BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29469_g1_i1 len=2305 path=[2283:0-2304]

Length=2305
                                                                      Score     E

gb|AHA15849.1|  male sterility protein 2                                900   0.0      
ref|XP_009590583.1|  PREDICTED: fatty acyl-CoA reductase 2              896   0.0      
ref|XP_009769707.1|  PREDICTED: fatty acyl-CoA reductase 2              889   0.0      
ref|XP_006360607.1|  PREDICTED: fatty acyl-CoA reductase 2-like         874   0.0      
ref|XP_004234754.1|  PREDICTED: fatty acyl-CoA reductase 2              867   0.0      
gb|AFB77197.1|  male sterility protein 2                                860   0.0      
ref|XP_007029101.1|  Jojoba acyl CoA reductase-related male steri...    825   0.0      
ref|XP_007029099.1|  Jojoba acyl CoA reductase-related male steri...    815   0.0      
ref|XP_011078802.1|  PREDICTED: fatty acyl-CoA reductase 2              808   0.0      
ref|XP_006481697.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    808   0.0      
ref|XP_006481696.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    809   0.0      
ref|XP_006429946.1|  hypothetical protein CICLE_v10011332mg             805   0.0      
gb|EYU20678.1|  hypothetical protein MIMGU_mgv1a003493mg                800   0.0      
ref|XP_007145718.1|  hypothetical protein PHAVU_007G262300g             796   0.0      
ref|XP_004305541.1|  PREDICTED: fatty acyl-CoA reductase 2-like         785   0.0      
ref|XP_010101094.1|  Fatty acyl-CoA reductase 2                         782   0.0      
ref|XP_008371142.1|  PREDICTED: fatty acyl-CoA reductase 2              781   0.0      
ref|XP_009335888.1|  PREDICTED: fatty acyl-CoA reductase 2              776   0.0      
gb|KHG30562.1|  Fatty acyl-CoA reductase 2                              775   0.0      
ref|XP_004514155.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    772   0.0      
ref|XP_002323348.2|  Male sterility protein 2                           773   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN00025.1|  Fatty acyl-CoA reductase 2                              772   0.0      
ref|XP_003520320.1|  PREDICTED: fatty acyl-CoA reductase 2-like         772   0.0      
ref|XP_011039509.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    772   0.0      
ref|XP_008241158.1|  PREDICTED: fatty acyl-CoA reductase 2              771   0.0      
ref|XP_007204810.1|  hypothetical protein PRUPE_ppa026306mg             769   0.0      
gb|ACA28679.1|  male sterility-related protein                          758   0.0      Linum usitatissimum
gb|AHJ37516.1|  fatty acyl-CoA reductase 2-like protein                 760   0.0      
ref|XP_002276588.1|  PREDICTED: fatty acyl-CoA reductase 2              760   0.0      Vitis vinifera
gb|KHN43996.1|  Fatty acyl-CoA reductase 2                              761   0.0      
emb|CBI29968.3|  unnamed protein product                                761   0.0      
gb|KEH41771.1|  fatty acyl-CoA reductase-like protein                   755   0.0      
ref|XP_004514156.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    746   0.0      
ref|XP_003535102.1|  PREDICTED: fatty acyl-CoA reductase 2-like         740   0.0      
ref|XP_010024331.1|  PREDICTED: fatty acyl-CoA reductase 2              741   0.0      
ref|XP_010520001.1|  PREDICTED: fatty acyl-CoA reductase 2-like         741   0.0      
gb|KCW90352.1|  hypothetical protein EUGRSUZ_A02497                     737   0.0      
ref|XP_002308347.2|  Male sterility protein 2                           721   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010673235.1|  PREDICTED: fatty acyl-CoA reductase 2              711   0.0      
ref|XP_006407385.1|  hypothetical protein EUTSA_v10020305mg             699   0.0      
ref|XP_010498380.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    692   0.0      
ref|XP_008776229.1|  PREDICTED: uncharacterized protein LOC103696395    716   0.0      
ref|XP_008442196.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    692   0.0      
ref|XP_006299443.1|  hypothetical protein CARUB_v10015607mg             693   0.0      
ref|XP_004144700.1|  PREDICTED: fatty acyl-CoA reductase 2-like         690   0.0      
ref|XP_009121004.1|  PREDICTED: fatty acyl-CoA reductase 2              691   0.0      
ref|XP_010498364.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    691   0.0      
ref|XP_010464945.1|  PREDICTED: fatty acyl-CoA reductase 2-like         690   0.0      
emb|CAA52019.1|  male sterility 2 (MS2) protein                         690   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882759.1|  hypothetical protein ARALYDRAFT_478549             689   0.0      
emb|CAA68190.1|  male sterility protein 2                               689   0.0      Brassica napus [oilseed rape]
ref|NP_187805.1|  fatty acyl-CoA reductase 2                            689   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ06658.1|  male sterility protein 2-2                              688   0.0      Brassica napus [oilseed rape]
gb|AAQ81302.2|  male sterility protein 2-1 mutant                       687   0.0      Brassica napus [oilseed rape]
ref|XP_011039510.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    684   0.0      
emb|CDY01079.1|  BnaC05g41210D                                          684   0.0      
ref|XP_010557956.1|  PREDICTED: fatty acyl-CoA reductase 2-like         684   0.0      
gb|KHG30561.1|  Fatty acyl-CoA reductase 2                              681   0.0      
emb|CDY08472.1|  BnaA05g27080D                                          681   0.0      
ref|XP_009146656.1|  PREDICTED: fatty acyl-CoA reductase 2-like         680   0.0      
ref|XP_006842773.1|  hypothetical protein AMTR_s00133p00107670          670   0.0      
ref|XP_009391351.1|  PREDICTED: fatty acyl-CoA reductase 2              647   0.0      
ref|XP_003562031.1|  PREDICTED: fatty acyl-CoA reductase 2-like         635   0.0      
dbj|BAK05128.1|  predicted protein                                      632   0.0      
ref|XP_004987158.1|  PREDICTED: fatty acyl-CoA reductase 2-like         630   0.0      
ref|XP_002468445.1|  hypothetical protein SORBIDRAFT_01g046030          619   0.0      Sorghum bicolor [broomcorn]
ref|XP_006651074.1|  PREDICTED: fatty acyl-CoA reductase 2-like         615   0.0      
gb|EMT31062.1|  Fatty acyl-CoA reductase 2                              611   0.0      
ref|XP_008442197.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    603   0.0      
ref|XP_008660506.1|  PREDICTED: fatty acyl-CoA reductase 2-like         606   0.0      
dbj|BAM71700.1|  hypothetical protein                                   605   0.0      
ref|NP_001049083.1|  Os03g0167600                                       602   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC74588.1|  hypothetical protein OsI_10168                          602   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006429861.1|  hypothetical protein CICLE_v10011477mg             598   0.0      
gb|EYU39978.1|  hypothetical protein MIMGU_mgv1a020686mg                588   0.0      
gb|AFW89578.1|  hypothetical protein ZEAMMB73_884169                    587   0.0      
ref|XP_006492869.1|  PREDICTED: fatty acyl-CoA reductase 2-like         583   0.0      
ref|XP_006429858.1|  hypothetical protein CICLE_v10011476mg             581   0.0      
ref|XP_006492917.1|  PREDICTED: fatty acyl-CoA reductase 2-like         572   0.0      
ref|XP_006492870.1|  PREDICTED: fatty acyl-CoA reductase 2-like         565   0.0      
ref|XP_006429863.1|  hypothetical protein CICLE_v10013412mg             552   0.0      
gb|EMS49198.1|  Fatty acyl-CoA reductase 2                              552   0.0      
ref|XP_007048737.1|  Jojoba acyl CoA reductase-related male steri...    544   0.0      
ref|XP_001771307.1|  predicted protein                                  535   3e-179   
emb|CDP14283.1|  unnamed protein product                                529   3e-179   
ref|XP_002323221.2|  hypothetical protein POPTR_0016s03140g             532   8e-178   Populus trichocarpa [western balsam poplar]
ref|XP_002534422.1|  Male sterility protein, putative                   528   3e-177   Ricinus communis
ref|XP_011041378.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    530   6e-177   
gb|KCW65408.1|  hypothetical protein EUGRSUZ_G02832                     526   1e-175   
gb|KCW45312.1|  hypothetical protein EUGRSUZ_L01017                     525   2e-175   
emb|CBI39166.3|  unnamed protein product                                528   2e-175   
ref|XP_010067301.1|  PREDICTED: fatty acyl-CoA reductase 2-like         528   3e-175   
gb|KCW65407.1|  hypothetical protein EUGRSUZ_G02831                     528   3e-175   
ref|XP_001758118.1|  predicted protein                                  523   1e-174   
emb|CAN83375.1|  hypothetical protein VITISV_003906                     524   6e-174   Vitis vinifera
gb|KCW65406.1|  hypothetical protein EUGRSUZ_G02831                     521   1e-172   
gb|EPS67970.1|  hypothetical protein M569_06803                         511   4e-172   
ref|XP_010040308.1|  PREDICTED: fatty acyl-CoA reductase 2-like         517   1e-171   
ref|XP_010559061.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    514   1e-170   
ref|XP_006373689.1|  hypothetical protein POPTR_0016s03140g             511   8e-170   
ref|XP_010325916.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    510   3e-168   
ref|XP_010068865.1|  PREDICTED: fatty acyl-CoA reductase 2-like         504   4e-167   
ref|XP_002974648.1|  hypothetical protein SELMODRAFT_101717             504   5e-167   
ref|XP_002963359.1|  hypothetical protein SELMODRAFT_80322              504   5e-167   
ref|XP_004246728.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    506   7e-167   
ref|XP_010040311.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    503   2e-165   
ref|XP_006345722.1|  PREDICTED: fatty acyl-CoA reductase 2-like         512   2e-164   
ref|XP_010040307.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    497   3e-164   
ref|XP_010326151.1|  PREDICTED: fatty acyl-CoA reductase 2-like         496   4e-163   
ref|XP_006429860.1|  hypothetical protein CICLE_v10011477mg             489   2e-162   
ref|XP_006345721.1|  PREDICTED: fatty acyl-CoA reductase 2-like         489   3e-161   
ref|XP_010544518.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    489   5e-161   
ref|XP_009104026.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    488   3e-160   
ref|XP_010504577.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    487   5e-160   
gb|AEQ33639.1|  male sterility protein 2                                477   5e-160   
ref|XP_009617271.1|  PREDICTED: fatty acyl-CoA reductase 2-like         488   1e-159   
ref|XP_009104027.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    486   2e-159   
ref|XP_010559060.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    482   4e-159   
ref|XP_010412804.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    484   1e-158   
ref|XP_010559064.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    483   1e-158   
ref|XP_009766808.1|  PREDICTED: fatty acyl-CoA reductase 2-like         484   2e-158   
