S+    V+GK+VYC  S    D  +K   G+G +I S +  DT    M P+T+V+   
Sbjct  388   DNSLDRVKVKGKLVYCKFSMPGGDSVVKGSGGIGAIIESLQFLDTARIFMAPSTMVNGTL  447

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G+ IDKYI++T++P+A I R+  VK  APF+ SFS+RGP   S +ILKPD+AAPG++ILA
Sbjct  448   GEAIDKYIHSTRSPSAVIHRTEEVKIPAPFIASFSSRGPNPGSQHILKPDIAAPGINILA  507

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             ++T + ++TG   DT+  K+N+ SGTSMA PH AG AAYVK+FHP W+PAAIKSA+MTTA
Sbjct  508   SFTPMRSLTGLKGDTQYSKFNLMSGTSMACPHVAGIAAYVKSFHPSWTPAAIKSAIMTTA  567

Query  1746  KAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTG-  1913
             K M  +  P G + A GAG + PT+A+ PGL++D+ +  Y+ +LC E +  +SL  L G 
Sbjct  568   KPMSRRTNPDGEF-AYGAGQLNPTRALNPGLVYDVGEMSYIQFLCSEGYPGSSLRVLLGP  626

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
              +   C ++    G D LNYP+M L L N    T    F RTVT VG   +V+ A ++AP
Sbjct  627   DRPVNCSSLVPGVGYDSLNYPTMQLTLRNARERTV-GVFVRTVTNVGPARSVYNATVRAP  685

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
              G+ ++V P  LSF +  QKRS+KV+V  +     +  +SGSL WK     VRSPI++
Sbjct  686   KGVKIAVKPMSLSFTRAMQKRSFKVIVEAE-PTLENQVVSGSLAWKGLHRVVRSPIVI  742



>ref|XP_010919430.1| PREDICTED: cucumisin-like [Elaeis guineensis]
Length=710

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/681 (50%), Positives = 441/681 (65%), Gaps = 16/681 (2%)
 Frame = +3

Query  258   AREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKA  437
             A+E  ++SY RSF+GF ARL  +EA ++ E D VVSV  NT +KL TT+SWDF+G++   
Sbjct  8     AKESLVYSYGRSFNGFAARLTDKEAAKIQEMDGVVSVLPNTILKLHTTKSWDFMGVTIGG  67

Query  438   NRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQY  617
                   E+++IVGLLDTG+W ES SF D G GPPPAKWKG C  G NFT CN K+IGA+Y
Sbjct  68    TLRLPTEANVIVGLLDTGIWPESASFSDQGMGPPPAKWKGICH-GANFT-CNNKIIGARY  125

Query  618   FNVEGF-APEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYK  794
             +N EGF  P D +SP D +GHG+H +S AAG +V  AS +G+A G ARGGVP ARIA YK
Sbjct  126   YNSEGFYDPTDFKSPRDSEGHGTHTSSTAAGALVPNASYFGLANGIARGGVPKARIAMYK  185

Query  795   VCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAA  974
             VCW  GC   D+LA FD AIADGVDVIS+S+GG P  FF D IAIGS+HAMKK IVT  +
Sbjct  186   VCWAFGCGTADILAAFDDAIADGVDVISVSLGGPPFPFFDDVIAIGSFHAMKKGIVTANS  245

Query  975   AGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLIS  1154
             AGN GPY GT+ NV+PW +TVAA++I+R+F + V LGNG++  G SIN F L   YPLI 
Sbjct  246   AGNSGPYPGTVSNVAPWTITVAASTINRKFIAKVALGNGQIFIGNSINPFPLMGTYPLIY  305

Query  1155  GTLAQDKNATYPGNYSACDYLSISEKL-VRGKIVYCLSSASQDYTIKWIHGVGVIASD-K  1328
             G  A + +A   G+ S   Y  +       GKIV C  +      +   +GVGVI SD +
Sbjct  306   GGSAPNISAGESGDISRYCYPGVLNSYKTEGKIVLC-DAIWDGSGVLMANGVGVIMSDSE  364

Query  1329  LPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQ  1505
               D      +PAT++ +EDGK+I +YI +T  P A I     ++   AP V SFS+RGP 
Sbjct  365   YSDFAFSYPLPATLISVEDGKQILEYIQSTSDPFATILMGETIEDVMAPTVVSFSSRGPN  424

Query  1506  TISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYV  1685
              +  +ILKPDL APG+ ILA+++ +A  +   DD   V YNV SGTSM+ PH +GAAAY+
Sbjct  425   YVVPDILKPDLTAPGVDILASWSPVAPPSIYYDDPLRVNYNVISGTSMSCPHVSGAAAYI  484

Query  1686  KTFHPDWSPAAIKSALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYM  1862
             K+ HP+WSPAAIKSALMTTA  M   K   A  A GAG I P KA+ PGLIFD ++ +Y+
Sbjct  485   KSVHPNWSPAAIKSALMTTAMVMDPRKNTDAEFAYGAGHIDPIKALNPGLIFDASEKDYV  544

Query  1863  SYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRT  2039
              +LCK+ +N  +L  +TG K + C        A  LNYPS  L +   +       F RT
Sbjct  545   DFLCKQGYNTTTLRLVTGDK-STCPKPTTIGKAWNLNYPSFALSVI--DGQRIWGVFPRT  601

Query  2040  VTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAIS-WYMSG  2216
             VT VGT S+ + A   +   LTV++ P++LSF    + +S+ V VSG    AIS  ++SG
Sbjct  602   VTNVGTPSSTYYASWSSSYPLTVTITPSVLSFSSRGETKSFTVTVSG---GAISQQFISG  658

Query  2217  SLVWKDNTHSVRSPILVYRSL  2279
              +VWKD TH+VR P++V+  L
Sbjct  659   YIVWKDETHTVRMPLVVFTML  679



>ref|XP_006486543.1| PREDICTED: cucumisin-like [Citrus sinensis]
Length=709

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/715 (47%), Positives = 461/715 (64%), Gaps = 23/715 (3%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             + YIVYMG+ P     SA   H ++L + LG    A ++ +HSY RSF+GFVA+L   EA
Sbjct  2     QEYIVYMGDRPTG-KFSATSFHTSMLHQVLGRS--ASDHLLHSYHRSFNGFVAKLTHDEA  58

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
             +RL     V+SVF N + +L TTRSWDF+G S    R    ESD+IVG+LDTG+W ES S
Sbjct  59    QRLKGMQGVMSVFPNGKKQLHTTRSWDFMGFSEHVKR-ATTESDIIVGMLDTGIWPESQS  117

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDGHGSHI  689
             F D+ +GPPP KWKG CQ   NFT CN K+IGA+++  +  F+P D +SP D +GHG+H 
Sbjct  118   FSDENFGPPPKKWKGSCQTSSNFT-CNNKIIGAKFYRSDKKFSPFDFKSPRDSEGHGTHT  176

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             +S AAG +V  ASL+GI  GTA GGVPSARIA YK+CW  GC D D+LA FD AIADGVD
Sbjct  177   SSTAAGGLVSKASLFGIGFGTAIGGVPSARIAVYKICWFDGCADADILAAFDDAIADGVD  236

Query  870   VISISVGGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +ISISVG     ++F+D IAIGS+HAMKK I+T+ +AGN GP   ++ NV+PW ++VAA+
Sbjct  237   IISISVGSFSAVNYFEDTIAIGSFHAMKKGILTSNSAGNSGPDAASLANVAPWTLSVAAS  296

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG-NYSACDYLS  1220
             ++DR+F + VKLGNGE+  G SINT +  GKM+PLI G  A ++   Y G N   C   S
Sbjct  297   TVDRKFVTRVKLGNGEVYEGISINTIDYKGKMFPLIYGGDAPNRTGGYQGSNSRFCSLGS  356

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKI  1397
             + EKLV+GKIV C    +  +       VG V+  +   D      +P + +D+ DG KI
Sbjct  357   LDEKLVQGKIVLC-DELNDGFGAATARAVGSVMQGNDDRDVAYSFPLPNSYLDLYDGIKI  415

Query  1398  DKYINTTKAPTAEIFRSRA-VKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
               Y+N+T  PTA I +S A     AP V SFS+RGP  I+ +ILKPDL APG+ ILA++T
Sbjct  416   ASYLNSTSIPTATILKSTAETNEFAPVVVSFSSRGPNPITNDILKPDLTAPGVDILASWT  475

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
               ++ +    D R+  +N+ SGTSM+ PHA  AAAYVK+F+P WSPAAIKSALMTTA  M
Sbjct  476   QASSPS--EGDPRISPFNIISGTSMSCPHATAAAAYVKSFYPSWSPAAIKSALMTTATPM  533

Query  1755  KIKPIG-AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
              ++    A  A G+G + P+ AV PGL++D  + +Y+ +LC + +++ +L  +TG  DN+
Sbjct  534   SVEANSDAEFAYGSGHLNPSMAVNPGLVYDAGELDYVKFLCGQGYSDKNLSLVTG--DNR  591

Query  1929  -CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C N   A   D LNYPS  L     N TT    F+RTVT VG+  + ++A +    GL 
Sbjct  592   SCSNSTNATVWD-LNYPSFALSTKPGNNTT--QVFHRTVTNVGSAVSTYRAVVYTRPGLM  648

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             + V P++L F    QK+S+ V V+    K+++  +S SLVW D  H VRSP++ +
Sbjct  649   IKVQPSVLYFKSLYQKQSFVVTVTANVGKSVN-MISASLVWDDGVHHVRSPVVAF  702



>ref|XP_010658507.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=762

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/725 (48%), Positives = 473/725 (65%), Gaps = 26/725 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D  RK YIVYMG  P     SA   H N+L +  G +  A    + SY+RSF+GFVA+L
Sbjct  47    EDDVRKEYIVYMGAKPAG-DFSASVIHTNMLEQVFGSDR-ASSSLVRSYKRSFNGFVAKL  104

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVSVF + + +L TTRSWDF+G   +  R    ESD+I+G+LD G+W
Sbjct  105   TEDEMQQMKGMDGVVSVFPSEKKQLHTTRSWDFVGFPRQVKRT-SVESDIIIGVLDGGIW  163

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDG  674
              ES SF D G+GPPP KWKG CQ   NFT CN K+IGA+Y+  +  F+PED +SP D DG
Sbjct  164   PESDSFDDKGFGPPPRKWKGTCQGFSNFT-CNNKIIGAKYYKSDRKFSPEDLQSPRDSDG  222

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC D D+LA FD AI
Sbjct  223   HGTHTASTAAGGLVNMASLMGFGLGTARGGVPSARIAVYKICWSDGCDDADILAAFDDAI  282

Query  855   ADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS S+G  P + +F+D  AIG++HAMK  I+T+ +AGN+GP   ++ +VSPW +
Sbjct  283   ADGVDIISYSLGNPPSQDYFKDTAAIGAFHAMKNGILTSTSAGNDGPRLVSVVSVSPWSL  342

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++IDR+F ++V+LG+ ++  GFSIN FE   MYPLI G  A +    + GN S  C
Sbjct  343   SVAASTIDRKFLTEVQLGDRKVYKGFSINAFEPNGMYPLIYGGDAPNTRGGFRGNTSRFC  402

Query  1209  DYLSISEKLVRGKIVYC--LSSASQDYTIKWIHG-VGVIASDKL---PDTVLPTMIPATI  1370
             +  S++  LV+GKIV C  L +  ++ +  ++ G VG +  D L    D+     +PA+ 
Sbjct  403   EKNSLNPNLVKGKIVLCIGLGAGLEETSNAFLAGAVGTVIVDGLRFPKDSSYIYPLPASR  462

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAP  1547
             +   DGK+I  YI++T  PTA I +S  VK T AP+VPSFS+RGP  I+ ++LKPDL AP
Sbjct  463   LGAGDGKRIAYYISSTSNPTASILKSIEVKDTLAPYVPSFSSRGPNNITHDLLKPDLTAP  522

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILAA++ ++ ++    D RV +YN+ SGTSMA PHA GAAAY+K+FHP WSPAAIKS
Sbjct  523   GVHILAAWSPISPISQMSGDNRVAQYNILSGTSMACPHATGAAAYIKSFHPTWSPAAIKS  582

Query  1728  ALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ALMTTA  M   K   A  A GAG I P +AV PGL++D ++ +++++LC E ++  +L 
Sbjct  583   ALMTTATPMSARKNPEAEFAYGAGNIDPVRAVHPGLVYDADEIDFVNFLCGEGYSFQTLR  642

Query  1902  SLTGSKDNKCKNIPAAQGAD-GLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKA  2078
              +TG      K   A  GA   LNYPS    L+  N  + +  F+R+VT VG+  + +KA
Sbjct  643   KVTGDHSACSK---ATNGAVWDLNYPS--FALSTSNKESIARTFHRSVTNVGSPMSTYKA  697

Query  2079  -KIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRS  2255
               I AP GL ++V PNILSF    QK S+ + V+G+  + I   +S SLVW D  H VRS
Sbjct  698   IVIGAPKGLKINVKPNILSFTSIGQKLSFVLKVNGRMVEDI---VSASLVWDDGLHKVRS  754

Query  2256  PILVY  2270
             PI+VY
Sbjct  755   PIIVY  759



>ref|XP_004165286.1| PREDICTED: LOW QUALITY PROTEIN: cucumisin-like, partial [Cucumis 
sativus]
Length=718

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/719 (46%), Positives = 457/719 (64%), Gaps = 17/719 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +++ Y+VYMG+      ++A   H ++L + L   + ++   ++SY RSFSGF ARL   
Sbjct  1     RKQVYVVYMGKPSGGGFLAASQLHTSMLQQVLTSSDASKSL-VYSYHRSFSGFAARLNDD  59

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EAR+L+E D+VVSVF + + +L TTRSWDF+G   +A+R    ESDLI+G+LDTG+W ES
Sbjct  60    EARKLAEMDEVVSVFPSEKHQLHTTRSWDFMGFFQQASRT-TLESDLIIGMLDTGIWPES  118

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP--EDQESPADFDGHG  680
              SF D+G+GPPP+KWKG+C+  LNFT CN K+IGA++F  +  +P   D  SP D  GHG
Sbjct  119   KSFSDEGFGPPPSKWKGECKPSLNFT-CNNKIIGARFFRSQPPSPGGADILSPRDTIGHG  177

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H +S A G  V  A+L+G+A GT+RGGVPSARIA YK+CW  GC   D+LA FD AIAD
Sbjct  178   THTSSTAGGNFVSDANLFGLAAGTSRGGVPSARIAVYKICWPDGCFGADILAAFDHAIAD  237

Query  861   GVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             GVD+ISISVG   PR++F D IAIG++HAMK  I+T+ + GN GP  G+I NVSPW ++V
Sbjct  238   GVDIISISVGSIFPRNYFNDSIAIGAFHAMKNGILTSNSGGNSGPSIGSISNVSPWSLSV  297

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYS-ACD  1211
             AA++IDR+F + V LGNGE   G S+NTF+ G K++PLI    A +  A + G+ S  C 
Sbjct  298   AASTIDRKFVTKVTLGNGESFHGISLNTFDAGDKLFPLIHAGEAPNTTAGFNGSISRLCF  357

Query  1212  YLSISEKLVRGKIVYC-LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDG  1388
               S+    V+GKIV C L S  +   I    G  ++    LP+      +P ++++   G
Sbjct  358   PGSLDMNKVQGKIVLCDLISDGEAALISGAVGT-IMQGSTLPEVAFLFPLPVSLINFNAG  416

Query  1389  KKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             K I +Y+ +   P A I +S  ++  +AP V SFS+RGP T++L+ILKPDLAA G+ ILA
Sbjct  417   KNIFQYLRSNSNPEAIIEKSTTIEDLSAPSVISFSSRGPNTVTLDILKPDLAASGVDILA  476

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +++    +TG V D R+  +N+ SGTSMA PHA GAAAYVK+FHP WSPAAIKSALMT+A
Sbjct  477   SWSEGTPITGIVGDKRIAPFNIISGTSMACPHATGAAAYVKSFHPTWSPAAIKSALMTSA  536

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKD  1922
               M  K    A  A GAG + P+ A+ PGL++D  + +Y+ +LC +  +     L     
Sbjct  537   FPMSPKLNTDAEFAYGAGHLNPSNAINPGLVYDAEELDYVKFLCGQGYSTEKLRLVSGDQ  596

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVF---KAKIKAP  2093
             N C ++     +D LNYPS  L + +P+    +  ++RTVT VG         KA IKAP
Sbjct  597   NNCSDVTKTAASD-LNYPSFGLVIISPSQRLTTRVYHRTVTNVGLPVIKLPSHKAVIKAP  655

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              GL V+V P  LSF    QK S+ V V  K        +SGSL W D  H VRSPI+ +
Sbjct  656   PGLKVTVRPATLSFRSLGQKISFTVTVRAKADVG-GKVISGSLTWDDGVHLVRSPIVSF  713



>gb|KGN50589.1| hypothetical protein Csa_5G187870 [Cucumis sativus]
Length=747

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/725 (46%), Positives = 466/725 (64%), Gaps = 22/725 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGE---LPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFV  308
             HD  RK YIVYMG+     D     +   HH  + E       A E+ +HSY+RSF+GFV
Sbjct  28    HDA-RKVYIVYMGDKLHDTDSDDTDSAPSHHKRILEKGTSSNFAPEFLLHSYKRSFNGFV  86

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   EA+++S  ++VVS+F N +  L TTRSWDF+G++  A R  + ES+L+VG+ DT
Sbjct  87    AKLTEEEAQKISAMEEVVSLFPNEKKHLHTTRSWDFIGLTKDAPRVKQVESNLVVGVFDT  146

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQ-YFNVEGFAPEDQESPAD  665
             G+W E+PSF D GYGP PAKWKG CQ   NFT CN+K+IGA+ Y +   F PED  SP D
Sbjct  147   GIWPENPSFSDVGYGPIPAKWKGTCQTSANFT-CNKKIIGARAYRSNNDFPPEDIRSPRD  205

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
              DGHG+H AS   G +V  AS YG+A GTARGG PSA IA YK+CW  GC   D+LA FD
Sbjct  206   SDGHGTHTASTVVGGLVNEASFYGLAGGTARGGTPSACIAVYKICWSDGCYSTDILAAFD  265

Query  846   AAIADGVDVISISVGGHPRS--FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVS  1019
              AIADGVD+ISIS+G  P+S  +F DP AIG++HAMK  I+T+ +AGNEGP + ++ NV+
Sbjct  266   DAIADGVDMISISLGS-PQSSPYFLDPTAIGAFHAMKNGILTSTSAGNEGPNYFSVSNVA  324

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGN  1196
             PW ++V A++IDR+  S V+LGN  +  GF+INTF+L GK YPLI    A +    + G+
Sbjct  325   PWALSVGASTIDRKLASKVELGNRNIYQGFTINTFDLEGKQYPLIYARDAPNIAGGFTGS  384

Query  1197  YSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATI  1370
              S  C   S++  LV+GK++ C S       + +   VGVI +D +  D+     +P++ 
Sbjct  385   MSRFCSANSVNANLVKGKVLVCDSVLPPSRFVNFSDAVGVIMNDGRTKDSSGSYPLPSSY  444

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             +   DG  +  Y+++  APTA I++S A+  T+AP V SFS+RGP   + +ILKPDL AP
Sbjct  445   LTTADGNNVKTYMSSNGAPTATIYKSNAINDTSAPLVVSFSSRGPNPQTFDILKPDLTAP  504

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILAA++ +A ++  V D+R   YN+ SGTSM+ PH   AA YVKTFHP WSPAAI+S
Sbjct  505   GVQILAAWSPIAPVSSGVIDSRTTLYNIISGTSMSCPHVTAAAVYVKTFHPTWSPAAIQS  564

Query  1728  ALMTTAKAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ALMTTA  +  +  + A  A GAG I P KA+ PGL++D  +S+Y+ +LC + +  + + 
Sbjct  565   ALMTTATPLSAVLNMQAEFAYGAGQIDPVKAIDPGLVYDAGESDYVKFLCGQGYTTSMVQ  624

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
               +  K+  C +    +  D LNYPS    L++  +  F+  F RT+T VG+ ++ + + 
Sbjct  625   RFSNDKNTVCNSTNMGRVWD-LNYPS--FALSSSPSRPFNQYFTRTLTNVGSKASTYTST  681

Query  2082  IKA-PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
             ++  P GLT++V P  LSF  T QKR++ + + G    +I+   S SL+W D +H+VRSP
Sbjct  682   VRGTPQGLTITVNPTSLSFNSTGQKRNFTLTIRGTVSSSIA---SASLIWSDGSHNVRSP  738

Query  2259  ILVYR  2273
             I V++
Sbjct  739   ITVFK  743



>ref|XP_010919429.1| PREDICTED: cucumisin-like [Elaeis guineensis]
Length=731

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/710 (48%), Positives = 450/710 (63%), Gaps = 17/710 (2%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MGE P    ++    HH+IL +  G    A+E  ++SY RSF+GF ARL  +EA  + E 
Sbjct  1     MGEKPKG-GVAVKSMHHSILADVFGSTSGAKESLVYSYGRSFNGFAARLTDKEAAGIQEM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D VVSV  NT ++L TT+SWDF+G++   N     ++D+IVGLLDTG+W ES SF D G 
Sbjct  60    DGVVSVLPNTMLELHTTKSWDFMGLTIGRNLRRPTKADVIVGLLDTGIWPESDSFSDKGM  119

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAG  707
             GPPPAKWKG CQ G NFT CN K+IGA+Y+N EG +   D +SP D  GHG+H AS AAG
Sbjct  120   GPPPAKWKGICQ-GSNFT-CNNKIIGARYYNSEGLYTSTDFKSPRDSIGHGTHTASTAAG  177

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V   S +G+A GTARGGVP AR+A YKVCW  GC   D+LA FD AIADGVD++S+S+
Sbjct  178   VLVPDTSYFGLANGTARGGVPKARVAMYKVCWAFGCGTADILAAFDDAIADGVDILSVSL  237

Query  888   GGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFE  1067
             GG P  FF D IAIGS+HAMKK I+T  +AGN GP+   + NV+PW +TVAA++IDR+F 
Sbjct  238   GGPPLPFFHDVIAIGSFHAMKKGILTANSAGNSGPHPRRVTNVAPWTITVAASTIDRKFI  297

Query  1068  SDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVRG  1244
             + V LGNG++ +G SIN F L   YPLI G  A + +A   G+ S  C   +++     G
Sbjct  298   AKVALGNGQIFTGNSINPFRLAGTYPLIYGGSAPNISAGASGDISKYCFRGALNSYKTEG  357

Query  1245  KIVYCLSSASQDYTIKWIHGVGVI-ASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTK  1421
             KIV C  +      +    G+GVI +S K  D      +PAT+V +EDGK+I  YI +T 
Sbjct  358   KIVLC-GTILDGSGVLMADGLGVIMSSPKYSDFAFSYPLPATLVSVEDGKQILDYIQSTS  416

Query  1422  APTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQ  1598
              P A I     ++   AP V SFS+RGP  +  +ILKPDL APG+ ILAA++ +A  +  
Sbjct  417   NPFATILMGETIEDVMAPTVVSFSSRGPSYVVPDILKPDLTAPGVDILAAWSPVAPPSIY  476

Query  1599  VDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK-IKPIGA  1775
              DD   V YNV SGTSM+ PH +GAAAY+K+ HP WSPAAIKSALMTTA  M   K   A
Sbjct  477   HDDPLRVNYNVISGTSMSCPHVSGAAAYIKSVHPSWSPAAIKSALMTTATVMDPRKNTDA  536

Query  1776  YLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQ  1952
               A GAG I+P KA+ PGLIF+  + +Y+ +LCK+ +N  +L  +TG K    K     +
Sbjct  537   EFAYGAGHIKPIKALNPGLIFNATEKDYVDFLCKQGYNTTTLRLVTGDKSTCPKPTTIGK  596

Query  1953  GADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILS  2132
               D LNYPS  L +   +       F RTVT VG  S+ + A   +   LTV++ P++LS
Sbjct  597   AWD-LNYPSFALSVI--DGQRIWGVFPRTVTNVGKPSSTYNASWSSSYPLTVTITPSVLS  653

Query  2133  FPQTNQKRSYKVVVSGKFQKAIS-WYMSGSLVWKDNTHSVRSPILVYRSL  2279
             F    + +S+ V VSG    A+S  ++SG +VWKD  H+VR P++VY +L
Sbjct  654   FSSLGETKSFTVTVSG---AAVSQQFISGYIVWKDEMHTVRMPLVVYTTL  700



>ref|XP_003544153.2| PREDICTED: cucumisin-like [Glycine max]
Length=736

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/722 (46%), Positives = 459/722 (64%), Gaps = 28/722 (4%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              RK YIVYMG+ P     +++   H  + + +   +   E  +HSY++SF+GFV +L   
Sbjct  26    DRKTYIVYMGDHPKGMDSASLPSLHITMAQKVLGSDFEPEAILHSYKKSFNGFVIKLTEE  85

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA+R++E D VVSVF N + +L TTRSWDF+G+S +  R    E D+IVG++D+G+W ES
Sbjct  86    EAQRMAEMDNVVSVFPNRKSRLQTTRSWDFIGVSQQIQRT-SLERDIIVGVIDSGLWPES  144

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGS  683
              SF D+G+GPPP+KWKG C    NFT CN+K+IGA+YFN+EG +A ED  SP D  GHGS
Sbjct  145   KSFSDEGFGPPPSKWKGSCH---NFT-CNKKIIGAKYFNIEGDYAKEDSISPRDVQGHGS  200

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIAD  860
             H AS  AG +V+ +SL G A GTARGGVPSARIA YKVCW + GC   + LA FD AIAD
Sbjct  201   HTASTIAGNLVKSSSLLGFASGTARGGVPSARIAIYKVCWIKIGCPQAETLAAFDEAIAD  260

Query  861   GVDVISISVGGHPR---SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             GVD+ISIS G        +FQ    IGS+HAMK+ I+T+ +A N GP   +I   SPW++
Sbjct  261   GVDIISISTGLTSIVYIPYFQSAFDIGSFHAMKRGILTSKSADNSGPGLSSITTYSPWIL  320

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLI-SGTLAQDKNATYPGNYSA  1205
             +VAA++I R+F + V+LGNG +  G SINTF+L  KM+PL+ +G +    +         
Sbjct  321   SVAASTIGRKFLTKVQLGNGMVFEGVSINTFDLKNKMFPLVYAGDVPNTADGYNSSTSRF  380

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIE  1382
             C   S+ + LV+GKIV C  +AS           G ++ +  + D      +P   + + 
Sbjct  381   CYVNSVDKHLVKGKIVLCDGNASPKKVGDLSGAAGMLLGATDVKDAPFTYALPTAFISLR  440

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVK--TTAPFVPSFSARGPQTISLNILKPDLAAPGLS  1556
             + K I  Y+ + +  TA IFRS      +  PF+ SFS+RGP  ++ N LKPDLAAPG++
Sbjct  441   NFKLIHSYMVSLRNSTATIFRSDEDNDDSQTPFIVSFSSRGPNPLTPNTLKPDLAAPGVN  500

Query  1557  ILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALM  1736
             ILAA++ + T++    D R V+YN+ESGTSMA PH + AAAYVK+FHP+WSPA IKSALM
Sbjct  501   ILAAWSPVYTISEFKGDKRAVQYNIESGTSMACPHVSAAAAYVKSFHPNWSPAMIKSALM  560

Query  1737  TTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             TTA  M   + P  A  A GAGLI P KA  PGL++DI++++Y+ +LC E + +  L  L
Sbjct  561   TTATPMSPTLNP-DAEFAYGAGLINPLKAANPGLVYDISEADYVKFLCGEGYTDEMLRVL  619

Query  1908  TGSKDN-KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKI  2084
             T  KD+ +C      +    LN PS+ L +   N ++FS  F+RTVT VG  ++ +KAK+
Sbjct  620   T--KDHSRCSKHAKKEAVYDLNLPSLALYV---NVSSFSRIFHRTVTNVGLATSSYKAKV  674

Query  2085  KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPIL  2264
              +P+ + + V PN+LSF    QK+S+ V++ G     I   +S SLVW D T  VRSPI+
Sbjct  675   VSPSLIDIQVKPNVLSFTSIGQKKSFSVIIEGNVNPDI---LSASLVWDDGTFQVRSPIV  731

Query  2265  VY  2270
             VY
Sbjct  732   VY  733



>ref|XP_002524249.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38173.1| Cucumisin precursor, putative [Ricinus communis]
Length=705

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/713 (46%), Positives = 455/713 (64%), Gaps = 20/713 (3%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             + YIVYMG+ P     SA   H N+L E+LG    A ++ + SY RSF+GFVA+L   E 
Sbjct  2     QAYIVYMGDRPKG-DFSASAFHTNMLQESLGSG--ASDFLLRSYHRSFNGFVAKLTEAEK  58

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
             ++L   + VVSVF + + +L TTRSWDF+G      R+   ESD+I+G+LD+G+W ES S
Sbjct  59    QKLEGMEGVVSVFPSLKKELHTTRSWDFMGFPLNVRRSIN-ESDVIIGMLDSGIWPESES  117

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHI  689
             F D+G+GPPPAKWKG CQ   NFT CN KVIGA+Y++ EG  +P +  SP D  GHG+H 
Sbjct  118   FSDEGFGPPPAKWKGTCQGSSNFT-CNNKVIGARYYHSEGEISPGEIASPRDSGGHGTHT  176

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAG +V  ASL GI  GTARGG+PSARIA YK+CW  GC D D+LA FD AIADGVD
Sbjct  177   ASTAAGSIVHQASLLGIGSGTARGGLPSARIAVYKICWHGGCSDADILAAFDDAIADGVD  236

Query  870   VISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +IS+SVGG P  +FQD IAIG++HAMK  I+T+ +AGN GP   ++ N +PW ++VAA++
Sbjct  237   IISLSVGGWPLDYFQDAIAIGAFHAMKNGILTSNSAGNSGPSSESVANFAPWALSVAAST  296

Query  1050  IDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYS-ACDYLSI  1223
             IDR+F S VKLGNG +  G SI+TF+LG  MYP+I G  A +  A     +S  C   S+
Sbjct  297   IDRKFVSQVKLGNGAIYEGLSIHTFDLGNTMYPIIYGGDAPNLTAGSTWYFSRLCFEDSL  356

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKL-PDTVLPTMIPATIVDIEDGKKID  1400
             ++ LV GKI+ C +  + +  I     VG I  +    D      +P T++ + DG  I 
Sbjct  357   NKTLVEGKILLCDAPDTGEAAIA-AGAVGSITQNGFYKDMARAYALPLTVLSMSDGADIL  415

Query  1401  KYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
             +Y+ +T  PTA I ++   K   AP V +FS+RGP  ++ +I+KPD+ APG+ ILAA++ 
Sbjct  416   EYLKSTSEPTATILKTVEYKDELAPAVSTFSSRGPNPVTRDIIKPDITAPGVDILAAWSG  475

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
               T+TG   D R+V YN+ SGTSM+ PHA+ AAAYVK+FHP WS  AIKSALMTTA  M 
Sbjct  476   AGTVTGSKADNRIVPYNIISGTSMSCPHASAAAAYVKSFHPKWSSDAIKSALMTTAYPMN  535

Query  1758  IKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
                      A G+G I P +A  PGL++D  +++Y+ +LC + +++  +  LTG  D+ C
Sbjct  536   PDTNTDVEFAYGSGHINPVQAADPGLVYDAGETDYVKFLCGQGYSSKQIQLLTG-DDSTC  594

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
                      D LNYPS    L+     + +  F+RTVT VG+ ++ +KA I AP+GL + 
Sbjct  595   SEATNGTVWD-LNYPS--FALSTKYGKSITRIFHRTVTNVGSPTSFYKAIINAPSGLKIQ  651

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             V P++LSF    Q++ + + V     K +   +SGSL+W D  H VRSPI+ +
Sbjct  652   VQPDMLSFQSLGQQQCFVMTVEATLIKTL---ISGSLIWDDGVHQVRSPIVAH  701



>ref|XP_010662545.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=736

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/724 (47%), Positives = 455/724 (63%), Gaps = 26/724 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             ++ QRK ++VYMG+LP     S    HHN+L E LG   LA+E  +HSY RSF+GFVARL
Sbjct  26    YEQQRKAHVVYMGDLPKGDA-SVASTHHNMLVEVLGSSSLAKESLLHSYGRSFNGFVARL  84

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E  R+++ + VVSVF NT+++L TTRSWDF  MS         E D+I+G+LDTG+W
Sbjct  85    SDEEVARIADMEGVVSVFPNTKVQLHTTRSWDF--MSFPEPPMGSYEGDVIIGMLDTGIW  142

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP--EDQESPADFD  671
              ES SF+D+G+GPPPAKWKG CQ   NFT CN K+IGA++++ +  A    D +SP D  
Sbjct  143   PESVSFRDEGFGPPPAKWKGICQTENNFT-CNNKIIGARFYDTDNLADPLRDTKSPRDTL  201

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHGSH AS AAGR VE AS YGIA G ARGGVP+AR+A YKVCWG GC   D+LA FD A
Sbjct  202   GHGSHTASTAAGRAVENASYYGIASGIARGGVPNARLAVYKVCWGGGCSPADILAAFDDA  261

Query  852   IADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD++SIS+G   P ++ ++P+AIGS+HAMK  I+T+ +AGN+GPY   I N +PW 
Sbjct  262   IADGVDILSISLGSEMPAAYNKEPVAIGSFHAMKNGILTSCSAGNKGPYRRQISNYAPWA  321

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLI-SGTLAQDKNATYPGNYS  1202
             +TVAA++IDR F + V LGNG+ I G S+N F L G  +PL+ SG  A   +A  P    
Sbjct  322   LTVAASTIDRSFVTKVVLGNGQTILGTSLNNFHLDGTSFPLVYSGDAANITSAMSPNIAG  381

Query  1203  ACDYLSISEKLVRGKIVYC--LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVD  1376
              C   ++S    RG +V C  LS +S  ++ +    VG+I +    +      +PA ++ 
Sbjct  382   ICFPGTLSTLKTRGAVVLCNILSDSSGAFSAE---AVGLIMASPFDEIAFAFPVPAVVIS  438

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSR-AVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              +D  K+  YI TT+ PTA I  +       AP V SFS+RGP  IS +ILKPD+ APG 
Sbjct  439   YDDRLKLIDYIRTTEYPTATILSTETTTDVMAPTVVSFSSRGPNPISPDILKPDVTAPGS  498

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             +ILAA++     +  V D R V Y + SGTSM+ PH  GAAAY+K  HP WSPAAIKSAL
Sbjct  499   NILAAWSPRGLSSVWVFDDRQVDYYIISGTSMSCPHVTGAAAYIKAAHPTWSPAAIKSAL  558

Query  1734  MTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             MTTA  M   K   A  A G+G I P KAV PGL+FD ++++Y+ +LCK+ +N   L  +
Sbjct  559   MTTATIMDPRKNEDAEFAYGSGHINPVKAVDPGLVFDASEADYVDFLCKQGYNTTHLRMI  618

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             TG       N P    A  LNYPS  L L   +     A++ RTVT VG+ ++ + + I 
Sbjct  619   TGDSSVCPSNEPGK--AWDLNYPSFGLSLL--DGEPVQASYLRTVTNVGSPNSTYHSHIT  674

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPI  2261
              P    V V P +L+F    +K+S+KV+++G    Q  I   +SG++ W D  H VR+PI
Sbjct  675   MPPSFAVLVEPPVLTFSDVGEKKSFKVIITGSPIVQVPI---ISGAIEWTDGNHVVRTPI  731

Query  2262  LVYR  2273
              V++
Sbjct  732   AVFQ  735



>emb|CAN72966.1| hypothetical protein VITISV_025342 [Vitis vinifera]
Length=776

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/720 (47%), Positives = 452/720 (63%), Gaps = 14/720 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H  +RK +IVYMGE P    +S V  HH++L   LG    A+E  I+SY RSF+GF A+L
Sbjct  23    HSDERKVHIVYMGEKPHG-AVSMVSMHHSMLASVLGSTASAKESLIYSYGRSFNGFAAKL  81

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E  R ++ D VVSV  N+ ++L TTRSWDF+G  T+++       D+I+GLLDTG+W
Sbjct  82    SDEEVTRFADMDGVVSVVPNSMLELHTTRSWDFMGF-TQSHVRDSLGGDVIIGLLDTGIW  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFN-VEGFAPEDQESPADFDG  674
              ES SF D+G+GPPPAKWKG CQ   NFT CN K+IGA+Y+N    +   D +SP D +G
Sbjct  141   PESESFSDEGFGPPPAKWKGMCQTENNFT-CNNKIIGARYYNSYNEYYDGDIKSPRDSEG  199

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAGR V GAS YG+A+G ARGG P+ARIA YKVCW +GC   D+LA FD AI
Sbjct  200   HGTHTASTAAGREVAGASFYGLAQGLARGGYPNARIAVYKVCWVRGCAAADILAAFDDAI  259

Query  855   ADGVDVISISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS+S+G   P  +F+D IAIGS+HAM + I+T+ +AGN+GP+ G + N SPW +
Sbjct  260   ADGVDIISVSLGFTFPEPYFEDVIAIGSFHAMGQGILTSTSAGNDGPWLGWVSNYSPWSL  319

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNAT-YPGNYSAC  1208
             TVAA+SIDR+F S + LGNG++ SG  IN  EL   YPLI G  A + +A   P + + C
Sbjct  320   TVAASSIDRKFVSKLVLGNGQIFSGIVINNLELNGTYPLIWGGDAANVSAQETPLSSADC  379

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIED  1385
                 +  + V+GKIV C         I    GVG+I  +    D      +PAT++  +D
Sbjct  380   LPGDLDSRKVKGKIVLCEFLWDGSGVIM-AGGVGIIMPAWYFNDFAFTFPLPATLLRRQD  438

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
               K+ +Y   +K P A I      K   AP V SFS+RGP  IS +ILKPDL APG+ IL
Sbjct  439   MDKVLQYARFSKNPIATILVGETRKDVMAPIVASFSSRGPNPISPDILKPDLTAPGVDIL  498

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++ + + +    DTR  +YN+ SGTSM+ PHA+GAAAYVK+ HP WSPAAIKSALMTT
Sbjct  499   AAWSPIVSPSEYEHDTRTAQYNIISGTSMSCPHASGAAAYVKSIHPSWSPAAIKSALMTT  558

Query  1743  AKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSK  1919
             A  M   K      A G+G I P KAV PGLI++ +K++Y+++LCK+  N S   L    
Sbjct  559   AYVMDTRKNEDKEFAYGSGHINPVKAVDPGLIYNTSKADYINFLCKQGYNTSTLRLITGD  618

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             D+ C +    +  D LNYPS  L +   +       F RTVT VG+ ++ + A +  P  
Sbjct  619   DSVCNSTKPGRAWD-LNYPSFSLAIE--DGQDIMGIFSRTVTNVGSPNSTYHASVYMPNS  675

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             + + V P +LSF    +K+S+ V V G  Q  +   +SG+++WKD  H VR+P+ VY  L
Sbjct  676   IEIEVEPPVLSFSAIGEKKSFTVRVYGP-QINMQPIISGAILWKDGVHVVRAPLAVYTVL  734



>ref|XP_006850442.1| hypothetical protein AMTR_s00165p00065060 [Amborella trichopoda]
 gb|ERN12023.1| hypothetical protein AMTR_s00165p00065060 [Amborella trichopoda]
Length=725

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/714 (47%), Positives = 461/714 (65%), Gaps = 22/714 (3%)
 Frame = +3

Query  159   YIVYMGE-LPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREAR  335
             +IVY+G+ L +D   SA   H  IL + L     A E  ++SYRRSF+GF A+L  +E  
Sbjct  5     HIVYLGQRLQED--FSAASLHLGILQQVLSGSS-ATESLVYSYRRSFNGFAAKLTQQEIE  61

Query  336   RLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSF  515
             +L   + VVS+F + + +L TTRSWDF+G +   NR+ K ESD++VG++DTG+W ES SF
Sbjct  62    KLESMEGVVSIFPSQKKQLHTTRSWDFMGFTETVNRSLKWESDVVVGVIDTGIWPESASF  121

Query  516   KDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAP-EDQESPADFDGHGSHI  689
              D+G+GPPP+KWKG CQ   NFT CN+K+IGA+++  +  F P  D  SP D  GHG+H 
Sbjct  122   SDEGFGPPPSKWKGTCQSSANFT-CNKKLIGARFYKADKQFDPILDDPSPRDTIGHGTHT  180

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAGR+V   SL+G+A G+ARG VPSARIA YKVCW  GC D D+LA FD AIADGVD
Sbjct  181   ASTAAGRVVSDTSLFGLALGSARGAVPSARIAVYKVCWSDGCSDADMLAAFDDAIADGVD  240

Query  870   VISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             VISIS+G   P  +F D +AIGS+HAMK  I+T+ +AGN+GPY G++ NV+PW +TVAA+
Sbjct  241   VISISIGHSIPLDYFMDSLAIGSFHAMKGGILTSISAGNDGPYAGSVTNVAPWTLTVAAS  300

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
             S DR+  + V LG+GE++ G ++NTF+L G  +PLI G  A + +A Y    S  C   +
Sbjct  301   STDRKIINKVALGDGEILVGRAVNTFQLKGTTFPLIYGGDAPNTSAGYSSLESMYCSPNT  360

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
             +   +V+GKIV C      +  +       ++  D   D      +PA++++  DG K+ 
Sbjct  361   LDRGVVKGKIVLCDIINKGEGALDANARGMIMRYDGYNDLAFSYPLPASLLNTTDGSKVY  420

Query  1401  KYI-NTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYT  1574
              Y+ N+T      I +S ++K + AP V SFS+RGP  I+ +ILKPDL APG+ ILAA++
Sbjct  421   NYLKNSTSNSKVNILKSESIKDSEAPTVVSFSSRGPNLITPDILKPDLTAPGVDILAAWS  480

Query  1575  ALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAM  1754
              +A+M+    D R VKYN+ SGTSM+ PH +GAAAYVK+F+P WSPAAIKSALMTTA  M
Sbjct  481   PVASMSVFEGDKRSVKYNIISGTSMSCPHVSGAAAYVKSFNPTWSPAAIKSALMTTATPM  540

Query  1755  K-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK  1928
                K   A  A G+G I P KAV PGL++D  + +Y+  LC + +N  +L  +TG  ++ 
Sbjct  541   SPTKNEDAEFAYGSGHIDPIKAVNPGLVYDAGEVDYVGMLCNQGYNTRTLRLVTG-DNST  599

Query  1929  CKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTV  2108
             C N+      D LNYPS   +++  +  +FSA F RTVT VG   +V+ A + + +  TV
Sbjct  600   CSNVANGTVLD-LNYPSFAYKVS--SGVSFSATFSRTVTNVGVPPSVYNAFVNSASAFTV  656

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             +V P  LSF    +K+S+ V V G    A+    S SLVW D  HSVRSPI+VY
Sbjct  657   TVEPTQLSFKSIGEKKSFTVKVEGSMGTAV----SASLVWSDGVHSVRSPIIVY  706



>ref|XP_004149952.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=747

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/725 (45%), Positives = 466/725 (64%), Gaps = 22/725 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGE---LPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFV  308
             HD  RK YIVYMG+     D     +   HH  + E       A E+ +HSY+RSF+GFV
Sbjct  28    HDA-RKVYIVYMGDKLHDTDSDDTDSAPSHHKRILEKGTSSNFAPEFLLHSYKRSFNGFV  86

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   EA+++S  ++VVS+F N +  L TTRSWDF+G++  A R  + ES+L+VG+ DT
Sbjct  87    AKLTEEEAQKISAMEEVVSLFPNEKKHLHTTRSWDFIGLTKDAPRVKQVESNLVVGVFDT  146

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQ-YFNVEGFAPEDQESPAD  665
             G+W E+PSF D GYGP PAKWKG CQ   NFT CN+K+IGA+ Y +   F PED  SP D
Sbjct  147   GIWPENPSFSDVGYGPIPAKWKGTCQTSANFT-CNKKIIGARAYRSNNDFPPEDIRSPRD  205

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
              DGHG+H AS   G +V  AS YG+A GTARGG PSA IA YK+CW  GC   D+LA FD
Sbjct  206   SDGHGTHTASTVVGGLVNEASFYGLAGGTARGGTPSACIAVYKICWSDGCYSTDILAAFD  265

Query  846   AAIADGVDVISISVGGHPRS--FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVS  1019
              AIADGVD+ISIS+G  P+S  +F DP AIG++HAMK  I+T+ +AGNEGP + ++ NV+
Sbjct  266   DAIADGVDMISISLGS-PQSSPYFLDPTAIGAFHAMKNGILTSTSAGNEGPNYFSVSNVA  324

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGN  1196
             PW ++V A++IDR+  S V+LGN  +  GF+INTF+L GK YPLI    A +    + G+
Sbjct  325   PWALSVGASTIDRKLASKVELGNRNIYQGFTINTFDLEGKQYPLIYARDAPNIAGGFTGS  384

Query  1197  YSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATI  1370
              S  C   S++  LV+GK++ C S       + +   VGVI +D +  D+     +P++ 
Sbjct  385   MSRFCSANSVNANLVKGKVLVCDSVLPPSRFVNFSDAVGVIMNDGRTKDSSGSYPLPSSY  444

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             +   DG  +  Y+++  +PTA I++S A+  T+AP V SFS+RGP   + +ILKPDL AP
Sbjct  445   LTTADGNNVKTYMSSNGSPTATIYKSNAINDTSAPLVVSFSSRGPNPQTFDILKPDLTAP  504

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILAA++ +A ++  V D+R   YN+ SGTSM+ PH   AA YVKTFHP WSPAAI+S
Sbjct  505   GVEILAAWSPIAPVSSGVIDSRTTLYNIISGTSMSCPHVTAAAVYVKTFHPTWSPAAIQS  564

Query  1728  ALMTTAKAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ALMTTA  +  +  + A  A GAG I P KA+ PGL++D  +S+Y+ +LC + +  + + 
Sbjct  565   ALMTTATPLSAVLNMQAEFAYGAGQIDPVKAIDPGLVYDAGESDYVKFLCGQGYTTSMVQ  624

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
               +  K+  C +    +  D LNYPS    L++  +  F+  F RT+T VG+ ++ + + 
Sbjct  625   RFSNDKNTVCNSTNMGRVWD-LNYPS--FALSSSPSRPFNQYFTRTLTNVGSKASTYTST  681

Query  2082  IKA-PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
             ++  P GLT++V P  LSF  T QKR++ + + G    +I+   S SL+W D +H+VRSP
Sbjct  682   VRGTPQGLTITVNPTSLSFNSTGQKRNFTLTIRGTVSSSIA---SASLIWSDGSHNVRSP  738

Query  2259  ILVYR  2273
             I V++
Sbjct  739   ITVFK  743



>gb|KEH20534.1| subtilisin-like serine protease [Medicago truncatula]
Length=646

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/649 (49%), Positives = 435/649 (67%), Gaps = 11/649 (2%)
 Frame = +3

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             ++V+SV  N   KL TTRSWDF+G+   A R  K ESD IV +LDTG+  E  SFKDDG 
Sbjct  2     NEVLSVLSNKYRKLHTTRSWDFIGLPLTAKRKLKQESDTIVAILDTGITPEFRSFKDDGL  61

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGSHIASIAAG  707
             GPPPAKW+G C K +NF+GCN K++GA+YF ++G +   D  SP D  GHG+H AS AAG
Sbjct  62    GPPPAKWRGTCDKYVNFSGCNNKIVGAKYFKLDGRSESSDILSPIDVSGHGTHTASTAAG  121

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDVISIS  884
              +V  ASL+G+A GTARG VPSAR+A YKVCW + GC DMDVLAGF+AAI DG DVIS+S
Sbjct  122   NLVPNASLFGLANGTARGAVPSARLAIYKVCWKEDGCADMDVLAGFEAAIDDGADVISVS  181

Query  885   VGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             +GG   ++ QD I+IG++HAM+K I+T A+AGN+GP   T++N +PW++TVAA+ IDR F
Sbjct  182   LGGENSNYLQDSISIGAFHAMRKGIITVASAGNDGPTMATVENHAPWVVTVAASGIDRDF  241

Query  1065  ESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVR  1241
              S V+LG    +SG  +NTF    K YPLI+G  A  +N++   N   C   S+    V+
Sbjct  242   HSTVELGTRTNVSGEGVNTFSPKQKQYPLINGMDAA-RNSSSKDNAKFCAKGSLEPNKVK  300

Query  1242  GKIVYC-LSSASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             GKIVYC   + S +  +K + G+G I   D+  D+    M PAT V+   G+ I  YI +
Sbjct  301   GKIVYCKFRTWSTEAVVKAVGGIGTIVEYDEFQDSPETFMAPATFVNRSTGQIITNYIQS  360

Query  1416  TKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
             T++P+A I +S  VK  APFV SFS+RGP + S ++LKPD+ APG+SILA++T   ++T 
Sbjct  361   TRSPSAVIHKSHEVKIPAPFVASFSSRGPNSGSQHVLKPDVTAPGISILASFTLRHSITS  420

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIG  1772
                DT+   + + SGTSMA PH +G AAYVK+FHP+W+PAAI+SA+MTTAK M  K    
Sbjct  421   IEGDTQFSVFTLMSGTSMACPHISGIAAYVKSFHPNWTPAAIRSAIMTTAKPMSQKVNKE  480

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAA  1949
             A  A GAGL+ PT+A+ PGLI+D+++  Y+ +LC E +N ++L  L GS  N C ++   
Sbjct  481   AEFAFGAGLVNPTRALNPGLIYDMDEFGYVQFLCHEGYNGSTLSILIGSPVN-CTSLLPG  539

Query  1950  QGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNIL  2129
              G D +NYPSM L +     +T    F R VT VG G T++ A IK+P G+ ++V P  L
Sbjct  540   IGHDAINYPSMQLSVKRNTESTI-GVFRRRVTNVGPGPTMYNATIKSPKGVEITVKPTSL  598

Query  2130  SFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
              F  T QK+++KVVV  K   ++   +SGSL+W++  + VRSPI++Y S
Sbjct  599   IFYHTLQKKNFKVVVKAKSMASMK-IVSGSLIWRNPRYIVRSPIVIYSS  646



>ref|XP_007009169.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY17979.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=702

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/700 (47%), Positives = 447/700 (64%), Gaps = 25/700 (4%)
 Frame = +3

Query  216   HHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLL  395
             H+++L +A G  E   +  + +Y+RSF GFV +L   EA +++  + VVSVF N +  L 
Sbjct  15    HNSMLQDAFG-SEFDMKSVLCTYKRSFDGFVVQLTEEEASKMAGMNGVVSVFPNEKRDLH  73

Query  396   TTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQK-G  572
             TTRSWDF+G S +  R+  +ESD+I+G+LDTG+W ES SF D G+GPPP KWKG CQ  G
Sbjct  74    TTRSWDFMGFSQQVERS-ASESDVIIGVLDTGIWPESESFNDKGFGPPPRKWKGNCQTAG  132

Query  573   LNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEG  749
              NFT CN K+IGAQY+  +G F P+D  SP D  GHG+H AS AAG +V  ASL+G A G
Sbjct  133   GNFT-CNNKIIGAQYYRSDGLFGPDDIVSPRDASGHGTHTASTAAGGLVNRASLFGFASG  191

Query  750   TARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGH-PRSFFQDPIA  926
             TARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SVG   P+ +F D IA
Sbjct  192   TARGGVPSARIAVYKICWFDGCYDADILAAFDDAIADGVDIISLSVGAATPKDYFNDSIA  251

Query  927   IGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISG  1106
             IG++HAM+  ++T  +AGN+GP   TI N SPW ++VAA++IDR+F + V+LGN  +  G
Sbjct  252   IGAFHAMRNGVLTVNSAGNQGPDRATITNFSPWALSVAASTIDRKFFTKVQLGNNMIYEG  311

Query  1107  FSINTFEL-GKMYPLISGTLAQDKNATYP-GNYSACDYLSISEKLVRGKIVYCLSSASQD  1280
              SINTF+L  +MYP+I G  A +    +   +   C   S+   LV+GKIV C    S  
Sbjct  312   VSINTFDLKNEMYPIIHGGSAPNTTGNFTWASSRNCFQNSLDRNLVKGKIVLCDRLVSGR  371

Query  1281  YTIKWIHGVGVIASDKLPDT---VLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSR  1451
               ++    VG +  D  P+    + P  +PA+ +D+ DG KI  Y+N+T  PTA IF+S+
Sbjct  372   EPLR-AGAVGTVLRDNAPNDDARLFP--LPASYLDLVDGSKIFVYVNSTSTPTATIFKSK  428

Query  1452  -AVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYN  1628
              A  + AP+V SFS+RGP  I+ +ILKPD++APG+ ILAA++ ++ ++    D R V +N
Sbjct  429   EANDSLAPYVVSFSSRGPNPITPDILKPDISAPGVHILAAWSLISPVSQTKGDNRFVPFN  488

Query  1629  VESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIGAYLASGAGLIR  1805
             + SGTSMA PH + AAAYVK+FHP WSPAAIKSALMTTA  M     + A  A G+G + 
Sbjct  489   IISGTSMACPHVSAAAAYVKSFHPTWSPAAIKSALMTTAFPMSSGINLDAEFAYGSGHLN  548

Query  1806  PTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNIPAAQGAD-GLNYPSM  1982
             P KAV PGL++D  + +Y+ +LC +        L    +  C    A  G   GLNYPS 
Sbjct  549   PIKAVDPGLVYDSEELDYIKFLCGQGYGTQFLQLVTRDNTTCSE--ATNGTVWGLNYPS-  605

Query  1983  HLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG-LTVSVVPNILSFPQTNQKRS  2159
                L    +TT S  F RTVT VG+  ++++A + AP G L + V PN+LSF    QK S
Sbjct  606   -FALFTSASTTVSRVFNRTVTNVGSPMSIYRANVTAPAGALKIQVNPNVLSFKSLGQKLS  664

Query  2160  YKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             + + + G   K+I   +S SL W D  H VRSPI  + S+
Sbjct  665   FSLTIEGTIDKSI---VSASLEWDDGVHKVRSPITAFVSI  701



>ref|XP_002262979.2| PREDICTED: cucumisin-like [Vitis vinifera]
Length=790

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/720 (47%), Positives = 451/720 (63%), Gaps = 14/720 (2%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H  +RK +IVYMGE P    +S V  HH++L   LG    A+E  I+SY RSF+GF A+L
Sbjct  23    HSDERKVHIVYMGEKPHG-AVSMVSMHHSMLASVLGSTASAKESLIYSYGRSFNGFAAKL  81

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E  R ++ D VVSV  N+ ++L TTRSWDF+G  T+++       D+I+GLLDTG+W
Sbjct  82    SDEEVTRFADMDGVVSVVPNSMLELHTTRSWDFMGF-TQSHVRDSLGGDVIIGLLDTGIW  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFN-VEGFAPEDQESPADFDG  674
              ES SF D+G+GPPPAKWKG CQ   NFT CN K+IGA+Y+N    +   D +SP D +G
Sbjct  141   PESESFSDEGFGPPPAKWKGMCQTENNFT-CNNKIIGARYYNSYNEYYDGDIKSPRDSEG  199

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAGR V GAS YG+A+G ARGG P+ARIA YKVCW +GC   D+LA FD AI
Sbjct  200   HGTHTASTAAGREVAGASFYGLAQGLARGGYPNARIAVYKVCWVRGCAAADILAAFDDAI  259

Query  855   ADGVDVISISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS+S+G   P  +F+D IAIGS+HAM + I+T+ +AGN+GP+ G + N SPW +
Sbjct  260   ADGVDIISVSLGLTFPEPYFEDVIAIGSFHAMGQGILTSTSAGNDGPWLGWVSNYSPWSL  319

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNAT-YPGNYSAC  1208
             TVAA+SIDR+F S + LGNG++ SG  IN  EL   YPLI G  A + +A   P + + C
Sbjct  320   TVAASSIDRKFVSKLVLGNGQIFSGIVINNLELNGTYPLIWGGDAANVSAQETPLSSADC  379

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIED  1385
                 +  + V+GKIV C         I    GVG+I  +    D      +PAT++  +D
Sbjct  380   LPGDLDSRKVKGKIVLCEFLWDGSGVIM-AGGVGIIMPAWYFNDFAFTFPLPATLLRRQD  438

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
               K+ +Y   +K P A I      K   AP V SFS+RGP  IS +ILKPDL APG+ IL
Sbjct  439   MDKVLQYARFSKNPIATILVGETRKDVMAPIVASFSSRGPNPISPDILKPDLTAPGVDIL  498

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++ + + +    DTR  +YN+ SGTSM+ PHA+GAAAYVK+ HP WSPAAIKSALMTT
Sbjct  499   AAWSPIVSPSEYERDTRTAQYNIISGTSMSCPHASGAAAYVKSIHPSWSPAAIKSALMTT  558

Query  1743  AKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSK  1919
             A  M   K      A G+G I P KAV PGLI++ +K +Y+++LCK+  N S   L    
Sbjct  559   AYVMDTRKNEDKEFAYGSGHINPVKAVDPGLIYNTSKPDYINFLCKQGYNTSTLRLITGD  618

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             D+ C +    +  D LNYPS  L +   +       F RTVT VG+ ++ + A +  P  
Sbjct  619   DSVCNSTKPGRAWD-LNYPSFSLAIE--DGLDIMGIFSRTVTNVGSPNSTYHASVYMPNS  675

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             + + V P +LSF    +K+S+ V V G  Q  +   +SG+++WKD  H VR+P+ VY  L
Sbjct  676   IEIEVEPPVLSFSAIGEKKSFTVRVYGP-QINMQPIISGAILWKDGVHVVRAPLAVYTVL  734



>ref|XP_007210247.1| hypothetical protein PRUPE_ppa014972mg [Prunus persica]
 gb|EMJ11446.1| hypothetical protein PRUPE_ppa014972mg [Prunus persica]
Length=736

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/719 (48%), Positives = 462/719 (64%), Gaps = 31/719 (4%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+ P     S    HH++L  ALG    A+E  I+SYR+SF+GF ARL   E  +LSE 
Sbjct  1     MGDRPQG-GFSVASTHHSMLQRALGSTLSAKESLIYSYRKSFNGFAARLSDEEVAKLSEM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             + VVSV  N ++KL TTRSWDF+G S K       E ++I+G++DTG+W ES SF D  +
Sbjct  60    EGVVSVIPNHKLKLHTTRSWDFMGFS-KGQLGVSIEGEVIIGVIDTGIWPESDSFNDKDF  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAG  707
             GPPP KWKG CQ G NFT CN K+IGA+++N EG +   +  SP D  GHGSH AS AAG
Sbjct  119   GPPPTKWKGVCQ-GPNFT-CNNKLIGARFYNSEGEYDSSEFHSPRDSIGHGSHTASTAAG  176

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
             R V  AS +G+A GTARGGVP ARIA YKVCW   C   D+LA FD AIADGVD+IS S+
Sbjct  177   REV-AASYFGLANGTARGGVPGARIAVYKVCWLSDCATADILAAFDDAIADGVDIISTSL  235

Query  888   GGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             G   P  + +DPIAIGS+HAMK  I+T+++AGN GPY  T+ N +PW++TVAA++IDRRF
Sbjct  236   GSDVPIQYLKDPIAIGSFHAMKNGILTSSSAGNSGPYPATVSNYAPWILTVAASTIDRRF  295

Query  1065  ESDVKLGNGELISGFSINTFEL-GKMYPLISG----TLAQDKNATYPGNYSACDYLSISE  1229
              +   LGNG++ SGFSIN F+L GK YPLI G     +++  ++ + G+   C   ++S 
Sbjct  296   TAKAVLGNGQVYSGFSINNFDLNGKSYPLIWGGDAANISKGASSEFAGD---CVPNTLSS  352

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYI  1409
               ++GKIVYC  S S    I+   GVG I  D   D      +P+T + IEDG+KI  YI
Sbjct  353   DKIKGKIVYC-DSFSDGSDIRRAGGVGTIMVDFPTDVAFNYPLPSTQITIEDGQKILNYI  411

Query  1410  NTTKAPTAEIFRS---RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
              +T+ P A I  S         AP + SFS+RGP  ++ +ILKPDL APG+ ILAA++ +
Sbjct  412   RSTENPIATILVSDPEHDKDVMAPSIASFSSRGPNPLTPDILKPDLTAPGVDILAAWSPV  471

Query  1581  ATMTGQV-DDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
             A  +    +DTR VKYN+ SGTSM+ PH +GAAAY+K  HP WS AAIKSALMTTA  + 
Sbjct  472   APPSETFYEDTRSVKYNIISGTSMSCPHVSGAAAYLKAAHPSWSAAAIKSALMTTATVLD  531

Query  1758  IKPIGAY-LASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
              K       A G+G I P KAV PGLIFDI++++Y+++LCK+ +N+ +L  +TG K++ C
Sbjct  532   SKKHADLEFAYGSGQINPLKAVKPGLIFDISEADYINFLCKQGYNSTTLRIITGDKNSSC  591

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP-TGLTV  2108
              +    +  D LNYPS  LQL   +     A F RTVT VG+ ++ +     +P + +TV
Sbjct  592   GSTKPGKAWD-LNYPSFSLQLE--DGQEIKAEFTRTVTNVGSPNSTYTIASFSPLSTITV  648

Query  2109  SVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             SV P+ LSF    +K+S+ V V+G    Q+ I   +SGS+V  D  H VR+P++VY  L
Sbjct  649   SVSPSTLSFSSVGEKKSFTVKVTGPKISQQPI---ISGSIVLSDGVHQVRAPLVVYTFL  704



>emb|CDP00153.1| unnamed protein product [Coffea canephora]
Length=699

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/707 (47%), Positives = 445/707 (63%), Gaps = 18/707 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+ P     S    H ++L EA+G +  A +  ++SY+RSF+GFVA+L   E  RL+  
Sbjct  1     MGDRPKG-DFSVSSRHSSMLQEAVGSKR-ASDSLLYSYKRSFNGFVAKLTEEEKERLASM  58

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D VVSVF N + +L TTRSWDF+G    A R   AESD+IV +LDTGVW ES SF D G+
Sbjct  59    DGVVSVFPNGKRELHTTRSWDFVGFPQNAPRK-TAESDIIVAMLDTGVWPESKSFDDTGF  117

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGSHIASIAAG  707
             GP P+KWKG C+   NFT CN K+IGA+++  +G  P+ D  SP D +GHGSH AS AAG
Sbjct  118   GPAPSKWKGTCETSKNFT-CNNKIIGAKHYRADGQVPDVDIPSPRDSEGHGSHTASTAAG  176

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
             R+V  ASL+ +  GTARGGVPSARIA YK+CW  GC D D+LA FD AIAD VD+IS+SV
Sbjct  177   RLVSKASLFDLGSGTARGGVPSARIAVYKICWSDGCYDSDILAAFDDAIADRVDIISLSV  236

Query  888   GGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P ++F+D IAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VA +  DR+F
Sbjct  237   GGSFPLNYFEDTIAIGAFHSMKHGILTSNSAGNSGPGASSITNFSPWSLSVAGSVTDRKF  296

Query  1065  ESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              ++V LGN  +  G S+NTF+L  ++YPL+ G    +  A +  + S  C Y S+    V
Sbjct  297   VTNVLLGNKNVYQGVSVNTFQLHDELYPLVYGGDVPNVAAGFDSSDSRYCIYNSLDVTKV  356

Query  1239  RGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTT  1418
              G IV C        T+       V+      D      +P + +   DG  I  YIN+T
Sbjct  357   NGTIVVCDKLNDGTTTLDAGATGTVMQDGGNKDFAFSFPLPVSYLSTRDGTTILNYINST  416

Query  1419  KAPTAEIFRSRA-VKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
               PTA I +S   V   AP+V SFS+RGP  I+ +ILKPD++APG+ I+AA++   T+TG
Sbjct  417   SEPTAVIRKSTTIVDKAAPYVASFSSRGPNPITADILKPDISAPGIDIVAAWSEATTVTG  476

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP-IG  1772
                DTRVV YN+ SGTSM+ PHA GAAAYVK+F+P WSPAAIKSALMTTA  M  K  I 
Sbjct  477   DEGDTRVVPYNIISGTSMSCPHATGAAAYVKSFNPTWSPAAIKSALMTTATPMSTKTNID  536

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAA  1949
             A  A G+G I P KA APGL++DI +++++S+LC + +N  +L  +TG+  + C     A
Sbjct  537   AEFAYGSGQINPIKAAAPGLVYDITEADFVSFLCGQGYNTTTLRRITGNNSSSCTKANNA  596

Query  1950  QGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNIL  2129
                D LNYPS  +   +   T     F+RTVT VG   + +KA + AP  L++ V P  L
Sbjct  597   TVWD-LNYPSFAVSAKSGQVTR---VFHRTVTNVGNPVSTYKATVTAPPQLSIQVNPITL  652

Query  2130  SFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             SF    QK S+ V V+ +  + I   +SGSLVW D  H VRSP++ +
Sbjct  653   SFKSLGQKLSFSVTVTAEIPRTI---ISGSLVWDDGVHQVRSPVVAH  696



>emb|CBI34765.3| unnamed protein product [Vitis vinifera]
Length=732

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/696 (48%), Positives = 446/696 (64%), Gaps = 18/696 (3%)
 Frame = +3

Query  216   HHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLL  395
             HH++L   LG    A+E  ++SY RSF+GF ARL   E  RLSE + VVSV  N  +KL 
Sbjct  15    HHSMLETVLGSTSSAKESLVYSYGRSFNGFAARLSDEEVGRLSEMEGVVSVTPNHILKLH  74

Query  396   TTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGL  575
             TTRSWDF+G S K       E ++IV LLDTG+W ES SF D+G+G PP+KW G CQ G 
Sbjct  75    TTRSWDFMGFS-KGTVGGSEEGEIIVALLDTGIWPESESFNDEGFGSPPSKWNGTCQ-GA  132

Query  576   NFTGCNRKVIGAQYFNVEGFAP-EDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGT  752
             NFT CN K+IGA+Y+N EG+    D +SP D  GHG+H AS AAGR V+GAS +G+A+GT
Sbjct  133   NFT-CNNKIIGARYYNSEGYYDISDFKSPRDSLGHGTHTASTAAGREVDGASYFGLAKGT  191

Query  753   ARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGG-HPRSFFQDPIAI  929
             ARG VP+ARIA YKVCW  GC   D+ A FD AIADGVD+IS+S+G   P  + QDPIAI
Sbjct  192   ARGAVPNARIAVYKVCWYYGCAVADIFAAFDDAIADGVDIISVSLGADFPLEYLQDPIAI  251

Query  930   GSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGF  1109
             GS+HAMK  I+T+++AGN GP+  T+ N +PW++TVAA+SIDR+F + V L NG++ +G 
Sbjct  252   GSFHAMKYGILTSSSAGNSGPFPVTVSNYAPWILTVAASSIDRKFVAQVVLSNGQVYTGL  311

Query  1110  SINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVRGKIVYCLSSASQDY  1283
             S+N+FEL G  +PLI G  A + +A Y  ++S  C   ++    ++GKIV C  +     
Sbjct  312   SVNSFELNGTTFPLIWGGDAANVSAGYSSDFSRYCLPDTLDSYKIKGKIVLC-DTLWDGS  370

Query  1284  TIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-  1460
             T+    GVG I +D + D      +PAT + +EDG  I  YI T K P A I  S     
Sbjct  371   TVLLADGVGTIMADLITDYAFNYPLPATQISVEDGLAILDYIRTAKNPLATILFSETWND  430

Query  1461  TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESG  1640
               AP V SFS+RGP  I+ +ILKPD+ APG+ ILAA++ +A  +    DTR V YN+ SG
Sbjct  431   VMAPNVVSFSSRGPNPITPDILKPDITAPGVDILAAWSPVAPPSIYYLDTRSVDYNIISG  490

Query  1641  TSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK-IKPIGAYLASGAGLIRPTKA  1817
             TSM+ PHA+GAAAYVK  HP+WSPAAIKSALMTTA  M   K      A G+G I P  A
Sbjct  491   TSMSCPHASGAAAYVKAAHPNWSPAAIKSALMTTAHVMDPRKHEDLEFAYGSGHINPLNA  550

Query  1818  VAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLT  1997
               PGL++D ++++Y+S+LCK+  N S   L    D+ C +    +  D LNYPS  L + 
Sbjct  551   TDPGLVYDASEADYISFLCKQGYNTSTLRLVTGDDSVCNSTEPGRAWD-LNYPSFSLAVE  609

Query  1998  NPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVS  2177
             + N       F RTVT VG+ ++ + A +  PT L+V+V P+++SF    +K+S+ V V 
Sbjct  610   DGNQIM--GVFTRTVTNVGSPNSTYTAGMYVPTTLSVTVEPSVISFSAIGEKKSFTVKVY  667

Query  2178  GK--FQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             G    Q+ I   MSG++ W D  H VRSP++VY  L
Sbjct  668   GPKISQQPI---MSGAIWWTDGVHEVRSPLVVYTVL  700



>ref|XP_011081055.1| PREDICTED: cucumisin-like [Sesamum indicum]
Length=775

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/723 (46%), Positives = 462/723 (64%), Gaps = 23/723 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H  +RK ++VYMG  P +  +S   +HH +L   LG    A++  +HSY RSF+GF A+L
Sbjct  23    HCQERKLHVVYMGGRPQE-DVSVASKHHAMLHRVLGSASAAKDSLVHSYGRSFNGFAAKL  81

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA R+SE + V+SV  N   K  TTRSWDF+ ++      P+ ESD+I+GLLDTGVW
Sbjct  82    TQEEAARISEMEGVISVNPNRIFKHHTTRSWDFMNVTIDKVGAPQ-ESDVIIGLLDTGVW  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              E PSF D G+GPPPAKWKG C    NFT CN K+IGA+Y+N +  F  +D  SP D +G
Sbjct  141   PEHPSFNDSGFGPPPAKWKGTCMTA-NFT-CNNKIIGARYYNSDNSFRYDDIPSPRDTEG  198

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG  VE AS +G+A+G ARGGVP +RIA YKVCW  GC   D+L  FD AI
Sbjct  199   HGTHTASTAAGVEVE-ASYFGLAKGIARGGVPKSRIAVYKVCWAFGCSSADILKAFDDAI  257

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS+S+G   P  +F DPIAIGS+HAM+  I+T+ +AGN GP+  T+ N +PW +
Sbjct  258   ADGVDIISVSLGSDWPDDYFDDPIAIGSFHAMRNGILTSNSAGNSGPFPVTVSNYAPWSL  317

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKN-ATYPGNYSA  1205
             TVAA++IDR+F + ++LGNG++ +G +INTF+L G  YPLI G  A +    + P     
Sbjct  318   TVAASTIDRKFVARMQLGNGQMFTGITINTFDLNGTSYPLIWGGDAANYTIGSSPDIAKY  377

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKL---PDTVLPTMIPATIVD  1376
             C   +++  +V GKIV+C  +      I   +GVG I +D L   PD      +PAT++ 
Sbjct  378   CITGAMNADIVAGKIVFC-EALWDGSGILLANGVGTIMADVLVENPDVAFSWPLPATLIS  436

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              EDGK + +YI +T+ PTA IF S   K   AP V SFS+RGP  IS +ILKPD+ APG+
Sbjct  437   PEDGKSVLEYIRSTENPTATIFYSDEWKDAMAPIVVSFSSRGPSPISPDILKPDITAPGV  496

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILA ++ L+  +   DD R   +N+ SGTSM+ PHA+GAAA+VK+ HP+WSPAAIKSAL
Sbjct  497   DILAGWSPLSPSSVYYDDERSTLFNIISGTSMSCPHASGAAAFVKSLHPNWSPAAIKSAL  556

Query  1734  MTTAKAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLT  1910
             MTTA  M   K      A G+G I PT A  PGL+FD ++++Y+++LCK+  N S   L 
Sbjct  557   MTTAYVMDPRKHEDLEFAYGSGQINPTAARDPGLVFDASETDYINFLCKQGYNTSTLRLV  616

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
                ++ C +    +  D LNYPS  L + +    T    F RTVT VG  ++ +KA +  
Sbjct  617   TGDNSTCASTTPGRAWD-LNYPSFSLYVEDGQPIT--GTFTRTVTNVGAANSTYKASLYM  673

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWY--MSGSLVWKDNTHSVRSPIL  2264
             P  ++V+V P++L+F    + +++ V V+G    AIS +   SG++ W D T+ VR+P++
Sbjct  674   PALISVTVEPSVLTFSAIGETQTFTVSVTG---PAISQHPITSGAITWTDGTYVVRTPLV  730

Query  2265  VYR  2273
             VY 
Sbjct  731   VYN  733



>gb|KDO69224.1| hypothetical protein CISIN_1g043420mg [Citrus sinensis]
Length=702

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/709 (47%), Positives = 457/709 (64%), Gaps = 23/709 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+ P     SA   H ++L + LG    A ++ +HSY RSF+GFVA+L   EA+RL   
Sbjct  1     MGDRPTG-KFSATSFHTSMLHQVLGRS--ASDHLLHSYHRSFNGFVAKLTHDEAQRLKGM  57