gb|KCW65405.1|  hypothetical protein EUGRSUZ_G02830                     481   3e-158   
ref|XP_010427503.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    481   1e-157   
ref|XP_009104015.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    481   2e-157   
gb|EYU36637.1|  hypothetical protein MIMGU_mgv1a003539mg                481   6e-157   
gb|EYU34259.1|  hypothetical protein MIMGU_mgv1a018251mg                479   1e-156   
ref|XP_010068863.1|  PREDICTED: fatty acyl-CoA reductase 2-like         475   3e-156   
emb|CDX67654.1|  BnaA07g16940D                                          477   7e-156   
ref|XP_002960337.1|  hypothetical protein SELMODRAFT_270198             474   1e-154   
ref|XP_010068864.1|  PREDICTED: fatty acyl-CoA reductase 2-like         471   2e-154   
ref|XP_002967375.1|  hypothetical protein SELMODRAFT_270623             473   6e-154   
ref|XP_007029095.1|  Uncharacterized protein TCM_025012                 473   7e-153   
ref|XP_006341245.1|  PREDICTED: fatty acyl-CoA reductase 2-like         466   9e-153   
ref|XP_009116368.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    469   1e-152   
ref|XP_011085075.1|  PREDICTED: fatty acyl-CoA reductase 2-like         470   2e-152   
gb|EYU17600.1|  hypothetical protein MIMGU_mgv1a023408mg                466   2e-152   
ref|XP_009139082.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    468   2e-152   
ref|XP_011074249.1|  PREDICTED: fatty acyl-CoA reductase 2-like         468   3e-152   
gb|EYU17592.1|  hypothetical protein MIMGU_mgv1a023221mg                464   4e-152   
emb|CDY56772.1|  BnaAnng14390D                                          465   2e-151   
ref|XP_009139081.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    465   3e-151   
ref|XP_010248281.1|  PREDICTED: fatty acyl-CoA reductase 2-like         455   2e-150   
gb|KCW49551.1|  hypothetical protein EUGRSUZ_K03070                     459   4e-150   
ref|XP_007048736.1|  Jojoba acyl CoA reductase-related male steri...    461   5e-150   
ref|XP_010909720.1|  PREDICTED: fatty acyl-CoA reductase 2-like         454   6e-149   
sp|B9TSP7.1|FACR6_ARATH  RecName: Full=Fatty acyl-CoA reductase 6...    459   6e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076814.1|  PREDICTED: fatty acyl-CoA reductase 2-like         457   8e-149   
ref|XP_010427501.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    457   2e-148   
emb|CDX72116.1|  BnaC08g27580D                                          457   2e-148   
emb|CDX72117.1|  BnaC08g27570D                                          453   1e-146   
ref|XP_010039188.1|  PREDICTED: fatty acyl-CoA reductase 2-like         442   1e-143   
ref|XP_009139083.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    443   5e-143   
ref|XP_010427505.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    439   1e-141   
ref|XP_002878102.1|  hypothetical protein ARALYDRAFT_324181             439   2e-141   
ref|XP_004172368.1|  PREDICTED: fatty acyl-CoA reductase 2-like         429   5e-141   
emb|CDX67663.1|  BnaA07g17030D                                          437   2e-140   
gb|KCW45311.1|  hypothetical protein EUGRSUZ_L01016                     432   8e-140   
gb|EYU36638.1|  hypothetical protein MIMGU_mgv1a004191mg                434   2e-139   
ref|XP_010427502.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    432   1e-138   
ref|XP_011041379.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    425   1e-137   
gb|EMT07818.1|  Fatty acyl-CoA reductase 2                              428   2e-137   
ref|XP_009104016.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    424   8e-136   
ref|XP_009139084.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    419   3e-134   
ref|NP_191229.1|  fatty acyl-CoA reductase 6                            420   4e-134   Arabidopsis thaliana [mouse-ear cress]
gb|ABR18362.1|  unknown                                                 414   5e-132   Picea sitchensis
gb|KDP46041.1|  hypothetical protein JCGZ_13487                         404   5e-130   
ref|XP_002534572.1|  Male sterility protein, putative                   403   1e-129   Ricinus communis
gb|KDO70812.1|  hypothetical protein CISIN_1g0426942mg                  397   2e-129   
ref|XP_009405296.1|  PREDICTED: probable fatty acyl-CoA reductase 4     404   1e-128   
ref|XP_007015863.1|  Jojoba acyl CoA reductase-related male steri...    404   1e-128   
emb|CDX76006.1|  BnaA04g02700D                                          405   1e-128   
emb|CDY28321.1|  BnaC03g66380D                                          402   6e-128   
ref|XP_006851509.1|  hypothetical protein AMTR_s00040p00158690          402   7e-128   
gb|EMT08796.1|  Fatty acyl-CoA reductase 1                              402   7e-128   
ref|XP_009108773.1|  PREDICTED: fatty acyl-CoA reductase 3-like         402   8e-128   
ref|XP_007150087.1|  hypothetical protein PHAVU_005G125400g             402   2e-127   
ref|XP_003540237.1|  PREDICTED: fatty acyl-CoA reductase 3-like         400   3e-127   
ref|XP_004506277.1|  PREDICTED: fatty acyl-CoA reductase 3-like         400   4e-127   
ref|XP_006412311.1|  hypothetical protein EUTSA_v10025005mg             400   4e-127   
ref|XP_006402959.1|  hypothetical protein EUTSA_v10005887mg             402   4e-127   
ref|XP_003573673.1|  PREDICTED: fatty acyl-CoA reductase 1-like         400   6e-127   
ref|XP_011088871.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    399   1e-126   
gb|AIZ97193.1|  fatty acyl-coenzyme A reductase                         398   3e-126   
ref|XP_007015865.1|  Jojoba acyl CoA reductase-related male steri...    399   3e-126   
ref|XP_003543435.1|  PREDICTED: fatty acyl-CoA reductase 3-like         398   4e-126   
gb|KEH29873.1|  gland-specific fatty acyl-CoA reductase                 398   4e-126   
ref|XP_010325917.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    399   5e-126   
dbj|BAH01371.1|  unnamed protein product                                397   1e-125   Oryza sativa Japonica Group [Japonica rice]
gb|KHN21439.1|  Fatty acyl-CoA reductase 3                              396   2e-125   
gb|EEC83314.1|  hypothetical protein OsI_28691                          396   2e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_007020558.1|  Fatty acid reductase 4                             396   2e-125   
gb|ADK66305.1|  gland-specific fatty acyl-CoA reductase 1               396   2e-125   
gb|AFW65447.1|  male sterility protein 2                                395   4e-125   
ref|XP_008462137.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    395   4e-125   
ref|XP_006664917.1|  PREDICTED: fatty acyl-CoA reductase 1-like         395   4e-125   
gb|EYU21147.1|  hypothetical protein MIMGU_mgv1a019387mg                394   5e-125   
ref|XP_009789793.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    394   2e-124   
ref|XP_004139568.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    394   2e-124   
ref|NP_001151388.1|  male sterility protein 2                           393   2e-124   Zea mays [maize]
ref|XP_002529056.1|  Male sterility protein, putative                   393   3e-124   Ricinus communis
ref|XP_003596783.1|  Fatty acyl-CoA reductase                           393   3e-124   
ref|XP_009631058.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    392   7e-124   
dbj|BAK04658.1|  predicted protein                                      392   8e-124   
dbj|BAD31814.1|  putative fatty acyl coA reductase                      392   9e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008462145.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    392   9e-124   
ref|XP_003538130.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    392   1e-123   
ref|XP_004506152.1|  PREDICTED: fatty acyl-CoA reductase 3-like         391   1e-123   
ref|XP_004973114.1|  PREDICTED: fatty acyl-CoA reductase 1-like         390   3e-123   
gb|AFK33782.1|  unknown                                                 390   4e-123   
gb|KHN38645.1|  Fatty acyl-CoA reductase 3                              390   6e-123   
ref|XP_011090359.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    389   6e-123   
ref|XP_004487512.1|  PREDICTED: fatty acyl-CoA reductase 3-like         389   8e-123   
gb|KHN38647.1|  Fatty acyl-CoA reductase 3                              389   1e-122   
ref|XP_007132412.1|  hypothetical protein PHAVU_011G092500g             389   1e-122   
gb|AFK47309.1|  unknown                                                 389   1e-122   
ref|XP_002867157.1|  predicted protein                                  389   1e-122   
ref|XP_006591085.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    388   3e-122   
ref|XP_008801227.1|  PREDICTED: probable fatty acyl-CoA reductase 4     388   3e-122   
ref|XP_004515386.1|  PREDICTED: fatty acyl-CoA reductase 3-like         388   3e-122   
ref|XP_007020559.1|  Fatty acid reductase 4                             387   4e-122   
ref|XP_002523777.1|  Male sterility protein, putative                   387   5e-122   Ricinus communis
ref|XP_006659273.1|  PREDICTED: fatty acyl-CoA reductase 1-like         387   6e-122   
gb|EYU34267.1|  hypothetical protein MIMGU_mgv1a018187mg                385   7e-122   
ref|XP_004487511.1|  PREDICTED: fatty acyl-CoA reductase 3-like         387   8e-122   
ref|XP_011090362.1|  PREDICTED: fatty acyl-CoA reductase 3-like         386   1e-121   
ref|XP_002305562.1|  hypothetical protein POPTR_0004s19600g             386   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010089855.1|  Fatty acyl-CoA reductase 3                         386   1e-121   
ref|XP_011046268.1|  PREDICTED: fatty acyl-CoA reductase 3-like         386   2e-121   
ref|XP_003543433.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    385   2e-121   
ref|XP_006341242.1|  PREDICTED: fatty acyl-CoA reductase 2-like         382   3e-121   
gb|AES67032.2|  gland-specific fatty acyl-CoA reductase                 385   3e-121   
ref|XP_002305561.2|  hypothetical protein POPTR_0004s19580g             385   3e-121   Populus trichocarpa [western balsam poplar]
gb|AFK38315.1|  unknown                                                 385   4e-121   
ref|XP_010271727.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    385   4e-121   
ref|XP_004974195.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    385   4e-121   
ref|XP_002449116.1|  hypothetical protein SORBIDRAFT_05g005340          385   4e-121   Sorghum bicolor [broomcorn]
ref|XP_006347238.1|  PREDICTED: fatty acyl-CoA reductase 3-like         384   5e-121   
ref|XP_004241314.1|  PREDICTED: fatty acyl-CoA reductase 3              384   6e-121   
emb|CDY48435.1|  BnaA08g11440D                                          384   6e-121   
ref|XP_003539817.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    384   7e-121   
gb|KDP42364.1|  hypothetical protein JCGZ_01940                         384   7e-121   
ref|XP_010271728.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    384   8e-121   
ref|XP_002263184.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    384   9e-121   Vitis vinifera
ref|XP_010943712.1|  PREDICTED: probable fatty acyl-CoA reductase 4     384   1e-120   
ref|NP_197642.1|  fatty acyl-CoA reductase 1                            384   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002263127.1|  PREDICTED: fatty acyl-CoA reductase 3              383   2e-120   Vitis vinifera