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
               V+SVF N + +L TTRSWDF+G S    R    ESD+IVG+LDTG+W ES SF D+ +
Sbjct  58    QGVMSVFPNGKKQLHTTRSWDFMGFSEHVKR-ATTESDIIVGMLDTGIWPESQSFSDENF  116

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDGHGSHIASIAAG  707
             GPPP KWKG CQ   NFT CN K+IGA+++  +  F+P D +SP D +GHG+H +S AAG
Sbjct  117   GPPPKKWKGSCQTSSNFT-CNNKIIGAKFYRSDKKFSPFDFKSPRDSEGHGTHTSSTAAG  175

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V  ASL+GI  GTA GGVPSARIA YK+CW  GC D D+LA FD AIADGVD+ISISV
Sbjct  176   GLVSKASLFGIGFGTAIGGVPSARIAVYKICWFDGCADADILAAFDDAIADGVDIISISV  235

Query  888   GGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             G     ++F+D IAIGS+HAMKK I+T+ +AGN GP   ++ NV+PW ++VAA+++DR+F
Sbjct  236   GSFSAVNYFEDTIAIGSFHAMKKGILTSNSAGNSGPDAASLANVAPWTLSVAASTVDRKF  295

Query  1065  ESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG-NYSACDYLSISEKLV  1238
              + VKLGNGE+  G SINT +  GKM+PLI G  A ++   Y G N   C   S+ EKLV
Sbjct  296   VTRVKLGNGEVYEGISINTIDYKGKMFPLIYGGDAPNRTGGYQGSNSRFCSLGSLDEKLV  355

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             +GKIV C    +  +       VG V+  +   D      +P + +D+ DG KI  Y+N+
Sbjct  356   QGKIVLC-DELNDGFGAATARAVGSVMQGNDDRDVAYSFPLPNSYLDLYDGSKIASYLNS  414

Query  1416  TKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T  PTA I +S A K   AP V SFS+RGP  I+ +ILKPDL APG+ ILA++T  ++ +
Sbjct  415   TSIPTATILKSTAEKNEFAPVVASFSSRGPNPITNDILKPDLTAPGVDILASWTQASSPS  474

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG  1772
                 D R+  +N+ SGTSM+ PHA  AAAYVK+F+P WSPAAIKSALMTTA  M ++   
Sbjct  475   --EGDPRISPFNIISGTSMSCPHATAAAAYVKSFYPSWSPAAIKSALMTTATPMSVEANS  532

Query  1773  -AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK-CKNIP  1943
              A  A G+G + P+ AV PGL++D  + +Y+ +LC + +++ +L  +TG  DN+ C N  
Sbjct  533   DAEFAYGSGHLNPSMAVNPGLVYDAGELDYVKFLCGQGYSDKNLSLVTG--DNRSCSNST  590

Query  1944  AAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPN  2123
              A   D LNYPS  L     N TT    F+RTVT VG+  + ++A +    GL + V P+
Sbjct  591   NATVWD-LNYPSFALSTKPGNNTT--QVFHRTVTNVGSAVSTYRAVVYTRPGLMIKVQPS  647

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             +L F    QK+S+ V V+    K+++  +S SLVW D  H VRSP++ +
Sbjct  648   VLYFKSLYQKQSFVVTVTANVGKSVN-MISASLVWDDGVHHVRSPVVAF  695



>ref|XP_002264496.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=773

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/723 (46%), Positives = 454/723 (63%), Gaps = 22/723 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             ++ QRK ++VYMG+LP     S    HHN+L E LG   LA+E  +HSY RSF+GFVARL
Sbjct  26    YEQQRKAHVVYMGDLPKGDA-SVASTHHNMLVEVLGSSSLAKESLLHSYGRSFNGFVARL  84

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E  R+++ + VVSVF NT+++L TTRSWDF  MS         E D+I+G+LDTG+W
Sbjct  85    SDEEVARIADMEGVVSVFPNTKVQLHTTRSWDF--MSFPEPPMGSYEGDVIIGMLDTGIW  142

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP--EDQESPADFD  671
              ES SF+D+G+GPPPAKWKG CQ   NFT CN K+IGA++++ +  A    D +SP D  
Sbjct  143   PESASFRDEGFGPPPAKWKGICQTENNFT-CNNKIIGARFYDTDNLADPLRDTKSPRDTL  201

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHGSH AS AAGR VE AS YGIA G ARGGVP+AR+A YKVCWG GC   D+LA FD A
Sbjct  202   GHGSHTASTAAGRAVENASYYGIASGVARGGVPNARLAVYKVCWGGGCSPADILAAFDDA  261

Query  852   IADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD++SIS+G   P ++ ++P+AIGS+HAMK  I+T+ +AGN+GPY   I N +PW 
Sbjct  262   IADGVDILSISLGSEMPAAYNKEPVAIGSFHAMKNGILTSCSAGNKGPYRRQISNYAPWA  321

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLI-SGTLAQDKNATYPGNYS  1202
             +TVAA++IDR F + V LGNG+ I G S+N F L G  +PL+ SG  A   +A  P    
Sbjct  322   LTVAASTIDRSFVTKVVLGNGQTILGTSLNNFHLDGTSFPLVYSGDAANITSAMSPDIAG  381

Query  1203  ACDYLSISEKLVRGKIVYC--LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVD  1376
              C   ++S    RG +V C  LS +S  ++ +    VG+I +    +      +PA ++ 
Sbjct  382   ICFPGTLSTLKTRGAVVLCNILSDSSGAFSAE---AVGLIMASPFDEIAFAFPVPAVVIS  438

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSR-AVKTTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              +D  K+  YI TT+ PTA I  +       AP V SFS+RGP  IS +ILKPD+ APG 
Sbjct  439   YDDRLKLIDYIRTTEYPTATILSTETTTDVMAPTVVSFSSRGPNPISPDILKPDVTAPGS  498

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
             +ILAA++     +  V D R V Y + SGTSM+ PH  GAA+Y+K  HP WSPAAIKSAL
Sbjct  499   NILAAWSPRGLSSVWVFDDRQVDYYIISGTSMSCPHVTGAASYIKAAHPTWSPAAIKSAL  558

Query  1734  MTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             MTTA  M   K   A  A G+G I P KAV PGL+FD ++++Y+ +LCK+ +N   L  +
Sbjct  559   MTTATIMDPRKNEDAEFAYGSGHINPLKAVDPGLVFDASEADYVDFLCKQGYNTTHLRMI  618

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             TG       N P    A  LNYPS  L L   +     A++ RTVT  G+ ++ + + I 
Sbjct  619   TGDSSVCPSNEPGK--AWDLNYPSFGLSLL--DGEPVQASYLRTVTNFGSPNSTYHSNIT  674

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
              P    V V P +L+F +  +K+S+KV+++G     +   +SG++ W D  H VR+PI V
Sbjct  675   MPPSFAVLVEPPVLTFSEVGEKKSFKVIITGSPIVQVP-VISGAIEWTDGNHVVRTPIAV  733

Query  2268  YRS  2276
             + +
Sbjct  734   FNN  736



>ref|XP_007009158.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY17968.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=1325

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/729 (48%), Positives = 466/729 (64%), Gaps = 28/729 (4%)
 Frame = +3

Query  123   ATLWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSG  302
             A +W  D   K YIVYMG+ P     SA   H NIL E LG         +HSY RSF+G
Sbjct  607   ALVW-DDGVHKVYIVYMGDRPSG-EFSAATLHSNILEEVLGSG--GSNSLLHSYHRSFNG  662

Query  303   FVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLL  482
             FVA+L   EA++L+  + VVSVF +   +L TTRSWDF+G S    R  + ESD+I+G+L
Sbjct  663   FVAKLTKDEAQKLASTEGVVSVFPSQRKQLHTTRSWDFMGFSQNVGRTSR-ESDIIIGML  721

Query  483   DTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESP  659
             DTG+W ES SF D+G+G PP KWKG CQ+  NFT CN K+IGA+Y+  +G F P+D +SP
Sbjct  722   DTGIWPESESFNDEGFGSPPKKWKGTCQESSNFT-CNNKIIGARYYRADGTFGPDDIQSP  780

Query  660   ADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAG  839
              D +GHG+H +S AAG +V  ASL+G+A GTARGGVPSARIA YK+CW  GC D D+LA 
Sbjct  781   RDSEGHGTHTSSTAAGALVSKASLFGLASGTARGGVPSARIAVYKICWSDGCPDEDILAA  840

Query  840   FDAAIADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNV  1016
             FD AIADGVD+ISISVGG    ++F D IAIG++H+MK  I+T+ +AGN GP   TI NV
Sbjct  841   FDDAIADGVDIISISVGGSIAVNYFDDTIAIGAFHSMKNGILTSNSAGNTGPALATITNV  900

Query  1017  SPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG  1193
             SPW ++VAA+SIDR+F + VKLGNGE+  G SINT EL  KMYPLI G  A +    Y  
Sbjct  901   SPWSLSVAASSIDRKFVTQVKLGNGEIYEGVSINTIELKDKMYPLIFGGDAPNTKKGYDS  960

Query  1194  NYSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATI  1370
             + S  C   S+ E LV GKIV C    S          VG +  D L D+     +P + 
Sbjct  961   SQSRYCSEDSLDETLVEGKIVLC-DEVSYGEGAIAAGAVGAVMQDYL-DSAFNFPLPVSC  1018

Query  1371  VDIEDGKKIDKYINT------TKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILK  1529
             +  +DG +I + I         + PTA IF+S  VK   AP+V SFS+RGP  I+ +ILK
Sbjct  1019  LGSDDGSEIREIITLFFFYCFNRKPTATIFKSIQVKDELAPWVVSFSSRGPNPITKDILK  1078

Query  1530  PDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWS  1709
             PDL APG+ ILAA++   T+TG   D RVV YN+ SGTSM+ PHA  AAAY+K+F+P WS
Sbjct  1079  PDLTAPGVDILAAWSQGTTITGVEGDDRVVSYNIISGTSMSCPHATAAAAYIKSFNPTWS  1138

Query  1710  PAAIKSALMTTAKAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-F  1883
             PAAIKSALMTTA  + ++    A  A G+G + P+ A++PGL++D  + +Y+ +LC + +
Sbjct  1139  PAAIKSALMTTAVPLSVETNTDAEFAFGSGHLAPSFALSPGLVYDAGEIDYVKFLCGQGY  1198

Query  1884  NNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGS  2063
             +  +L  +TG + +  + I     A  LNYPS  L  +   +T     F+R +T VG   
Sbjct  1199  STKTLRLVTGDRSSCSEAINGT--AWDLNYPSFALSASLGKST--KRIFHRILTNVGPAV  1254

Query  2064  TVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTH  2243
             +++KA ++AP GL + V P +LSF    QK+S+ V V+ K    +   +SGSL+W+D  H
Sbjct  1255  SIYKAVVQAPRGLEIHVQPRVLSFKSLGQKKSFVVTVTAKVDDNM---VSGSLIWEDGVH  1311

Query  2244  SVRSPILVY  2270
              VRSP++ +
Sbjct  1312  QVRSPVVAF  1320


 Score =   510 bits (1313),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 306/705 (43%), Positives = 410/705 (58%), Gaps = 100/705 (14%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+ P     SA   H++++ E +G    A    +HSY+RSF+GF A+L   EA +L+  
Sbjct  1     MGDPPKG-EFSAATLHNSMIQEIVGSSG-ASNLLLHSYQRSFNGFAAKLTEEEAEKLAGI  58

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
                VSVF + + KL TTRSWDF+G S  + R    ESD+I+G+LDTG+W ES SF D  +
Sbjct  59    KGAVSVFPSQKKKLRTTRSWDFIGFSQHSRRT-TLESDIIIGMLDTGIWPESESFSDQEF  117

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADFDGHGSHIASIAAG  707
             GPPP KWKG CQ   NFT CN K+IGA+Y+  +G  P ED +SP D +GHGSH ASIAAG
Sbjct  118   GPPPKKWKGTCQTSSNFT-CNNKIIGAKYYRADGDCPSEDFKSPRDSEGHGSHTASIAAG  176

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V  ASLYG   GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD+IS+SV
Sbjct  177   GLVSRASLYGFRTGTARGGVPSARIAVYKICWFDGCADEDILAAFDDAIADGVDIISLSV  236

Query  888   GGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG   S +FQD IAIG++H+MKK I+T+ +AGN GPY+G++ N SPW ++V A++IDR+F
Sbjct  237   GGFFGSDYFQDSIAIGAFHSMKKGILTSNSAGNGGPYYGSVVNFSPWSLSVGASTIDRKF  296

Query  1065  ESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRG  1244
             E+ VKLGNG++                                          +E  +  
Sbjct  297   ETKVKLGNGKV-----------------------------------------FTENFI--  313

Query  1245  KIVYCLSSASQDYTIKW--IH----GVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
                  LS A    T KW  IH     VG +I  D + D       P + +D+ DG  +  
Sbjct  314   ----LLSGAEMPRTKKWDTIHPNPGAVGAIIQDDGIKDFAYSFPFPVSNLDLTDGSDVLH  369

Query  1404  YINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             Y+NTTK P A IFRS   K   AP+V SFS+RGP  IS +IL+PD+ APG +ILAA++  
Sbjct  370   YVNTTKNPIATIFRSTEEKDELAPYVVSFSSRGPNPISPDILEPDITAPGAAILAAWSPA  429

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
              T+TG   D RVV YN+ SGTSM+ PHA                         TA    +
Sbjct  430   TTVTGVEGDKRVVPYNIISGTSMSCPHA-------------------------TATNTDL  464

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKN  1937
             +     LA GAG I P+ A+ PGLI+D  + +Y+ +LC + +++  +  +TG K ++C  
Sbjct  465   E-----LAYGAGNINPSLAINPGLIYDAGEIDYVKFLCGQGYSDKQIRLVTGDK-SRCSK  518

Query  1938  IPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
               A  G A  LNYPS    L  P+    S  F+RTVT VG+  + +KA +KAP  L + V
Sbjct  519   --ATNGTASNLNYPS--FTLFAPSGPHISRDFHRTVTNVGSAVSTYKAIVKAPKELDIQV  574

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSV  2249
              P++LSF    +K+S+ V ++ K   A+   +SG+LVW D  H V
Sbjct  575   KPSVLSFKSIGEKKSFVVTIAAKV--ALPSIVSGALVWDDGVHKV  617



>ref|XP_004165775.1| PREDICTED: LOW QUALITY PROTEIN: cucumisin-like [Cucumis sativus]
Length=747

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/725 (45%), Positives = 463/725 (64%), Gaps = 22/725 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGE---LPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFV  308
             HD  RK YIVYMG+     D     +   HH  + E       A E+ +HSY+RSF+GFV
Sbjct  28    HDA-RKVYIVYMGDKLHDTDSDDTDSAPSHHKRILEKGTSSNFAPEFLLHSYKRSFNGFV  86

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   EA+++S  ++VVS+F N +  L TTRSWDF+G++  A R  + ES+L+VG+ DT
Sbjct  87    AKLTEEEAQKISAMEEVVSLFPNEKKHLHTTRSWDFIGLTKDAPRVKQVESNLVVGVFDT  146

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQ-YFNVEGFAPEDQESPAD  665
             G+W E+PSF D GYGP PAKWKG CQ   NFT CN+K+IGA+ Y +   F PED  SP D
Sbjct  147   GIWPENPSFSDVGYGPIPAKWKGTCQTSANFT-CNKKIIGARAYRSNNDFPPEDIRSPRD  205

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
              DGHG+H AS   G +V  AS YG+A GTARGG PSA IA YK+CW  GC   D+LA FD
Sbjct  206   SDGHGTHTASTVVGGLVNEASFYGLARGTARGGTPSACIAVYKICWSDGCYSTDILAAFD  265

Query  846   AAIADGVDVISISVGGHPRS--FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVS  1019
              AIADGVD+ISIS+G  P+S  +F DP AIG++HAMK  I+T+ +AGNEGP + ++ NV+
Sbjct  266   DAIADGVDIISISLGS-PQSSPYFLDPTAIGAFHAMKNGILTSTSAGNEGPNYFSVSNVA  324

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGN  1196
             PW ++V A++IDR+  S V+LGN  +  GF+INTF+L GK YPLI    A +    + G+
Sbjct  325   PWALSVGASTIDRKLASKVELGNRNIYQGFTINTFDLEGKQYPLIYARDAPNIAGGFTGS  384

Query  1197  YSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATI  1370
              S  C   S++  LV+GK++ C S       + +   VGVI +D +  D+     +P++ 
Sbjct  385   MSRFCSANSVNANLVKGKVLVCDSVLPPSRFVNFSDAVGVIMNDGRTKDSSGSYPLPSSY  444

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             +   DG  +  Y+++  APTA I++S A+  T+AP V SFS+RGP   + +ILKPDL AP
Sbjct  445   LTTADGNNVKTYMSSNGAPTATIYKSNAINDTSAPLVVSFSSRGPNPQTFDILKPDLTAP  504

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILAA++ +A ++  V D+R   YN+ SGTSM+ PH   AA  VKTFHP WSPAAI+S
Sbjct  505   GVQILAAWSPIAPVSSGVIDSRKTLYNIISGTSMSCPHVTAAAVXVKTFHPTWSPAAIQS  564

Query  1728  ALMTTAKAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ALMTTA  +  +  + A  A GAG I P KA+ PGL++D  +S+Y+ +LC + +  + + 
Sbjct  565   ALMTTATPLSAVLNMQAEFAYGAGQIDPVKAIDPGLVYDAGESDYVKFLCGQGYTTSMVQ  624

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
               +  K+  C +    +  D LNYPS    L++  +  F+  F RT+T VG+ ++ + + 
Sbjct  625   RFSNDKNTVCNSTNMGRVWD-LNYPS--FALSSSPSRPFNQYFTRTLTNVGSKASTYTST  681

Query  2082  IKA-PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
             ++  P GLT++V P  LSF  T  KR++ + + G    +I    S SL+W D +H+VRSP
Sbjct  682   VRGTPQGLTITVNPTSLSFNSTGXKRNFTLTIRGTVSSSI---ASASLIWSDGSHNVRSP  738

Query  2259  ILVYR  2273
             I V++
Sbjct  739   ITVFK  743



>emb|CAN77548.1| hypothetical protein VITISV_004712 [Vitis vinifera]
Length=799

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/718 (48%), Positives = 451/718 (63%), Gaps = 29/718 (4%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             + YIVYMG+LP    +SA     NIL E  G      EY +HSY+RSF+GFVARL   E+
Sbjct  36    QEYIVYMGDLPKG-QVSASSLQANILQEVTGS---GSEYLLHSYKRSFNGFVARLTEEES  91

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
             R LS  D VVSVF N + KLLTTRSWDF+G   +AN+    ESD+IVG+LDTG+W ES S
Sbjct  92    RELSSMDGVVSVFPNGKKKLLTTRSWDFIGFPLEANKT-TTESDIIVGMLDTGIWPESAS  150

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGSHI  689
             F D+G+GPPP+KWKG CQ   NFT CN K+IGA+Y+  +GF P  D  SP D +GHG+H 
Sbjct  151   FSDEGFGPPPSKWKGTCQTSSNFT-CNNKIIGAKYYRSDGFIPSVDFASPRDTEGHGTHT  209

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAG +V GASL G+  GTARGG PSARIA YK+CW  GC D D+LA FD AIADGVD
Sbjct  210   ASTAAGNVVSGASLLGLGAGTARGGTPSARIAVYKICWADGCYDADILAAFDDAIADGVD  269

Query  870   VISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +IS+SVGG  P  +F+DPIAIG++H+MK  I+T+ A GN  P   +I N SPW ++VAA+
Sbjct  270   IISLSVGGSFPLDYFEDPIAIGAFHSMKNGILTSNAGGNSXPDPASITNFSPWSLSVAAS  329

Query  1047  SIDRRFESDVKLGNGELISG-FSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
              IDR+F + + LGN     G  S+NTFE+  M PLI G  A + +A    +YS  C   S
Sbjct  330   VIDRKFLTALHLGNNLTYEGXLSLNTFEMNDMVPLIYGGDAPNTSAGSDAHYSRYCLEGS  389

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
             ++E LV GKIV C         +       V+ +D   D      +P + +D      + 
Sbjct  390   LNESLVTGKIVLCDGLGDGVGAMSAGAAGTVMPNDGYTDLSFAFPLPTSCLDSNYTSDVH  449

Query  1401  KYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
             +YIN+T  PTA I ++  VK   APFV  FS+RGP  I+ +IL PD+AAPG++ILAA+T 
Sbjct  450   EYINSTSTPTANIQKTTEVKNELAPFVVWFSSRGPNPITRDILSPDIAAPGVNILAAWTX  509

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
              +++TG   DTRVV YN+ SGTSMA PHA+GAAAYVK+FHP WSPAAIKSALMTTA  + 
Sbjct  510   XSSLTGVPGDTRVVPYNIISGTSMACPHASGAAAYVKSFHPTWSPAAIKSALMTTASRLS  569

Query  1758  IKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
             ++       A GAG + P  A  PGL++D  +++Y+ +LC + +N   L  +TG      
Sbjct  570   VETNTDLEFAYGAGQLNPLLAANPGLVYDAGEADYIKFLCGQGYNTTKLHLVTG------  623

Query  1932  KNIPAAQGADG----LNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             +NI  +   +G    LNYPS    ++  N    +  F RTVT VG+  + +KA +  P  
Sbjct  624   ENITCSAATNGTVWDLNYPS--FAVSTDNGVGVTRTFTRTVTNVGSPVSTYKANVAGPPE  681

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSV--RSPILV  2267
             L++ V P++LSF    + +++ V V        S  +SGSLVW D  + V  R P LV
Sbjct  682   LSIQVEPSVLSFKSLGETQTFTVTVG--VAALSSPVISGSLVWDDGVYKVMGRGPWLV  737



>ref|XP_006486542.1| PREDICTED: cucumisin-like [Citrus sinensis]
Length=714

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/716 (45%), Positives = 444/716 (62%), Gaps = 16/716 (2%)
 Frame = +3

Query  153   KPYIVYMGELPD-DPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             + YIVYMG  P     +S+   H ++L   +    +     + +YR+SF+GF  +L   E
Sbjct  2     QTYIVYMGNQPQLQSQLSSASLHMSMLQRVI-RSNIGPGSILRNYRKSFNGFAVKLTEEE  60

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             AR ++    VVSVF N + KL TTRSWDF+G S + +R+   ESD+++G+ DTG+W ES 
Sbjct  61    ARIMAGMGGVVSVFPNRKRKLHTTRSWDFMGFSQQVDRSTTEESDIVIGVFDTGIWPESE  120

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSH  686
             SF   G+GPPP KW+G CQ   NFT CN K++GA+Y+  +G F P+D  SP D DGHGSH
Sbjct  121   SFNGTGFGPPPTKWRGSCQVSANFT-CNNKIVGARYYKSDGEFGPDDLPSPRDTDGHGSH  179

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG +V  A+LYG + GTARG VPSARIA YK+CW  GC D D+LA FD AIADGV
Sbjct  180   TASTAAGNLVSMANLYGFSSGTARGCVPSARIAVYKICWSDGCDDADILAAFDDAIADGV  239

Query  867   DVISISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+IS+S+G  +P  +F D IAIG++HAM+  I+T+A+AGN+GP   TI NV+PW ++VAA
Sbjct  240   DIISLSLGSSNPHEYFNDSIAIGTFHAMRNGILTSASAGNDGPSRSTITNVAPWFISVAA  299

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFELGKM-YPLISGTLAQDKNATYPGNYSA-CDYL  1217
             ++IDR+F + V+LGN  +  G SINT++L  + YPLI G  A + +  +  + S  C   
Sbjct  300   STIDRKFSTKVQLGNNNIYEGISINTYDLQNVTYPLIYGGDAANISGGFTDSSSRFCYQD  359

Query  1218  SISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKI  1397
             S+ + LV+GKIV C    S +          ++   +  D      +P + VD  DG  I
Sbjct  360   SLDQNLVKGKIVVCDDLVSGEGPFSAGAVGALMQGQRRRDRAFSFPLPTSYVDTNDGSDI  419

Query  1398  DKYIN--TTKAPTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
               YIN  +T+  TA I+RS     T APFV S S+RGP  I+ +ILKPD++APG+ ILAA
Sbjct  420   LLYINSTSTRNATATIYRSTEGNNTLAPFVGSLSSRGPNPITPDILKPDISAPGIDILAA  479

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             ++ +  ++    D R V YN+ SGTSMA PH  GAAAY+K+FHP WSPAAIKSALMTTA 
Sbjct  480   WSPVNPVSEVKGDPRFVPYNIISGTSMACPHVTGAAAYIKSFHPTWSPAAIKSALMTTAT  539

Query  1749  AM-KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDN  1925
              M   K   A  A G+G + P K++ PGL++D    +Y+ +LC    + +L  L    ++
Sbjct  540   PMSSAKNRDAEFAYGSGHVNPIKSLNPGLVYDAEAIDYVKFLCGHGYSTNLLQLVTGDNS  599

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSA-AFYRTVTYVGTGSTVFKAKIKAPTGL  2102
              C     A   D LNYPS+ L +    +   S+  F R VT VG+  + +KA + AP GL
Sbjct  600   SCSETIHATVWD-LNYPSLALSVFPFESNNISSRVFNRVVTNVGSPLSTYKASVTAPAGL  658

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              + V PN+LSF    QK+ +++ + G     I   +S SLVW D  H VRSPI+VY
Sbjct  659   KIQVNPNVLSFTSLGQKQPFQLTIEGTI---IESTVSASLVWDDGVHQVRSPIVVY  711



>ref|XP_006435587.1| hypothetical protein CICLE_v10033808mg [Citrus clementina]
 gb|ESR48827.1| hypothetical protein CICLE_v10033808mg [Citrus clementina]
Length=702

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/708 (47%), Positives = 456/708 (64%), Gaps = 24/708 (3%)
 Frame = +3

Query  180   LPDDPT--ISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKD  353
             + D PT   SA   H ++L + LG    A ++ +HSY RSF+GFVA+L   EA+RL    
Sbjct  1     MGDRPTGKFSATSFHTSMLHQVLGRS--ASDHLLHSYHRSFNGFVAKLTHDEAQRLKGMQ  58

Query  354   KVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYG  533
              V+SVF N + +L TTRSWDF+G S    R    ESD+IVG+LDTG+W ES SF D+ +G
Sbjct  59    GVMSVFPNGKKQLHTTRSWDFMGFSEHVKR-ATTESDIIVGMLDTGIWPESQSFSDENFG  117

Query  534   PPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDGHGSHIASIAAGR  710
             PPP KWKG CQ   NFT CN K+IGA+++  +  F+P D +SP D +GHG+H +S AAG 
Sbjct  118   PPPKKWKGSCQTSSNFT-CNNKIIGAKFYRSDKKFSPFDFKSPRDSEGHGTHTSSTAAGG  176

Query  711   MVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVG  890
             +V  ASL+GI  GTA GGVPSARIA YK+CW  GC D D+LA FD AIADGVD+ISISVG
Sbjct  177   LVSKASLFGIGFGTAIGGVPSARIAVYKICWFDGCADADILAAFDDAIADGVDIISISVG  236

Query  891   GHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFE  1067
                  ++F+D IAIGS+HAMKK I+T+ +AGN GP   ++ NV+PW ++VAA+++DR+F 
Sbjct  237   SFSAVNYFEDTIAIGSFHAMKKGILTSNSAGNSGPDAASLANVAPWTLSVAASTVDRKFV  296

Query  1068  SDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG-NYSACDYLSISEKLVR  1241
             + VKLGNGE+  G SINT +  GKM+PLI G  A ++   Y G N   C   S+ EKLV+
Sbjct  297   TRVKLGNGEVYEGISINTIDYKGKMFPLIYGGDAPNRTGGYQGSNSRFCSLGSLDEKLVQ  356

Query  1242  GKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTT  1418
             GKIV C    +  +       VG V+  +   D      +P + +D+ DG KI  Y+N+T
Sbjct  357   GKIVLC-DELNDGFGAATARAVGSVMQGNDDRDVAYSFPLPNSYLDLYDGIKIASYLNST  415

Query  1419  KAPTAEIFRSRA-VKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
               PTA I +S A     AP V SFS+RGP  I+ +ILKPDL APG+ ILA++T  ++ + 
Sbjct  416   SIPTATILKSTAETNEFAPVVVSFSSRGPNPITNDILKPDLTAPGVDILASWTQASSPS-  474

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG-  1772
                D R+  +N+ SGTSM+ PHA  AAAYVK+F+P WSPAAIKSALMTTA  M ++    
Sbjct  475   -EGDPRISPFNIISGTSMSCPHATAAAAYVKSFYPSWSPAAIKSALMTTATPMSVEANSD  533

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNK-CKNIPA  1946
             A  A G+G + P+ AV PGL++D  + +Y+ +LC + +++ +L  +TG  DN+ C N   
Sbjct  534   AEFAYGSGHLNPSMAVNPGLVYDAGELDYVKFLCGQGYSDKNLSLVTG--DNRSCSNSTN  591

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNI  2126
             A   D LNYPS  L     N TT    F+RTVT VG+  + ++A +    GL + V P++
Sbjct  592   ATVWD-LNYPSFALSTKPGNNTT--QVFHRTVTNVGSAVSTYRAVVYTRPGLMIKVQPSV  648

Query  2127  LSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L F    QK+S+ V V+    K+++  +S SLVW D  H VRSP++ +
Sbjct  649   LYFKSLYQKQSFVVTVTANVGKSVN-MISASLVWDDGVHHVRSPVVAF  695



>ref|XP_008461745.1| PREDICTED: LOW QUALITY PROTEIN: cucumisin-like [Cucumis melo]
Length=705

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/706 (46%), Positives = 450/706 (64%), Gaps = 12/706 (2%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+      ++A + H N+L + L   + ++   ++SY RSFSGF ARL   EAR+L+E 
Sbjct  1     MGKPSGGGLLAASELHTNMLQQVLTTSDASKSL-VYSYHRSFSGFAARLNNDEARKLAEM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D+VVSVF + + +L TTRSWDF+G   +  R    ESDLI+G+LDTG+W ES SF D+G+
Sbjct  60    DEVVSVFPSEKYQLHTTRSWDFMGFFQQVPRT-TLESDLIIGMLDTGIWPESKSFSDEGF  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIASIAAGR  710
             GPPP+KWKG+C+  LNFT CN K+IGA++F  E  +  D  SP D  GHG+H +S A G 
Sbjct  119   GPPPSKWKGECKPNLNFT-CNNKIIGARFFRSEPLSGADILSPRDTKGHGTHTSSTAGGN  177

Query  711   MVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVG  890
              V GA+L+G+A GT+RGGVPSARIA YK+CW  GC   D+LA FD AIADGVD+ISISVG
Sbjct  178   FVSGANLFGLAAGTSRGGVPSARIAVYKICWSDGCFSADILAAFDHAIADGVDIISISVG  237

Query  891   -GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFE  1067
                 +++F D IAIG++HAMK  I+T+ + GN GP  G+I NVSPW ++VAA++IDR+F 
Sbjct  238   FFFSKNYFNDSIAIGAFHAMKNGILTSNSGGNSGPSLGSITNVSPWSLSVAASTIDRKFV  297

Query  1068  SDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYS-ACDYLSISEKLVR  1241
             + V LGNGE   G S+NTF++G K++PLI    A +  A +  + S  C   S+    VR
Sbjct  298   TKVTLGNGESFHGISLNTFDVGDKLFPLIHAGDAPNTTAGFSRSISRLCFPGSLDVDKVR  357

Query  1242  GKIVYC-LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTT  1418
             GKIV C L+S  +   I    G  ++    LP+      +P +++++  GK + +Y+ + 
Sbjct  358   GKIVICDLNSDGEAALISGAVG-SIMQVPALPEVAFLFPLPISLINLNAGKNVFQYLRSN  416

Query  1419  KAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
               P A I +S  ++  ++P V  FS+RGP  I+L+ILKPDLAAPG+ ILA+++    +TG
Sbjct  417   SNPEAIIEKSTTIEDLSSPSVVPFSSRGPSIITLDILKPDLAAPGVDILASWSEGTPITG  476

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-PIG  1772
              V D R+  +N+ SGTSM+ PHA GAA YVK+FHP WSPAAIK ALMTTA AM  K    
Sbjct  477   VVGDNRIAPFNIISGTSMSCPHATGAAVYVKSFHPTWSPAAIKXALMTTAFAMSPKLNTD  536

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNIPAAQ  1952
             A  A GAG + P  AV PGL++D  + +Y+ +LC +  +     L     N C ++    
Sbjct  537   AEFAYGAGHLNPVNAVNPGLVYDAEELDYIKFLCGQGYSTEKLRLVSGDQNNCSDVTKTA  596

Query  1953  GADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILS  2132
              +D LNYPS  L + +P+  + S  ++RTVT VG   + +KA IKAP GL V+V P  LS
Sbjct  597   ASD-LNYPSFGLVIISPSKRSISRVYHRTVTNVGMPVSTYKAVIKAPPGLKVTVRPATLS  655

Query  2133  FPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             F    QK S+ V V  K        +SGSL W D  H VRSPI+ +
Sbjct  656   FRSLGQKISFTVTVRAKADVG-GKVVSGSLTWDDGVHLVRSPIVSF  700



>gb|KHN07611.1| Cucumisin [Glycine soja]
Length=708

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/715 (45%), Positives = 461/715 (64%), Gaps = 16/715 (2%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             + YIVY G   +D   SA+  + ++L E + D     +   H ++RSFSGFVA L   EA
Sbjct  2     QSYIVYTGNSMNDEA-SALTLYSSMLQE-VADSNAEPKLVQHHFKRSFSGFVAMLTEEEA  59

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
              R++  D+VV+VF N + +L TTRSWDF+G   +ANR P AESD+I+ +LD+G+W ES S
Sbjct  60    DRMARHDRVVAVFPNKKKQLHTTRSWDFIGFPLQANRAP-AESDVIIAVLDSGIWPESES  118

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHI  689
             F D G+GPPP+KWKG CQ   NFT CN K+IGA+ +  +G F+ +D +S  D DGHG+H+
Sbjct  119   FNDKGFGPPPSKWKGTCQTSKNFT-CNNKIIGAKIYKADGFFSDDDPKSVRDIDGHGTHV  177

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAG  V  AS+ G+ +GTARGG   ARIA YKVCW  GC D D+LA FD AIADGVD
Sbjct  178   ASTAAGNPVGTASMLGLGQGTARGGATKARIAVYKVCWFDGCSDADILAAFDDAIADGVD  237

Query  870   VISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +I++S+GG +  +FF+D IAIG++HA++   +T  +AGN GP   ++ N SPW +TVAA+
Sbjct  238   IITVSLGGFNDENFFRDVIAIGAFHAVRNGALTVTSAGNGGPRPSSLSNFSPWSITVAAS  297

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
             +IDR+F + V+LGN     G SINTF+L G++YP+I G  A +K     G+ S  C   S
Sbjct  298   TIDRKFVTKVELGNKITYEGTSINTFDLKGELYPIIYGGDAPNKGVGIDGSSSRFCFSGS  357

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
             + +KLV GKIV C S +             ++      D  L   +P + + ++DG  + 
Sbjct  358   LDKKLVHGKIVLCDSRSQVSGPFDAGAVGALVQGQGFRDIPLSFPLPGSYLALQDGVSVY  417

Query  1401  KYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
              YIN+T+ PTA IF++   K T AP V SFS+RGP  ++  ILKPDL APG+SILA+++ 
Sbjct  418   DYINSTRTPTATIFKTDETKDTIAPVVASFSSRGPNIVTPEILKPDLVAPGVSILASWSP  477

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
             ++  +    D R + +N+ SGTSMA PH +GAAAYVK+FHP WSPAAI+SALMTTAK + 
Sbjct  478   VSPPSDIEGDNRTLNFNIISGTSMACPHVSGAAAYVKSFHPTWSPAAIRSALMTTAKQLS  537

Query  1758  IKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKC  1931
              K  + A  A G+G I P+KAV PGL++D  + +Y+ +LC + ++  +L  +TG  ++ C
Sbjct  538   PKTNLQAEFAYGSGQIDPSKAVYPGLVYDAGEIDYVRFLCGQGYSTRTLQLITG-DNSSC  596

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
                      D LNY S  L +   N+ + S +F RTV  VG+ ++ +KA + +P GL + 
Sbjct  597   PETKNGSARD-LNYASFALFVPPSNSNSISGSFNRTVINVGSPTSTYKATVTSPEGLKIK  655

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             V P++L F   NQK+++ + + G+ +  I   +SGSLVW D  + VRSPI+V+ +
Sbjct  656   VNPSVLPFTSLNQKQTFVLTIEGQLKGPI---VSGSLVWGDGKYQVRSPIVVFNT  707



>ref|XP_008454861.1| PREDICTED: xylem serine proteinase 1-like [Cucumis melo]
Length=777

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/700 (48%), Positives = 446/700 (64%), Gaps = 13/700 (2%)
 Frame = +3

Query  198   ISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRN  377
             +  +D + N+L         A+E  ++SY  +F+ F A+L   EA+ LSE+  V  V  N
Sbjct  78    VDGLDINLNVLMSVKESHVEAKESMVYSYTNNFNAFAAKLTEAEAKTLSERGDVQHVIPN  137

Query  378   TEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKG  557
                KL TTRSWDFLG    A R  + ESD+IVGL DTG+   + SFKDDG+GPPP KWKG
Sbjct  138   RYRKLQTTRSWDFLGFPINAKRKTRQESDIIVGLFDTGITPTADSFKDDGFGPPPKKWKG  197

Query  558   KCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIASIAAGRMVEGASLY  734
              C    NF+GCN K+IGA+YF ++G   P D  SP D +GHG+H +S A G ++ GA+L 
Sbjct  198   TCDHFANFSGCNNKLIGARYFKLDGLTEPLDILSPIDINGHGTHTSSTATGNVITGANLS  257

Query  735   GIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVDVISISVGGHPR-SF  908
             G+A+GTARGGVPSAR+A YKVCW   GC DMD+LA FDAAI DGVDVISIS+ G    ++
Sbjct  258   GLAQGTARGGVPSARVAMYKVCWTSTGCSDMDLLAAFDAAIQDGVDVISISIAGIGYGNY  317

Query  909   FQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGN  1088
              +DPI+IG++HAMKK I+T  AAGN GP  GT+ N +PW++TVAA+SIDR F S V+LGN
Sbjct  318   TEDPISIGAFHAMKKGIITVTAAGNNGPSAGTVVNHAPWILTVAASSIDRTFISPVELGN  377

Query  1089  GELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVRGKIVYC-L  1262
             G+ ISG  IN F    KMY L+SG     KN     + + C   S+    V+  IV+C L
Sbjct  378   GKNISGVGINLFNPEKKMYKLVSGEDVA-KNIESKDDATYCVENSLDPSKVKDSIVFCKL  436

Query  1263  SSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEI  1439
              +   D  +K I   G ++ SD+  D     M P+T+V    G  ID YI++++ PTA I
Sbjct  437   LTWGADSAVKSIGAAGAILQSDQFLDNTDIFMAPSTLVSSFVGATIDSYIHSSRTPTAVI  496

Query  1440  FRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVV  1619
             +++R     AP V  FS+RGP   S  ILKPD+AAPG++ILA YT L ++TG   DT+  
Sbjct  497   YKTRQHIGAAPIVAPFSSRGPNPGSTRILKPDIAAPGVNILAGYTPLKSLTGLKGDTQFS  556

Query  1620  KYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK--PIGAYLASGA  1793
             K+ + SGTSMA PH A AAAYVK+FHP WSPAAI+SAL+TTAK +  +  P G +   GA
Sbjct  557   KFTLMSGTSMACPHVAAAAAYVKSFHPLWSPAAIRSALLTTAKPISRRGNPDGEF-GYGA  615

Query  1794  GLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLN  1970
             G + P KA  PGLI+D+N+  Y+ +LC E ++ +S+  LTG+K   C  I   QG D LN
Sbjct  616   GNLNPGKAKNPGLIYDLNEMSYIQFLCSEGYSGSSISILTGTKSINCATIIRGQGYDSLN  675

Query  1971  YPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQ  2150
             YP+  L+L +    T +A F+R VT VGT  +V+   + AP G+ ++V P  LSF    Q
Sbjct  676   YPTFQLRLQSTRQPT-TAVFWREVTNVGTPVSVYNTTVWAPPGVEITVEPATLSFSYLLQ  734

Query  2151  KRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             K  +KVVV      + +  +SGS+ W +  + VRSPI+VY
Sbjct  735   KERFKVVVKANPLPS-NKMVSGSITWFNPRYVVRSPIVVY  773



>ref|XP_010662562.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=750

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/713 (47%), Positives = 447/713 (63%), Gaps = 14/713 (2%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             +IVYMGE P    +S V  HH++L   LG    A+E  I+SY RSF+GF A+L   E  R
Sbjct  4     HIVYMGEKPHG-AVSMVSMHHSMLASVLGSTASAKESLIYSYGRSFNGFAAKLSDEEVTR  62

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
              ++ D VVSV  N+ ++L TTRSWDF+G  T+++       D+I+GLLDTG+W ES SF 
Sbjct  63    FADMDGVVSVVPNSMLELHTTRSWDFMGF-TQSHVRDSLGGDVIIGLLDTGIWPESESFS  121

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFN-VEGFAPEDQESPADFDGHGSHIAS  695
             D+G+GPPPAKWKG CQ   NFT CN K+IGA+Y+N    +   D +SP D +GHG+H AS
Sbjct  122   DEGFGPPPAKWKGMCQTENNFT-CNNKIIGARYYNSYNEYYDGDIKSPRDSEGHGTHTAS  180

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVI  875
              AAGR V GAS YG+A+G ARGG P+ARIA YKVCW +GC   D+LA FD AIADGVD+I
Sbjct  181   TAAGREVAGASFYGLAQGLARGGYPNARIAVYKVCWVRGCAAADILAAFDDAIADGVDII  240

Query  876   SISVG-GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             S+S+G   P  +F+D IAIGS+HAM + I+T+ +AGN+GP+ G + N SPW +TVAA+SI
Sbjct  241   SVSLGFTFPEPYFEDVIAIGSFHAMGQGILTSTSAGNDGPWLGWVSNYSPWSLTVAASSI  300

Query  1053  DRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNAT-YPGNYSACDYLSISE  1229
             DR+F S + LGNG++ SG  IN  EL   YPLI G  A + +A   P + + C    +  
Sbjct  301   DRKFVSKLVLGNGQIFSGIVINNLELNGTYPLIWGGDAANVSAQETPLSSADCLPGDLDS  360

Query  1230  KLVRGKIVYCLSSASQDYTIKWIHGVGVIA-SDKLPDTVLPTMIPATIVDIEDGKKIDKY  1406
             + V+GKIV C         I    GVG+I  +    D      +PAT++  +D  K+ +Y
Sbjct  361   RKVKGKIVLCEFLWDGSGVIM-AGGVGIIMPAWYFNDFAFTFPLPATLLRRQDMDKVLQY  419

Query  1407  INTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALA  1583
                +K P A I      K   AP V SFS+RGP  IS +ILKPDL APG+ ILAA++ + 
Sbjct  420   ARFSKNPIATILVGETRKDVMAPIVASFSSRGPNPISPDILKPDLTAPGVDILAAWSPIV  479

Query  1584  TMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI-  1760
             + +    DTR  +YN+ SGTSM+ PHA+GAAAYVK+ HP WSPAAIKSALMTTA  M   
Sbjct  480   SPSEYEHDTRTAQYNIISGTSMSCPHASGAAAYVKSIHPSWSPAAIKSALMTTAYVMDTR  539

Query  1761  KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNI  1940
             K      A G+G I P KAV PGLI++ +K++Y+++LCK+  N S   L    D+ C + 
Sbjct  540   KNEDKEFAYGSGHINPVKAVDPGLIYNTSKADYINFLCKQGYNTSTLRLITGDDSVCNST  599

Query  1941  PAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVP  2120
                +  D LNYPS  L +   +       F RTVT VG+ ++ + A +  P  + + V P
Sbjct  600   KPGRAWD-LNYPSFSLAIE--DGQDIMGIFSRTVTNVGSPNSTYHASVYMPNSIEIEVEP  656

Query  2121  NILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
              +LSF    +K+S+ V V G  Q  +   +SG+++W D  H VR+P+ VY  L
Sbjct  657   PVLSFSAIGEKKSFTVRVYGP-QINMQPIISGAILWTDGVHVVRAPLAVYTVL  708



>ref|XP_008437519.1| PREDICTED: cucumisin-like isoform X1 [Cucumis melo]
Length=746

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/726 (46%), Positives = 455/726 (63%), Gaps = 25/726 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISA-VDEHHN--ILTEALGDEELAREYRIHSYRRSFSGFVA  311
             D  RK YIVYMG  P D   S  +  HH+  +L EA+G    A    +HSY+RSF+GFVA
Sbjct  27    DQYRKTYIVYMGSHPKDQVSSTPLSSHHHMRLLQEAIG-STFAPHCLLHSYKRSFNGFVA  85

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTG  491
             +L   EA+++SE + V+SVF N E++L TTRSWDF+G S +  R P  ESD+IVG+ DTG
Sbjct  86    KLTETEAKKVSEMEGVISVFPNEELQLHTTRSWDFMGFSEQVERVPSVESDIIVGVFDTG  145

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPADF  668
             +W ESPSF D GYGPPP KWKG C+  LNF+ CN K+IGAQ +  +G  P +D + P D 
Sbjct  146   IWPESPSFLDHGYGPPPPKWKGSCEVSLNFS-CNNKIIGAQSYRSDGRYPIDDIKGPRDS  204

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             +GHG+H AS  AG +V  AS+ G+  GTARGGVPSARIA+YKVCW   C   DVLA FD 
Sbjct  205   NGHGTHAASTVAGGLVRQASMLGLGTGTARGGVPSARIAAYKVCWSDTCSGADVLAAFDD  264

Query  849   AIADGVDVISISVGGHPR----SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNV  1016
             AIADGVD+IS+SVG  P+    ++F DPIAIG++HAM+  I+T+++AGNEGP   T+ N 
Sbjct  265   AIADGVDIISLSVG--PKRPIPNYFNDPIAIGTFHAMRNGILTSSSAGNEGPRPFTLTNF  322

Query  1017  SPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG  1193
             SPW ++VAA++ DRRF + V+LG+G   +G +INTF+L G  YPL+      +    + G
Sbjct  323   SPWALSVAASTTDRRFLTAVQLGDGRKFNGVTINTFDLNGTQYPLVHAGNIPNVTGGFNG  382

Query  1194  NYSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPAT  1367
             + S  C   S+  +LV+GKI  C S             +G+I  D  P D      +PA+
Sbjct  383   SISRFCLGNSVDRELVKGKIAVCDSIVLPSDVGSLESALGIIMQDGSPKDLTAAFPLPAS  442

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAA  1544
              +  +    I  Y+N T+ PTA I +S  +K   AP V SFS+RGP   + +ILKPD+  
Sbjct  443   HLGTQQRPLISSYLNLTRIPTATILKSTELKLEAAPLVASFSSRGPNPTTPDILKPDVIG  502

Query  1545  PGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             PG+ ILAA++ + + +    D R + +N+ SGTSMA PHA   AAYVK+FHP WSPAA+K
Sbjct  503   PGVEILAAWSPIRSPSDAKGDNRKLLFNIISGTSMACPHATAVAAYVKSFHPSWSPAALK  562

Query  1725  SALMTTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASL  1898
             SAL+TTA  M+  + P  A  A G+G I P  AV PGLI++ ++ +Y+ +LC E  N +L
Sbjct  563   SALITTAFPMRGDLYP-EAEFAYGSGHINPLGAVNPGLIYNASEIDYIRFLCGEGYNTTL  621

Query  1899  GSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKA  2078
               +    ++ C    +    D LNY S    L    +T FS  + R VT VG+ ++ +KA
Sbjct  622   LRIITKDNSTCSPTNSGLVYD-LNYHS--FALFTYISTPFSQVYKRRVTNVGSTNSTYKA  678

Query  2079  KIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
              I AP+ L ++V P+ LSF    ++  ++V + GK   +I+   S SLVW D  H VRSP
Sbjct  679   TIFAPSELNITVNPSTLSFKALEEELKFEVTIEGKINGSIA---SASLVWDDGVHKVRSP  735

Query  2259  ILVYRS  2276
             I+V+ S
Sbjct  736   IIVFDS  741



>ref|XP_006590070.1| PREDICTED: cucumisin-like [Glycine max]
 gb|KHN30262.1| Cucumisin [Glycine soja]
Length=734

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/730 (47%), Positives = 457/730 (63%), Gaps = 46/730 (6%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              RK YIVYMG+ P     S    H +++   LG  + A +  +HSY++SF+GFVA+L   
Sbjct  27    DRKTYIVYMGDHPKGVVQSTELLHISMVQNILG-SKFAPDALLHSYKKSFNGFVAKLTEE  85

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA R++  D VVSVF+N + KL TT+SWDF+G S    R    ESD+IVG++D G+W ES
Sbjct  86    EAARMAGLDGVVSVFQNKKNKLQTTKSWDFIGFSQNVKRT-SIESDIIVGVIDFGIWPES  144

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGS  683
              SF D G+GPPP KWKG C    NFT CN K+IGA+YF ++G F  +D  SP D +GHG+
Sbjct  145   DSFNDKGFGPPPQKWKGTCH---NFT-CNNKIIGAKYFRMDGSFGEDDIISPRDSNGHGT  200

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS AAG  VE  S +G+A GTARGGVPSARIA YK CW  GC D D+L  FD AIAD 
Sbjct  201   HCASTAAGNSVESTSFFGLASGTARGGVPSARIAVYKPCWSSGCDDADILQAFDEAIADD  260

Query  864   VDVISISVG----GHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             VDVISIS+G     H R++F+D  AIG++HAMKK I+T+ +AGNEGP   T+   +PWL+
Sbjct  261   VDVISISLGPVSVDH-RNYFEDVFAIGAFHAMKKGILTSHSAGNEGPELSTMSVYAPWLL  319

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-A  1205
             +VAA++ DR+  + V+LG+G +  G S+NTF+L  + YPLI    A +    +  + S +
Sbjct  320   SVAASTTDRKLFTLVQLGDGTVYEGVSVNTFDLKNESYPLIYAGDAPNITGGFNRSISRS  379

Query  1206  CDYLSISEKLVRGKIVYC----------LSSASQDYTIKWIHGVGVIASDKLPDTVLPTM  1355
             C   S+ E LV+GKIV C          L+S +    ++       +AS  + +T     
Sbjct  380   CIQNSLDEDLVKGKIVLCDGLIGSRSLGLASGAAGILLR------SLASKDVANTF---A  430

Query  1356  IPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKP  1532
             +PA  +   DG  I  YIN T  PTA IF+S   K + AP++ SFS+RGP  I+ NILKP
Sbjct  431   LPAVHLSSNDGALIHSYINLTGNPTATIFKSNEGKDSLAPYIASFSSRGPNPITPNILKP  490

Query  1533  DLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSP  1712
             DLAAPG+ ILAA++ ++ + G   D R   YN+ SGTSMA PH   AAAY+K+FHPDWSP
Sbjct  491   DLAAPGVDILAAWSPISPVAGVKGDERNGNYNIISGTSMACPHVTAAAAYIKSFHPDWSP  550

Query  1713  AAIKSALMTTAKAMKI--KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-F  1883
             A IKSALMTTA  M I   P  A  A GAG I P KA+ PGL++D N+ +Y+ +LC + +
Sbjct  551   ATIKSALMTTATPMSIALNP-EAEFAYGAGQINPIKALNPGLVYDANEIDYVKFLCGQGY  609

Query  1884  NNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGS  2063
             +   L S+T + ++ C         D LN PS  L +  P  T FS  F+RTVT VG+ +
Sbjct  610   DTKKLRSIT-ADNSSCTQANNGTVWD-LNLPSFALSMNTP--TFFSRVFHRTVTNVGSAT  665

Query  2064  TVFKAKIKAPTG-LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNT  2240
             + +KA++ AP   L + V P +LSF    QK+S+ + + G+    I   +S SLVW D T
Sbjct  666   SKYKARVIAPPSLLNIIVEPEVLSFSFVGQKKSFTLRIEGRINVGI---VSSSLVWDDGT  722

Query  2241  HSVRSPILVY  2270
               VRSPI+VY
Sbjct  723   SQVRSPIVVY  732



>ref|XP_010257110.1| PREDICTED: cucumisin-like [Nelumbo nucifera]
Length=731

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/721 (46%), Positives = 463/721 (64%), Gaps = 30/721 (4%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D +RK +IVYMG LP+    S    H NIL E + +E  A E  +HSY+RSF+GF A+L 
Sbjct  28    DEERKVHIVYMGALPES-QYSLTSHHINILEEVV-EESNATESLVHSYKRSFNGFAAKLN  85

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
              RE ++L+ K+ VVSVF +  ++L TTRSWDF+G++    R P+ E D+I+G++D+G+W 
Sbjct  86    DRERQKLARKEGVVSVFPSRSLQLQTTRSWDFMGLTETVKRVPEVEGDVIIGVIDSGIWP  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHG  680
             ES SF D+G+GPPP KWKG C  G NFT CN K+IGA+ +      P++  +  D  GHG
Sbjct  146   ESESFSDEGFGPPPKKWKGACNGGKNFT-CNNKLIGARTYT--DLGPDN--TARDTVGHG  200

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             SH AS AAG  V+ A  YG+A+G ARGGVPSARIA+YKVC   GC D D+LA FD AIAD
Sbjct  201   SHTASTAAGNKVKDAGFYGLAQGNARGGVPSARIAAYKVCAEGGCSDADILAAFDDAIAD  260

Query  861   GVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             GVD+ISIS+G        QD IAIGS+HAM+  I+T+ +AGN GP  GT  +V+PWL++V
Sbjct  261   GVDIISISLGSSLAIDMVQDSIAIGSFHAMQNGILTSHSAGNSGPGLGTTASVAPWLLSV  320

Query  1038  AATSIDRRFESDVKLGNGEL--ISGFSINTFEL-GKMYPLISGTLAQDKNATY---PGNY  1199
             AA+S DRR    V LG+G    + G S+N+F+L G+ + LI G     KNA+      + 
Sbjct  321   AASSTDRRIIDKVVLGDGTTTTLVGTSVNSFDLKGEKFDLIYG-----KNASLRCSDDDV  375

Query  1200  SACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVD  1376
               C    +   LV+GK+V C   +  +  +     +G I  D +  D      +PAT++ 
Sbjct  376   RLCKNGCLDANLVKGKVVVCDEVSKGEEPVH-ARALGTIMIDNRFNDFGRIYPLPATLLI  434

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              E+G+K+  Y+N+T+ P A I +S A+  + AP V SFS+RGP  I   I+KPD++APG+
Sbjct  435   PENGEKVKSYMNSTRNPQANILKSEAIHDSIAPVVASFSSRGPNVIIAEIIKPDISAPGV  494

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILAA++ LA+ +G   D R VKY++ SGTSMA PH  GAAAYVK+FHP+WSP+AIKSAL
Sbjct  495   DILAAFSPLASPSGIKSDKRSVKYSIMSGTSMACPHVTGAAAYVKSFHPEWSPSAIKSAL  554

Query  1734  MTTAKAMKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCK-EFNNASLGSLT  1910
             MTTA  M         A GAG I P KAV PGL+++  KS+Y+  LC   +++  +  +T
Sbjct  555   MTTAWPMNATKNELEFAYGAGHIDPVKAVNPGLVYETLKSDYIQMLCNINYDSWRIREIT  614

Query  1911  GSKDNKCKNIPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             G + + C    A+QG A  LNYPSM + +T   A  F + + RTVT VG+ ++++KA + 
Sbjct  615   GERIS-CPE--ASQGSAKDLNYPSMGVMVTGEKA--FKSNWTRTVTNVGSANSIYKATVT  669

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             +   L ++V P++LSF   N+ +++ V V+G      + Y S SLVW D THSVRSPI+V
Sbjct  670   SDPKLQITVNPDVLSFQALNENKTFVVTVAGGELPDNTVY-SASLVWSDGTHSVRSPIVV  728

Query  2268  Y  2270
             Y
Sbjct  729   Y  729



>ref|XP_009396946.1| PREDICTED: cucumisin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396947.1| PREDICTED: cucumisin-like [Musa acuminata subsp. malaccensis]
Length=728

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/725 (46%), Positives = 455/725 (63%), Gaps = 36/725 (5%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAR-EYRIHSYRRSFSGFVARL  317
             + +RK YIVYMG      + +   EH N+L + L  E  A  +  ++SY +SF+   A+L
Sbjct  30    NEERKVYIVYMGHQTSSSSSTEA-EHLNLLKQVL--EGCAPCDSLVYSYTKSFNALAAKL  86

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
             L +E  +L+    VVSVF +  +   TTRSWDFLG     NRNP  ESD+IVG++DTG+W
Sbjct  87    LTKEMEKLAGMKGVVSVFPSKILHPRTTRSWDFLGFPATVNRNPPLESDVIVGMIDTGIW  146

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGH  677
              ES SF D G GPPP KWKG C   +N   CN K+IGA+Y+N      + +ESP DF+GH
Sbjct  147   PESESFNDQGLGPPPRKWKGDC---INLK-CNNKIIGARYYNSLNDTSQ-EESPRDFNGH  201

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H AS  AG+ V+GASLYG+A GTARGGVPSAR+A YKVCW  GC + D+LA FD AIA
Sbjct  202   GTHTASTVAGKSVQGASLYGLAGGTARGGVPSARLAVYKVCWSFGCAEQDILAAFDDAIA  261

Query  858   DGVDVISISVGGHPRSF--FQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             DGVD+ISIS+G +P +F  F D +AIGS+HAMKK ++T+A+ GN GPY GT+ NV+PW++
Sbjct  262   DGVDIISISIG-YPSAFDYFLDAMAIGSFHAMKKGVLTSASGGNSGPYHGTVGNVAPWML  320

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGK-MYPLISGTLAQDKNATYPGNYSAC  1208
               AA+S DR     +  G+   + G S+NTF   K  YP +             G++   
Sbjct  321   VSAASSTDRHIIDKLVTGDQRCVVGASVNTFATEKESYPFVYFG---------DGSFPPA  371

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGV--GVIASDKLPDTVLPTMIPATIVDIE  1382
             D   + EKLV+GKIV C      D T  ++ G    V+ +D   DT     +PA  +   
Sbjct  372   DCTQLDEKLVKGKIVLC--GYIDDGTGAYLAGAKGAVMLNDAFLDTSFSFPLPAIAISYS  429

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAV-KTTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             +G+K+ +YIN T  P A I +S AV    AP V SFS+RGP TI+ +ILKPD++APG+ I
Sbjct  430   NGEKLMQYINKTNNPVANIHKSEAVFDPKAPVVGSFSSRGPNTITADILKPDISAPGIDI  489

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAA++ L  ++G  +DTR V+YN+ SGTSMA PH +GAAAYVK+FHP WSPAAI SALMT
Sbjct  490   LAAWSKLGKVSGSPNDTRSVEYNIISGTSMACPHTSGAAAYVKSFHPSWSPAAIMSALMT  549

Query  1740  TAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             TAK M   + P  A LA GAG + P KAV PGL+FD   ++Y+  LC E +N + +  +T
Sbjct  550   TAKPMNPSLHP-DAELAYGAGQLNPVKAVDPGLVFDAADTDYVQMLCDEGYNKSMIRIIT  608

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             G  D++C +    + A  LNYPSM L +   +  +F+  F R+VT VG   ++++ KIKA
Sbjct  609   G--DDRCCSSLGRRTARDLNYPSMALHVA--SNESFAGNFTRSVTNVGDACSIYRVKIKA  664

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
                L V V P  L F + ++K+ + V VSG    A +   S S+VW D  HSVRS ++VY
Sbjct  665   DGRLKVVVNPKTLVFTKPDEKQGFVVSVSGG-PMATNSTASASIVWLDGKHSVRSAMVVY  723

Query  2271  RSLQT  2285
                 +
Sbjct  724   TDFTS  728



>ref|XP_008245984.1| PREDICTED: cucumisin-like [Prunus mume]
Length=726

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/712 (46%), Positives = 447/712 (63%), Gaps = 25/712 (4%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVY+G LP +   S +     IL E +  +  A  + + SY+RSF+GF A+L  +E
Sbjct  32    RKTYIVYLGSLPHNEVFSPLSNQIGIL-ERVVQKTSASNFLLTSYKRSFNGFAAKLTEQE  90

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
               RL+   +VVSVF +   +L TTRSWDFLG++  A RN  AES+ I+G++D+G+  +S 
Sbjct  91    RERLAGMKEVVSVFPSRIFQLQTTRSWDFLGLNQTAKRNATAESNTIIGVIDSGISPDSE  150

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D+G+GP P KWKG CQ G NFT CN K+IGA+Y+   G         +D  GHG+H 
Sbjct  151   SFNDEGFGPAPKKWKGICQGGQNFT-CNNKIIGARYYTDAG--------ASDAVGHGTHT  201

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAG  V+  S YG+A+GTARGGVPSARIA+YKVC   GC    +L GFD AIADGVD
Sbjct  202   ASTAAGNPVKDVSFYGLAQGTARGGVPSARIAAYKVCSVSGCPTEAILQGFDDAIADGVD  261

Query  870   VISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +I+IS+G    + F QDPIAIG++HAM+K I+T  +AGN GP  G++ +V+PW +TVAA+
Sbjct  262   IITISIGAESSAPFQQDPIAIGAFHAMEKGILTLQSAGNSGPEAGSVSSVAPWTLTVAAS  321

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
             S DRR    + LGNG+ I G S+N+FEL G  +PL+ G  A  +      +   C    +
Sbjct  322   STDRRIIDKIVLGNGKTIVGSSVNSFELNGTSFPLVYGKDASSQ--CVDSDARQCVAGCL  379

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
                LV+GKIV C   A  +        +G I     PD      +PA+ +  +D   +  
Sbjct  380   DADLVKGKIVLC-DQAGGNTEAHQAGALGSILKTSKPDVAFIVPLPASGLGSQDYDVVKS  438

Query  1404  YINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             Y+ +TK P A I +SRA+K   AP V SFS+RGP  I   I+KPD++APG+ ILAAY+ L
Sbjct  439   YLKSTKRPRANILKSRAIKDDGAPVVASFSSRGPNQIVPEIIKPDISAPGIDILAAYSTL  498

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA---KA  1751
             A +TG  +D R VKY++ SGTSM+ PH AG AAY+KTFHPDWSPAAIKS++MTTA     
Sbjct  499   APVTGGTEDERRVKYSILSGTSMSCPHVAGVAAYIKTFHPDWSPAAIKSSIMTTAWPVND  558

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKC  1931
              K  P  A  A G+G I P KA+ PGL+F+ +K +Y+ +LC   +  S+  ++G   + C
Sbjct  559   TKTSP--AEFAYGSGHINPLKAINPGLVFEASKEDYIKFLCSVLDEESVRLISGDS-SSC  615

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
                 A      LNYPS+   +   ++T+F   F+RTV  VG  ++ FKA I + + + + 
Sbjct  616   PAGSAKVSPKDLNYPSLAANVN--SSTSFKINFHRTVKNVGLPNSTFKANILSSSEVDIK  673

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             VVP++LSF   N+++++ V V G+     S ++S SLVW D THSVRSPILV
Sbjct  674   VVPDVLSFKSLNEEKTFDVTVVGRGIPEGS-HVSASLVWTDGTHSVRSPILV  724



>ref|NP_001237585.1| subtilisin-like protease C1 precursor [Glycine max]
 gb|AAN12272.1| subtilisin-like protease C1 [Glycine max]
 gb|AAD02075.4| subtilisin-like protease C1 [Glycine max]
Length=738

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/719 (45%), Positives = 468/719 (65%), Gaps = 18/719 (3%)
 Frame = +3

Query  144   TQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLP  323
             +Q K YIVY G   +D   SA+  + ++L E + D     +   H ++RSFSGFVA L  
Sbjct  29    SQLKSYIVYTGNSMNDEA-SALTLYSSMLQE-VADSNAEPKLVQHHFKRSFSGFVAMLTE  86

Query  324   REARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVE  503
              EA R++  D+VV+VF N + +L TTRSWDF+G   +ANR P AESD+I+ + D+G+W E
Sbjct  87    EEADRMARHDRVVAVFPNKKKQLHTTRSWDFIGFPLQANRAP-AESDVIIAVFDSGIWPE  145

Query  504   SPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHG  680
             S SF D G+GPPP+KWKG CQ   NFT CN K+IGA+ + V+G F+ +D +S  D DGHG
Sbjct  146   SESFNDKGFGPPPSKWKGTCQTSKNFT-CNNKIIGAKIYKVDGFFSKDDPKSVRDIDGHG  204

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIAD  860
             +H+AS AAG  V  AS+ G+ +GT+RGGV  ARIA YKVCW  GC D D+LA FD AIAD
Sbjct  205   THVASTAAGNPVSTASMLGLGQGTSRGGVTKARIAVYKVCWFDGCTDADILAAFDDAIAD  264

Query  861   GVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             GVD+I++S+GG    ++F+D IAIG++HA++  ++T  +AGN GP   ++ N SPW ++V
Sbjct  265   GVDIITVSLGGFSDENYFRDGIAIGAFHAVRNGVLTVTSAGNSGPRPSSLSNFSPWSISV  324

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG-NYSACD  1211
             AA++IDR+F + V+LGN     G SINTF+L G++YP+I G  A +K     G +   C 
Sbjct  325   AASTIDRKFVTKVELGNKITYEGTSINTFDLKGELYPIIYGGDAPNKGEGIDGSSSRYCS  384

Query  1212  YLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATIVDIEDG  1388
               S+ +KLV+GKIV C  S S+         VG +   +    + P++ +P + + ++DG
Sbjct  385   SGSLDKKLVKGKIVLC-ESRSKALGPFDAGAVGALIQGQGFRDLPPSLPLPGSYLALQDG  443

Query  1389  KKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
               +  YIN+T+ P A IF++   K T AP V SFS+RGP  ++  ILKPDL APG+SILA
Sbjct  444   ASVYDYINSTRTPIATIFKTDETKDTIAPVVASFSSRGPNIVTPEILKPDLVAPGVSILA  503

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +++  +  +    D R + +N+ SGTSMA PH +GAAAYVK+FHP WSPAAI+SALMTTA
Sbjct  504   SWSPASPPSDVEGDNRTLNFNIISGTSMACPHVSGAAAYVKSFHPTWSPAAIRSALMTTA  563

Query  1746  KAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
             K +  K  + A  A GAG I P+KAV PGL++D  + +Y+ +LC + ++  +L  +TG  
Sbjct  564   KQLSPKTHLRAEFAYGAGQIDPSKAVYPGLVYDAGEIDYVRFLCGQGYSTRTLQLITG-D  622

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             ++ C         D LNY S  L +   N+ + S +F RTVT VG+  + +KA + +P G
Sbjct  623   NSSCPETKNGSARD-LNYASFALFVPPYNSNSVSGSFNRTVTNVGSPKSTYKATVTSPKG  681

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             L + V P++L F   NQK+++ + ++GK +  I   +SGSLVW D  + VRSPI+V+ +
Sbjct  682   LKIEVNPSVLPFTSLNQKQTFVLTITGKLEGPI---VSGSLVWDDGKYQVRSPIVVFNT  737



>ref|XP_008464909.1| PREDICTED: cucumisin-like, partial [Cucumis melo]
Length=684

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/678 (48%), Positives = 438/678 (65%), Gaps = 16/678 (2%)
 Frame = +3

Query  258   AREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKA  437
             A +  ++SY RSFSGF ARL   EAR+L+E D VVSVF + + +L TTRSWDF+G   +A
Sbjct  13    ASKSLVYSYHRSFSGFAARLNDDEARKLAEMDGVVSVFPSEKKQLHTTRSWDFMGFFQEA  72

Query  438   NRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQY  617
              R  + ESDLI+G+LDTG+W ES SF D+G+GPPP+KWKG+C    NFT CN K+IGA++
Sbjct  73    PRK-RLESDLIIGMLDTGIWPESKSFSDEGFGPPPSKWKGECAH--NFT-CNNKIIGARF  128

Query  618   FNVEGFAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKV  797
             F  E     D  SP D +GHG+H +S A G +V  A+L+G+A GT+RGG PSARIA YK+
Sbjct  129   FRSEPVI-GDSPSPRDTEGHGTHTSSTAGGNLVTDANLFGLAAGTSRGGAPSARIAVYKI  187

Query  798   CWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAA  974
             CW  GC D D+LA FD AIADGVD+ISISVGG   S +  DPIAIG++HAMK  I+T+ +
Sbjct  188   CWSNGCPDADILAAFDHAIADGVDIISISVGGFGASNYLDDPIAIGAFHAMKNGILTSNS  247

Query  975   AGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLI  1151
              GN GP  G++ NVSPW ++VAA++IDR+F + V LGNGE I G S+NTFELG K++PLI
Sbjct  248   GGNSGPNLGSLSNVSPWSLSVAASTIDRKFVTKVTLGNGESIQGISVNTFELGDKLFPLI  307

Query  1152  SGTLAQDKNATYPGNYS-ACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK  1328
                 A +  A + G+ S  C   S+    V+GKIV C   +  D T +    VG +  D 
Sbjct  308   HAGDAPNTTAGFNGSTSRLCFPGSLDVDKVQGKIVICDLISGGDVT-QSSGAVGTVMLDS  366

Query  1329  -LPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGP  1502
                D       P +++    GK + +Y+ +   P A I +S  ++  +AP V SFS+RGP
Sbjct  367   GFQDVAFLFPQPVSLISFHTGKSLFQYLRSNSNPEAIIEKSTTIEDLSAPSVVSFSSRGP  426

Query  1503  QTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAY  1682
               I+L+ILKPDLAAPG+ I+A+++   ++TG   D R+  +N+ SGTSM+ PHA GAAAY
Sbjct  427   NVITLDILKPDLAAPGVDIIASWSEATSITGVEGDKRIAPFNIISGTSMSCPHATGAAAY  486

Query  1683  VKTFHPDWSPAAIKSALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEY  1859
             VK+FHP WSPAAIKSALMT+A  M  K    A LA GAG + P  A+ PGL++D  + +Y
Sbjct  487   VKSFHPSWSPAAIKSALMTSAFPMSPKLNTDAELAYGAGHLNPVNAINPGLVYDAEELDY  546

Query  1860  MSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYR  2036
             + +LC + ++   L  ++G   N C ++     +D LNYPS  L + + +    S  ++R
Sbjct  547   IKFLCGQGYSTKDLRLVSGDHSN-CSDVTKTAASD-LNYPSFGLVINSTSQRLISRVYHR  604

Query  2037  TVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSG  2216
             TVT VG   + +KA IKAP GL V+V P  LSF    QK S+ V V  K   A    +SG
Sbjct  605   TVTNVGLPVSTYKAVIKAPPGLKVTVRPATLSFRSLGQKISFTVTVRAKADVA-GKVVSG  663

Query  2217  SLVWKDNTHSVRSPILVY  2270
             SL W D  H VRSPI+ +
Sbjct  664   SLTWDDGVHLVRSPIVSF  681



>ref|XP_010658504.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=702

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/708 (47%), Positives = 448/708 (63%), Gaps = 19/708 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+LP    +S    H N+L E +G    A +Y +HSY++SF+GFVA L   E +RLS  
Sbjct  1     MGDLPKGGALSLSSFHTNMLQEVVGSSS-ASKYLLHSYKKSFNGFVAELTKEEMKRLSAM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
               VVSVF N + +LLTTRSWDF+G   KA RN   ESD++VG+LD+G+W ES SF D G+
Sbjct  60    KGVVSVFPNEKKQLLTTRSWDFMGFPQKATRN-TTESDIVVGVLDSGIWPESASFNDKGF  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIASIAAG  707
             GPPP+KWKG C    NFT CN K+IGA+Y+   G  PE + ES  D +GHG+H AS AAG
Sbjct  119   GPPPSKWKGTCDSSANFT-CNNKIIGARYYRSSGSIPEGEFESARDANGHGTHTASTAAG  177

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V+ ASL G+A GTARGGVPSARIA YK+CW  GC   D+LA FD AIADGVD+IS+SV
Sbjct  178   GIVDDASLLGVASGTARGGVPSARIAVYKICWSDGCFSADILAAFDDAIADGVDIISLSV  237

Query  888   GG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P  +F+DPIAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA++IDR+F
Sbjct  238   GGSSPNDYFRDPIAIGAFHSMKNGILTSNSAGNSGPDLASITNFSPWSLSVAASTIDRKF  297

Query  1065  ESDVKLGNGELIS-GFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              + + LG+ ++     S+NTF++  M P+I    A +K   + G+ S  C   S+ + LV
Sbjct  298   LTKLVLGDNQVYEDSISLNTFKMEDMLPIIYAGDAPNKAGGFTGSESRYCYEDSLDKSLV  357

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
              GKIV C    SQ   +      G +I  D          +P + +D  +  KI +Y+N+
Sbjct  358   TGKIVLC-DETSQGQAVLAAGAAGTIIPDDGNEGRTFSFPVPTSCLDTSNISKIQQYMNS  416