ref|XP_007208215.1|  hypothetical protein PRUPE_ppa018909mg             382   5e-120   
ref|XP_009611540.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    382   5e-120   
ref|XP_010244271.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    382   6e-120   
ref|XP_002313667.2|  acyl CoA reductase family protein                  382   6e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004145802.1|  PREDICTED: fatty acyl-CoA reductase 3-like         382   6e-120   
ref|XP_002313668.2|  hypothetical protein POPTR_0009s14720g             381   1e-119   Populus trichocarpa [western balsam poplar]
gb|EMT11621.1|  Fatty acyl-CoA reductase 1                              381   1e-119   
ref|NP_567936.5|  fatty acyl-CoA reductase CER4                         380   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205116.1|  hypothetical protein PRUPE_ppa004817mg             380   2e-119   
gb|EYU36076.1|  hypothetical protein MIMGU_mgv1a004914mg                381   2e-119   
ref|XP_003539173.1|  PREDICTED: fatty acyl-CoA reductase 3-like         380   2e-119   
emb|CDX69007.1|  BnaC01g04460D                                          380   2e-119   
gb|EMT11633.1|  Fatty acyl-CoA reductase 1                              380   2e-119   
ref|XP_006287458.1|  hypothetical protein CARUB_v10000664mg             382   2e-119   
emb|CDY21232.1|  BnaC03g53920D                                          380   2e-119   
ref|XP_006371440.1|  hypothetical protein POPTR_0019s10390g             380   3e-119   
ref|XP_003540238.1|  PREDICTED: fatty acyl-CoA reductase 3-like         380   3e-119   
ref|XP_010535678.1|  PREDICTED: fatty acyl-CoA reductase 3-like         380   3e-119   
ref|XP_008228881.1|  PREDICTED: fatty acyl-CoA reductase 3-like         379   6e-119   
ref|XP_010447195.1|  PREDICTED: fatty acyl-CoA reductase 3-like         379   6e-119   
ref|XP_011090360.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    379   7e-119   
emb|CDY09144.1|  BnaA02g05700D                                          379   9e-119   
ref|XP_006349115.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    379   1e-118   
ref|XP_010493325.1|  PREDICTED: putative fatty acyl-CoA reductase 7     379   1e-118   
ref|NP_190040.3|  fatty acyl-CoA reductase 4                            379   1e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AID60102.1|  alcohol-forming fatty acyl-CoA reductase                378   1e-118   
ref|XP_008228895.1|  PREDICTED: fatty acyl-CoA reductase 3-like         379   2e-118   
ref|XP_010432512.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    379   2e-118   
ref|XP_004974194.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    379   2e-118   
ref|XP_002449115.1|  hypothetical protein SORBIDRAFT_05g005330          378   3e-118   Sorghum bicolor [broomcorn]
ref|XP_010031500.1|  PREDICTED: fatty acyl-CoA reductase 3              377   3e-118   
ref|XP_011044880.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    377   3e-118   
gb|AEV53412.1|  fatty acyl-CoA reductase 3                              377   3e-118   
ref|NP_190041.2|  fatty acyl-CoA reductase 5                            377   3e-118   
ref|XP_010520426.1|  PREDICTED: fatty acyl-CoA reductase 3-like         377   3e-118   
ref|XP_009126546.1|  PREDICTED: fatty acyl-CoA reductase 1-like         377   3e-118   
ref|XP_004291622.1|  PREDICTED: fatty acyl-CoA reductase 3-like         377   4e-118   
ref|XP_009364295.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    377   4e-118   
gb|KDP42371.1|  hypothetical protein JCGZ_01947                         377   5e-118   
gb|ACF85730.1|  unknown                                                 377   5e-118   
ref|XP_009781717.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    377   5e-118   
ref|XP_009338685.1|  PREDICTED: fatty acyl-CoA reductase 3-like         377   5e-118   
ref|XP_002445685.1|  hypothetical protein SORBIDRAFT_07g024230          377   6e-118   
ref|XP_007206366.1|  hypothetical protein PRUPE_ppa017843mg             376   7e-118   
ref|XP_004251043.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    376   7e-118   
ref|XP_006283617.1|  hypothetical protein CARUB_v10004673mg             376   1e-117   
emb|CDY35688.1|  BnaC02g09540D                                          376   1e-117   
emb|CDY26934.1|  BnaC09g36490D                                          375   1e-117   
gb|ACG42983.1|  male sterility protein 2                                376   2e-117   
ref|XP_009119230.1|  PREDICTED: fatty acyl-CoA reductase 3              375   2e-117   
ref|XP_009364296.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    375   2e-117   
ref|XP_007205112.1|  hypothetical protein PRUPE_ppa004772mg             375   2e-117   
ref|XP_008228911.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    374   4e-117   
ref|XP_009120651.1|  PREDICTED: fatty acyl-CoA reductase 1              374   4e-117   
emb|CDX92346.1|  BnaA10g13850D                                          374   4e-117   
ref|XP_010687363.1|  PREDICTED: fatty acyl-CoA reductase 3-like         374   5e-117   
ref|XP_002875671.1|  oxidoreductase, acting on the CH-CH group of...    374   6e-117   
emb|CBI75514.1|  male sterility protein, putative, expressed            374   1e-116   
ref|XP_010514783.1|  PREDICTED: probable fatty acyl-CoA reductase...    373   1e-116   
ref|XP_008458592.1|  PREDICTED: fatty acyl-CoA reductase 3-like         373   1e-116   
ref|XP_003574925.1|  PREDICTED: fatty acyl-CoA reductase 3-like         374   1e-116   
ref|XP_011044902.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    373   2e-116   
ref|XP_006659274.1|  PREDICTED: fatty acyl-CoA reductase 1-like         373   2e-116   
emb|CDY30935.1|  BnaA06g19780D                                          372   2e-116   
ref|XP_010686043.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    372   2e-116   
ref|XP_010454514.1|  PREDICTED: fatty acyl-CoA reductase 1-like         372   3e-116   
ref|XP_010421031.1|  PREDICTED: putative fatty acyl-CoA reductase 7     372   4e-116   
ref|XP_009150272.1|  PREDICTED: probable fatty acyl-CoA reductase 4     372   4e-116   
ref|XP_006279365.1|  hypothetical protein CARUB_v10007993mg             372   5e-116   
emb|CDP06945.1|  unnamed protein product                                371   8e-116   
ref|XP_009376588.1|  PREDICTED: fatty acyl-CoA reductase 3-like         371   8e-116   
ref|XP_002872004.1|  hypothetical protein ARALYDRAFT_910242             371   8e-116   
emb|CDX99193.1|  BnaA06g18840D                                          371   9e-116   
ref|XP_004974193.1|  PREDICTED: fatty acyl-CoA reductase 1-like         371   1e-115   
ref|XP_009150309.1|  PREDICTED: probable fatty acyl-CoA reductase 5     371   1e-115   
ref|XP_010045241.1|  PREDICTED: fatty acyl-CoA reductase 3-like         370   2e-115   
emb|CAN81280.1|  hypothetical protein VITISV_041831                     369   2e-115   
gb|KFK39898.1|  hypothetical protein AALP_AA3G303100                    370   2e-115   
ref|XP_006400757.1|  hypothetical protein EUTSA_v10013355mg             370   2e-115   
ref|XP_010493337.1|  PREDICTED: fatty acyl-CoA reductase 1              370   2e-115   
ref|XP_006419126.1|  hypothetical protein EUTSA_v10002497mg             370   2e-115   
ref|XP_010514781.1|  PREDICTED: fatty acyl-CoA reductase 3-like         370   3e-115   
ref|XP_009419621.1|  PREDICTED: fatty acyl-CoA reductase 3-like         369   3e-115   
ref|XP_008353939.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    369   4e-115   
gb|EMT00454.1|  Fatty acyl-CoA reductase 1                              370   4e-115   
ref|XP_010454504.1|  PREDICTED: putative fatty acyl-CoA reductase 7     369   5e-115   
sp|Q9XGY7.1|FAR_SIMCH  RecName: Full=Alcohol-forming fatty acyl-C...    369   5e-115   
gb|EMS54669.1|  Fatty acyl-CoA reductase 1                              369   7e-115   
ref|XP_010503101.1|  PREDICTED: fatty acyl-CoA reductase 3-like         369   7e-115   
ref|XP_002875672.1|  oxidoreductase, acting on the CH-CH group of...    369   8e-115   
ref|XP_007132408.1|  hypothetical protein PHAVU_011G092300g             368   8e-115   
gb|AFW89579.1|  hypothetical protein ZEAMMB73_884169                    374   1e-114   
gb|KCW58994.1|  hypothetical protein EUGRSUZ_H01618                     368   1e-114   
gb|KFK30008.1|  hypothetical protein AALP_AA7G205800                    368   2e-114   
ref|XP_009785725.1|  PREDICTED: fatty acyl-CoA reductase 3-like         367   2e-114   
gb|KFK39899.1|  hypothetical protein AALP_AA3G303200                    367   3e-114   
ref|XP_004974196.1|  PREDICTED: fatty acyl-CoA reductase 3-like         367   3e-114   
ref|XP_007150088.1|  hypothetical protein PHAVU_005G125500g             367   4e-114   
gb|KDO70939.1|  hypothetical protein CISIN_1g047226mg                   359   5e-114   
ref|XP_010425869.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    366   5e-114   
ref|XP_004166245.1|  PREDICTED: fatty acyl-CoA reductase 3-like         366   5e-114   
ref|XP_007132411.1|  hypothetical protein PHAVU_011G092400g             366   6e-114   
ref|XP_009373003.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    366   6e-114   
ref|XP_006487974.1|  PREDICTED: fatty acyl-CoA reductase 3-like         366   7e-114   
ref|XP_010486875.1|  PREDICTED: fatty acyl-CoA reductase 2-like         362   7e-114   
ref|NP_001183038.1|  hypothetical protein                               366   8e-114   
ref|XP_010070015.1|  PREDICTED: probable fatty acyl-CoA reductase 4     366   8e-114   
ref|XP_009364297.1|  PREDICTED: fatty acyl-CoA reductase 3-like         365   1e-113   
ref|XP_003538131.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    365   2e-113   
ref|XP_009419426.1|  PREDICTED: probable fatty acyl-CoA reductase 4     365   2e-113   
ref|XP_004145801.1|  PREDICTED: fatty acyl-CoA reductase 3-like         364   2e-113   
ref|XP_010514782.1|  PREDICTED: probable fatty acyl-CoA reductase 5     365   3e-113   
gb|AIZ97195.1|  fatty acyl-coenzyme A reductase 4                       365   3e-113   
ref|XP_011088872.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    362   6e-113   
gb|EMS57501.1|  putative fatty acyl-CoA reductase 5                     364   6e-113   
emb|CAD30696.1|  fatty acyl coA reductase                               363   8e-113   
ref|XP_002445686.1|  hypothetical protein SORBIDRAFT_07g024240          364   9e-113   
emb|CDY08707.1|  BnaC03g54750D                                          363   1e-112   
ref|XP_004241312.1|  PREDICTED: probable fatty acyl-CoA reductase...    362   2e-112   
ref|XP_011005173.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    362   2e-112   
ref|XP_010503105.1|  PREDICTED: probable fatty acyl-CoA reductase 5     362   2e-112   
ref|XP_002445692.1|  hypothetical protein SORBIDRAFT_07g024290          362   2e-112   
gb|EMT30212.1|  Fatty acyl-CoA reductase 1                              362   2e-112   
emb|CAA20592.1|  male sterility 2-like protein                          361   3e-112   
ref|XP_011088866.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    362   3e-112   
gb|KFK33885.1|  hypothetical protein AALP_AA5G072900                    362   3e-112   
ref|XP_004291620.1|  PREDICTED: fatty acyl-CoA reductase 3-like         361   4e-112   
emb|CAD30692.1|  fatty acyl coA reductase                               362   4e-112   
ref|XP_007020562.1|  Fatty acid reductase 4                             362   4e-112   
ref|XP_004291621.1|  PREDICTED: fatty acyl-CoA reductase 1-like         361   5e-112   
ref|XP_009610475.1|  PREDICTED: fatty acyl-CoA reductase 3-like         361   6e-112   
ref|XP_008228906.1|  PREDICTED: fatty acyl-CoA reductase 3-like         361   6e-112   
ref|XP_006290972.1|  hypothetical protein CARUB_v10017087mg             361   6e-112   
gb|KDO58051.1|  hypothetical protein CISIN_1g037479mg                   361   7e-112   
ref|XP_011089202.1|  PREDICTED: fatty acyl-CoA reductase 3-like         360   1e-111   
gb|AIE57506.1|  CER4                                                    359   2e-111   
ref|XP_006419124.1|  hypothetical protein EUTSA_v10002499mg             360   2e-111   
emb|CDY65611.1|  BnaCnng47950D                                          359   2e-111   
gb|KFK23136.1|  hypothetical protein AALP_AAs65178U000500               359   2e-111   
emb|CAB80096.1|  male sterility 2-like protein                          359   2e-111   
ref|XP_006419122.1|  hypothetical protein EUTSA_v10002495mg             360   2e-111   
ref|XP_006349384.1|  PREDICTED: fatty acyl-CoA reductase 3-like         359   2e-111   
ref|XP_010255716.1|  PREDICTED: fatty acyl-CoA reductase 3-like         359   2e-111   
ref|XP_006349114.1|  PREDICTED: fatty acyl-CoA reductase 1-like         358   6e-111   
gb|KCW58995.1|  hypothetical protein EUGRSUZ_H01619                     357   9e-111   
gb|AES88411.2|  gland-specific fatty acyl-CoA reductase                 358   1e-110   
ref|XP_009610473.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    357   1e-110   
ref|XP_006279387.1|  hypothetical protein CARUB_v10008006mg             357   2e-110   
ref|XP_010314793.1|  PREDICTED: fatty acyl-CoA reductase 3-like         356   3e-110   
gb|AES98766.2|  gland-specific fatty acyl-CoA reductase                 356   4e-110   
dbj|BAD46254.1|  putative fatty acyl coA reductase                      356   4e-110   
ref|NP_001063962.1|  Os09g0567500                                       356   5e-110   
gb|KGN46944.1|  hypothetical protein Csa_6G151810                       356   6e-110   
ref|XP_010425872.1|  PREDICTED: probable fatty acyl-CoA reductase...    356   6e-110   
ref|XP_010520424.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    356   6e-110   
ref|XP_004161427.1|  PREDICTED: fatty acyl-CoA reductase 3-like         358   6e-110   
ref|XP_010520425.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    355   9e-110   
ref|XP_008458693.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    356   9e-110   
ref|XP_004308636.1|  PREDICTED: fatty acyl-CoA reductase 3-like         355   1e-109   
ref|XP_010313341.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    354   2e-109   
gb|KFK33883.1|  hypothetical protein AALP_AA5G072700                    354   2e-109   
gb|KHN38648.1|  Fatty acyl-CoA reductase 3                              354   2e-109   
emb|CBI75517.1|  male sterility protein, putative, expressed            354   2e-109   
ref|XP_002875673.1|  oxidoreductase, acting on the CH-CH group of...    354   2e-109   
ref|XP_004295749.1|  PREDICTED: probable fatty acyl-CoA reductase...    354   3e-109   
emb|CDX98566.1|  BnaC05g38090D                                          353   6e-109   
ref|XP_009120662.1|  PREDICTED: putative fatty acyl-CoA reductase 7     353   8e-109   
ref|NP_190042.2|  fatty acyl-CoA reductase 8                            353   8e-109   
ref|XP_010503102.1|  PREDICTED: probable fatty acyl-CoA reductase...    352   1e-108   
ref|XP_006660992.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    353   1e-108   
gb|ABK28586.1|  unknown                                                 352   1e-108   
ref|XP_009131879.1|  PREDICTED: putative fatty acyl-CoA reductase...    352   2e-108   
ref|XP_003615808.1|  Fatty acyl-CoA reductase                           351   3e-108   
ref|XP_006347255.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    351   4e-108   
ref|XP_002453813.1|  hypothetical protein SORBIDRAFT_04g018431          347   4e-108   
ref|XP_002443047.1|  hypothetical protein SORBIDRAFT_08g006870          350   4e-108   
emb|CDX76007.1|  BnaA04g02710D                                          349   6e-108   
ref|XP_007132904.1|  hypothetical protein PHAVU_011G134800g             350   6e-108   
ref|XP_010520422.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    351   6e-108   
ref|XP_010687495.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    350   7e-108   
ref|XP_006400746.1|  hypothetical protein EUTSA_v10015841mg             350   8e-108   
ref|XP_004957115.1|  PREDICTED: fatty acyl-CoA reductase 1-like         350   8e-108   
ref|XP_010520423.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    350   1e-107   
ref|XP_009610474.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    349   1e-107   
ref|XP_010535677.1|  PREDICTED: fatty acyl-CoA reductase 1-like         348   2e-107   
ref|XP_006349136.1|  PREDICTED: fatty acyl-CoA reductase 3-like         350   2e-107   
ref|XP_009131878.1|  PREDICTED: putative fatty acyl-CoA reductase...    348   3e-107   
ref|XP_004956203.1|  PREDICTED: fatty acyl-CoA reductase 1-like         348   4e-107   
ref|XP_006591086.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    347   4e-107   
ref|XP_011089201.1|  PREDICTED: fatty acyl-CoA reductase 3-like         348   6e-107   
ref|XP_010651912.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    346   1e-106   
gb|KCW44418.1|  hypothetical protein EUGRSUZ_L02093                     345   2e-106   
ref|XP_006341246.1|  PREDICTED: fatty acyl-CoA reductase 2-like         342   2e-106   
ref|XP_010503103.1|  PREDICTED: probable fatty acyl-CoA reductase...    347   2e-106   
emb|CDY32028.1|  BnaC06g16060D                                          347   4e-106   
ref|XP_006400747.1|  hypothetical protein EUTSA_v10013371mg             345   7e-106   
gb|EEC82054.1|  hypothetical protein OsI_26036                          345   9e-106   
gb|EMT24985.1|  Fatty acyl-CoA reductase 1                              345   9e-106   
gb|EAZ07989.1|  hypothetical protein OsI_30251                          345   1e-105   
ref|NP_001062488.1|  Os08g0557800                                       345   1e-105   
ref|XP_010326043.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    340   1e-105   
gb|AES88362.2|  gland-specific fatty acyl-CoA reductase                 344   2e-105   
gb|AFW89576.1|  hypothetical protein ZEAMMB73_884169                    335   2e-105   
ref|XP_006478011.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    346   2e-105   
ref|XP_008664571.1|  PREDICTED: fatty acyl-CoA reductase 1-like         344   4e-105   
tpg|DAA48675.1|  TPA: hypothetical protein ZEAMMB73_021815              344   4e-105   
ref|XP_004171145.1|  PREDICTED: fatty acyl-CoA reductase 3-like         340   5e-105   
emb|CBI39167.3|  unnamed protein product                                336   5e-105   
ref|XP_003578640.1|  PREDICTED: fatty acyl-CoA reductase 1-like         342   2e-104   
gb|EMS49520.1|  Fatty acyl-CoA reductase 1                              342   6e-104   
ref|XP_004251041.1|  PREDICTED: probable fatty acyl-CoA reductase 4     339   8e-104   
gb|AIZ97194.1|  fatty acyl-coenzyme A reductase 3                       340   9e-104   
ref|XP_010425870.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    338   1e-103   
ref|XP_006347258.1|  PREDICTED: fatty acyl-CoA reductase 3-like         339   1e-103   
ref|NP_001030809.1|  fatty acyl-CoA reductase 4                         337   1e-103   
emb|CAE02214.2|  OSJNBb0002N06.4                                        339   2e-103   
gb|EYU36082.1|  hypothetical protein MIMGU_mgv1a004946mg                339   2e-103   
ref|XP_011088867.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    337   2e-103   
emb|CDX92353.1|  BnaA10g13920D                                          338   3e-103   
ref|XP_006659688.1|  PREDICTED: fatty acyl-CoA reductase 1-like         338   5e-103   
gb|EYU36959.1|  hypothetical protein MIMGU_mgv1a0177801mg               337   5e-103   
gb|AJA71622.1|  Male sterility factor protein                           338   8e-103   
emb|CAH66590.1|  OSIGBa0092G14.1                                        337   1e-102   
emb|CAB88537.1|  acyl CoA reductase-like protein                        333   2e-102   
ref|XP_004490308.1|  PREDICTED: fatty acyl-CoA reductase 8-like         335   2e-102   
ref|XP_002462532.1|  hypothetical protein SORBIDRAFT_02g027540          335   3e-102   
ref|XP_010686048.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    335   3e-102   
ref|XP_003606163.1|  Fatty acyl-CoA reductase                           332   8e-102   
ref|XP_006653297.1|  PREDICTED: fatty acyl-CoA reductase 1-like         333   2e-101   
ref|XP_010514784.1|  PREDICTED: probable fatty acyl-CoA reductase...    331   2e-101   
ref|NP_001052541.1|  Os04g0354600                                       332   5e-101   
ref|XP_010041357.1|  PREDICTED: probable fatty acyl-CoA reductase 4     329   6e-101   
emb|CAD30694.1|  fatty acyl coA reductase                               333   6e-101   
gb|EMT24902.1|  Putative fatty acyl-CoA reductase 5                     333   7e-101   
ref|XP_010271729.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    330   8e-101   
ref|XP_004957631.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    332   8e-101   
ref|XP_010271730.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    330   1e-100   
ref|XP_011005175.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    330   1e-100   
ref|XP_002459832.1|  hypothetical protein SORBIDRAFT_02g011920          331   2e-100   
ref|XP_008458594.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    329   2e-100   
emb|CAH66597.1|  OSIGBa0092G14.8                                        330   3e-100   
ref|XP_003578641.1|  PREDICTED: putative fatty acyl-CoA reductase 7     330   3e-100   
ref|XP_006279378.1|  hypothetical protein CARUB_v10007996mg             328   3e-100   
gb|EMS53770.1|  Fatty acyl-CoA reductase 3                              330   4e-100   
gb|AIU99981.1|  alcohol-forming fatty acyl-coenzyme A reductase         331   4e-100   
gb|KDO70813.1|  hypothetical protein CISIN_1g0426941mg                  323   8e-100   
ref|XP_008458595.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    324   4e-99    
ref|XP_004490345.1|  PREDICTED: fatty acyl-CoA reductase 8-like         327   1e-98    
gb|KCW58570.1|  hypothetical protein EUGRSUZ_H01227                     321   5e-98    
ref|XP_009620478.1|  PREDICTED: fatty acyl-CoA reductase 3-like         322   5e-98    
dbj|BAK06275.1|  predicted protein                                      325   7e-98    
ref|XP_004490307.1|  PREDICTED: fatty acyl-CoA reductase 8-like         323   9e-98    
ref|XP_010111080.1|  Fatty acyl-CoA reductase 1                         332   2e-97    
ref|XP_011005176.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    320   2e-97    