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
                PTA+I RS AVK  +AP V  FS+RGP  I+ +IL PD+ APG+ ILAA+   + +T
Sbjct  417   ASNPTAKIERSMAVKEESAPIVALFSSRGPNPITSDILSPDITAPGVQILAAWAEASPLT  476

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP-I  1769
                 D RV KYN+ SGTSM+ PHA+GAAAYVK+FHP WSPAAIKSALMTTA  M +K   
Sbjct  477   DVPGDERVAKYNIISGTSMSCPHASGAAAYVKSFHPTWSPAAIKSALMTTATPMNVKTNT  536

Query  1770  GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPA  1946
                 A GAG + P KA  PGL++D   ++Y+ +LC + ++  +L  +TG   + C     
Sbjct  537   DLEFAYGAGHLNPVKAANPGLVYDAGAADYVKFLCGQGYSTENLRLITGDS-STCTKATN  595

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNI  2126
                 D LNYPS  L ++     T +  F RTVT VG+  + +K K+ AP GLTV V P +
Sbjct  596   GTVWD-LNYPSFALSIS--AGETVTRTFTRTVTNVGSPVSTYKVKVTAPPGLTVKVEPPV  652

Query  2127  LSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L+F    Q++++ V  +    ++I   +SGSLVW D    VRSPI+ +
Sbjct  653   LTFKSVGQRQTFTVTATAAGNESI---LSGSLVWDDGVFQVRSPIVAF  697



>ref|XP_007016591.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34210.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=744

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/728 (45%), Positives = 461/728 (63%), Gaps = 27/728 (4%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPD-DPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YI Y+G LP+ D + S+   HH  + +A+  +     Y I SY+RSF+GF A+L
Sbjct  28    DEDRKVYIAYLGSLPERDYSPSS---HHFSMLQAVIKQSSVANYLIRSYKRSFNGFAAKL  84

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA +L+   +VVS+F N    L TTRSWDFLG+     RNP  ESD+I+G++D+G+W
Sbjct  85    TNEEANKLASMKEVVSIFPNKVYHLQTTRSWDFLGLKDSVKRNPTVESDVIIGVIDSGIW  144

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGH  677
              ES SF D G+GP P KWKG C  G NFT CN K+IGA+++N E   P  +ES  D DGH
Sbjct  145   PESESFSDKGFGPAPKKWKGSCSGGKNFT-CNNKLIGARFYNSE--EPR-EESARDGDGH  200

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H AS AAG  VE AS +G+A+GTARGGVPSARIA+YKVC   GC   D+LA FD AIA
Sbjct  201   GTHTASTAAGNNVEDASFFGLAQGTARGGVPSARIAAYKVCKQNGCASADILAAFDDAIA  260

Query  858   DGVDVISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGT-IQNVSPWLM  1031
             DGVD+I+ISVG   RS F+QD IAIG++HA +K I+T  +AGNEG      + +V PW++
Sbjct  261   DGVDLITISVGSTTRSDFYQDSIAIGAFHAAEKGILTVQSAGNEGRLGKQGVTSVVPWIL  320

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKM-YPLISGTLAQDKNATYPGNYSAC  1208
             TVAA+SIDRRF S V LGNG+ ++G SIN+F+L K  +PL+ G    +           C
Sbjct  321   TVAASSIDRRFFSKVVLGNGKTLNGLSINSFDLKKTKFPLVYGKEIANLGCNEEITARVC  380

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDG  1388
             +   ++  LV+ KIV C      +   +     G I   ++ D      + A+ +  ++ 
Sbjct  381   ETGCLNSTLVKEKIVLC-DQFRGNNEARDAGAAGSILKTEIDDVSFVLPLAASALSTDNY  439

Query  1389  KKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             + +  Y+N+TK P AEI RS  ++ + AP V  FS+RGP  +  +I+KPDL+APG+ ILA
Sbjct  440   ESVKSYLNSTKRPVAEILRSETIEDSAAPVVAPFSSRGPNFMEPDIMKPDLSAPGVDILA  499

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             A++ + + +G   D R VKY++ SGTSM+ PHAA  AAYVKTFHP+WSP+AI+SALMTTA
Sbjct  500   AFSPIGSPSGNPADKRQVKYSILSGTSMSCPHAAAVAAYVKTFHPEWSPSAIQSALMTTA  559

Query  1746  KAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCK-EFNNASLGSLTGS  1916
               M     P G  LA G+G + P KA  PGL++++ K +Y+ +LC   +++  L  ++G 
Sbjct  560   FPMDQSTNPDGE-LAYGSGHVNPVKATDPGLVYEVVKGDYIKFLCSIGYDSEKLRRISG-  617

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
              ++ C           LNYPS+  Q+  P+  +F+  F+RTVT VG  S+ +KAK+ + +
Sbjct  618   DNSTCSKTSENILPRDLNYPSLTAQIL-PD-KSFTVGFHRTVTNVGIASSTYKAKVSSNS  675

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWY--MSGSLVWKDNTHSVRSPILV-  2267
              L V V P +LSF    +K+S+ V V+G    A+S +  +S SL W D THSV+SPI++ 
Sbjct  676   KLEVKVDPEVLSFKALKEKKSFNVTVTG---DALSLFSMVSASLEWSDGTHSVKSPIVIH  732

Query  2268  -YRSLQTD  2288
              Y+S + +
Sbjct  733   SYKSFRLE  740



>ref|XP_010658656.1| PREDICTED: cucumisin-like [Vitis vinifera]
Length=1364

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/738 (47%), Positives = 463/738 (63%), Gaps = 46/738 (6%)
 Frame = +3

Query  129   LWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFV  308
             +W  D   + YIVYMG+LP    +S    H N+L E  G    A EY +HSY+RSF+GFV
Sbjct  647   VW-DDGVFQEYIVYMGDLPKG-QVSVSSLHANMLQEVTGSS--ASEYLLHSYKRSFNGFV  702

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   E+++LS  D VVSVF N + KLLTTRSWDF+G   +ANR    ESD+IVG+LDT
Sbjct  703   AKLTEEESKKLSSMDGVVSVFPNGKKKLLTTRSWDFIGFPVEANRT-TTESDIIVGMLDT  761

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAP-EDQESPAD  665
             G+W ES SF D+GYGPPP KWKG CQ   NFT CN K+IGA+Y+  +G  P  D  SP D
Sbjct  762   GIWPESASFSDEGYGPPPTKWKGTCQTSSNFT-CNNKIIGAKYYRSDGKVPRRDFPSPRD  820

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFD  845
              +GHGSH AS AAG +V GASL GI  GTARGG PSARI+ YK+CW  GC D D+LA FD
Sbjct  821   SEGHGSHTASTAAGNLVGGASLLGIGTGTARGGAPSARISVYKICWADGCYDADILAAFD  880

Query  846   AAIADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSP  1022
              AIADGVDVIS+SVGG  P  +F+D IAIG++H+MK  I+T+ +AGN GP   +I N SP
Sbjct  881   DAIADGVDVISLSVGGFSPLDYFEDSIAIGAFHSMKSGILTSNSAGNSGPDAASITNFSP  940

Query  1023  WLMTVAATSIDRRFESDVKLGNGELISG-FSINTFELGKMYPLISGTLAQDKNATYPGNY  1199
             W ++VAA+ IDR+F + + LGN +   G  S+NTFE+  M PLI G  A + +A Y G+ 
Sbjct  941   WSLSVAASVIDRKFVTPLHLGNNQTYVGVLSLNTFEMNDMVPLIYGGDAPNTSAGYDGSS  1000

Query  1200  SA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-------  1355
             S  C   S+ + LV GKIV C      + ++    GVG +++  +  TV+P         
Sbjct  1001  SRYCYEDSLDKSLVTGKIVLC-----DELSL----GVGALSAGAV-GTVMPHEGNTEYSF  1050

Query  1356  ---IPATIVDIEDGKKIDKYINTTK-------APTAEIFRSRAVKTT-APFVPSFSARGP  1502
                I A+ +D      + +YIN+T+        PTA I ++   K   APFV SFS+RGP
Sbjct  1051  NFPIAASCLDSVYTSNVHEYINSTRYFSCFNSTPTANIQKTTEAKNELAPFVVSFSSRGP  1110

Query  1503  QTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAY  1682
               I+ +IL PD+AAPG+ ILAA+T  +++TG   DTRVV YN+ SGTSMA PHA+GAAAY
Sbjct  1111  NPITRDILSPDIAAPGVDILAAWTGASSLTGVPGDTRVVPYNIISGTSMACPHASGAAAY  1170

Query  1683  VKTFHPDWSPAAIKSALMTTAKAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEY  1859
             VK+FHP WSP+AIKSA+MTTA  M ++       A GAG + P +A  PGL++D   ++Y
Sbjct  1171  VKSFHPTWSPSAIKSAIMTTASPMSVETNTDLEFAYGAGQLNPLQAANPGLVYDAGAADY  1230

Query  1860  MSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYR  2036
             + +LC + +N+  L  +TG  DN   +         LNYPS    ++  +      +F R
Sbjct  1231  IKFLCGQGYNDTKLQLITG--DNSTCSAATNGTVWDLNYPS--FAVSTEHGAGVIRSFTR  1286

Query  2037  TVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSG  2216
             TVT VG+  + +KA +  P  L++ V P +LSF    + +++ V V        S  +SG
Sbjct  1287  TVTNVGSPVSTYKAIVLGPPELSIRVEPGVLSFKSLGETQTFTVTVG--VAALSSPVISG  1344

Query  2217  SLVWKDNTHSVRSPILVY  2270
             SLVW D  + VRSPI+ Y
Sbjct  1345  SLVWDDGVYQVRSPIVAY  1362


 Score =   533 bits (1372),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 297/693 (43%), Positives = 413/693 (60%), Gaps = 48/693 (7%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG LP    +S    H N+L E +G    A +Y + SY+RSF+GFVA L   E +RLS  
Sbjct  1     MGNLPKGGALSISSFHTNMLQEVVGSSS-ASKYLLRSYKRSFNGFVAELTREEMKRLSAM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
               VVSVF N + +LLTTRSWDF+G   K  RN   ESD++VG+LD+G+W ES SF D G+
Sbjct  60    KGVVSVFPNEKKQLLTTRSWDFMGFPQKVTRN-TTESDIVVGMLDSGIWPESASFSDKGF  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIASIAAG  707
             GPPP+KWKG C+   NFT CN K+IGA+Y+   G  PE + ES  D +GHG+H AS AAG
Sbjct  119   GPPPSKWKGTCETSTNFT-CNNKIIGARYYRSSGSVPEGEFESARDANGHGTHTASTAAG  177

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V+ ASL G+A GTARGGVPSARIA YK+CW  GC   D+LA FD AIADGVD+IS+SV
Sbjct  178   GIVDDASLLGVASGTARGGVPSARIAVYKICWSDGCFSADILAAFDDAIADGVDIISLSV  237

Query  888   GG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P  +F+DPIAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA++IDR+F
Sbjct  238   GGSSPNDYFRDPIAIGAFHSMKNGILTSNSAGNSGPDLASITNFSPWSLSVAASTIDRKF  297

Query  1065  ESDVKLGNGELIS-GFSINTFELGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVR  1241
              + + LG+ ++     S+NTF++  M+P+I    A ++   + G    C   S+ + LV 
Sbjct  298   LTKLVLGDNQVYEDSISLNTFKMKDMHPIIYAGDAPNRAGGFTG---LCTDDSLDKSLVT  354

Query  1242  GKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTK  1421
             GKIV+C  S+     +       +I  +          +P + +D  D  KI +Y+N+  
Sbjct  355   GKIVFCDGSSRGQAVLAAGAAGTIIPDEGNEGRTFSFPVPTSCLDTSDTSKIQQYMNSAS  414

Query  1422  APTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQ  1598
               TA+I RS AVK  +AP V SFS+RGP  ++ +IL PD+ APG+ ILAA+T  + +T  
Sbjct  415   NATAKIERSIAVKEESAPIVASFSSRGPNPVTTDILSPDITAPGVQILAAWTEASPLTDV  474

Query  1599  VDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIGAY  1778
               D RV KYN+ SGTSM+ PHA+G    ++                              
Sbjct  475   PGDKRVAKYNIISGTSMSCPHASGTNTDLE------------------------------  504

Query  1779  LASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQG  1955
              A GAG + P KA  PGL++D   ++Y+ +LC + ++  +L  +TG  D+ C        
Sbjct  505   FAYGAGHLNPVKARNPGLVYDTGAADYIKFLCGQGYSTENLRLITG-DDSSCTKATNGTV  563

Query  1956  ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSF  2135
              D LNYPS    LT  +  T +  F RTVT VG+  + +K K+ A  GLTV V P++LSF
Sbjct  564   WD-LNYPS--FTLTTRDGKTVTRTFARTVTNVGSAVSTYKVKVTASPGLTVKVEPSVLSF  620

Query  2136  PQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKD  2234
                 QK+++ V  +    +     ++GSLVW D
Sbjct  621   KSLGQKKTFTVTATAAGDE---LKLTGSLVWDD  650



>ref|XP_007016592.1| Subtilase 4.13, putative isoform 2 [Theobroma cacao]
 gb|EOY34211.1| Subtilase 4.13, putative isoform 2 [Theobroma cacao]
Length=737

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/728 (45%), Positives = 461/728 (63%), Gaps = 27/728 (4%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPD-DPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YI Y+G LP+ D + S+   HH  + +A+  +     Y I SY+RSF+GF A+L
Sbjct  21    DEDRKVYIAYLGSLPERDYSPSS---HHFSMLQAVIKQSSVANYLIRSYKRSFNGFAAKL  77

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA +L+   +VVS+F N    L TTRSWDFLG+     RNP  ESD+I+G++D+G+W
Sbjct  78    TNEEANKLASMKEVVSIFPNKVYHLQTTRSWDFLGLKDSVKRNPTVESDVIIGVIDSGIW  137

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGH  677
              ES SF D G+GP P KWKG C  G NFT CN K+IGA+++N E   P  +ES  D DGH
Sbjct  138   PESESFSDKGFGPAPKKWKGSCSGGKNFT-CNNKLIGARFYNSE--EPR-EESARDGDGH  193

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIA  857
             G+H AS AAG  VE AS +G+A+GTARGGVPSARIA+YKVC   GC   D+LA FD AIA
Sbjct  194   GTHTASTAAGNNVEDASFFGLAQGTARGGVPSARIAAYKVCKQNGCASADILAAFDDAIA  253

Query  858   DGVDVISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGT-IQNVSPWLM  1031
             DGVD+I+ISVG   RS F+QD IAIG++HA +K I+T  +AGNEG      + +V PW++
Sbjct  254   DGVDLITISVGSTTRSDFYQDSIAIGAFHAAEKGILTVQSAGNEGRLGKQGVTSVVPWIL  313

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKM-YPLISGTLAQDKNATYPGNYSAC  1208
             TVAA+SIDRRF S V LGNG+ ++G SIN+F+L K  +PL+ G    +           C
Sbjct  314   TVAASSIDRRFFSKVVLGNGKTLNGLSINSFDLKKTKFPLVYGKEIANLGCNEEITARVC  373

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDG  1388
             +   ++  LV+ KIV C      +   +     G I   ++ D      + A+ +  ++ 
Sbjct  374   ETGCLNSTLVKEKIVLC-DQFRGNNEARDAGAAGSILKTEIDDVSFVLPLAASALSTDNY  432

Query  1389  KKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             + +  Y+N+TK P AEI RS  ++ + AP V  FS+RGP  +  +I+KPDL+APG+ ILA
Sbjct  433   ESVKSYLNSTKRPVAEILRSETIEDSAAPVVAPFSSRGPNFMEPDIMKPDLSAPGVDILA  492

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             A++ + + +G   D R VKY++ SGTSM+ PHAA  AAYVKTFHP+WSP+AI+SALMTTA
Sbjct  493   AFSPIGSPSGNPADKRQVKYSILSGTSMSCPHAAAVAAYVKTFHPEWSPSAIQSALMTTA  552

Query  1746  KAM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCK-EFNNASLGSLTGS  1916
               M     P G  LA G+G + P KA  PGL++++ K +Y+ +LC   +++  L  ++G 
Sbjct  553   FPMDQSTNPDGE-LAYGSGHVNPVKATDPGLVYEVVKGDYIKFLCSIGYDSEKLRRISG-  610

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
              ++ C           LNYPS+  Q+  P+  +F+  F+RTVT VG  S+ +KAK+ + +
Sbjct  611   DNSTCSKTSENILPRDLNYPSLTAQIL-PD-KSFTVGFHRTVTNVGIASSTYKAKVSSNS  668

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWY--MSGSLVWKDNTHSVRSPILV-  2267
              L V V P +LSF    +K+S+ V V+G    A+S +  +S SL W D THSV+SPI++ 
Sbjct  669   KLEVKVDPEVLSFKALKEKKSFNVTVTG---DALSLFSMVSASLEWSDGTHSVKSPIVIH  725

Query  2268  -YRSLQTD  2288
              Y+S + +
Sbjct  726   SYKSFRLE  733



>ref|XP_007141823.1| hypothetical protein PHAVU_008G228700g [Phaseolus vulgaris]
 gb|ESW13817.1| hypothetical protein PHAVU_008G228700g [Phaseolus vulgaris]
Length=733

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/726 (46%), Positives = 455/726 (63%), Gaps = 32/726 (4%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             +  RK YIVYMG+ P D  ++++   H  + + +   +   E  +HSY+ +F+ FV +L 
Sbjct  24    NNDRKTYIVYMGDHPKDTDLTSIPSLHTTMAQKVLGSDFKTEAVLHSYK-NFNAFVMKLT  82

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               EA+R++E + VVSVF N +    TTRSW+FLG+    NR    ESD+IVG++DTG+W 
Sbjct  83    EEEAKRMAEMESVVSVFPNGKNVPRTTRSWNFLGLPQNTNRE-TTESDIIVGVIDTGIWP  141

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDGH  677
             ES SF D G+GPPP KWKG C    NFT CN K+IGA+YFN++  FA +D  SP D +GH
Sbjct  142   ESESFSDKGFGPPPTKWKGSCH---NFT-CNNKIIGAKYFNLKREFAKDDILSPRDGEGH  197

Query  678   GSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQG-CQDMDVLAGFDAAI  854
             GSH AS  AG  V   SL+G+A GTARGGVPSARIA YKVCW  G C D D LA FD AI
Sbjct  198   GSHCASTVAGNSVNSVSLFGLASGTARGGVPSARIAVYKVCWKTGNCGDADTLAAFDEAI  257

Query  855   ADGVDVISISVG-GH--PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
             +DGVDVISIS G G+     +FQD   IGS+HAMKK I+T+ +A N GP   ++ N +PW
Sbjct  258   SDGVDVISISTGLGNIVHVPYFQDSNNIGSFHAMKKGILTSNSANNLGPNLYSMTNYAPW  317

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFELG-KMYPLISGTLAQDKNATYPGNYS  1202
             L++VAA++ DR+  + VKLGNG +  G SINTF+L  K+YPL+ G    D   T  G+ S
Sbjct  318   LLSVAASTFDRKIVTKVKLGNGAIYEGVSINTFDLKRKLYPLVYG---GDIPNTAGGHNS  374

Query  1203  A----CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLP-DTVLPTMIPAT  1367
             +    C+  S+ +  V+GKIV C S    +        VGVI  +  P D      +PA 
Sbjct  375   STSRYCEKDSLDKHSVQGKIVLCESIQGAEDAGFLSGAVGVIFGNNYPKDLPGAYALPAL  434

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRSRAVKT-TAPFVPSFSARGPQTISLNILKPDLAA  1544
              V + D + I  Y+ + +  TA IF+S  V     P + SFS+RGP  I+ N LKPD+AA
Sbjct  435   EVTLWDLRLIHSYLTSNRNATATIFKSEEVNDGLIPSIASFSSRGPNPITPNTLKPDIAA  494

Query  1545  PGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             PG+ ++AA++ +  ++    D R VKYNV SGTSMA PHA   AAY+K+FHP+WSPA IK
Sbjct  495   PGVEVIAAWSPIDPISSVKGDKRKVKYNVISGTSMACPHATATAAYIKSFHPNWSPAMIK  554

Query  1725  SALMTTAKAMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNAS  1895
             SALMTTA  M   + P  A  A GAGLI P KA  PGL++DIN+++Y+ +LC E F +  
Sbjct  555   SALMTTATPMSRTLNP-EAEFAYGAGLINPVKAPNPGLVYDINEADYIKFLCGEGFTDKE  613

Query  1896  LGSLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFK  2075
             L  LT +  + CK     +    LN PS  L +   N + FS+ + RTVT VG+ ++ +K
Sbjct  614   LRVLT-ADHSSCKGQANKKAVFELNLPSFSLYV---NDSYFSSPYRRTVTNVGSTTSTYK  669

Query  2076  AKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRS  2255
             A++ AP+ L + V PN LSF    QK+S+ V++ G+    I   +S SL+W D  H VRS
Sbjct  670   ARVIAPSLLNIQVKPNTLSFTSIGQKKSFYVIIQGRINVEI---LSASLIWDDGNHQVRS  726

Query  2256  PILVYR  2273
             PI+VY+
Sbjct  727   PIVVYQ  732



>ref|XP_008461717.1| PREDICTED: cucumisin-like [Cucumis melo]
Length=740

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/719 (47%), Positives = 456/719 (63%), Gaps = 32/719 (4%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG   +D   S+   HH  + E +     A ++ ++SY+RSF+GF  RL   E
Sbjct  37    RKTYIVYMGSTLED--TSSTPLHHRAMLEQVIGSNFAPKHLLYSYKRSFNGFAVRLTEEE  94

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A++++ K+ VVSVF N +  + TTRSWDF+G +    R  + ES+++VG+LDTG+W ESP
Sbjct  95    AQKIALKEGVVSVFPNGKKHVHTTRSWDFMGFTQSVPRVNQVESNIVVGVLDTGIWPESP  154

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D    PPPA WKG+CQ   +F  CNRK+IGA+ +  E   P + +SP D +GHG+H 
Sbjct  155   SFNDADLDPPPAGWKGQCQTSPDFQ-CNRKIIGARTYRSENLPPGNTQSPRDSEGHGTHT  213

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS  AG +V  ASLYG+  GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD
Sbjct  214   ASTVAGGLVSQASLYGLGFGTARGGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVD  273

Query  870   VISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +IS+SVGG   +S+F D IAIG++HAMK  I+T+ +AGNEGP + T  NVSPW ++VAA+
Sbjct  274   IISLSVGGSVVKSYFTDSIAIGAFHAMKHGILTSNSAGNEGPEYFTTSNVSPWSLSVAAS  333

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
             +IDR+F S V+L NG    G +I+TF+L GK YPLI G  A +K+  +  + S  CD  S
Sbjct  334   TIDRKFVSRVQLANGTAYQGPAIHTFDLMGKQYPLIYGGDAPNKSGGFNSSISRFCDENS  393

Query  1221  ISEKLVRGKIVYCLS--SASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGK  1391
             + + LV+GKI+ C S   AS   +      VG+I    +  D      +PA+ +      
Sbjct  394   VDQSLVKGKILVCDSILRASTMESFNKNGAVGIIMQGSRFKDYASSYPLPASYL------  447

Query  1392  KIDKYINTTKAPTAEIFRSRAV-KTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
                   N T + TA IF+S A+  ++AP V SFS+RGP   +L+ILKPDL APG+ ILAA
Sbjct  448   ---HNANITLSSTASIFKSNAILDSSAPSVVSFSSRGPNLATLDILKPDLTAPGVEILAA  504

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             ++ +AT++G   D+R V YN+ SGTSM+ PHA   A YVKTF+P WSPAAIKSALMTTA 
Sbjct  505   WSPIATVSGVAGDSRSVLYNIISGTSMSCPHATAIAVYVKTFNPTWSPAAIKSALMTTAF  564

Query  1749  AM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE--FNNASLGSLTGS  1916
             +M  K+ P  A  A GAG I P KAV PGL+++  +++Y+++LC +  +    +  +TG 
Sbjct  565   SMNAKVNP-QAEFAYGAGHINPLKAVNPGLVYNATETDYINFLCGQEGYTTDMVRRITG-  622

Query  1917  KDNKCKNIPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
              +  C   PA  G    LNYPS     T P+  T +  F RT+T V + ++++ AK+ AP
Sbjct  623   DNTACT--PANSGRVWDLNYPSFAFS-TTPSQLTINQFFARTLTNVESKTSLYSAKVFAP  679

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
               L ++V P  L F      +S+K+ V G   + I   +SGSLVW D  H VRSPI VY
Sbjct  680   PSLRITVDPPSLLFNGIGDTKSFKLTVQGTVNQNI---ISGSLVWTDGVHQVRSPITVY  735



>ref|XP_007163485.1| hypothetical protein PHAVU_001G238100g [Phaseolus vulgaris]
 gb|ESW35479.1| hypothetical protein PHAVU_001G238100g [Phaseolus vulgaris]
Length=734

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/723 (45%), Positives = 462/723 (64%), Gaps = 23/723 (3%)
 Frame = +3

Query  129   LWPHDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFV  308
             L    +Q K YIVY G    D   SA+  + +IL E    +   +  + H YRRSFSGF 
Sbjct  23    LCQSSSQLKSYIVYTGNAMKDED-SALALYSSILQEVAESKAEPKSVQQH-YRRSFSGFA  80

Query  309   ARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDT  488
             A+L   EA RL+  ++VV+VF N + +L TTRSWDF+G   +A R    ESD+I+G+LD+
Sbjct  81    AKLTEEEANRLARHERVVAVFPNEKKQLHTTRSWDFIGFPLQAER-ATVESDVIIGVLDS  139

Query  489   GVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPAD  665
             G+W ES SF D G+GPPP+KWKG CQ   NFT CN K+IGA+ +  +G F  E+  SP D
Sbjct  140   GIWAESESFNDKGFGPPPSKWKGTCQSSKNFT-CNNKIIGAKSYKADGFFTNEEPNSPLD  198

Query  666   FDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGF  842
              +GHG+H AS AAG  V  AS+ G+A+GTARGG   ARIA YKVCW  +GC D D+LA F
Sbjct  199   INGHGTHTASTAAGNPVSPASMLGLAQGTARGGAIKARIAVYKVCWLDEGCSDADILAAF  258

Query  843   DAAIADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVS  1019
             D AIADGVD+IS+S+GG    ++F+  I+IG++HA++K ++T  +AGN GP + ++ N S
Sbjct  259   DDAIADGVDIISVSIGGFSGGNYFKHVISIGAFHAVRKGVLTVTSAGNSGPRYSSLSNFS  318

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGN  1196
             PW +TVAA++IDR+F + V+LGN     G SINTF+L G++YP+I G  A +K   +   
Sbjct  319   PWSITVAASTIDRKFVTKVELGNNITYEGVSINTFDLKGELYPIIYGGDAPNKG--FDST  376

Query  1197  YSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATI  1370
              S  C   S+ +KLV GKIV C   +    T      VG +   +    + P++ +P + 
Sbjct  377   ISRFCFSDSLDKKLVEGKIVLCDGRSGAIGTFD-AGAVGALLQGQSYRDLSPSLPLPGSY  435

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAP  1547
             +D++DG  I  YIN+T+ PTA IF++ A K T AP V SFS+RGP  I+  +LKPDL AP
Sbjct  436   LDLQDGTSILDYINSTRIPTATIFKTDATKDTVAPIVASFSSRGPNIITPEVLKPDLVAP  495

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ I+A+++ ++  +G   D R + +N+ SGTSMA PH +GAAAYVK+F+P WSPAAI+S
Sbjct  496   GVDIIASWSPVSPPSGVDGDNRTLSFNIISGTSMACPHVSGAAAYVKSFYPTWSPAAIRS  555

Query  1728  ALMTTAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ALMTTA+ +  K  + A  A GAG I P+KA+ PGL++D  + +Y+ +LC + +++ SL 
Sbjct  556   ALMTTARQLNPKNNLHAEFAYGAGQIDPSKALYPGLVYDAGEIDYVRFLCGQGYSSRSLQ  615

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
              +TG   + C    +A+    LNY S  L     N+   S +F RTVT VG+ +  +KA 
Sbjct  616   LVTGDS-SSCTETSSAR---DLNYASFALFSPPSNSNIVSGSFNRTVTNVGSATCTYKAH  671

Query  2082  IKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             +  P GL +   PN+LSF   NQK S+ + ++G   +A++   S SL W D    VRSPI
Sbjct  672   VIGPEGLIIEANPNVLSFTSLNQKLSFVLTINGTINEAVA---SASLTWDDGKVQVRSPI  728

Query  2262  LVY  2270
             +V+
Sbjct  729   VVF  731



>gb|KHN17875.1| Cucumisin [Glycine soja]
Length=745

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/714 (45%), Positives = 466/714 (65%), Gaps = 18/714 (3%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YI+Y G   +D   SA+  + ++L E + D     +   H ++RSFSGFVA L   EA R
Sbjct  41    YIIYTGNSMNDEA-SALTLYSDMLQE-VADSNAEPKLVQHHFKRSFSGFVAMLTEEEANR  98

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             ++  D+VV+VF N + +L TTRSWDF+G   +ANR P AESD+I+ + D+G+W ES SF 
Sbjct  99    MARHDRVVAVFPNKKKQLHTTRSWDFIGFPLQANRAP-AESDVIIAVFDSGIWPESESFN  157

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIAS  695
             D G+GPPP+KWKG CQ   NFT CN K+IGA+ + V+G F+ +D +S  D DGHG+H+AS
Sbjct  158   DKGFGPPPSKWKGTCQTSKNFT-CNNKIIGAKIYKVDGFFSKDDPKSVRDIDGHGTHVAS  216

Query  696   IAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVI  875
              AAG  V  AS+ G+ +GT+RGGV  ARIA YKVCW  GC D D+LA FD AIADGVD+I
Sbjct  217   TAAGNPVSTASMLGLGQGTSRGGVTKARIAVYKVCWFDGCTDADILAAFDDAIADGVDII  276

Query  876   SISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSI  1052
             ++S+GG    ++F+D IAIG++HA++  ++T  +AGN GP   ++ N SPW ++VAA++I
Sbjct  277   TVSLGGFSDENYFRDGIAIGAFHAVRNGVLTVTSAGNSGPRPSSLSNFSPWSISVAASTI  336

Query  1053  DRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPG-NYSACDYLSIS  1226
             DR+F + V+LGN     G SINTF+L G++YP+I G  A +K     G +   C   S+ 
Sbjct  337   DRKFVTKVELGNKITYEGTSINTFDLKGELYPIIYGGDAPNKGEGIDGSSSRYCSSGSLD  396

Query  1227  EKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM-IPATIVDIEDGKKIDK  1403
             +KLV+GKIV C  S S+         VG +   +    + P++ +P + + ++DG  +  
Sbjct  397   KKLVKGKIVLC-ESRSKALGPFDAGAVGALIQGQGFRDLPPSLPLPGSYLALQDGASVYD  455

Query  1404  YINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             YIN+T+ P A IF++   K T AP V SFS+RGP  ++  ILKPDL APG+SILA+++ +
Sbjct  456   YINSTRTPIATIFKTDETKDTIAPVVASFSSRGPNIVTPEILKPDLVAPGVSILASWSPV  515

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKI  1760
             +  +    D R + +N+ SGTSMA PH +GAAAYVK+FHP WSPAAI+SALMTTAK +  
Sbjct  516   SPPSDIEGDNRTLNFNIISGTSMACPHVSGAAAYVKSFHPTWSPAAIRSALMTTAKQLSP  575

Query  1761  KP-IGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCK  1934
             K  + A  A GAG I P+KAV PGL++D  + +Y+ +LC + ++  +L  +TG  ++ C 
Sbjct  576   KTHLLAEFAYGAGQIDPSKAVYPGLVYDAGEIDYVRFLCGQGYSTRTLQLITG-DNSSCP  634

Query  1935  NIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSV  2114
                     D LNY S  L +   N+ + S +F RTVT VG+  + +KA + +P GL + V
Sbjct  635   ETKNGSARD-LNYASFALFVPPSNSNSVSGSFNRTVTNVGSPKSTYKATVTSPKGLKIEV  693

Query  2115  VPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
              P++L F   NQK+++ + ++GK +  I   +SGSLVW D  + VRSPI+V+ +
Sbjct  694   NPSVLPFTSLNQKQTFVLTITGKLEGPI---VSGSLVWDDGKYQVRSPIVVFNT  744



>gb|KHN20892.1| Cucumisin [Glycine soja]
Length=742

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/717 (45%), Positives = 451/717 (63%), Gaps = 22/717 (3%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             K YIVY G    D T S     + I+ + + D   A +  +H Y+RSFSGFV +L   EA
Sbjct  32    KTYIVYTGNSMKDETSSLF--LYQIMLQEVADSNAAPKSVLHHYKRSFSGFVVKLTEEEA  89

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
              R++  D VVSVF N + +L TT+SWDF+G      R+   ESD+I+G++DTG+W ES S
Sbjct  90    NRIAGLDGVVSVFPNGKKQLYTTKSWDFIGFPQHVQRS-NTESDIIIGVIDTGIWPESES  148

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIA  692
             F D G+GPPP+KWKG CQ   NFT CN K+IGA+Y+  +GF  +D +SP D DGHG+H A
Sbjct  149   FNDKGFGPPPSKWKGTCQIS-NFT-CNNKIIGAKYYKADGFKIKDLKSPRDTDGHGTHTA  206

Query  693   SIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDV  872
             S AAG  V  AS+ G+ +GT+RGG  SARIA YK CW   C D D+LA FD AIADGVD+
Sbjct  207   STAAGNPVSMASMLGLGQGTSRGGATSARIAVYKACWNDHCDDADILAAFDDAIADGVDI  266

Query  873   ISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +S+S+GG + +++F D  +IG++HAMK  IVT  AAGN GP   ++ N+ PW ++VAA++
Sbjct  267   LSVSLGGSNDQNYFGDASSIGAFHAMKNGIVTVFAAGNSGPSPASVDNLYPWSISVAAST  326

Query  1050  IDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSI  1223
             +DR+F + V+LG+     G SINTF+L G+++PLI G  A +  A    + S  C   S+
Sbjct  327   LDRKFVTKVQLGDNRTYEGISINTFDLKGELHPLIFGGDAPNTKAGKDESESRLCHLYSL  386

Query  1224  SEKLVRGKIVYCLSSASQDYTIKW--IHGVG----VIASDKLPDTVLPTMIPATIVDIED  1385
                LV+GKIV C    S    IK    H  G    +I      D     ++  + ++++D
Sbjct  387   DPNLVKGKIVLC-EDGSGTSPIKEGSQHKAGAVGFLIQGQSSRDYAFSFVLSGSYLELKD  445

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G  +  YI +T  PTA IF+S  +K T AP V SFS+RGP  ++  ILKPDL APG++IL
Sbjct  446   GVSVYGYIKSTGNPTATIFKSNEIKDTLAPQVASFSSRGPNIVTPEILKPDLMAPGVNIL  505

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             A+++ ++  +    D R +++N+ SGTSM+ PH +GAA YVK FHP WSPAAI+SALMTT
Sbjct  506   ASWSPISPPSDTHADKRELQFNIISGTSMSCPHVSGAAGYVKLFHPTWSPAAIRSALMTT  565

Query  1743  AKAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSK  1919
             AK M  +    A  A GAG I   KAV PGL++D ++S+Y+ +LC +  ++ +  L    
Sbjct  566   AKQMSPVNNRDAEFAYGAGQIDLYKAVKPGLVYDADESDYVRFLCGQGYSSKMLKLITGD  625

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
             ++ C   P     D LNYPS  LQ T+ +    S +FYRTVT VG+ ++ +KA + AP G
Sbjct  626   NSTCPETPYGTARD-LNYPSFALQATH-STPIVSGSFYRTVTNVGSPNSTYKATVTAPIG  683

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L + V P++LSF    QKRS+ + + G    AI   +SGSLVW D    VRSPI+V+
Sbjct  684   LKIQVTPSVLSFTSLGQKRSFVLSIDGAIDSAI---VSGSLVWHDGEFQVRSPIIVF  737



>emb|CBI31595.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/708 (47%), Positives = 448/708 (63%), Gaps = 19/708 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+LP    +S    H N+L E +G    A +Y +HSY++SF+GFVA L   E +RLS  
Sbjct  1     MGDLPKGGALSLSSFHTNMLQEVVGSSS-ASKYLLHSYKKSFNGFVAELTKEEMKRLSAM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
               VVSVF N + +LLTTRSWDF+G   KA RN   ESD++VG+LD+G+W ES SF D G+
Sbjct  60    KGVVSVFPNEKKQLLTTRSWDFMGFPQKATRN-TTESDIVVGVLDSGIWPESASFNDKGF  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDGHGSHIASIAAG  707
             GPPP+KWKG C    NFT CN K+IGA+Y+   G  PE + ES  D +GHG+H AS AAG
Sbjct  119   GPPPSKWKGTCDSSANFT-CNNKIIGARYYRSSGSIPEGEFESARDANGHGTHTASTAAG  177