>gb|AHA15849.1| male sterility protein 2 [Petunia x hybrida]
Length=600

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/590 (73%), Positives = 497/590 (84%), Gaps = 24/590 (4%)
 Frame = +1

Query  199   RLCLPLRINNMVYCQGGGSNIVTTGRA--------VDQASKAAALMEA-GSLLLAPNGNA  351
             R C P ++NNMVYCQ  G+N + +G +        V+ +    A MEA GS++L PNG+ 
Sbjct  25    RWCPPKKMNNMVYCQSTGTNAIKSGNSSVITERSSVNGSDNGKAFMEAAGSMVLTPNGST  84

Query  352   QaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLI  531
             QA              ++ +K+LV  Y    +DGIGI +FLRGK+FLITG TGFLGKVLI
Sbjct  85    QA--------------DIKVKDLVP-YERHDDDGIGITKFLRGKAFLITGATGFLGKVLI  129

Query  532   EKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVP  711
             EKILRT PDV+KI+ILIKA NKEVAM+RLK EI++A++FK LKQ +GKSYQ FMLSKLVP
Sbjct  130   EKILRTAPDVNKIFILIKAKNKEVAMQRLKNEILNADIFKCLKQDHGKSYQTFMLSKLVP  189

Query  712   VVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQ  891
             VVGNVCES+LGID+ TA M+AKEVD+IVNSAANTTFDERYD ALDINTGGP+RLM FA  
Sbjct  190   VVGNVCESNLGIDEDTANMMAKEVDVIVNSAANTTFDERYDTALDINTGGPSRLMNFAKI  249

Query  892   CHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMV  1071
             CH LKLFL VSTAYVNGQRQG+I+EK FCIG+SIA E+++ G  +SS P LNVEDE+++V
Sbjct  250   CHNLKLFLQVSTAYVNGQRQGRIMEKSFCIGDSIARENLLCGVNQSSFPSLNVEDEIKLV  309

Query  1072  LSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSV  1251
             L +KQ L + ++ QKMKE+GLERANKFGWQDTYVFTKAMGEMMI++MRG+IPVVI+RPSV
Sbjct  310   LESKQALDNNSVPQKMKEIGLERANKFGWQDTYVFTKAMGEMMINSMRGDIPVVIIRPSV  369

Query  1252  IESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAK  1431
             IEST+KEPFPGWMEG+RMMDPIIL+YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAK
Sbjct  370   IESTYKEPFPGWMEGSRMMDPIILYYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAK  429

Query  1432  HGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSME  1611
             HG  GKPG+S+Y +ASS VNPLVF DLAR+L++HF   PYIDSKG+PI VP+M L  SME
Sbjct  430   HGTEGKPGSSVYQVASSAVNPLVFKDLARMLFDHFNHSPYIDSKGRPIHVPKMALLRSME  489