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
              +V+ ASL G+A GTARGGVPSARIA YK+CW  GC   D+LA FD AIADGVD+IS+SV
Sbjct  178   GIVDDASLLGVASGTARGGVPSARIAVYKICWSDGCFSADILAAFDDAIADGVDIISLSV  237

Query  888   GG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             GG  P  +F+DPIAIG++H+MK  I+T+ +AGN GP   +I N SPW ++VAA++IDR+F
Sbjct  238   GGSSPNDYFRDPIAIGAFHSMKNGILTSNSAGNSGPDLASITNFSPWSLSVAASTIDRKF  297

Query  1065  ESDVKLGNGELIS-GFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              + + LG+ ++     S+NTF++  M P+I    A +K   + G+ S  C   S+ + LV
Sbjct  298   LTKLVLGDNQVYEDSISLNTFKMEDMLPIIYAGDAPNKAGGFTGSESRYCYEDSLDKSLV  357

Query  1239  RGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
              GKIV C    SQ   +      G +I  D          +P + +D  +  KI +Y+N+
Sbjct  358   TGKIVLC-DETSQGQAVLAAGAAGTIIPDDGNEGRTFSFPVPTSCLDTSNISKIQQYMNS  416

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
                PTA+I RS AVK  +AP V  FS+RGP  I+ +IL PD+ APG+ ILAA+   + +T
Sbjct  417   ASNPTAKIERSMAVKEESAPIVALFSSRGPNPITSDILSPDITAPGVQILAAWAEASPLT  476

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKP-I  1769
                 D RV KYN+ SGTSM+ PHA+GAAAYVK+FHP WSPAAIKSALMTTA  M +K   
Sbjct  477   DVPGDERVAKYNIISGTSMSCPHASGAAAYVKSFHPTWSPAAIKSALMTTATPMNVKTNT  536

Query  1770  GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPA  1946
                 A GAG + P KA  PGL++D   ++Y+ +LC + ++  +L  +TG   + C     
Sbjct  537   DLEFAYGAGHLNPVKAANPGLVYDAGAADYVKFLCGQGYSTENLRLITGDS-STCTKATN  595

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNI  2126
                 D LNYPS  L ++     T +  F RTVT VG+  + +K K+ AP GLTV V P +
Sbjct  596   GTVWD-LNYPSFALSIS--AGETVTRTFTRTVTNVGSPVSTYKVKVTAPPGLTVKVEPPV  652

Query  2127  LSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             L+F    Q++++ V  +    ++I   +SGSLVW D    VRSPI+ +
Sbjct  653   LTFKSVGQRQTFTVTATAAGNESI---LSGSLVWDDGVFQVRSPIVAF  697



>gb|KHN20889.1| Cucumisin [Glycine soja]
Length=696

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/698 (46%), Positives = 446/698 (64%), Gaps = 28/698 (4%)
 Frame = +3

Query  219   HNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLT  398
             H  + + +   +   E  +HSY++SF+GFV +L   EA+R++E D VVSVF N + +L T
Sbjct  10    HITMAQKVLGSDFEPEAILHSYKKSFNGFVIKLTEEEAQRMAEMDNVVSVFPNRKSRLQT  69

Query  399   TRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLN  578
             TRSWDF+G+S +  R    E D+IVG++D+G+W ES SF D+G+GPPP+KWKG C    N
Sbjct  70    TRSWDFIGVSQQIQRT-SLERDIIVGVIDSGLWPESKSFSDEGFGPPPSKWKGSCH---N  125

Query  579   FTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTA  755
             FT CN+K+IGA+YFN+EG +A ED  SP D  GHGSH AS  AG +V+ +SL G A GTA
Sbjct  126   FT-CNKKIIGAKYFNIEGDYAKEDSISPRDVQGHGSHTASTIAGNLVKSSSLLGFASGTA  184

Query  756   RGGVPSARIASYKVCWGQ-GCQDMDVLAGFDAAIADGVDVISISVGGHPR---SFFQDPI  923
             RGGVPSARIA YKVCW + GC   + LA FD AIADGVD+ISIS G        +FQ   
Sbjct  185   RGGVPSARIAIYKVCWIKIGCPQAETLAAFDEAIADGVDIISISTGLTSIVYIPYFQSAF  244

Query  924   AIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELIS  1103
              IGS+HAMK+ I+T+ +A N GP   +I   SPW+++VAA++I R+F + V+LGNG +  
Sbjct  245   DIGSFHAMKRGILTSKSADNSGPGLSSITTYSPWILSVAASTIGRKFLTKVQLGNGMVFE  304

Query  1104  GFSINTFEL-GKMYPLI-SGTLAQDKNATYPGNYSACDYLSISEKLVRGKIVYCLSSASQ  1277
             G SINTF+L  KM+PL+ +G +    +         C   S+ + LV+GKIV C  +AS 
Sbjct  305   GVSINTFDLKNKMFPLVYAGDVPNTADGYNSSTSRFCYVNSVDKHLVKGKIVLCDGNASP  364

Query  1278  DYTIKWIHGVG-VIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRA  1454
                       G ++ +  + D      +P   + + + K I  Y+ + +  TA IFRS  
Sbjct  365   KKVGDLSGAAGMLLGATDVKDAPFTYALPTAFISLRNFKLIHSYMVSLRNSTATIFRSDE  424

Query  1455  VK--TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYN  1628
                 +  PF+ SFS+RGP  ++ N LKPDLAAPG++ILAA++ + T++    D R V+YN
Sbjct  425   DNDDSQTPFIVSFSSRGPNPLTPNTLKPDLAAPGVNILAAWSPVYTISEFKGDKRAVQYN  484

Query  1629  VESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK--IKPIGAYLASGAGLI  1802
             +ESGTSMA PH + AAAYVK+FHP+WSPA IKSALMTTA  M   + P  A  A GAGLI
Sbjct  485   IESGTSMACPHVSAAAAYVKSFHPNWSPAMIKSALMTTATPMSPTLNP-DAEFAYGAGLI  543

Query  1803  RPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDN-KCKNIPAAQGADGLNYP  1976
              P KA  PGL++DI++++Y+ +LC E + +  L  LT  KD+ +C      +    LN P
Sbjct  544   NPLKAANPGLVYDISEADYVKFLCGEGYTDEMLRVLT--KDHSRCSKHAKKEAVYDLNLP  601

Query  1977  SMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKR  2156
             S+ L +   N ++FS  F+RTVT VG  ++ +KAK+ +P+ + + V PN+LSF    QK+
Sbjct  602   SLALYV---NVSSFSRIFHRTVTNVGLATSSYKAKVVSPSLIDIQVKPNVLSFTSIGQKK  658

Query  2157  SYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             S+ V++ G     I   +S SLVW D T  VRSPI+VY
Sbjct  659   SFSVIIEGNVNPDI---LSASLVWDDGTFQVRSPIVVY  693



>emb|CBI31592.3| unnamed protein product [Vitis vinifera]
Length=706

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/686 (48%), Positives = 440/686 (64%), Gaps = 27/686 (4%)
 Frame = +3

Query  252   ELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMST  431
             E A +Y +HSY++SF+GFVA+L   E+++LS  D VVSVF N + KLLTTRSWDF+G   
Sbjct  33    ENASQYLLHSYKKSFNGFVAKLTEEESKKLSGMDGVVSVFPNGKKKLLTTRSWDFIGFPL  92

Query  432   KANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGA  611
             +ANR    ESD+IVG+LDTG+W E+ SF D+GYGPPP KW+G CQ   NFT CN K+IGA
Sbjct  93    EANRT-TTESDIIVGMLDTGIWPEADSFSDEGYGPPPTKWQGTCQTSSNFT-CNNKIIGA  150

Query  612   QYFNVEG-FAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIAS  788
             +Y+  +G   PED  SP D +GHG+H AS AAG +V GASL G+  GTARGG PSARIA 
Sbjct  151   RYYRSDGNVPPEDFASPRDTEGHGTHTASTAAGNVVSGASLLGLGAGTARGGTPSARIAV  210

Query  789   YKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVT  965
             YK+CW  GC D D+LA FD AIADGV++IS+SVGG  P  +F+D IAIG++H+MK  I+T
Sbjct  211   YKICWADGCYDADILAAFDDAIADGVNIISLSVGGSFPLDYFEDSIAIGAFHSMKNGILT  270

Query  966   TAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISG-FSINTFELGKMY  1142
             + A GN GP  G+I N SPW ++VAA+ IDR+F + + LGN     G  S+NTFE+  M 
Sbjct  271   SNAGGNSGPDPGSITNFSPWSLSVAASVIDRKFLTALHLGNNLTYEGELSLNTFEMNGMV  330

Query  1143  PLISGTLAQDKNATYPGNYSA-CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VI  1316
             PLI G  A + +A    +YS  C   +++  LV GKIV+C    S          VG V+
Sbjct  331   PLIYGGDAPNTSAGSDASYSRYCYEGTLNTSLVTGKIVFC-DQLSDGVGAMSAGAVGTVM  389

Query  1317  ASDKLPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSA  1493
              SD   D  L   +P + +D      + +YIN+T  PTA I +S   K   APFV  FS+
Sbjct  390   PSDGYTDLSLAFPLPTSCLDSNYTTNVHEYINSTSTPTANIQKSTEAKNELAPFVVWFSS  449

Query  1494  RGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGA  1673
             RGP  I+ +IL PD+AAPG++ILAA+T  +++TG   DTRVV YN+ SGTSMA PHA+GA
Sbjct  450   RGPNPITRDILSPDIAAPGVNILAAWTEASSLTGVPGDTRVVPYNIISGTSMACPHASGA  509

Query  1674  AAYVKTFHPDWSPAAIKSALMTTAKAMKIKP-IGAYLASGAGLIRPTKAVAPGLIFDINK  1850
             AAYVK+F+P WSPAAIKSALMTTA  +  +       + GAG + P +A  PGL++D  +
Sbjct  510   AAYVKSFNPTWSPAAIKSALMTTASPLSAETNTDLEFSYGAGQLNPLQAANPGLVYDAGE  569

Query  1851  SEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAAQGADG----LNYPSMHLQLTNPNATT  2015
             ++Y+ +LC + +N   L  +TG      +NI  +   +G    LNYPS    ++  +   
Sbjct  570   ADYIKFLCGQGYNTTKLHLVTG------ENITCSAATNGTVWDLNYPS--FAISTEHEAG  621

Query  2016  FSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKA  2195
              +  F RTVT VG+  + +KA +  P   ++ V P +LSF    + +++ V V      A
Sbjct  622   VNRTFTRTVTNVGSPVSTYKAIVVGPPEFSIKVEPGVLSFKSLGETQTFTVTVG---VAA  678

Query  2196  ISW-YMSGSLVWKDNTHSVRSPILVY  2270
             +S   +SGSLVW D  + VRSPI+ Y
Sbjct  679   LSNPVISGSLVWDDGVYKVRSPIVAY  704



>ref|XP_010106763.1| Xylem serine proteinase 1 [Morus notabilis]
 gb|EXC11730.1| Xylem serine proteinase 1 [Morus notabilis]
Length=763

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/705 (47%), Positives = 445/705 (63%), Gaps = 14/705 (2%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             ++K YI+Y G  P +   SAV +H ++L+        A+E  ++SY +SF+ F A L   
Sbjct  32    EKKFYIIYFGGRPVEED-SAVRKHIDVLSSVKESFVEAKESIVYSYTKSFNAFAAELSSD  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA +++E D+V+SV  N   KL TT+SWDF+G+   A R  KAES+++VGL DTG+  +S
Sbjct  91    EANKIAEMDEVLSVIPNRYRKLHTTKSWDFIGLPLTARRKLKAESNIVVGLFDTGITPQS  150

Query  507   PSFKDDGYGPP-PAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHG  680
              SFKD G  P  P  WKG C    NF+GCN K+IGA+YF ++G   P D  SP D DGHG
Sbjct  151   DSFKDYGLTPDLPPHWKGTCDVSANFSGCNNKIIGARYFKLDGNPDPSDVLSPLDADGHG  210

Query  681   SHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIA  857
             +H +S  AG  V  ASL+G+A+GT+RG VPSAR+A YKVCW   GC D+D+LA FDAAI 
Sbjct  211   THTSSTLAGDNVPNASLFGLAKGTSRGAVPSARVAMYKVCWISSGCSDIDILAAFDAAIH  270

Query  858   DGVDVISISVGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTV  1037
             DGVDVIS+S+GG    +  D IAIGS+HAM   I+T  +AGN+GP  G++ N +PWL+TV
Sbjct  271   DGVDVISLSIGGGSADYTADSIAIGSFHAMNNGIITVTSAGNDGPSLGSVSNHAPWLLTV  330

Query  1038  AATSIDRRFESDVKLGNGELISGFSINTFE-LGKMYPLISGT-LAQDKNATYPGNYSACD  1211
             AA+ IDR F+S V+ G+G+ I G  I+TF    KMYPL+SG  +A +  +     +   D
Sbjct  331   AASGIDRAFKSQVQFGDGKSILGSGISTFHPTQKMYPLVSGDDIAHNSASKEDARFCYAD  390

Query  1212  YLSISEKLVRGKIVYC-LSSASQD-YTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIED  1385
               S+  K V+GK+V C L+S   D           ++ SD+  D     M PATIV+   
Sbjct  391   --SLDSKKVKGKLVLCKLASWGADSVIKGIGGIGTIVESDQFLDAAQIFMAPATIVNSTI  448

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILA  1565
             G+ I+ YI++T + TA I +S  V+  APF+ SFS+RGP   +  ILKPD+AAPG+ ILA
Sbjct  449   GETINHYIHSTGSATAVIHKSNEVQVRAPFIASFSSRGPSPGTKRILKPDIAAPGIDILA  508

Query  1566  AYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA  1745
             +YT L ++TG   DT+  K+ + SGTSMA PH AG AAYVK+FHP WSPAAI+SA++TTA
Sbjct  509   SYTPLKSLTGLKGDTQFSKFTIMSGTSMACPHVAGVAAYVKSFHPHWSPAAIRSAILTTA  568

Query  1746  KAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSK  1919
               M  +    A  A GAG + P +A+ PGLI+D+N   Y+ +LC E + ++SL  L GSK
Sbjct  569   TPMSPRVNAEAEFAYGAGQLNPRRALNPGLIYDMNNMSYIQFLCLEGYKDSSLAPLIGSK  628

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTG  2099
                C ++    G DGLNYP+  L L     TT  A + RTVT VG   + + A + AP G
Sbjct  629   FVNCSSLIPGLGYDGLNYPTFQLTLKRKQKTTL-AIYRRTVTNVGPPRSSYNATVIAPKG  687

Query  2100  LTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYM-SGSLVWK  2231
             + ++V P  L F +  QKRS+KVVV  K+  +    M SG L WK
Sbjct  688   VEITVTPMSLVFTKAMQKRSFKVVVKAKWDPSREGQMVSGRLAWK  732



>emb|CDP15047.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/729 (47%), Positives = 459/729 (63%), Gaps = 44/729 (6%)
 Frame = +3

Query  141   DTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLL  320
             D  +K YIVYMG+ P     SA  +H ++L  ALG    A +  ++SY+RSF+GFVA+L 
Sbjct  29    DGNKKQYIVYMGDRPQG-DFSASSQHSSLLQAALGSTR-ASDSLVYSYKRSFNGFVAKLT  86

Query  321   PREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWV  500
               E  RL++ + VVSVF N + +L T+RSWDFLG    A RN   ESD+IVG+LDTG+W 
Sbjct  87    EEEMERLADMEGVVSVFPNGKKQLHTSRSWDFLGFPENAERN-TVESDIIVGMLDTGIWP  145

Query  501   ESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ---ESPADFD  671
             ES SF D G+GPPP+KWKG C+   NFT CN K+IGA+++ ++G  P D+    SP D  
Sbjct  146   ESESFDDSGFGPPPSKWKGTCETSDNFT-CNNKIIGAKHYYLDGDQPLDEGEFASPRDSA  204

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHGSH ASIAAGRMV+GASLYG+  GTARGGVPSARIA YK+CW   C D +VLA FD A
Sbjct  205   GHGSHTASIAAGRMVKGASLYGLRSGTARGGVPSARIAVYKICWKDHCSDANVLAAFDDA  264

Query  852   IADGVDVISISVGGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGT---IQNVS  1019
             IADGVD+ISISVGG     +F+D I+I ++HAMK  I+T+ +AGN G  +GT   + N S
Sbjct  265   IADGVDIISISVGGKMSVDYFEDSISIAAFHAMKHGILTSVSAGNLG--YGTGGYLTNYS  322

Query  1020  PWLMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGT----LAQDKNAT  1184
             PW +TVAA++IDR+F ++V+LGNGE+  G SINTF+L G+ YPL+ G        D N T
Sbjct  323   PWSLTVAASTIDRKFVTNVRLGNGEVYEGVSINTFDLNGEYYPLVKGEDVLETGGDGNKT  382

Query  1185  ---YPGNYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTM  1355
                 PG+          +    GKIV+   S    +         ++  D   D      
Sbjct  383   RYGMPGSLGG-------DAQYSGKIVFSELSNGWAFATDGGAVGSIMQWDPGNDVASTYP  435

Query  1356  IPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAV-KTTAPFVPSFSARGPQTISLNILKP  1532
             I A ++  + G K+  YI +T   TA I +S  V    APF+ SFS+RGP  I+++ILKP
Sbjct  436   ISAAVLAQDPGNKVLNYITSTSNATATIDKSIEVGDIPAPFIASFSSRGPNPITVDILKP  495

Query  1533  DLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSP  1712
             D++APG+ ILAA++   T+TG   D RVVKYN +SGTSMA PHA GAAA+VK+++P  SP
Sbjct  496   DISAPGVDILAAWSEATTVTGYAGDKRVVKYNFDSGTSMACPHATGAAAFVKSYNPTLSP  555

Query  1713  AAIKSALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLC-KEFN  1886
             AAIKSALMTTA  +   + + A  A G+G I P KA+ PGL++DI +++++S+LC +++N
Sbjct  556   AAIKSALMTTATIISAERDVDAEFAYGSGQINPLKAIHPGLVYDIEEADFVSFLCGQDYN  615

Query  1887  NASLGSLTGSKDNKC---KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGT  2057
               +L  +TG     C   KNI        LNYP+    L+ P+    +  F+RT+T V  
Sbjct  616   ITTLQLITGDSSVSCSKEKNISVWD----LNYPA--FTLSTPSGLV-TRVFHRTLTNVAD  668

Query  2058  GSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDN  2237
               + +KA I +   L + V P  LSF    +K+S+ V V+    K ++   SGSLVW D 
Sbjct  669   VGSTYKATITSAPELNIHVSPAALSFESFGEKQSFTVTVTANVTKHVT---SGSLVWDDG  725

Query  2238  THSVRSPIL  2264
              H VRSP++
Sbjct  726   VHQVRSPVV  734



>ref|XP_002509690.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51077.1| Cucumisin precursor, putative [Ricinus communis]
Length=771

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/725 (46%), Positives = 459/725 (63%), Gaps = 22/725 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H   RK +IVYMG  P     SA   HH+IL   LG    A+E  ++SY RSF+GF A+L
Sbjct  23    HGNDRKVHIVYMGNRPHG-DFSAEITHHSILKSVLGSTSSAKESLVYSYGRSFNGFAAKL  81

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA RLSE D ++SV  N  + + TTRSWDF+G S K+  +   + D+I+GLLDTGVW
Sbjct  82    SHEEAERLSEMDGIISVMPNHMLNIHTTRSWDFMGFS-KSKLSGSQQGDVIIGLLDTGVW  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D+G GP P+KWKG CQ   NFT CN K+IGA+Y+N E  +   D +SP D +G
Sbjct  141   PESESFNDEGMGPAPSKWKGTCQGEGNFT-CNNKIIGARYYNSEDWYFDTDFKSPRDSEG  199

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HGSH AS AAGR V+GAS  G+AEG ARG VP ARIA YKVCW  GC   D+LA FD AI
Sbjct  200   HGSHTASTAAGREVQGASYLGLAEGLARGAVPYARIAVYKVCWSFGCAAADILAAFDDAI  259

Query  855   ADGVDVISISVGGHPRSF--FQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             ADGVD+IS+S+G  P +F   +DPIAIGS+HAM+  I+T  +AGN GP   T  NV+PW 
Sbjct  260   ADGVDIISVSLGA-PWAFPYMEDPIAIGSFHAMRYGILTANSAGNSGPSPYTASNVAPWT  318

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNA-TYPGNYSA  1205
             +TVAA++IDR+F ++  LG+G++I+G S+N+F L   YPLI G  A + +A   P     
Sbjct  319   LTVAASTIDRKFVANAVLGSGKVITGLSVNSFILNGTYPLIWGGDAANYSAGADPDIAKY  378

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDK--LPDTVLPTMIPATIVDI  1379
             C   +++  +V GKIV+C  S      +   +GVG I +D     D      +PAT++  
Sbjct  379   CVTGAMNSYIVAGKIVFC-ESIWDGSGVLLANGVGTIMADPEYSKDFAFSYPLPATVITP  437

Query  1380  EDGKKIDKYINTTKAPTAEIFRSRA-VKTTAPFVPSFSARGPQTISLNILKPDLAAPGLS  1556
              +G++I +YI +T+ P A I  S       AP V SFS+RGP  I+ +ILKPDL APG+ 
Sbjct  438   VEGQQILEYIRSTENPIATIEVSETWTDIMAPSVVSFSSRGPNAINPDILKPDLTAPGVD  497

Query  1557  ILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALM  1736
             ILAA++ ++  +   +DTR V +N+ SGTSM+ PHA+GAAAYVK  HPDWSPAA+KSALM
Sbjct  498   ILAAWSPVSPPSIYYEDTRSVNFNIISGTSMSCPHASGAAAYVKAAHPDWSPAAVKSALM  557

Query  1737  TTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLT  1910
             TTA  M   K      A G+G I P  A  PGL++D ++++Y+++LCK+ +N  +L  +T
Sbjct  558   TTAYVMDSRKHPDQEFAYGSGHINPEAATKPGLVYDASEADYINFLCKQGYNTTTLRLIT  617

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
             G     C +    +  D LNYP+  L +   +       F RTVT VG  ++ +   +  
Sbjct  618   GDNSTICNSTEPGRAWD-LNYPTYSLAIE--DGQPIQGVFTRTVTNVGKPNSTYSISMYL  674

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPIL  2264
             P+ ++V+V P++LSF    +K+++ V VSG    Q+ I   MSG+++W D T+ VRSP++
Sbjct  675   PSTISVTVEPSVLSFSDIGEKKTFTVKVSGPKISQQRI---MSGAIMWNDGTYVVRSPLV  731

Query  2265  VYRSL  2279
             VY  L
Sbjct  732   VYNIL  736



>ref|XP_011081159.1| PREDICTED: cucumisin-like [Sesamum indicum]
Length=773

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/721 (45%), Positives = 455/721 (63%), Gaps = 24/721 (3%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +RK ++VYMG+ P    +S    HH++L   L     A E  ++SY RSF+GF A+L  +
Sbjct  26    ERKLHVVYMGDRPQG-DLSLASTHHSMLRSVLESGSSAEESLVYSYDRSFNGFAAKLTKQ  84

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA  +SE + VVS+  N  +KL TTRSWDF+G S K       E D+I+G +DTGVW E 
Sbjct  85    EAASISEMEGVVSIIPNRMLKLHTTRSWDFMGFS-KDKLGAGQEGDVIIGFIDTGVWPEH  143

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGS  683
             PSF D G+GPPPAKWKG+CQ   NFT CN K+IGA+Y+N +  +   D  SP D +GHG+
Sbjct  144   PSFNDTGFGPPPAKWKGQCQTK-NFT-CNNKLIGARYYNSDNDYDDTDIHSPRDTEGHGT  201

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS AAG  + G S  G+AEG ARGGVP+ARIA YKVCW  GC   D+L  FD AI DG
Sbjct  202   HTASTAAGVELPGTSFLGLAEGVARGGVPNARIAVYKVCWDSGCGLADILKAFDDAIGDG  261

Query  864   VDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             VDVIS+S+G   P  +F DPIAIGS+HAMK  I+T+ +AGN GP   T+ N +PW MTVA
Sbjct  262   VDVISVSLGSFWPSDYFDDPIAIGSFHAMKNGILTSNSAGNSGPEPVTVTNFAPWTMTVA  321

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDY  1214
             A++IDR+F +++ LGNG++++G SIN+F+L G  YPL+ G  A +       +Y+  C+ 
Sbjct  322   ASTIDRKFAANLALGNGQILTGISINSFDLNGTSYPLMWGGDAVNYTMGSSSDYTRYCEA  381

Query  1215  LSISEKLVRGKIVYCLSSASQDYT-IKWIHGVGVIASDK---LPDTVLPTMIPATIVDIE  1382
              +++  ++ GKIV C     QD + I   +G+G+I  D    +PD      +PAT++  +
Sbjct  382   DAMNLDMLVGKIVLC--EGLQDGSAILLSNGIGIIMMDPTVGIPDYAFSYPLPATLISPD  439

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             D +K+ +YI +TK P A I      K   AP V SFS+RGP  +S +ILKPD+AAPG+ I
Sbjct  440   DFRKVMEYIRSTKYPEATILLGETWKDAMAPTVVSFSSRGPSPVSPDILKPDIAAPGVDI  499

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LA ++ LA  +    D+R + +NV SGTSMA PHA+  AAYVK  HPDWSPAAIKSA+MT
Sbjct  500   LAGWSPLAPPSIYYKDSRSLYFNVISGTSMACPHASATAAYVKAAHPDWSPAAIKSAIMT  559

Query  1740  TAKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGS  1916
             TA  M  K       A G+G I P  A+ PGL+FD + ++Y+++LCK+  N +   L   
Sbjct  560   TAYIMDPKRHKDLEFAYGSGHINPAAALDPGLVFDASATDYINFLCKQGYNTTTLRLVTG  619

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
              ++ C N    +G D LNYPS  L +   +       F RTVT VG  ++ + A I  P 
Sbjct  620   DNSTCANTTPGRGWD-LNYPSFSLYVE--DGQQIMGTFTRTVTNVGAANSTYTASIDVPP  676

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              ++V++ P+ L+F    + +S+ V V+G    Q+ I+   SG++ W+D TH+VRSP++VY
Sbjct  677   LISVAIEPSTLTFSAVGETQSFTVKVTGPPISQQPIT---SGAITWRDGTHAVRSPLVVY  733

Query  2271  R  2273
              
Sbjct  734   N  734



>ref|XP_003545246.2| PREDICTED: cucumisin-like [Glycine max]
Length=736

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/711 (45%), Positives = 450/711 (63%), Gaps = 16/711 (2%)
 Frame = +3

Query  153   KPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREA  332
             K YIVY G    D T S++  + ++L E + D   A +  +H Y+RSFSGFV +L   EA
Sbjct  32    KTYIVYTGNSMKDET-SSLSLYQSMLQE-VADSNAAPKSVLHHYKRSFSGFVVKLTEEEA  89

Query  333   RRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPS  512
              R++  D VVSVF N + +L TT+SWDF+G      R+   ESD+I+G++DTG+W ES S
Sbjct  90    NRIAGLDGVVSVFPNGKKQLYTTKSWDFIGFPQHVQRS-NTESDIIIGVIDTGIWPESES  148

Query  513   FKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIA  692
             F D G+ PPP+KWKG CQ   NFT CN K+IGA+Y+  +GF  +D +SP D DGHG+H A
Sbjct  149   FNDKGFRPPPSKWKGTCQIS-NFT-CNNKIIGAKYYKADGFKIKDLKSPRDTDGHGTHTA  206

Query  693   SIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDV  872
             S AAG  V  AS+ G+ +GT+RGG  SARIA YK CW   C D+D+LA FD AIADGVD+
Sbjct  207   STAAGNPVSMASMLGLGQGTSRGGATSARIAVYKACWNDHCDDVDILAAFDDAIADGVDI  266

Query  873   ISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATS  1049
             +S+S+GG + +++F D  +IG++HAMK  IVT  AAGN GP   ++ N+ PW ++VAA++
Sbjct  267   LSVSLGGSNDQNYFGDASSIGAFHAMKNGIVTVFAAGNSGPSPASVDNLYPWSISVAAST  326

Query  1050  IDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYS-ACDYLSI  1223
             +DR+F + V+LG+     G SINTF+L G+++PLI G  A +  A    + S  C   S+
Sbjct  327   LDRKFVTKVQLGDNRTYEGISINTFDLKGELHPLIFGGDAPNTKAGKDESESRLCHLYSL  386

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
                LV+GKIV C   +          G  +I      D     ++  + ++++DG  +  
Sbjct  387   DPNLVKGKIVLCEDGSGLGPLKAGAVGF-LIQGQSSRDYAFSFVLSGSYLELKDGVSVYG  445

Query  1404  YINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             YI +T  PTA IF+S  +K T AP V SFS+RGP  ++  ILKPDL APG++ILA+++ +
Sbjct  446   YIKSTGNPTATIFKSNEIKDTLAPQVASFSSRGPNIVTPEILKPDLMAPGVNILASWSPI  505

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK-  1757
             +  +    D R +++N+ SGTSM+ PH +GAA YVK+FHP WSPAAI+SALMTT K M  
Sbjct  506   SPPSDTHADKRELQFNIISGTSMSCPHVSGAAGYVKSFHPTWSPAAIRSALMTTVKQMSP  565

Query  1758  IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKN  1937
             +       A GAG I P KAV PGL++D ++S+Y+ +LC +  ++ +  L    ++ C  
Sbjct  566   VNNRDTEFAYGAGQIDPYKAVKPGLVYDADESDYVRFLCGQGYSSKMLKLITGDNSTCPE  625

Query  1938  IPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVV  2117
              P     D LNYPS  LQ T  +    S +FYRTVT VG+ ++ +KA + AP GL + V 
Sbjct  626   TPYGTARD-LNYPSFALQATQ-STPIVSGSFYRTVTNVGSPNSTYKATVTAPIGLKIQVT  683

Query  2118  PNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
             P++LSF    QKRS+ + + G    AI   +SGSLVW D    VRSPI+V+
Sbjct  684   PSVLSFTSLGQKRSFVLSIDGAIYSAI---VSGSLVWHDGEFQVRSPIIVF  731



>ref|XP_006857966.1| hypothetical protein AMTR_s00069p00176100 [Amborella trichopoda]
 gb|ERN19433.1| hypothetical protein AMTR_s00069p00176100 [Amborella trichopoda]
Length=728

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/721 (45%), Positives = 449/721 (62%), Gaps = 36/721 (5%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MG+L +D  +SA   HH +L + LG  + A+E  I+SY RSF+GF ARL   E +  SE 
Sbjct  1     MGDLNND--VSAKSMHHLMLQDVLGSSDAAKESFIYSYGRSFNGFAARLTDEEVQTFSEM  58

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             + VVSV  NT ++L TTRSWDF+G++         E+D++VGLLDTG+W ES SF D+G 
Sbjct  59    EGVVSVIPNTMLQLHTTRSWDFMGLTMNVTTPAPYETDVVVGLLDTGIWPESLSFNDEGM  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGSHIASIAAG  707
             GPPP  WKG CQ   NFT CN K+IGA+++  +G+  E D +SP D  GHG+H AS AAG
Sbjct  119   GPPPKSWKGICQTADNFT-CNNKIIGARFYKSDGYYDETDFKSPRDSVGHGTHTASTAAG  177

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQG-CQDMDVLAGFDAAIADGVDVISIS  884
             R   GAS +G+ +G ARGGVPSAR+A YKVCW  G C   D+LAGFD AIADG  ++S+S
Sbjct  178   RPYNGASYFGLGKGLARGGVPSARVAVYKVCWAGGRCGLADILAGFDDAIADGCHILSVS  237

Query  885   VGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRR  1061
             +G   P  + QDPIAIGS+HAMK  I+T+ +AGN GP   ++ N +PW +TVAA++IDR+
Sbjct  238   LGASSPVEYMQDPIAIGSFHAMKNGILTSNSAGNSGPSPYSVSNNAPWSLTVAASTIDRK  297

Query  1062  FESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA---------CDY  1214
             F S V+LGNG++ +G +IN+F L   YPLI G  A         NYSA         C  
Sbjct  298   FVSQVQLGNGQIYAGHAINSFALNGTYPLIYGGDA--------ANYSAGATDLTSKYCIQ  349

Query  1215  LSISEKLVRGKIVYC--LSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIED  1385
              +++     GKIV C  L   S     K   G+G I SD +  D      +PAT++  ++
Sbjct  350   DTLNSFKTEGKIVLCDFLYDGSGVLQAK---GLGTIMSDRRYTDFAFSYPLPATLLLPDE  406

Query  1386  GKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
             G+ +  YI +T  P   I +    + + AP V SFS+RGP  ++L+ILKPDL APG+ IL
Sbjct  407   GESVKAYIRSTSTPIGTILKGETFQDSVAPTVVSFSSRGPNAVTLDILKPDLTAPGVDIL  466

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA++ +A  +G   D R V +N+ SGTSM+ PH +GAAAYVK+++P WSPAAIKSALMTT
Sbjct  467   AAWSPVAPPSGSPVDKRSVDFNIISGTSMSCPHVSGAAAYVKSYYPSWSPAAIKSALMTT  526

Query  1743  AKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGS  1916
             A  M   K   A  A G+G I P +AV PGL++D   ++Y+ +LCK+ +N  +L  +TG 
Sbjct  527   ASFMDSRKNEEAEFAYGSGHIDPVRAVHPGLVYDAGVNDYIDFLCKQGYNTTTLRLITGD  586

Query  1917  KDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPT  2096
               + C +      A GLNYPS+ L +   +       F RTVT VG  ++ + A I AP+
Sbjct  587   NTSSCAS-STYDKAWGLNYPSIALSIA--DGQPIKGVFPRTVTNVGYANSTYHAFITAPS  643

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             G+ ++V PN+LSF    +K+S+ V + G     +    SG++ W D  H VRSP++VY  
Sbjct  644   GIKITVEPNVLSFKSVGEKQSFLVKIDGGVVSQLP-IQSGAITWNDGVHQVRSPVIVYTV  702

Query  2277  L  2279
             L
Sbjct  703   L  703



>ref|XP_006477361.1| PREDICTED: cucumisin-like [Citrus sinensis]
Length=767

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/724 (46%), Positives = 454/724 (63%), Gaps = 21/724 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELP--DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVA  311
             H  +RK +IVYMGE P  D P  S    HH++L   LG    A+E  ++SY RSF+GF A
Sbjct  23    HGQERKVHIVYMGERPQGDFPVAST---HHSMLQNVLGSTLSAKESLVYSYGRSFNGFAA  79

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTG  491
             +L   E  R SE + V+SV  N ++K+ TTRSWDF+G S K   +   E  +I+GLLDTG
Sbjct  80    KLTDEEVARFSETEGVISVIPNHKLKIHTTRSWDFMGFS-KGKLSSSQEGSVIIGLLDTG  138

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADF  668
             +W ES SF D G  PPPAKWKG C  G NFT CN K+IGA+Y+N E  +   D  SP D 
Sbjct  139   IWPESASFNDKGLSPPPAKWKGIC-TGANFT-CNNKIIGARYYNSENIYEVTDFHSPRDS  196

Query  669   DGHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDA  848
             +GHG+H +S AAGR V  AS YG+AEGTARGGVP+ARI+ YKVCW  GC   D+LA FD 
Sbjct  197   EGHGTHTSSTAAGREVPHASYYGLAEGTARGGVPNARISMYKVCWSDGCATADILAAFDD  256

Query  849   AIADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPW  1025
             AIADGVD+IS+S+G   P  +F+DPIAIGS+HAMK  I+T+ +AGN GP   ++ N +PW
Sbjct  257   AIADGVDIISVSLGSDFPFEYFEDPIAIGSFHAMKYGILTSNSAGNSGPDPYSVSNFAPW  316

Query  1026  LMTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNA-TYPGNY  1199
              +TVAA+SIDR+F +   LGNG    G SIN+F+L G  YPLI G  A + +A   P   
Sbjct  317   TLTVAASSIDRKFVAQAVLGNGITYPGLSINSFDLNGISYPLIWGGDAANYSAGANPDIA  376

Query  1200  SACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKL-PDTVLPTMIPATIVD  1376
               C   +++   V GKIV+C  S      I  ++G+G I +D +  D      +PAT++ 
Sbjct  377   RFCAADALNSYKVEGKIVFC-ESLLDGSDILAVNGLGTIMADSVFTDLAFSYPLPATLIS  435

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              E+G+ I  YI +T+ P A I      K   AP V SFS+RGP  I+++ILKPD+ APG+
Sbjct  436   KENGQDILDYIRSTEYPIATIMFGETWKDAMAPKVVSFSSRGPNPITVDILKPDITAPGV  495