Query  1612  ALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDN  1791
              LSSHLWRDAI++SGLT L D  GKLS KLENICRKSVEQAKYLA+IYEPYTFYGGRFDN
Sbjct  490   DLSSHLWRDAINRSGLTDLADPNGKLSRKLENICRKSVEQAKYLANIYEPYTFYGGRFDN  549

Query  1792  SNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSC  1941
             SN QKLMECMSKEERWQFGF+VESIDWKDYISNVHIPGLR+HVMKGRGSC
Sbjct  550   SNTQKLMECMSKEERWQFGFDVESIDWKDYISNVHIPGLRKHVMKGRGSC  599



>ref|XP_009590583.1| PREDICTED: fatty acyl-CoA reductase 2 [Nicotiana tomentosiformis]
Length=597

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/604 (71%), Positives = 505/604 (84%), Gaps = 31/604 (5%)
 Frame = +1

Query  178   CFVVSK--------HRLCLPLRINNMVYCQGGGSN------IVTTGRAVDQASKAAALME  315
             C V+S+         R C P +++NM+YCQ  G+N      +++   +V  +  + ALME
Sbjct  10    CSVISRTALKLSNNSRRCPPKKVDNMIYCQSSGTNAIKLSSLISERSSVISSDHSTALME  69

Query  316   A-GSLLLAPNGNAQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFL  492
             A GSL+L+ NG++QA               + +K+LV    E+H+DGIGI +FLRGKSFL
Sbjct  70    AAGSLVLSSNGSSQA--------------EIKVKDLVP--YERHDDGIGITKFLRGKSFL  113

Query  493   ITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYG  672
             ITG TGFLGKVLIEK+LRT PDV+KI+ILIKA NKE AM+RLK EI+SA++FK LKQ +G
Sbjct  114   ITGATGFLGKVLIEKMLRTAPDVNKIFILIKAKNKEHAMKRLKNEILSADIFKSLKQVHG  173

Query  673   KSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDIN  852
             KSYQ FML+KLVPVVGNVCES+LGID+ T++M+AKEVDIIVNSAANTTFDERYD+ALDIN
Sbjct  174   KSYQTFMLNKLVPVVGNVCESNLGIDEDTSKMMAKEVDIIVNSAANTTFDERYDIALDIN  233

Query  853   TGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESS  1032
             TGGP+RLM FA QCH LKLFL VSTAYVNGQRQG+I+EKPFC+G+SIA E++++G   +S
Sbjct  234   TGGPSRLMNFAKQCHNLKLFLQVSTAYVNGQRQGRIMEKPFCVGDSIARENLLSGVNHNS  293

Query  1033  VPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNM  1212
              P LNVEDE+++VL  KQ L + ++ QKMKE+GLERANKFGWQDTYVFTKAMGEMMID+M
Sbjct  294   FPFLNVEDEIKLVLETKQALDNNSVTQKMKEIGLERANKFGWQDTYVFTKAMGEMMIDSM  353

Query  1213  RGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPA  1392
             RG+IPVVI+RPSVIEST+KEPFPGWMEG+RMMDPIIL+YGKGQLTGFLVDPNGVLDVVPA
Sbjct  354   RGDIPVVIIRPSVIESTYKEPFPGWMEGSRMMDPIILYYGKGQLTGFLVDPNGVLDVVPA  413

Query  1393  DMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKP  1572
             DMVVNATLAAMAKHG  GK G+S+Y +ASS VNPLVF DLAR+L++HF   PYIDSKG+P
Sbjct  414   DMVVNATLAAMAKHGTEGKTGSSVYQVASSAVNPLVFKDLARMLFDHFNHSPYIDSKGRP  473

Query  1573  IDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASI  1752
             I VP+M L  SME  SSHLW+DAI++SGLT L D  G LS KLENICRKSVEQAKYLA+I
Sbjct  474   IHVPKMTLLRSMEDFSSHLWQDAINRSGLTDLADPNGNLSKKLENICRKSVEQAKYLANI  533

Query  1753  YEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             YEPYTFYGGRFDNSN Q+LMECMSKEERWQFGF+VE+IDWKDYISNVHIPGLR+HVMKGR
Sbjct  534   YEPYTFYGGRFDNSNTQRLMECMSKEERWQFGFDVENIDWKDYISNVHIPGLRKHVMKGR  593

Query  1933  GSCS  1944
             GSCS
Sbjct  594   GSCS  597



>ref|XP_009769707.1| PREDICTED: fatty acyl-CoA reductase 2 [Nicotiana sylvestris]
Length=593

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/583 (72%), Positives = 496/583 (85%), Gaps = 19/583 (3%)
 Frame = +1

Query  205   CLPLRINNMVYCQGGGSNIVTTGRAVDQA--SKAAALMEA-GSLLLAPNGNAQaaaassa  375
             C   +++NM+YCQ  G+N++ +           + A MEA GSL+L+PN N+QA      
Sbjct  27    CPAKKVDNMIYCQSSGTNVIKSSSRSSVIRSDHSTAFMEAAGSLVLSPNSNSQA------  80

Query  376   sasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVP  555
                      + +K+LV    E+H+DGIGI +FLRGK+FLITG TGFLGKVLIEK+LRT P
Sbjct  81    --------EIKVKDLVP--YERHDDGIGITKFLRGKAFLITGATGFLGKVLIEKMLRTAP  130

Query  556   DVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCES  735
             DV+KI+ILIKA NKE AM+RLK EI++A++FK LKQ +GK YQ FML+KLVPVVGNVCES
Sbjct  131   DVNKIFILIKAKNKEHAMKRLKNEILNADIFKSLKQVHGKFYQTFMLTKLVPVVGNVCES  190

Query  736   DLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFL  915
             +LGID+ T++MIAKEVDIIVNSAANTTFDERYD+ALDINTGGP+RL+ FA QCH LKLFL
Sbjct  191   NLGIDEDTSKMIAKEVDIIVNSAANTTFDERYDIALDINTGGPSRLINFAKQCHNLKLFL  250

Query  916   HVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLS  1095
              VSTAYVNGQRQG+I+EKPFCIG+SIA E++++G   +S P LNVEDE+++VL +KQ L 
Sbjct  251   QVSTAYVNGQRQGRIMEKPFCIGDSIARENLLSGVNHNSFPFLNVEDEIKLVLESKQALD  310

Query  1096  DGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEP  1275
             + +++QKMKE+GLERANKFGWQDTYVFTKAMGEMMID+MRG+IPVVI+RPSVIEST+KEP
Sbjct  311   NNSVSQKMKEIGLERANKFGWQDTYVFTKAMGEMMIDSMRGDIPVVIIRPSVIESTYKEP  370

Query  1276  FPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPG  1455
             FPGWMEG+RMMDPIIL+YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG  GKPG
Sbjct  371   FPGWMEGSRMMDPIILYYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGTEGKPG  430

Query  1456  TSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWR  1635
             +S+Y +ASS VNPLVF DLAR+L++HF   PYIDSKG+PI VP+M L  SME LSSHLW+
Sbjct  431   SSVYQVASSAVNPLVFKDLARMLFDHFNRSPYIDSKGRPIHVPKMTLLRSMEDLSSHLWQ  490

Query  1636  DAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLME  1815
             DAI++SGLT L D    LS KLENICRKSVEQAKYLA+IYEPYTFYGGRFDNSN Q+LME
Sbjct  491   DAINRSGLTDLADPNSNLSKKLENICRKSVEQAKYLANIYEPYTFYGGRFDNSNTQRLME  550

Query  1816  CMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             CMSKEERWQFGF+VESIDWKDYISNVHIPGLR+HVMKGRGSCS
Sbjct  551   CMSKEERWQFGFDVESIDWKDYISNVHIPGLRKHVMKGRGSCS  593



>ref|XP_006360607.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum tuberosum]
Length=585

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/583 (72%), Positives = 481/583 (83%), Gaps = 23/583 (4%)
 Frame = +1

Query  199   RLCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassas  378
             R C P    N VYCQ  G+        V + S   +    GSL+L PN            
Sbjct  25    RWCPP----NKVYCQTSGTKNGNVSSVVTERSSVNSEKTLGSLVLTPN------------  68

Query  379   asasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPD  558
                     + +K+LV     +H+DGIGI  FLRGK+FLITG TGFLGKVLIEKILRT PD
Sbjct  69    ------TEIKVKDLVPYGQPRHDDGIGITMFLRGKAFLITGATGFLGKVLIEKILRTTPD  122

Query  559   VHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESD  738
             V+KI+ILIKA NKEVAM+RLK EI++A++F  LKQ +GKSYQ FMLSKLVPV+GNVCE++
Sbjct  123   VNKIFILIKAKNKEVAMQRLKNEILNADIFNCLKQVHGKSYQTFMLSKLVPVLGNVCEAN  182

Query  739   LGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLH  918
             LGID  TA M+AKEVDIIVNSAANTTFDERYD+ALDINTGGP RLM FA QCH LKLFL 
Sbjct  183   LGIDQDTANMMAKEVDIIVNSAANTTFDERYDIALDINTGGPTRLMNFAKQCHNLKLFLQ  242

Query  919   VSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSD  1098
             VSTAYVNGQRQG+I+EKPFCIG+SIA E++++    +S   LNVEDE+++VL +KQGL D
Sbjct  243   VSTAYVNGQRQGRIMEKPFCIGDSIAKENLLSEVNPNSFTSLNVEDEIKLVLESKQGLED  302

Query  1099  GAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPF  1278
              ++AQKMKE+GL+RANKFGWQDTYVFTKAMGEMMID+MRG+IPVVI+RPSVIEST+KEPF
Sbjct  303   NSVAQKMKEIGLQRANKFGWQDTYVFTKAMGEMMIDSMRGDIPVVIIRPSVIESTYKEPF  362