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILA+++ +A  +   +DTR V +N+ SGTSM+ PHA+G+AAYVK  HP+WSP++IKSAL
Sbjct  496   DILASWSPVAPPSLDPEDTRSVSFNIISGTSMSCPHASGSAAYVKAAHPNWSPSSIKSAL  555

Query  1734  MTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSL  1907
             MTTA  M   K      A G+G I P +A+ PGL++D  + +Y+++LCK+ +N   +  +
Sbjct  556   MTTAYVMDSRKQEDLEFAYGSGHINPAQAIDPGLVYDATEVDYVNFLCKQGYNTTIIRQI  615

Query  1908  TGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIK  2087
             TG   + C +    +  D LNYPS  L +   +       F RTVT VG+ ++ +  +  
Sbjct  616   TGDNSSVCNSTEPGRAWD-LNYPSFSLAIE--DGQPIYGLFTRTVTNVGSPNSTYTVRPY  672

Query  2088  APTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
              P  + V V P  LSF    +++S+ V V+G  + A    MSG++VW+D  H VRSP+++
Sbjct  673   MPASVRVDVEPQSLSFSAVGEQKSFTVKVTGP-KIAQQPIMSGAIVWEDGVHQVRSPVVI  731

Query  2268  YRSL  2279
             Y  L
Sbjct  732   YNIL  735



>ref|XP_002524251.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38175.1| Cucumisin precursor, putative [Ricinus communis]
Length=721

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/715 (45%), Positives = 451/715 (63%), Gaps = 38/715 (5%)
 Frame = +3

Query  216   HHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLL  395
             H ++L E +G +    +  I+SY+RSF+GF A+L   E  +L+  + VVSVF + + +L 
Sbjct  16    HISMLQEVVGSD--GSDSLIYSYKRSFNGFAAKLTNEEMLKLAGMEGVVSVFPSEKKRLH  73

Query  396   TTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGL  575
             TTRSWDF+  S    R+   ES++I+G+LDTG+W ES SF D+ +GPPP KWKG CQ+  
Sbjct  74    TTRSWDFMSFSKHVRRSTVLESNIIIGMLDTGIWPESESFSDEDFGPPPTKWKGICQESS  133

Query  576   NFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGT  752
             NFT CN K+IGA+Y+  +G F P+D  SP D +GHGSH +S AAG ++  AS+ G+  GT
Sbjct  134   NFT-CNNKIIGARYYRSDGYFGPDDIVSPRDSEGHGSHTSSAAAGNLIHHASMDGLGSGT  192

Query  753   ARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHP-RSFFQDPIAI  929
             ARGGVPSARIA YK+CW  GC D D+LA FD AI DGVD+ISISVGG   + +F D IAI
Sbjct  193   ARGGVPSARIAVYKICWSDGCYDADILAAFDDAIDDGVDIISISVGGFSAKDYFNDSIAI  252

Query  930   GSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGF  1109
             G++HAMK  I+T+A+AGN GPY  T+ N +PW ++VAA++IDR+F + VKLGNG+   G 
Sbjct  253   GAFHAMKHGILTSASAGNSGPYPATMSNYAPWFLSVAASTIDRKFFTKVKLGNGDTYEGV  312

Query  1110  SINTFELG-KMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLVRGKIVYCLSSASQDY  1283
             SINTF L  KMYP+I G  A D +  +  + S  C   S+ + LV+GKIV C   +S + 
Sbjct  313   SINTFNLNHKMYPVIYGGNAPDIDKGFNESVSRYCIKNSLDKTLVKGKIVLCDYISSGET  372

Query  1284  TIKWIHGVGVIASDK-LPDTVLPTMIPATIVDIEDGKKIDKYINTTKAPTAEIFRSRAVK  1460
              +     +G I  D    D      +PA+ ++++DG ++ +Y+N T+ PTA IF+S   K
Sbjct  373   QLV-AEAIGTIMQDGYYQDAAYNFPLPASHLNLDDGFEVSEYVNRTRKPTATIFKSIEKK  431

Query  1461  -TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVES  1637
                AP+V SFS+RGP  I+ +IL PD+AAPG+ ILAA+T   ++TG + D RV+ +N+ S
Sbjct  432   DKLAPYVVSFSSRGPNPITKDILTPDIAAPGIDILAAWTEGNSITGFIGDDRVLPFNIIS  491

Query  1638  GTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT-------------------AKAMKI  1760
             GTSMA PHA  AAAY+K+F+P WSPAA+KSALMTT                   A A  +
Sbjct  492   GTSMACPHATAAAAYIKSFNPTWSPAALKSALMTTECAYGMYELTGASFSLLLLAAAFPM  551

Query  1761  KPIG---AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKC  1931
              P     A  A GAG + P KA+ PGL++D  +++++ +LC +        L    ++ C
Sbjct  552   SPETNPEAEFAYGAGHLNPVKAINPGLVYDAGENQFIQFLCGQGYTTKQLRLVAGDNSSC  611

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
               +P    +D LN PS    L+  +  +    F+RTVT VG+  + +KA + AP GL ++
Sbjct  612   SKVPKTTSSD-LNLPS--FTLSALSGQSVGRVFHRTVTNVGSAVSSYKAIVNAPKGLKIN  668

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVYRS  2276
             V P++LSF    +++++ V V  K   A    +SGSL W D  H VRSPIL Y S
Sbjct  669   VTPDVLSFKNLGEQKTFIVTVIAKMGYA---SISGSLSWDDGEHQVRSPILAYVS  720



>ref|XP_011081160.1| PREDICTED: cucumisin-like [Sesamum indicum]
Length=775

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/723 (46%), Positives = 460/723 (64%), Gaps = 23/723 (3%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             H  +RK ++VYMG  P +  +S   +HH +L   LG    A++  +HSY RSF+GF A+L
Sbjct  23    HCKERKLHVVYMGGRPQE-DVSVASKHHAMLHRVLGSASAAKDSLVHSYGRSFNGFAAKL  81

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                EA R+SE + V+SV  N   K  TTRSWDF+ ++      P+ ESD+I+GLLDTGVW
Sbjct  82    TQEEAARISEMEGVISVNPNRIFKHHTTRSWDFMNVTIDKVGAPQ-ESDVIIGLLDTGVW  140

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQ-ESPADFDG  674
              E PSF D G+GPPPAKWKG C    NFT CN K+IGA+Y+N +     D   SP D +G
Sbjct  141   PEHPSFNDSGFGPPPAKWKGTCMTA-NFT-CNNKIIGARYYNSDNSYYYDDIPSPRDTEG  198

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG  VE AS +G+A+G ARGGVP +RIA YKVCW  GC   D+L  FD AI
Sbjct  199   HGTHTASTAAGVEVE-ASYFGLAKGIARGGVPKSRIAVYKVCWAFGCSSADILKAFDDAI  257

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS+S+G   P  +F DPIAIGS+HAM+  I+T+ +AGN GP+  T+ N +PW +
Sbjct  258   ADGVDIISVSLGSDWPDDYFDDPIAIGSFHAMRNGILTSNSAGNSGPFPVTVSNYAPWSL  317

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKN-ATYPGNYSA  1205
             TVAA++IDR+F + ++LGNG++ +G +INTF+L G  YPLI G  A +    + P     
Sbjct  318   TVAASTIDRKFVARMQLGNGQMFTGITINTFDLNGTSYPLIWGGDAANYTIGSSPDIAKY  377

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKL---PDTVLPTMIPATIVD  1376
             C   +++  +V GKIV+C  +      I   +GVG I +D L   PD      +PAT++ 
Sbjct  378   CITGAMNADIVAGKIVFC-EALWDGSGILLANGVGTIMADVLVENPDVAFSWPLPATLIS  436

Query  1377  IEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGL  1553
              EDGK + +YI +T+ PTA IF S   K   AP V SFS+RGP  IS +ILKPD+ APG+
Sbjct  437   PEDGKSVLEYIRSTENPTATIFYSDEWKDAMAPIVVSFSSRGPSPISPDILKPDITAPGV  496

Query  1554  SILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSAL  1733
              ILA ++ L+  +   DD R   +N+ SGTSM+ PHA+GAAA+VK+ HP+WSPAAIKSAL
Sbjct  497   DILAGWSPLSPSSVYYDDERSTLFNIISGTSMSCPHASGAAAFVKSLHPNWSPAAIKSAL  556

Query  1734  MTTAKAMK-IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLT  1910
             MTTA  M   K      A G+G I PT A  PGL+FD ++++Y+++LCK+  N S   L 
Sbjct  557   MTTAYVMDPRKHEDLEFAYGSGQINPTAARDPGLVFDASETDYINFLCKQGYNTSTLRLV  616

Query  1911  GSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
                ++ C +    +  D LNYPS  L + +    T    F RTVT VG  ++ +KA +  
Sbjct  617   TGDNSTCASTTPGRAWD-LNYPSFSLYVEDGQPIT--GTFTRTVTNVGAANSTYKASLYM  673

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWY--MSGSLVWKDNTHSVRSPIL  2264
             P  ++V+V P++L+F    + +++ V V+G    AIS +   SG++ W D TH VR+P++
Sbjct  674   PALISVTVEPSVLTFSAIGETQTFTVNVTG---PAISQHPITSGAITWTDGTHVVRTPLV  730

Query  2265  VYR  2273
             VY 
Sbjct  731   VYN  733



>ref|XP_004171308.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=747

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/718 (46%), Positives = 450/718 (63%), Gaps = 23/718 (3%)
 Frame = +3

Query  150   RKPYIVYMGELPD-DPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +K YIVYMG  P   P+ S+   H  +L E++G         +HSY+RSF+GFVA++   
Sbjct  30    QKTYIVYMGNHPKGKPSTSS--HHMRLLKESIG-SSFPPNSLLHSYKRSFNGFVAKMTED  86

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA+++SE + V+SVF N + +L TTRSW+F+G S +  R P  ESD+IVG+ DTG+W ES
Sbjct  87    EAKKVSEMEGVISVFPNGKKQLHTTRSWNFMGFSEQVKRVPMVESDIIVGVFDTGIWPES  146

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGS  683
             PSF D GYGPPPAKWKG C+   NF+ CN K+IGA+ ++  G  PE D E P D +GHG+
Sbjct  147   PSFDDTGYGPPPAKWKGSCEVSANFS-CNNKIIGARSYHSSGPHPEGDLEGPIDSNGHGT  205

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS  AG +V  A++ G+  GTARGGVPSARIA YK+CW   C D D+LA FD AIADG
Sbjct  206   HTASTVAGGLVRQANMLGLGLGTARGGVPSARIAVYKICWSDNCSDADILAAFDDAIADG  265

Query  864   VDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             VD++S+SV G   +++F D +AIGS+HAMKK I+++ AAGN GP   ++ N SPW +TVA
Sbjct  266   VDILSVSVAGPGFKNYFNDSMAIGSFHAMKKGILSSFAAGNTGPGSASVANYSPWSLTVA  325

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A++ DR  E+ V+LG+G  + G +INTF++ GK  PL+ G      N T     S C   
Sbjct  326   ASTTDRVLETVVELGDGRELKGVTINTFDMKGKQVPLVYGGDIPKAN-TSSSFSSQCLRN  384

Query  1218  SISEKLVRGKIVYC---LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDG  1388
             S+  KL +GKIV C    +S ++   +K   G+ ++ +D   D      IPA+ +D + G
Sbjct  385   SVDLKLAKGKIVMCDMITTSPAEAVAVKGAVGI-IMQNDSPKDRTFSFPIPASHIDTKSG  443

Query  1389  KKIDKYINTTKA-PTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
               I  YIN+T + PTA I +S    +  AP V SFS+RGP  ++ NILKPDL+ PG+ IL
Sbjct  444   ALILSYINSTNSIPTATIKKSIERKRRRAPSVASFSSRGPNPVTPNILKPDLSGPGVEIL  503

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA+  +A+ +G V+D + V YN+ SGTSMA PH    AAYVK+FHP WSPAA+KSALMTT
Sbjct  504   AAWPPIASPSGAVEDNKRVLYNIISGTSMACPHVTAVAAYVKSFHPTWSPAALKSALMTT  563

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSK  1919
             A  M  K       A GAG + P  AV PGLI+D ++ +Y+ +LC +     L  L    
Sbjct  564   AFPMSPKRNQDKEFAYGAGHLNPLGAVHPGLIYDASEIDYVRFLCGQGYTTELLQLVSDD  623

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP-T  2096
              N C +  +    D LNYPS    L+   +   +  + RTVT VG+ S  +KA I  P  
Sbjct  624   SNTCSSNDSDTVFD-LNYPS--FALSTNISVPINQVYRRTVTNVGSRSATYKATIINPWK  680

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              L + V P++LSF    +K+S++V + GK ++ I    S SLVW D  H VRSPI V+
Sbjct  681   NLDIKVNPSVLSFTSLGEKQSFEVTIRGKIRRNIE---SASLVWNDGKHKVRSPITVF  735



>ref|XP_004135366.1| PREDICTED: cucumisin-like [Cucumis sativus]
 gb|KGN52180.1| hypothetical protein Csa_5G613580 [Cucumis sativus]
Length=745

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/718 (46%), Positives = 451/718 (63%), Gaps = 23/718 (3%)
 Frame = +3

Query  150   RKPYIVYMGELPD-DPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +K YIVYMG  P   P+ S+   H  +L E++G         +HSY+RSF+GFVA++   
Sbjct  30    QKTYIVYMGNHPKGKPSTSS--HHMRLLKESIG-SSFPPNSLLHSYKRSFNGFVAKMTED  86

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             EA+++SE + V+SVF N + +L TTRSW+F+G S +  R P  ESD+IVG+ DTG+W ES
Sbjct  87    EAKKVSEMEGVISVFPNGKKQLHTTRSWNFMGFSEQVKRVPMVESDIIVGVFDTGIWPES  146

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPE-DQESPADFDGHGS  683
             PSF D GYGPPPAKWKG C+   NF+ CN K+IGA+ ++  G  PE D E P D +GHG+
Sbjct  147   PSFDDTGYGPPPAKWKGSCEVSANFS-CNNKIIGARSYHSSGPHPEGDLEGPIDSNGHGT  205

Query  684   HIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADG  863
             H AS  AG +V  A++ G+  GTARGGVPSARIA YK+CW   C D D+LA FD AIADG
Sbjct  206   HTASTVAGGLVRQANMLGLGLGTARGGVPSARIAVYKICWSDNCSDADILAAFDDAIADG  265

Query  864   VDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVA  1040
             VD++S+SV G   +++F D +AIGS+HAMKK I+++ AAGN GP   ++ N SPW +TVA
Sbjct  266   VDILSVSVAGPGFKNYFNDSMAIGSFHAMKKGILSSFAAGNTGPGSASVANYSPWSLTVA  325

Query  1041  ATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYL  1217
             A++ DR  E+ V+LG+G  + G +INTF++ GK  PL+ G      N T     S C   
Sbjct  326   ASTTDRVLETVVELGDGRELKGVTINTFDMKGKQVPLVYGGDIPKAN-TSSSFSSQCLRN  384

Query  1218  SISEKLVRGKIVYC---LSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDG  1388
             S+  KL +GKIV C    +S ++   +K   G+ ++ +D   D      IPA+ +D + G
Sbjct  385   SVDLKLAKGKIVMCDMITTSPAEAVAVKGAVGI-IMQNDSPKDRTFSFPIPASHIDTKSG  443

Query  1389  KKIDKYINTTKA-PTAEIFRS-RAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSIL  1562
               I  YIN+T + PTA I +S    +  AP V SFS+RGP  ++ NILKPDL+ PG+ IL
Sbjct  444   ALILSYINSTNSIPTATIKKSIERKRRRAPSVASFSSRGPNPVTPNILKPDLSGPGVEIL  503

Query  1563  AAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTT  1742
             AA+  +A+ +G V+D + V YN+ SGTSMA PH    AAYVK+FHP WSPAA+KSALMTT
Sbjct  504   AAWPPIASPSGAVEDNKRVLYNIISGTSMACPHVTAVAAYVKSFHPTWSPAALKSALMTT  563

Query  1743  AKAMKIK-PIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSK  1919
             A  M  K       A GAG + P  AV PGLI+D ++ +Y+ +LC +     L  L    
Sbjct  564   AFPMSPKRNQDKEFAYGAGHLNPLGAVHPGLIYDASEIDYVRFLCGQGYTTELLQLVSDG  623

Query  1920  DNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP-T  2096
              N C +  +    D LNYPS    L+   +   +  + RTVT +G+ S ++KA I  P  
Sbjct  624   SNTCSSNDSDTVFD-LNYPS--FALSTNISVPINQVYRRTVTNIGSRSAMYKATIINPWK  680

Query  2097  GLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              L + V P++LSF    +K+S++V + GK ++ I    S SLVW D  H VRSPI V+
Sbjct  681   NLDIKVNPSVLSFTSLGEKQSFEVTIRGKIRRNIE---SASLVWNDGKHKVRSPITVF  735



>ref|XP_010650972.1| PREDICTED: cucumisin-like [Vitis vinifera]
 emb|CBI16047.3| unnamed protein product [Vitis vinifera]
Length=705

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/710 (46%), Positives = 452/710 (64%), Gaps = 20/710 (3%)
 Frame = +3

Query  159   YIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARR  338
             YIVY+G LP     S + +H NIL + L +   +R+  + SY+RSF+GF A+L  +E  +
Sbjct  4     YIVYLGSLPQG-EFSPLSQHLNILEDVL-EGSSSRDSLVRSYKRSFNGFAAKLTEKEREK  61

Query  339   LSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFK  518
             L  KD VVS+F +  ++L TTRSWDF+G+S    R P  ESD+IVG++DTG+W ESPSF 
Sbjct  62    LCNKDGVVSIFPSNLLQLQTTRSWDFMGLSETIERKPAVESDVIVGVIDTGIWPESPSFS  121

Query  519   DDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHIASI  698
             D+G+GPPP KWKG C  G NFT CN+KVIGAQ +N     P+D  S  D DGHGSH AS 
Sbjct  122   DEGFGPPPKKWKGVCSGGKNFT-CNKKVIGAQLYNSLN-DPDD--SVRDRDGHGSHTAST  177

Query  699   AAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVIS  878
             AAG  ++GAS YG+AEG+ARGGVPSARIA YKVC+  GC D D+LA FD AI+DGVD+IS
Sbjct  178   AAGNKIKGASFYGVAEGSARGGVPSARIAVYKVCFQSGCADADILAAFDDAISDGVDIIS  237

Query  879   ISVGGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSID  1055
             +S+G     +  +D +AIGS+HAM K I+T  +AGN GP   ++ +V+PW+++VAA++ D
Sbjct  238   VSLGKRSAPNLNEDSLAIGSFHAMAKGILTLNSAGNGGPNTYSVGSVAPWMVSVAASTTD  297

Query  1056  RRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLSISEK  1232
             R+  + V LGNG  ++G SINTF L G  +PL+ G  A      Y     + D L  S  
Sbjct  298   RQIITKVVLGNGTTLAGSSINTFVLNGTEFPLVYGKDATRTCDEYEAQLCSGDCLERS--  355

Query  1233  LVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYIN  1412
             LV GKI+ C  S + D        VG I+ +    +++P   P + ++ E+ + I+ Y  
Sbjct  356   LVEGKIILC-RSITGDRDAHEAGAVGSISQEFDVPSIVP--FPISTLNEEEFRMIETYYI  412

Query  1413  TTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATM  1589
             +TK P A I +S + K ++AP V SFS+RGP TI   ILKPD+ APG+ ILAAY+ +A +
Sbjct  413   STKNPKANILKSESTKDSSAPVVASFSSRGPNTIIPEILKPDITAPGVDILAAYSPVAPV  472

Query  1590  TGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPI  1769
             T + +D R VKY + SGTSM+ PH AG AAY+KTFHPDWSP+AI+SAL+TTA  M     
Sbjct  473   TDEAEDKRSVKYTILSGTSMSCPHVAGIAAYIKTFHPDWSPSAIQSALITTAWPMNGTTY  532

Query  1770  -GAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKCKNIPA  1946
                 LA G+G + P KAV+PGL+++  K++Y++ +C    +     L    ++ C     
Sbjct  533   DDGELAFGSGHVDPVKAVSPGLVYEALKADYINMMCSMGYDTKTVRLVSGDNSSCPKDTK  592

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKAPTGLTVSVVPN  2123
                 D LNYPSM +++      +F   F RTVT  G+ ++ +KA  I   + + V V P+
Sbjct  593   GSPKD-LNYPSMAVKVE--ETKSFKVEFPRTVTNFGSANSTYKATVINTNSHIKVQVNPD  649

Query  2124  ILSFPQTNQKRSYKVVVSGKFQKAISWYM-SGSLVWKDNTHSVRSPILVY  2270
             ILSF    +K+S+ V V G+   +I   + + SLVW D THSVRSPI+ Y
Sbjct  650   ILSFKLEKEKKSFVVTVVGQGLDSIEAPIAAASLVWSDGTHSVRSPIVAY  699



>ref|XP_007210779.1| hypothetical protein PRUPE_ppa019173mg [Prunus persica]
 gb|EMJ11978.1| hypothetical protein PRUPE_ppa019173mg [Prunus persica]
Length=732

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/713 (47%), Positives = 450/713 (63%), Gaps = 23/713 (3%)
 Frame = +3

Query  171   MGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPREARRLSEK  350
             MGE P     S    HH++L   LG    A++  I+SY +SF+GF ARL   E  +LSE 
Sbjct  1     MGERPKG-DFSVASTHHSMLETVLGSTSSAKDSLIYSYGKSFNGFAARLSDEEVAKLSEM  59

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             + VVSV  N ++KL TTRSWDF+G S K       E  +I+G+LDTG+W ES SF DD +
Sbjct  60    EGVVSVLPNHKLKLHTTRSWDFMGFS-KGTLPAPIEGKVIIGVLDTGIWPESDSFNDDDF  118

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDGHGSHIASIAAG  707
             GPPP+KWKGKC  G NFT CN K+IGA+Y+N E  +   D +SP D +GHGSH AS AAG
Sbjct  119   GPPPSKWKGKCT-GANFT-CNNKLIGARYYNSEDNYDTTDIKSPRDSEGHGSHTASTAAG  176

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISV  887
             R V  AS +G+A GTARGGVP+ARIA YKVCW  GC   D+LA FD AIADGVD+IS S+
Sbjct  177   REVP-ASYFGLAAGTARGGVPNARIAVYKVCWASGCASADILAAFDDAIADGVDIISTSL  235

Query  888   GG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             G   P  + +DPIAIGS+HAMK  I+T+++AGN GP+  T+ N +PW++TVAA++IDRRF
Sbjct  236   GAPFPFEYLEDPIAIGSFHAMKYGILTSSSAGNSGPFPATVSNYAPWILTVAASTIDRRF  295

Query  1065  ESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLSISEKLV  1238
              +   LGNGE+ SG S+N F+L GK YPLI G  A + +A      S+ C + +++   V
Sbjct  296   VAKAVLGNGEIYSGLSVNNFDLNGKSYPLIWGGDAANFSAGANSAISSQCFHGAMNSYKV  355

Query  1239  RGKIVYCLSSASQDYTIKWIHGVGVIASDKL-PDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             +GKIV+C         I    GVG I +D L  D      + AT++  EDG+++  YI +
Sbjct  356   KGKIVFC-ERIGDGAGILSADGVGAIMADSLFTDFAFSFPLSATVITTEDGQRVLDYIRS  414

Query  1416  TKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMT  1592
             T+ P A I      K   AP++ SFS+RGP  I+ +ILKPDL APG+ ILAA++ +A  +
Sbjct  415   TENPVATILVGETDKDVMAPYIISFSSRGPNPITPDILKPDLTAPGVDILAAWSPVAPPS  474

Query  1593  GQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG  1772
                +DTR V+YN+ SGTSM+ PHA+GAAAYVK  HP WS AAIKSALMTTA  +  K   
Sbjct  475   VDFEDTRSVEYNIISGTSMSCPHASGAAAYVKAAHPKWSAAAIKSALMTTAHVLDPKKHD  534

Query  1773  AY-LASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPA  1946
                 A G+G I P KAV PGL+FD ++++Y+ +LCK+ +N  +L  + G   + C     
Sbjct  535   ELEFAYGSGHINPLKAVKPGLVFDASEADYVHFLCKQGYNTTTLKLIIGDNSSSCGRTKP  594

Query  1947  AQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNI  2126
              +  D LNYPS  L +   +     A F RTVT VG+ ++ +      P    VSV P+ 
Sbjct  595   GRAWD-LNYPSFSLAVE--DGQKIHAVFTRTVTNVGSPNSTYYINAYTPYS-RVSVTPST  650

Query  2127  LSFPQTNQKRSYKVVVSGK--FQKAISWYMSGSLVWKDNTHSVRSPILVYRSL  2279
             LSF    +K+S+ V VSG    Q+ I   +SG+++  D  H VRSP+++Y  L
Sbjct  651   LSFSAVGEKKSFTVKVSGPPISQQPI---LSGAVLLTDGVHVVRSPLVIYTIL  700



>ref|XP_004293027.1| PREDICTED: cucumisin-like [Fragaria vesca subsp. vesca]
Length=736

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/723 (45%), Positives = 450/723 (62%), Gaps = 31/723 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHH-NILTEALGDEELAREYRIHSYRRSFSGFVAR  314
             +D  RK +IVY+G LP+  T+ +   HH ++L + +      + Y I SY+RSF+GF A+
Sbjct  27    NDEDRKVHIVYLGSLPN--TVYSPSSHHLDMLQKVVQGSGSLKNYLIRSYKRSFNGFAAK  84

Query  315   LLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGV  494
             L  +E  +L+   +VVS+F++T+ KL TTRSWDF+G + K NRN   ESD+I+G++D+G+
Sbjct  85    LTDQEREKLAYMKEVVSIFQSTKFKLQTTRSWDFMGFNEKINRNVTTESDVIIGVIDSGI  144

Query  495   WVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDG  674
             W ES SF+D G+GP P KWKG C  G NFT CN K+IGA+Y++         +S  D  G
Sbjct  145   WPESESFQDKGFGPVPKKWKGACNGGKNFT-CNNKLIGARYYS-------SIQSARDEVG  196

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVC-WGQGCQDMDVLAGFDAA  851
             HGSH AS+AAG  V+  S YG+A+GTARGGVPSARIA+Y+VC     C   DVL  FD A
Sbjct  197   HGSHTASVAAGNSVKDVSFYGLAQGTARGGVPSARIAAYQVCDLDSFCSGHDVLTAFDDA  256

Query  852   IADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD+I+IS+G   P  F++DPIAIGS+HAM K I+T+ +AGNEGP   T+ + +PW 
Sbjct  257   IADGVDIITISIGTDLPSDFYKDPIAIGSFHAMAKGILTSNSAGNEGPAGDTVSSAAPWT  316

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLA-----QDKNATYP  1190
             +TVAA+ IDRR    V LGNG +I G S+NTF L G  +PLI G  A      D  A Y 
Sbjct  317   LTVAASRIDRRIIDKVVLGNGSIIVGTSVNTFTLNGTNFPLIYGQDASRHECSDSQAGY-  375

Query  1191  GNYSACDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVG-VIASDKLPDTVLPTMIPAT  1367
                  CD   +    V+GKIV C +    D        +G ++ +D   D      +PA 
Sbjct  376   -----CDEDCLDSDAVKGKIVLCDAFDESDVVALKAGALGSILNNDGTGDFSNVLSLPAI  430

Query  1368  IVDIEDGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAA  1544
              +  E+   +  Y+N+T+ P A I RS  +    AP V SFS+RGP  I+ +I+KPDL+A
Sbjct  431   ALSHENYIAVKFYMNSTRDPRANILRSEVINDAAAPIVASFSSRGPNPITPDIIKPDLSA  490

Query  1545  PGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIK  1724
             PG+ ILAAY+ +A+++   +D R VKY++ SGTSM+ PHAA  AAYVK+FHPDWSP+AIK
Sbjct  491   PGVDILAAYSPVASISVSPEDKRHVKYHILSGTSMSCPHAAAVAAYVKSFHPDWSPSAIK  550

Query  1725  SALMTTAKAM-KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLG  1901
             S+LMTTA  M       A  A G+G I P KAV PGL+++ +K +++  LC E++ A + 
Sbjct  551   SSLMTTAWPMNNTNNAPAEFAYGSGHINPVKAVDPGLVYETSKEDFIKLLCMEYDEAKVR  610

Query  1902  SLTGSKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK  2081
              ++G  ++ C           LNYPSM      P    F+  F+RTV  VG  ++ + A 
Sbjct  611   LISG-DNSSCPTGSDKGSPKDLNYPSMAAANITPK-KPFTINFHRTVKNVGLANSTYSAS  668

Query  2082  I-KAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSP  2258
             I +    + + V P+ILSF   N+++S+ V V GK     S  +S SL+W DN HSVRSP
Sbjct  669   IVQNSKEVDIKVTPDILSFKSLNEEKSFDVTVVGKGLIGGSLIISSSLIWSDNNHSVRSP  728

Query  2259  ILV  2267
             I+V
Sbjct  729   IVV  731



>ref|XP_008344605.1| PREDICTED: cucumisin-like [Malus domestica]
Length=727

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/715 (44%), Positives = 445/715 (62%), Gaps = 32/715 (4%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
             +RK YI+Y+G LP D   S +  H  IL E + +   A    + SY++SF+GF A+L  R
Sbjct  32    ERKTYIIYLGSLPKDELFSPLSHHIGIL-ERVTESSSASNLLVRSYKKSFNGFAAKLTDR  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             E   L++  +VVSVF +   KL TTRSW+FLG + K  RNP  ES++I+G++D+G+W ES
Sbjct  91    EGETLAKMKEVVSVFPSKTYKLQTTRSWEFLGFNXKHKRNPTVESNVIIGVIDSGIWPES  150

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSH  686
              SF D+G+GP P KWKG C+ G NFT CN K+IGA+++           S  D +GHG+H
Sbjct  151   KSFSDEGFGPAPKKWKGVCKGGKNFT-CNNKIIGARFYT--------DSSARDENGHGTH  201

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG  V+G S YG+ +GTARGGVPSARIA+YKVC  +GC    +L  FD AI DGV
Sbjct  202   TASTAAGNPVKGVSFYGLGQGTARGGVPSARIAAYKVCNSEGCSSEGLLGAFDDAIHDGV  261

Query  867   DVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+I+IS+G        QDPIAIG+ HA++K I+T  +AGN GP  G++ +V+PW++ VAA
Sbjct  262   DIITISIGAXSAEPLDQDPIAIGALHAIEKGILTLQSAGNSGPDGGSVASVAPWILAVAA  321

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
             +S DRR    V LGN   + G S+N F+L G  +PLI G     K A++   +  C+   
Sbjct  322   SSTDRRIIDKVILGNRRTLVGSSVNAFKLNGTSFPLIEG-----KKASH--CFLDCEIGC  374

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
             +   L +GKIV C S+A        +  +G + S   PD      +PA   D +D   ++
Sbjct  375   LDPNLAKGKIVVC-SAARGSIEAXRVGAIGALTSTTEPDVSFIVPLPAASFDSKDFGAVE  433

Query  1401  KYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
              Y+++T  P A+I +S  +K   AP + SFS+RGP +I   I+KPD+ APG+ ILAAY+ 
Sbjct  434   SYLSSTANPRAKILKSEVIKDLAAPTIASFSSRGPNSILPEIIKPDITAPGVDILAAYSP  493

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
             +A +    +D R VKY++ SGTSM+ PHAAG AAY+KTFHP+WSP+AIKS+++TTA  + 
Sbjct  494   VAPLIESSEDQRHVKYSILSGTSMSCPHAAGVAAYIKTFHPNWSPSAIKSSILTTAGPVN  553

Query  1758  -----IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKD  1922
                    P     + G+G I P KAV PGL+++ +K++Y+  LC   + + +  ++G K 
Sbjct  554   GTNNSTSP--GEFSYGSGHINPVKAVNPGLVYETSKNDYIKMLCSTLDESKVRLISGDKA  611

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
               C      + A  LNYPS+   ++    T+FS  F RTV  VG  ++ +KAKI +  G+
Sbjct  612   -PCSASTGNKSAKDLNYPSLASNVS--PGTSFSVKFQRTVKNVGVANSTYKAKIISKPGV  668

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
              + VVP +LSF   N+K+++ V VSG+     S ++S SLVW D THSVRSPILV
Sbjct  669   NIKVVPQVLSFKSLNEKKTFNVTVSGRGMPNXS-HVSASLVWTDGTHSVRSPILV  722



>ref|XP_004149954.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=739

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/719 (46%), Positives = 456/719 (63%), Gaps = 31/719 (4%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG   +D   S+   HH  + E +     A ++ ++SY+RSF+GF  RL   E
Sbjct  35    RKTYIVYMGSKLED--TSSTPLHHRAMLEQVVGSNFAPKHLLYSYKRSFNGFAVRLTEEE  92

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A++++ K+ VVSVF N +  + TTRSWDF+G +    R  + ES+++VG+LDTG+W ESP
Sbjct  93    AQKIALKEGVVSVFPNGKKHVHTTRSWDFMGFTQSVPRVNQVESNIVVGVLDTGIWPESP  152

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D   GPPPA WKG+CQ   +F  CNRK+IGA+ +  E   P + +SP D +GHG+H 
Sbjct  153   SFNDTDLGPPPAGWKGQCQTSPDFQ-CNRKIIGARTYRSEKLPPGNIQSPRDSEGHGTHT  211

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS  AG +V  ASLYG+  GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD
Sbjct  212   ASTVAGGLVSEASLYGLGFGTARGGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVD  271

Query  870   VISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +IS+SVGG   +S+F D IAIG++HA+K  I+T+ +AGNEGP + T  NVSPW ++VAA+
Sbjct  272   IISLSVGGSEVKSYFTDSIAIGAFHAIKHGILTSNSAGNEGPEYFTTSNVSPWSLSVAAS  331

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
             +IDR+F S V+L NG +  G +I+TF+L GK YPLI G  A +K+  +  + S  C+  S
Sbjct  332   TIDRKFVSRVQLANGTVYQGPAIHTFDLMGKQYPLIHGGDAPNKSGGFNSSISRYCNENS  391

Query  1221  ISEKLVRGKIVYCLS--SASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGK  1391
             +   LV+GKI+ C S   AS   ++     VG+I    +  D      +PA+ +   +  
Sbjct  392   LDLSLVKGKILVCDSILRASTVESVNKNGAVGIIMQGSRFKDYASSYPLPASYLHSTN--  449

Query  1392  KIDKYINTTKAPTAEIFRSRAV-KTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
                  INT  + TA IF+S  +   +AP V SFS+RGP   +L+ILKPDL APG+ ILAA
Sbjct  450   -----INTLSS-TATIFKSNEILNASAPSVVSFSSRGPNLATLDILKPDLTAPGVEILAA  503

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             ++ +A ++G   D+R V YN+ SGTSM+ PHA   A YVKTF+P WSPAAIKSALMTTA 
Sbjct  504   WSPIAPVSGIAGDSRSVLYNIISGTSMSCPHATAIAVYVKTFNPTWSPAAIKSALMTTAF  563

Query  1749  AM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE--FNNASLGSLTGS  1916
             +M  K+ P  A  A GAG I P KA+ PGL+++  +++Y+++LC +  +    +  +TG 
Sbjct  564   SMNAKVNP-EAEFAYGAGHINPLKALNPGLVYNATETDYINFLCGQEGYTTEMVRHITGD  622

Query  1917  KDNKCKNIPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             K   C   PA  G    LNYPS     T P+  T +  F RT+T V   ++++ AK+ AP
Sbjct  623   K-TACT--PANSGRVWDLNYPSFAFS-TTPSQLTINQFFTRTLTNVEFNTSLYTAKVFAP  678

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
               L ++V P  L F      +S+K+ V G   + I   +SGSLVW D  H VRSPI VY
Sbjct  679   PSLRITVDPPSLLFNGIGDTKSFKLTVQGTVNQNI---VSGSLVWTDGVHQVRSPITVY  734



>ref|XP_004164258.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=752

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/719 (46%), Positives = 456/719 (63%), Gaps = 31/719 (4%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVYMG   +D   S+   HH  + E +     A ++ ++SY+RSF+GF  RL   E
Sbjct  35    RKTYIVYMGSKLED--TSSTPLHHRAMLEQVVGSNFAPKHLLYSYKRSFNGFAVRLTEEE  92

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
             A++++ K+ VVSVF N +  + TTRSWDF+G +    R  + ES+++VG+LDTG+W ESP
Sbjct  93    AQKIALKEGVVSVFPNGKKHVHTTRSWDFMGFTQSVPRVNQVESNIVVGVLDTGIWPESP  152

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D   GPPPA WKG+CQ   +F  CNRK+IGA+ +  E   P + +SP D +GHG+H 
Sbjct  153   SFNDTDLGPPPAGWKGQCQTSPDFQ-CNRKIIGARTYRSEKLPPGNIQSPRDSEGHGTHT  211

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS  AG +V  ASLYG+  GTARGGVPSARIA YK+CW  GC D D+LA FD AIADGVD
Sbjct  212   ASTVAGGLVSEASLYGLGFGTARGGVPSARIAVYKICWSDGCYDADILAAFDDAIADGVD  271

Query  870   VISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +IS+SVGG   +S+F D IAIG++HA+K  I+T+ +AGNEGP + T  NVSPW ++VAA+
Sbjct  272   IISLSVGGSEVKSYFTDSIAIGAFHAIKHGILTSNSAGNEGPEYFTTSNVSPWSLSVAAS  331

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSA-CDYLS  1220
             +IDR+F S V+L NG +  G +I+TF+L GK YPLI G  A +K+  +  + S  C+  S
Sbjct  332   TIDRKFVSRVQLANGTVYQGPAIHTFDLMGKQYPLIHGGDAPNKSGGFNSSISRYCNENS  391

Query  1221  ISEKLVRGKIVYCLS--SASQDYTIKWIHGVGVIAS-DKLPDTVLPTMIPATIVDIEDGK  1391
             +   LV+GKI+ C S   AS   ++     VG+I    +  D      +PA+ +   +  
Sbjct  392   LDLSLVKGKILVCDSILRASTVESVNKNGAVGIIMQGSRFKDYASSYPLPASYLHSTN--  449

Query  1392  KIDKYINTTKAPTAEIFRSRAV-KTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAA  1568
                  INT  + TA IF+S  +   +AP V SFS+RGP   +L+ILKPDL APG+ ILAA
Sbjct  450   -----INTLSS-TATIFKSNEILNASAPSVVSFSSRGPNLATLDILKPDLTAPGVEILAA  503

Query  1569  YTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             ++ +A ++G   D+R V YN+ SGTSM+ PHA   A YVKTF+P WSPAAIKSALMTTA 
Sbjct  504   WSPIAPVSGIAGDSRSVLYNIISGTSMSCPHATAIAVYVKTFNPTWSPAAIKSALMTTAF  563

Query  1749  AM--KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE--FNNASLGSLTGS  1916
             +M  K+ P  A  A GAG I P KA+ PGL+++  +++Y+++LC +  +    +  +TG 
Sbjct  564   SMNAKVNP-EAEFAYGAGHINPLKALNPGLVYNATETDYINFLCGQEGYTTEMVRHITGD  622

Query  1917  KDNKCKNIPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAP  2093
             K   C   PA  G    LNYPS     T P+  T +  F RT+T V   ++++ AK+ AP
Sbjct  623   K-TACT--PANSGRVWDLNYPSFAFS-TTPSQLTINQFFTRTLTNVEFNTSLYTAKVFAP  678

Query  2094  TGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
               L ++V P  L F      +S+K+ V G   + I   +SGSLVW D  H VRSPI VY
Sbjct  679   PSLRITVDPPSLLFNGIGDTKSFKLTVQGTVNQNI---VSGSLVWTDGVHQVRSPITVY  734



>ref|XP_010273983.1| PREDICTED: cucumisin-like [Nelumbo nucifera]
Length=743

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/720 (44%), Positives = 455/720 (63%), Gaps = 23/720 (3%)
 Frame = +3

Query  141   DTQRKPYIVYMGEL---PDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVA  311
             +  RK +IVYMG L    DD  +++  +H +IL + +    LA    + SY+RSF+GF A
Sbjct  28    EEDRKVHIVYMGALNTDQDDGXLTS-SQHLSILRQVVEGRNLATGSLVRSYKRSFNGFAA  86

Query  312   RLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTG  491
             +L  RE ++L   D V+SVF +  ++L TTRSW+F+G++ K  R P AESD+IVG+LD G
Sbjct  87    KLNKREKQKLESMDGVLSVFPSRTLQLHTTRSWNFMGLTAKTKRQPNAESDVIVGVLDXG  146

Query  492   VWVESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFD  671
             +W ES SF D+G+GPPP KWKG C  G NFT CN K+IGA+ +++      + E+  D +
Sbjct  147   IWPESESFSDEGFGPPPKKWKGTCNGGSNFT-CNNKLIGARVYSL------NDETARDKE  199

Query  672   GHGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAA  851
             GHG+H AS AAG  V   S YG+A G ARGGVPSARIA YK+C   GC++ D+L+ FD A
Sbjct  200   GHGTHTASTAAGNRVVNVSFYGLARGNARGGVPSARIAVYKICNSVGCREEDILSAFDDA  259

Query  852   IADGVDVISISVGG-HPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWL  1028
             IADGVD+ISISVGG     F  D IAIG++HAM K I+T+ +AGN GP+  ++ +V+PW+
Sbjct  260   IADGVDIISISVGGAQAFDFSSDSIAIGAFHAMAKGILTSNSAGNSGPFAASVSSVAPWM  319

Query  1029  MTVAATSIDRRFESDVKLGNGELISGFSINTF-ELGKMYPLISGTLAQDKNATYPGNYSA  1205
              +VAA+S DR+    V LG+G  + G S+N+F    +   L+ G  A  K    P +   
Sbjct  320   FSVAASSTDRQIIDKVVLGDGTKLVGKSVNSFGARNRKVDLVYGRSASTK--CDPDSVQL  377

Query  1206  CDYLSISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASD-KLPDTVLPTMIPATIVDIE  1382
             C    +   LV+GKIV C   +  +  ++ +  +G I  D +L D  L   +PA ++  E
Sbjct  378   CASDCLDGDLVKGKIVVCDKISIGEEPMR-VGALGTIMIDNELNDFSLIYPLPAVLLTPE  436

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             +G+ +  Y+N+T+ P A I RS A+  ++AP V SFS+RGP  I+ +I+KPD+ APG+ I
Sbjct  437   NGENLKLYMNSTRDPQANILRSEAIHDSSAPLVVSFSSRGPNLITPDIIKPDVTAPGVDI  496

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             L+A++ +A+++    D R VKY++ SGTSM+ PH  G+AAYVK+FHPDWSPAAIKSALMT
Sbjct  497   LSAFSPIASVSDSNADKRSVKYSILSGTSMSCPHVTGSAAYVKSFHPDWSPAAIKSALMT  556

Query  1740  TAKAM-KIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCK-EFNNASLGSLTG  1913
             TA+ M   +   A  A GAG I P KA  PGL++D  K +Y+  LC   +++  +  ++G
Sbjct  557   TARPMSSAQNEDAEFAYGAGHIDPVKARNPGLVYDAQKGDYIQMLCNIGYDSKRVRLISG  616

Query  1914  SKDNKCKNIPAAQG-ADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKA  2090
                + C      +G A  LNYPSM L +    A  F++ F RTVT VG  ++ +KAK+ +
Sbjct  617   DNSSSCPKQANGKGSAKDLNYPSMGLYIDGFKA--FNSNFTRTVTNVGFPNSTYKAKVTS  674

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              + + +SV P++LSF   N+K+S+   V G           GSLVW D  HSVRSPI+VY
Sbjct  675   DSTMKISVKPSVLSFKALNEKKSFVATVGGSALSLTHSTARGSLVWSDGIHSVRSPIVVY  734



>ref|XP_006445191.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
 gb|ESR58431.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
Length=1364

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/638 (50%), Positives = 428/638 (67%), Gaps = 10/638 (2%)
 Frame = +3

Query  351   DKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESPSFKDDGY  530
             D+V+SVF N   +L TTRSWDF+G+   A RN K ESD++VGL+DTG+  ES SFKD G+
Sbjct  2     DRVLSVFPNRYHQLHTTRSWDFIGLPQTARRNLKIESDIVVGLMDTGITPESESFKDSGF  61

Query  531   GPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFA-PEDQESPADFDGHGSHIASIAAG  707
             GPPPAKWKGKC    NF+GCN K+IGA+YF ++G   P D  SP D DGHG+H +S  AG
Sbjct  62    GPPPAKWKGKCDHFANFSGCNNKLIGARYFKLDGNPDPWDILSPIDVDGHGTHTSSTLAG  121

Query  708   RMVEGASLYGIAEGTARGGVPSARIASYKVCW-GQGCQDMDVLAGFDAAIADGVDVISIS  884
              +V  ASLYG+A G ARG VP+AR+A+YKVCW   GC DMD+LA FDAAI DGV+VISIS
Sbjct  122   NVVANASLYGLAWGAARGAVPNARVAAYKVCWVSSGCSDMDILAAFDAAIHDGVNVISIS  181

Query  885   VGGHPRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRF  1064
             +GG    +  D I++G++HA+KK IVT A+AGN+GP +GT+ N +PWL+TVAA+ IDR+F
Sbjct  182   IGGATEDYASDTISVGAFHALKKGIVTVASAGNDGPKWGTVSNHAPWLVTVAASGIDRQF  241

Query  1065  ESDVKLGNGELISGFSINTFE-LGKMYPLISGTLAQDKNATYPGNYSACDYLSISEKLVR  1241
             +S VK GNG  +SG  +NTF+   K YPL+SG     KN+    +   C   S+  K V+
Sbjct  242   KSKVKTGNGRSVSGVGVNTFDPKEKFYPLVSGADVA-KNSESRDSARFCFDDSLDPKKVK  300

Query  1242  GKIVYC-LSSASQD-YTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDKYINT  1415
             GK+VYC L +   D           ++ S++  D     M P T+V++ DG  I  YI++
Sbjct  301   GKLVYCKLGTWGADSVIKGIGGVGIIVGSEQFLDVAQIYMAPGTMVNVTDGDNITDYIHS  360

Query  1416  TKAPTAEIFRSRAVKTTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTG  1595
             T++P+A I++S+ VK  APF+ SFS+RGP   S ++LKPD+AAPG+ ILA+YT + ++TG
Sbjct  361   TRSPSAVIYKSQEVKVRAPFIASFSSRGPNPGSKHLLKPDIAAPGIDILASYTLMKSLTG  420

Query  1596  QVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIKPIG-  1772
                DT+  K+ + SGTSMA PH AG  AYVK+FHP WSPAAIKSA+MTTAK M  +    
Sbjct  421   LKGDTQYSKFTLMSGTSMACPHIAGVVAYVKSFHPSWSPAAIKSAIMTTAKPMSQRVNNE  480

Query  1773  AYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLGSLTGSKDNKCKNIPAA  1949
             A  A GAG + P KAV+PGL++D++   Y+ +LC E +N +SL  L GSK   C ++   
Sbjct  481   AEFAYGAGQVNPQKAVSPGLVYDMDDMSYIQFLCHEGYNGSSLAVLVGSKSINCTSLIPG  540

Query  1950  QGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNIL  2129
              G D LNYP+M + L + N    +A F R VT VG   +++ A IKAP G+ ++V P  L
Sbjct  541   VGYDALNYPTMQVSLKS-NGELTTAIFRRRVTNVGPRLSIYNATIKAPKGVNITVKPMSL  599

Query  2130  SFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTH  2243
             SF +T+ KRS+ VVV  K   + +  +SGSL WK   H
Sbjct  600   SFSRTSHKRSFSVVVKAKPMSS-TQVLSGSLEWKSPRH  636


 Score =   242 bits (617),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 190/325 (58%), Gaps = 11/325 (3%)
 Frame = +3

Query  246   DEELAREYRIHSYRRSFSGFVARLLPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGM  425
             ++E      +++Y  + SGF A+L  ++ + L   D  +S   +  + L TT S  FLG+
Sbjct  765   EQETTPPQILYAYENAISGFSAKLSTKQLKSLETVDGFLSATPDELLTLHTTYSPHFLGL  824

Query  426   STKAN--RNPKAESDLIVGLLDTGVWVESPSFKDDGYGPPPAKWKGKCQKGLNFT--GCN  593
              +            D+IVG++DTG+W E  +F+D G  P P++WKG C++G  F+   CN
Sbjct  825   ESGIGLWDATNLAKDVIVGVIDTGIWPEHIAFQDTGMPPVPSRWKGGCEEGTKFSQSNCN  884

Query  594   RKVIGAQYF-----NVEGFAPE--DQESPADFDGHGSHIASIAAGRMVEGASLYGIAEGT  752
              K+IGA+ F     +V G   E  D  SP D  GHG+H AS AAG +V  A+L+G+A G 
Sbjct  885   NKLIGARAFFKGYESVVGRINETVDYRSPRDAQGHGTHTASTAAGNIVANANLFGLARGK  944

Query  753   ARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVDVISISVGGHPRSFFQDPIAIG  932
             A G   ++RIA+YK CW  GC   D+LA  D A+ADGVDV+S+S+GG  R +++D +AI 
Sbjct  945   AAGMRYTSRIAAYKACWSLGCSSSDILAAIDKAVADGVDVLSLSLGGSSRPYYRDTVAIA  1004

Query  933   SYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAATSIDRRFESDVKLGNGELISGFS  1112
             S+ A +  +  + +AGN GP   T+ N +PW+MTVAA+  DR F + VKLGNG    G S
Sbjct  1005  SFGATQSGVFVSCSAGNSGPSISTVDNTAPWIMTVAASYTDRSFPAIVKLGNGHSFEGSS  1064

Query  1113  INTFELGKMYPLISGTLAQDKNATY  1187
             + + +  K  PL+ G  A    A Y
Sbjct  1065  LYSGKGSKQLPLVFGKTAGVSGAEY  1089


 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 150/276 (54%), Gaps = 19/276 (7%)
 Frame = +3

Query  1482  SFSARGPQTISLNILKPDLAAPGLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPH  1661
             SFS+RGP  +  +++KPD+ APG++ILAA+ A  + +    D R V +N+ SGTSM+ PH
Sbjct  1091  SFSSRGPSLVGHDVIKPDVTAPGVNILAAWPATTSPSMLKSDDRRVLFNIISGTSMSCPH  1150

Query  1662  AAGAAAYVKTFHPDWSPAAIKSALMTTAKAMKIK-------------PIGAYLASGAGLI  1802
              +G AA +K+ H DWS AAIKSALMTTA  +  +             P+    A G+G +
Sbjct  1151  VSGLAALLKSVHEDWSTAAIKSALMTTAYTLNNRNSPIADVGGSSDTPLATAFAFGSGHV  1210

Query  1803  RPTKAVAPGLIFDINKSEYMSYLCKEFNNASLG-SLTGSKDNKCKNIPAAQGADGLNYPS  1979
              P  A  PGLI+DI   +Y+ YLC   N  SL  +L    +  C N P+A     LNYPS
Sbjct  1211  DPESASDPGLIYDIATEDYLDYLC-SLNYTSLQLALFAGGNFTCPN-PSAFHPGKLNYPS  1268

Query  1980  MHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVSVVPNILSFPQTNQKRS  2159
               +     N    S  + R+VT VGT    +  K++ P G+ V++ P ILSF +  +  S
Sbjct  1269  FAVNFKG-NVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLVTITPPILSFQKIGEILS  1327

Query  2160  YKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             YKV       +  S    GSL W    ++V+SPI V
Sbjct  1328  YKVTFVS--LRGASNESFGSLTWVSGKYAVKSPIAV  1361



>ref|XP_007219654.1| hypothetical protein PRUPE_ppa025139mg, partial [Prunus persica]
 gb|EMJ20853.1| hypothetical protein PRUPE_ppa025139mg, partial [Prunus persica]
Length=695

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/712 (45%), Positives = 445/712 (63%), Gaps = 25/712 (4%)
 Frame = +3

Query  150   RKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPRE  329
             RK YIVY+G LP D   S +     IL E +  +  A  + + SY+RSF+GF A+L  +E
Sbjct  1     RKTYIVYLGSLPHDEVFSPLSNQIGIL-ERVVQKTSAANFLLTSYKRSFNGFAAKLTEQE  59

Query  330   ARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVESP  509
               RL+   +VVSVF +   +L TTRSWDFLG++    RN   ES+ I+G++D+G+  +S 
Sbjct  60    RERLAGMKEVVSVFPSRTFQLQTTRSWDFLGLNQTTKRNATVESNTIIGVIDSGISPDSE  119

Query  510   SFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSHI  689
             SF D+G+GP P KWKG C+ G NFT CN K+IGA+Y+  +G         +D  GHG+H 
Sbjct  120   SFNDEGFGPAPKKWKGVCKGGQNFT-CNNKIIGARYYTDDG--------ASDAVGHGTHT  170

Query  690   ASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGVD  869
             AS AAG  V+  S YG+A+GTARGGVPSARIA+YKVC   GC    +L GFD AIADGVD
Sbjct  171   ASTAAGNPVKDVSFYGLAQGTARGGVPSARIAAYKVCSVSGCPTEAILQGFDDAIADGVD  230

Query  870   VISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAAT  1046
             +I+IS+G    + F QDPIAIG++HAM+K I+T  +AGN GP  G++ +V+PW +TVAA+
Sbjct  231   IITISIGAESSAPFQQDPIAIGAFHAMEKGILTLQSAGNSGPEAGSVSSVAPWTLTVAAS  290

Query  1047  SIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLSI  1223
             S DRR    + LGNG+ I G S+N+F+L G  +PL+ G  A  +      +   C    +
Sbjct  291   STDRRIIDKIVLGNGKTIVGSSVNSFKLNGTNFPLVYGKDASSQ--CVDSDARQCVAGCL  348

Query  1224  SEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKIDK  1403
                LV+GKIV C   A  +        +G I +   PD      +PA+ +  +D   +  
Sbjct  349   DADLVKGKIVLC-DQAGGNTEAHQAGALGSILNTSKPDVAFVVPLPASGLGSQDYDVVKS  407

Query  1404  YINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTAL  1580
             Y+ +TK P A I +S A+K   AP V SFS+RGP  I   I+KPD++APG+ ILAAY+ L
Sbjct  408   YLKSTKRPRANILKSEAIKDDGAPVVASFSSRGPNQIVPEIIKPDISAPGIDILAAYSTL  467

Query  1581  ATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTA---KA  1751
             A +TG  +D R VKY++ SGTSM+ PH AG AAY+KTFHPDWSPAAIKS++MTTA     
Sbjct  468   APITGSTEDKRRVKYSILSGTSMSCPHVAGVAAYIKTFHPDWSPAAIKSSIMTTAWPVND  527

Query  1752  MKIKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDNKC  1931
              K  P  A  A G+G I P KA+ PGL+F+ +K +Y+ +LC   +  S+  ++G   + C
Sbjct  528   TKTSP--AEFAYGSGHINPLKAINPGLVFEASKEDYIKFLCSVLDEGSVRLISGDS-SSC  584

Query  1932  KNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLTVS  2111
                 A      LNYPS+   +   ++T+F+  F RTV  VG  ++ +KA I + + + + 
Sbjct  585   PAGSAKVLPKDLNYPSLAANVN--SSTSFTINFLRTVKNVGLPNSTYKANILSSSEVDIK  642

Query  2112  VVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             V P++LSF   N+++++ V V G+     S ++S SLVW D THSVRSPILV
Sbjct  643   VEPDVLSFKSLNEEKTFDVTVVGRGIPEGS-HVSASLVWTDGTHSVRSPILV  693



>emb|CBI31602.3| unnamed protein product [Vitis vinifera]
Length=1474

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/725 (48%), Positives = 473/725 (65%), Gaps = 26/725 (4%)
 Frame = +3

Query  138   HDTQRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
              D  RK YIVYMG  P     SA   H N+L +  G +  A    + SY+RSF+GFVA+L
Sbjct  759   EDDVRKEYIVYMGAKPAG-DFSASVIHTNMLEQVFGSDR-ASSSLVRSYKRSFNGFVAKL  816

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVSVF + + +L TTRSWDF+G   +  R    ESD+I+G+LD G+W
Sbjct  817   TEDEMQQMKGMDGVVSVFPSEKKQLHTTRSWDFVGFPRQVKRT-SVESDIIIGVLDGGIW  875

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVE-GFAPEDQESPADFDG  674
              ES SF D G+GPPP KWKG CQ   NFT CN K+IGA+Y+  +  F+PED +SP D DG
Sbjct  876   PESDSFDDKGFGPPPRKWKGTCQGFSNFT-CNNKIIGAKYYKSDRKFSPEDLQSPRDSDG  934

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC D D+LA FD AI
Sbjct  935   HGTHTASTAAGGLVNMASLMGFGLGTARGGVPSARIAVYKICWSDGCDDADILAAFDDAI  994

Query  855   ADGVDVISISVGGHP-RSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+IS S+G  P + +F+D  AIG++HAMK  I+T+ +AGN+GP   ++ +VSPW +
Sbjct  995   ADGVDIISYSLGNPPSQDYFKDTAAIGAFHAMKNGILTSTSAGNDGPRLVSVVSVSPWSL  1054

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++IDR+F ++V+LG+ ++  GFSIN FE   MYPLI G  A +    + GN S  C
Sbjct  1055  SVAASTIDRKFLTEVQLGDRKVYKGFSINAFEPNGMYPLIYGGDAPNTRGGFRGNTSRFC  1114

Query  1209  DYLSISEKLVRGKIVYC--LSSASQDYTIKWIHG-VGVIASDKL---PDTVLPTMIPATI  1370
             +  S++  LV+GKIV C  L +  ++ +  ++ G VG +  D L    D+     +PA+ 
Sbjct  1115  EKNSLNPNLVKGKIVLCIGLGAGLEETSNAFLAGAVGTVIVDGLRFPKDSSYIYPLPASR  1174

Query  1371  VDIEDGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAP  1547
             +   DGK+I  YI++T  PTA I +S  VK T AP+VPSFS+RGP  I+ ++LKPDL AP
Sbjct  1175  LGAGDGKRIAYYISSTSNPTASILKSIEVKDTLAPYVPSFSSRGPNNITHDLLKPDLTAP  1234

Query  1548  GLSILAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKS  1727
             G+ ILAA++ ++ ++    D RV +YN+ SGTSMA PHA GAAAY+K+FHP WSPAAIKS
Sbjct  1235  GVHILAAWSPISPISQMSGDNRVAQYNILSGTSMACPHATGAAAYIKSFHPTWSPAAIKS  1294

Query  1728  ALMTTAKAMKI-KPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKE-FNNASLG  1901
             ALMTTA  M   K   A  A GAG I P +AV PGL++D ++ +++++LC E ++  +L 
Sbjct  1295  ALMTTATPMSARKNPEAEFAYGAGNIDPVRAVHPGLVYDADEIDFVNFLCGEGYSFQTLR  1354

Query  1902  SLTGSKDNKCKNIPAAQGAD-GLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKA  2078
              +TG      K   A  GA   LNYPS    L+  N  + +  F+R+VT VG+  + +KA
Sbjct  1355  KVTGDHSACSK---ATNGAVWDLNYPS--FALSTSNKESIARTFHRSVTNVGSPMSTYKA  1409

Query  2079  -KIKAPTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRS  2255
               I AP GL ++V PNILSF    QK S+ + V+G+  + I   +S SLVW D  H VRS
Sbjct  1410  IVIGAPKGLKINVKPNILSFTSIGQKLSFVLKVNGRMVEDI---VSASLVWDDGLHKVRS  1466

Query  2256  PILVY  2270
             PI+VY
Sbjct  1467  PIIVY  1471


 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/717 (47%), Positives = 452/717 (63%), Gaps = 41/717 (6%)
 Frame = +3

Query  141   DTQRKPYIVYMGELP-DDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARL  317
             D  RK YIVYMG  P  D + SA+  H ++L +  G    A    + SY+RSF+GFVA+L
Sbjct  38    DDGRKEYIVYMGAKPAGDFSASAI--HIDMLQQVFGSSR-ASISLVRSYKRSFNGFVAKL  94

Query  318   LPREARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVW  497
                E +++   D VVS+F N + +L TTRSWDF+G   +  R    ESD+I+G+LD+G+W
Sbjct  95    TEEEMQQMKGMDGVVSIFPNEKKQLHTTRSWDFVGFPQQVKRT-SIESDIIIGVLDSGIW  153

Query  498   VESPSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEG-FAPEDQESPADFDG  674
              ES SF D+G+GPPP+KW G CQ   NFT CN K+IGA+Y+   G F  ED +SP D +G
Sbjct  154   PESDSFDDEGFGPPPSKWIGTCQGFSNFT-CNNKIIGAKYYRSSGQFRQEDFQSPRDSEG  212

Query  675   HGSHIASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAI  854
             HG+H AS AAG +V  ASL G   GTARGGVPSARIA YK+CW  GC   D+LA FD AI
Sbjct  213   HGTHTASTAAGGLVSMASLMGFGLGTARGGVPSARIAVYKICWSDGCFGADILAAFDDAI  272

Query  855   ADGVDVISISVGGH-PRSFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLM  1031
             ADGVD+ISISVGG  P ++F+DPIAIG++HAMKK+I+T+A+AGN+GP   +I N SPW +
Sbjct  273   ADGVDIISISVGGKTPTNYFEDPIAIGAFHAMKKRILTSASAGNDGPVLASITNFSPWSL  332

Query  1032  TVAATSIDRRFESDVKLGNGELISGFSINTFELGKMYPLISGTLAQDKNATYPGNYSA-C  1208
             +VAA++IDR F + V+LG+  +  G SINTFEL  MYPLI G  A +  A + GN S  C
Sbjct  333   SVAASTIDRDFFTKVQLGDSNVFEGVSINTFELNDMYPLIYGGDAPNTAAGFSGNRSRFC  392

Query  1209  DYLSISEKLVRGKIVYCLSSASQDYTIKWIHG-VGVIASDKLP-DTVLPTMIPATIVDIE  1382
                +++  LV+GKIV C      +    ++ G VG + +D LP D+     +PA+ +   
Sbjct  393   FPSTLNPNLVKGKIVLC--DVKTNGAGAFLAGAVGALMADTLPKDSSRSFPLPASHLSAR  450

Query  1383  DGKKIDKYINTTKAPTAEIFRSRAVKTT-APFVPSFSARGPQTISLNILKPDLAAPGLSI  1559
             DG  I  YIN+T  PTA IF+S  V    AP+V SFS+RGP   S ++LKPD+AAPG+ I
Sbjct  451   DGSSIANYINSTSNPTASIFKSTEVSDALAPYVVSFSSRGPNPASFDLLKPDIAAPGVRI  510

Query  1560  LAAYTALATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMT  1739
             LAA+  +A ++G   D R V YN+ SGTSM+ PHA+GAAAY+K+F+P WSPAAIKSALMT
Sbjct  511   LAAWPPIAPVSGVKGDNREVLYNIISGTSMSCPHASGAAAYIKSFNPTWSPAAIKSALMT  570

Query  1740  TAKAMKIKPI-GAYLASGAGLIRPTKAVAPGLIFDINKSEYMS-YLCKEFNNASLGSLTG  1913
             TA  M  K    A  A GAG I P KA+ PGL++D ++ +Y+  ++C    N ++ +   
Sbjct  571   TATPMSAKKNPEAEFAYGAGNIDPVKAIDPGLVYDADEIDYVKFFVCSAATNGTVWN---  627

Query  1914  SKDNKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAK-IKA  2090
                              LNYPS    L++    + +  F RTVT VG+  + +KA  I A
Sbjct  628   -----------------LNYPS--FALSSLTKESITGMFNRTVTNVGSSVSTYKATVIGA  668

Query  2091  PTGLTVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPI  2261
             P GL + V P+ILSF    QK S+ + V GK ++     + GS ++     S   PI
Sbjct  669   PEGLEIQVEPSILSFTSLMQKLSFVLKVEGKVER--ERRLEGSSIYMYACPSTTKPI  723



>ref|XP_008346999.1| PREDICTED: cucumisin-like [Malus domestica]
Length=710

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/716 (45%), Positives = 443/716 (62%), Gaps = 30/716 (4%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              RK YIVY+G LP D   S +  H  IL E++ +        + SY++SF+GF A+L  R
Sbjct  15    DRKTYIVYLGSLPKDQLFSPLSHHIGIL-ESITESSSPSNLLVRSYKKSFNGFAAKLTDR  73

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             E  RL+  + VVSVF +T   L TTRSWDFLG S K  RNP  ES++ VG++D+G+W ES
Sbjct  74    ERERLANMEGVVSVFLSTTYXLQTTRSWDFLGFSEKVKRNPTVESNVXVGVIDSGIWPES  133

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSH  686
              SF D+G+GP P  WKG C+ G NFT CN K+IGA+Y+           +  D  GHG+H
Sbjct  134   NSFSDEGFGPAPKXWKGVCKGGFNFT-CNXKLIGARYY--------IDSTARDEVGHGTH  184

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG  VE  S YG+A+G ARGGVPSARIA+YKVC  +GC    +LA FD AIADGV
Sbjct  185   TASTAAGNPVEPVSFYGLAQGIARGGVPSARIAAYKVCXSEGCSVDGILAAFDDAIADGV  244

Query  867   DVISISVGGHPR-SFFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+I+IS+       F +DPIAIG++HAM+K I+T+ +AGN GP   T+ +V+PW+++VAA
Sbjct  245   DIITISIASETAPPFHEDPIAIGAFHAMEKGILTSNSAGNYGPAERTVSSVAPWILSVAA  304

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFELGKM-YPLISGTLAQDKNATYPGNYSACDYLS  1220
             +S DRR    V LGNG  + G S+NT EL  M YPLI G     K+A        C+   
Sbjct  305   SSTDRRIIDKVVLGNGRTLVGSSVNTLELNGMSYPLIEG-----KDALRSSGCVDCEDGC  359

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIH--GVGVIASDKLPDTVLPTMIPATIVDIEDGKK  1394
             +   LV+G IV C  +   + +I+  H   +G I S    D      +PAT    +D   
Sbjct  360   LDPDLVKGNIVVCRQA---NGSIEAHHAGAIGAITSTTRSDVSFVVPLPATSFSSKDYDV  416

Query  1395  IDKYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAY  1571
             +  Y+N+T  P   I +S  +K   AP V SFS+RGP  I   I+KPD+ APG+ ILAA+
Sbjct  417   VHSYLNSTAKPVGNILKSEVIKDLAAPTVASFSSRGPNNILPEIIKPDITAPGVEILAAF  476

Query  1572  TALATMTGQVDD-TRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAK  1748
             + +A++T   +D  R VKY ++SGTSM+ PH AG AAY+KTFHP+WSPAAIKS++MTTA 
Sbjct  477   SPVASLTVSSEDLKRHVKYCIQSGTSMSCPHVAGVAAYIKTFHPNWSPAAIKSSIMTTAG  536

Query  1749  AMK--IKPIGAYLASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKD  1922
              +       G +L  G+G I P KAV PGL+++ +K +Y+  LC   + AS+  ++G  D
Sbjct  537   PVNNTSNSTGEFLY-GSGHINPLKAVDPGLVYETSKDDYIKLLCSILDEASVRLISG-DD  594

Query  1923  NKCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGL  2102
             + C      +    LNYPSM   +  P  ++FS  F RTV  VG  ++ +KA I + +G+
Sbjct  595   HPCSAKTGKKSPKDLNYPSMAGTVA-PGTSSFSLKFRRTVKNVGLANSTYKANIISKSGV  653

Query  2103  TVSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILVY  2270
              + VVP +LSF   N+++++ V VSG+     S ++S SLVW D T+SVRSP+LV+
Sbjct  654   DIQVVPQVLSFKSLNEEKAFDVTVSGRGMPYGS-HVSASLVWTDGTYSVRSPVLVF  708



>ref|XP_009354470.1| PREDICTED: cucumisin-like [Pyrus x bretschneideri]
Length=727

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/714 (45%), Positives = 448/714 (63%), Gaps = 30/714 (4%)
 Frame = +3

Query  147   QRKPYIVYMGELPDDPTISAVDEHHNILTEALGDEELAREYRIHSYRRSFSGFVARLLPR  326
              RK YIVY+G LP D   S +  H  IL E + +   A    + SY+RS +GF A+L  R
Sbjct  32    DRKTYIVYLGSLPKDDVFSPLSHHIGIL-ERVIESSSASNLLVRSYKRSINGFAAKLTDR  90

Query  327   EARRLSEKDKVVSVFRNTEMKLLTTRSWDFLGMSTKANRNPKAESDLIVGLLDTGVWVES  506
             E  RL++  +VVSVF +T  KL TTRSW+FLG + K  RNP  ES++IVG++DTG+W ES
Sbjct  91    ERERLAKMKEVVSVFPSTSYKLQTTRSWEFLGFNEKLKRNPTVESNVIVGVIDTGIWPES  150

Query  507   PSFKDDGYGPPPAKWKGKCQKGLNFTGCNRKVIGAQYFNVEGFAPEDQESPADFDGHGSH  686
              SF D+G+GP P KWKG C+ G NFT CN K+IGA+++           S  D  GHG+H
Sbjct  151   ESFSDEGFGPAPRKWKGVCKGGKNFT-CNNKIIGARFYV--------GSSARDDVGHGTH  201

Query  687   IASIAAGRMVEGASLYGIAEGTARGGVPSARIASYKVCWGQGCQDMDVLAGFDAAIADGV  866
              AS AAG  V+G S YG+A GTA GGVPSARIA+YKVC  + C    +LA FD AIADGV
Sbjct  202   TASTAAGNPVKGVSFYGLAHGTATGGVPSARIATYKVCGSKVCATNKILAAFDDAIADGV  261

Query  867   DVISISVGGHPRS-FFQDPIAIGSYHAMKKKIVTTAAAGNEGPYFGTIQNVSPWLMTVAA  1043
             D+I+IS+G    + F +D IAIG++HA++K I+T+ +AGN GPY  ++ +V+PW++TVAA
Sbjct  262   DIITISIGSTSAAPFDRDAIAIGAFHALEKGILTSQSAGNSGPYESSVSSVAPWILTVAA  321

Query  1044  TSIDRRFESDVKLGNGELISGFSINTFEL-GKMYPLISGTLAQDKNATYPGNYSACDYLS  1220
             +  DRR    V LGNG  + G S+N FEL G  +PLI    A+D ++        CD   
Sbjct  322   SITDRRIIDKVVLGNGRTLVGNSLNAFELKGTGFPLIE---AKDASS----ECGDCDAGC  374

Query  1221  ISEKLVRGKIVYCLSSASQDYTIKWIHGVGVIASDKLPDTVLPTMIPATIVDIEDGKKID  1400
             +   LV+GKIV C   A     ++ +  +G ++   +PD      +PA     +D   + 
Sbjct  375   LDPNLVKGKIVVC-RWAFGSIEVRRVGAIGALSESIIPDVSGIVPLPAASFSSKDFDVVK  433

Query  1401  KYINTTKAPTAEIFRSRAVK-TTAPFVPSFSARGPQTISLNILKPDLAAPGLSILAAYTA  1577
              Y+N+T  P A++ +S  +K   AP V SFS+RGP  I   I+KPD+ APG+ ILAAY+ 
Sbjct  434   SYVNSTGKPRAKLLKSEVIKDLAAPTVASFSSRGPNFILPEIIKPDITAPGVDILAAYSP  493

Query  1578  LATMTGQVDDTRVVKYNVESGTSMATPHAAGAAAYVKTFHPDWSPAAIKSALMTTAKAMK  1757
             +A +T  V+D R VKY+  SGTSM+ PHAAG AAY+KTFHP+WSPAAIKS++MTTA    
Sbjct  494   VAPLTESVEDRRHVKYSFLSGTSMSCPHAAGVAAYIKTFHPNWSPAAIKSSIMTTAGPAN  553

Query  1758  IKPIGAY----LASGAGLIRPTKAVAPGLIFDINKSEYMSYLCKEFNNASLGSLTGSKDN  1925
             I   G+Y     + G+G I P KA+ PGL+++ +K +Y+  LC   + + +  ++G K  
Sbjct  554   ITD-GSYWPGVFSYGSGHINPLKALNPGLVYETSKDDYIKLLCSILDESKVQLISGDK-R  611

Query  1926  KCKNIPAAQGADGLNYPSMHLQLTNPNATTFSAAFYRTVTYVGTGSTVFKAKIKAPTGLT  2105
              C      + A  LNYPS+  ++     ++FS  F RTV  VG  ++ +KAK  +  G+ 
Sbjct  612   PCPARTGKKWAKDLNYPSLAGKVV--TESSFSIQFQRTVKNVGLANSTYKAKTISKRGVN  669

Query  2106  VSVVPNILSFPQTNQKRSYKVVVSGKFQKAISWYMSGSLVWKDNTHSVRSPILV  2267
             + VVP +LSF   N+K+++ V VSG+   + + Y+S SLVW D THSVRSPIL+
Sbjct  670   IKVVPQVLSFKSLNEKKTFNVTVSGRDIPSRT-YVSASLVWTDGTHSVRSPILL  722



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7988994253112