Query  1279  PGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT  1458
             PGWMEG+RMMDPIIL+YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG  GKPG+
Sbjct  363   PGWMEGSRMMDPIILYYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGTEGKPGS  422

Query  1459  S-IYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWR  1635
             S +Y +ASS VNPLVF DLAR+L++HF   PYIDSKG+PI VP+M L  SM+ LSSHLWR
Sbjct  423   SNVYQVASSAVNPLVFKDLARMLFDHFNRSPYIDSKGRPIHVPKMSLLRSMDDLSSHLWR  482

Query  1636  DAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLME  1815
             DAI++SGLT L D  GKLS KLENICRKSVEQAKYLA+IYEPYTFYGGRFDNSN Q+LME
Sbjct  483   DAINRSGLTDLTDPNGKLSRKLENICRKSVEQAKYLANIYEPYTFYGGRFDNSNTQRLME  542

Query  1816  CMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             CMSKEERWQFGF+VESIDWKDYISNVHIPGLR+HVMKGRGSC+
Sbjct  543   CMSKEERWQFGFDVESIDWKDYISNVHIPGLRKHVMKGRGSCT  585



>ref|XP_004234754.1| PREDICTED: fatty acyl-CoA reductase 2 [Solanum lycopersicum]
Length=585

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/583 (72%), Positives = 480/583 (82%), Gaps = 23/583 (4%)
 Frame = +1

Query  199   RLCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassas  378
             R C P    N VYCQ  G+        V + S  ++    GSL+L  N            
Sbjct  25    RWCPP----NKVYCQTSGTKNGNVSSVVTERSSVSSEKSLGSLVLTSN------------  68

Query  379   asasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPD  558
                     + +K+LV     +H+DGIGI  FLRGK+FLITG TGFLGKVLIEKILRT PD
Sbjct  69    ------TEIKVKDLVPYGQPRHDDGIGINMFLRGKAFLITGATGFLGKVLIEKILRTAPD  122

Query  559   VHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESD  738
             V+KI+ILIKA NKEVAM+RLK EI++A++F  LKQ +GKSYQ FMLSKLVPV+GNVCE++
Sbjct  123   VNKIFILIKAKNKEVAMQRLKNEILNADIFNCLKQVHGKSYQTFMLSKLVPVLGNVCEAN  182

Query  739   LGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLH  918
             LGID  TA M+AKEVDIIVNSAANTTFDERYD+ALDINTGGP RLM FA QCH LKLFL 
Sbjct  183   LGIDQDTANMMAKEVDIIVNSAANTTFDERYDIALDINTGGPTRLMNFAKQCHNLKLFLQ  242

Query  919   VSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSD  1098
             VSTAYVNGQRQG+I+EKPFCIG+SIA E++++    +S   LNVEDE+++VL +KQGL +
Sbjct  243   VSTAYVNGQRQGRIMEKPFCIGDSIAKENLLSEVNPNSFTSLNVEDEIKLVLESKQGLEN  302

Query  1099  GAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPF  1278
              ++AQKMKE+GL+RANKFGWQDTYVFTKAMGEMMID+MRG+IPVVI+RPSVIEST+KEPF
Sbjct  303   NSVAQKMKEIGLQRANKFGWQDTYVFTKAMGEMMIDSMRGDIPVVIIRPSVIESTYKEPF  362

Query  1279  PGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT  1458
             PGWMEG+RMMDPIIL+YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG  GKPG+
Sbjct  363   PGWMEGSRMMDPIILYYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGTEGKPGS  422

Query  1459  S-IYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWR  1635
             S +Y +ASS VNPLVF DLAR+L++HF   PYIDSKG+PI VP+M L  SME LSSHLWR
Sbjct  423   SNVYQVASSAVNPLVFKDLARMLFDHFNRSPYIDSKGRPIHVPKMSLLRSMEDLSSHLWR  482

Query  1636  DAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLME  1815
             DAI++SGLT L D  GKLS KLENICRKSVEQAKYLA+IYEPYTFYGGRFDNSN Q+LME
Sbjct  483   DAINRSGLTDLTDPNGKLSRKLENICRKSVEQAKYLANIYEPYTFYGGRFDNSNTQRLME  542

Query  1816  CMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
              MSKEERWQFGF+VESIDWKDYISNVHIPGLR+HVMKGRGSC+
Sbjct  543   SMSKEERWQFGFDVESIDWKDYISNVHIPGLRKHVMKGRGSCT  585



>gb|AFB77197.1| male sterility protein 2, partial [Lycium barbarum]
Length=526

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/541 (76%), Positives = 469/541 (87%), Gaps = 19/541 (4%)
 Frame = +1

Query  325   LLLAPNGNAQaaaassasasasaaENVGMKELVSSYVEKHED-GIGIVRFLRGKSFLITG  501
             L+L+PNG++QA               + +K+LV     KH+D GIGI +FLRGK+FLITG
Sbjct  1     LVLSPNGSSQA--------------EIKVKDLVPYGQSKHDDDGIGITKFLRGKAFLITG  46

Query  502   GTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSY  681
              TGFLGKVLIEKILRT PDV+KI+ILIKA NK+VAM+RLK EI++A++F  LKQ +GKSY
Sbjct  47    ATGFLGKVLIEKILRTAPDVNKIFILIKAKNKQVAMQRLKNEILNADIFNRLKQVHGKSY  106

Query  682   QVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGG  861
             Q FMLSKL+PVVGNVCES+LGID+ TA M+AKEVD+IVNSAANTTFDERYD+ALDINTGG
Sbjct  107   QTFMLSKLLPVVGNVCESNLGIDEDTANMMAKEVDVIVNSAANTTFDERYDIALDINTGG  166

Query  862   PNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPK  1041
             P+RLM FA QCH LKLFL VSTAYVNGQRQG+I+EKPFCIG+SIA E V      +S P 
Sbjct  167   PSRLMNFAKQCHNLKLFLQVSTAYVNGQRQGRIMEKPFCIGDSIAREKV----DHNSFPS  222

Query  1042  LNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGN  1221
             LNVEDE+++VL +KQ L D ++AQKMKE+GL+RANKFGWQDTYVFTKAMGEMMID MR +
Sbjct  223   LNVEDEIKLVLDSKQALEDNSVAQKMKEIGLQRANKFGWQDTYVFTKAMGEMMIDTMRSD  282

Query  1222  IPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMV  1401
             IPVVI+RPSVIEST++EPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMV
Sbjct  283   IPVVIIRPSVIESTYREPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMV  342

Query  1402  VNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDV  1581
             VNATLAA+AKHGAAGKPG++IY +ASSVVNPLVF DLA LL++HF S PYIDSKG+PI V
Sbjct  343   VNATLAAIAKHGAAGKPGSNIYQVASSVVNPLVFKDLATLLFDHFNSSPYIDSKGRPIHV  402

Query  1582  PRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEP  1761
             PRMKL +SME LS HLW+DAI++SGLT   D  GKLS KLENICRKSVEQAKYLA IYEP
Sbjct  403   PRMKLLNSMEDLSFHLWQDAINRSGLTDTADPNGKLSRKLENICRKSVEQAKYLAHIYEP  462

Query  1762  YTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSC  1941
             YTFYGGRFDNSN Q LMECMSKEERWQFGF+VE+IDWKDYISNVHIPGLR++VMKGRG C
Sbjct  463   YTFYGGRFDNSNTQWLMECMSKEERWQFGFDVENIDWKDYISNVHIPGLRKYVMKGRGLC  522

Query  1942  S  1944
             S
Sbjct  523   S  523



>ref|XP_007029101.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOY09603.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=602

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/588 (69%), Positives = 474/588 (81%), Gaps = 29/588 (5%)
 Frame = +1

Query  223   NNMVYCQGGGSNIVTTGRA--------VDQASKAAALMEAGSLLLAPNGNAQaaaassas  378
             N  V+CQG G+ + T+G +        +  A + A +M+AGSL+++PNGN+QA       
Sbjct  30    NIFVHCQGSGNAVKTSGVSSVLRERSKMVNADRGATVMDAGSLVMSPNGNSQA-------  82

Query  379   asasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKI  540
                    ++ +K+LV      +S VE  E GIGIV+FLRGK F ITG TGFL KVLIEKI
Sbjct  83    -------DIALKDLVPYGGSTTSLVELQE-GIGIVKFLRGKDFFITGSTGFLAKVLIEKI  134

Query  541   LRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVG  720
             LRTVPDV KI++LIKA N+E AMERLK EII+AELFK L+QTYG SYQ FMLSKLVP+VG
Sbjct  135   LRTVPDVGKIFLLIKAKNREAAMERLKSEIINAELFKCLQQTYGNSYQNFMLSKLVPLVG  194

Query  721   NVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHK  900
             N+CESDLG+D   A+MIAKEVDIIVNSAANTTFDERYDVA+DINT G   LM FA +C K
Sbjct  195   NICESDLGLDGDLADMIAKEVDIIVNSAANTTFDERYDVAIDINTRGACHLMCFAKKCQK  254

Query  901   LKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSA  1080
             LKLFL VSTAYVNGQRQG+I+EKPF IG+ IA E++++     S+P+L+VEDE+ + L++
Sbjct  255   LKLFLQVSTAYVNGQRQGRIMEKPFDIGDCIARENLISETTPRSIPELDVEDELTLALNS  314

Query  1081  KQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIES  1260
             K+G  D  +A KMKELGLERA K+GWQDTYVFTKAMGEMMI+NMRG IPVVI+RPSVIES
Sbjct  315   KKGFDDTEVAHKMKELGLERARKYGWQDTYVFTKAMGEMMINNMRGEIPVVIIRPSVIES  374

Query  1261  THKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGA  1440
             T KEPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAA+A+HG 
Sbjct  375   TCKEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAIARHGV  434

Query  1441  AGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALS  1620
               KP  +IYHIASSVVNPLVF DLARLLYEH+ S P++DSKG PI VP MKLF+SME  S
Sbjct  435   TPKPDINIYHIASSVVNPLVFQDLARLLYEHYNSSPFLDSKGSPIHVPSMKLFNSMEDFS  494

Query  1621  SHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNA  1800
             +HLWRDA  ++GLTA+    GKLS KLE ICRKSVEQAKYLA+IYEPYTFY GRFD+SN 
Sbjct  495   AHLWRDATQRTGLTAVASWSGKLSQKLETICRKSVEQAKYLANIYEPYTFYAGRFDSSNT  554

Query  1801  QKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             ++LME MS+EE+  FGF+V S+DWKDYI NVHIPGLRRHVMKGRG C+
Sbjct  555   ERLMEIMSEEEKRNFGFDVGSMDWKDYIKNVHIPGLRRHVMKGRGMCT  602



>ref|XP_007029099.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOY09601.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=602

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/588 (68%), Positives = 473/588 (80%), Gaps = 29/588 (5%)
 Frame = +1

Query  223   NNMVYCQGGGSNIVTTG-----RAVDQ---ASKAAALMEAGSLLLAPNGNAQaaaassas  378
             N+ V+CQG G+ I T+G     R + +   A + A +M+AGSL+++ NGN+QA       
Sbjct  30    NHFVHCQGSGNAINTSGISSVLREISEMVNADRGATVMDAGSLVMSLNGNSQA-------  82

Query  379   asasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKI  540
                    ++ +KELV      +S VE  E GIGIV+FLRGK F ITG TGFL KVLIEKI
Sbjct  83    -------DIAIKELVPCGGSTTSLVELQE-GIGIVKFLRGKDFFITGSTGFLAKVLIEKI  134

Query  541   LRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVG  720
             LRTVPDV KI++LIKA N+E AMERLK EII+AELFK L+QTYG SY+ FMLSKLVPVVG
Sbjct  135   LRTVPDVGKIFLLIKAKNREAAMERLKSEIINAELFKCLQQTYGNSYKNFMLSKLVPVVG  194

Query  721   NVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHK  900
             NVCESDLG+D   A+MIAKEVDIIVNSAA TTFDERYDVA+D+NT G   LM FA +C K
Sbjct  195   NVCESDLGLDGDLADMIAKEVDIIVNSAAKTTFDERYDVAIDVNTKGARHLMGFAKKCQK  254

Query  901   LKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSA  1080
             L+LFL VSTAYVNGQRQG+I+EKPF IG+ IA E++++    +S+P+L+VEDE+ + L++
Sbjct  255   LELFLQVSTAYVNGQRQGRIMEKPFDIGDCIARENLISETTPTSIPELDVEDELLLALNS  314

Query  1081  KQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIES  1260
             K+G  D  +AQKMKELGLERA K+GWQD Y FTKAMGEMMI+NMRG IPVVI+RPSVIES
Sbjct  315   KKGFDDTEVAQKMKELGLERARKYGWQDAYAFTKAMGEMMINNMRGEIPVVIIRPSVIES  374

Query  1261  THKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGA  1440
             T KEPFPGWMEGNRMMDP++L YGKGQLTGFL DPNGVLDVVPADMVVNATLAA+A+HG 
Sbjct  375   TCKEPFPGWMEGNRMMDPLVLCYGKGQLTGFLADPNGVLDVVPADMVVNATLAAIARHGM  434

Query  1441  AGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALS  1620
               KP  SIYHIASSVVNPLVF DLARLLYEH+ S P++DSKG PI VP +KLF+SME  S
Sbjct  435   TPKPDISIYHIASSVVNPLVFQDLARLLYEHYSSSPFLDSKGSPIHVPSVKLFNSMEDFS  494

Query  1621  SHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNA  1800
             +HLWRDA  K+GLTA+    GKLS KLE ICRKSVEQAKYLA+ YEPYTFYGGRFDNSN 
Sbjct  495   AHLWRDATQKAGLTAVASWGGKLSHKLETICRKSVEQAKYLANKYEPYTFYGGRFDNSNT  554

Query  1801  QKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             ++LME MS+EE+  FGF+VESIDWKDYI  VHIPGL+RHV+KGRG C+
Sbjct  555   ERLMEIMSEEEKRNFGFDVESIDWKDYIKKVHIPGLKRHVLKGRGMCT  602



>ref|XP_011078802.1| PREDICTED: fatty acyl-CoA reductase 2 [Sesamum indicum]
Length=589

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/592 (68%), Positives = 473/592 (80%), Gaps = 34/592 (6%)
 Frame = +1

Query  193   KHRLCLPLRINNMVYCQGGG--------SNIVTTGRAVDQASKAAALMEAGSLLLAPNGN  348
             KH         +MVYCQ G         S+++T   A+  A    ALME GSL+L+PNG 
Sbjct  24    KHGRLFSGNKKSMVYCQSGNHAIKSSGISSVLTETSALISADHGPALME-GSLVLSPNG-  81

Query  349   AQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVL  528
                                  K+L    VE H++G+GIV++LRGK+FL+TG TGFLGKVL
Sbjct  82    ---------------------KDL---DVEMHDEGLGIVKYLRGKTFLLTGATGFLGKVL  117

Query  529   IEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLV  708
             +EK+LRT PDV KI+++IKA NKE A ERL+ EI+ AELF  LKQ +GKSYQ FMLSKL+
Sbjct  118   VEKMLRTAPDVLKIFVVIKAKNKEAASERLRNEIMHAELFTRLKQIHGKSYQAFMLSKLI  177

Query  709   PVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAH  888
             PVVGNVCE++LG+D+  AE++ +EVD+I+NSAANTTFDERYD ALDINTGGP RLM FA 
Sbjct  178   PVVGNVCETNLGVDEDAAELLTQEVDVIINSAANTTFDERYDTALDINTGGPTRLMSFAK  237

Query  889   QCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEM  1068
             +C KLKLFL VSTAYVNGQRQG+I+EKPF +GESIA E+VV GN + S+PKL+VEDE+++
Sbjct  238   KCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGESIAAETVVCGNHQVSLPKLSVEDEIKV  297

Query  1069  VLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPS  1248
             VL +K+ L D ++ QKMKELG++RANKFGWQDTYVFTKAMGEMMID++RG IPVV++RPS
Sbjct  298   VLESKKTLEDDSLLQKMKELGMQRANKFGWQDTYVFTKAMGEMMIDSLRGEIPVVVIRPS  357

Query  1249  VIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMA  1428
             VIEST++EPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNAT AAMA
Sbjct  358   VIESTYREPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATFAAMA  417

Query  1429  KHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSM  1608
             KHGA GKP  SIY +ASSVVNPLVF DLA LLY+HF S P++D  G P+ VP+MKLFSSM
Sbjct  418   KHGAGGKPECSIYQVASSVVNPLVFRDLAELLYQHFSSSPFMDPTGSPVRVPKMKLFSSM  477

Query  1609  EALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFD  1788
             E  SSHLWR AI ++GL A  +  GKLS KLE+ICRKSVEQAKYLA IYE YTFYGGRFD
Sbjct  478   EDFSSHLWRHAIKQTGLGAFTNLDGKLSHKLESICRKSVEQAKYLAKIYESYTFYGGRFD  537

Query  1789  NSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             NSN ++LM  MSK+ER QFGF+VE+IDWKDYI+NVHIPGLRRHVMKGRG  S
Sbjct  538   NSNTKRLMGFMSKDERQQFGFDVENIDWKDYITNVHIPGLRRHVMKGRGLSS  589



>ref|XP_006481697.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006481698.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X3 [Citrus 
sinensis]
Length=598

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/579 (68%), Positives = 473/579 (82%), Gaps = 11/579 (2%)
 Frame = +1

Query  202   LCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAAL-MEAGSLLLAPNGNAQaaaassas  378
             LCL  +  ++++CQGGG    ++G +     ++      AGSL+L+PNG   A       
Sbjct  27    LCLLRKKRSIMHCQGGGKTTRSSGVSPALKERSTVTDTAAGSLVLSPNGKGHAEIVVQ--  84

Query  379   asasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPD  558
                   + V      +S VE  +DGIGIV+FL+ K+F +TG TGFL KVLIEKILRTVPD
Sbjct  85    ------DLVPFGGQATSLVE-LQDGIGIVKFLKAKNFFVTGATGFLAKVLIEKILRTVPD  137

Query  559   VHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESD  738
             V KI++LIKA N+E AMERLK EII+AELFK LKQTYGKSYQ FMLSKLVP VGNVCE++
Sbjct  138   VGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYGKSYQAFMLSKLVPAVGNVCENN  197

Query  739   LGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLH  918
             LG+++  A++IAKEVD+IVNSAANTTFDERYD+A+DINT GP RLM+FA QC+KLKLF+ 
Sbjct  198   LGLEEDLADVIAKEVDVIVNSAANTTFDERYDIAIDINTRGPCRLMEFAKQCNKLKLFVQ  257

Query  919   VSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSD  1098
             VSTAYVNGQR+GK++EKPFC+G+SIA E+ V+ N    +P L+VE+EM++ L +K+  +D
Sbjct  258   VSTAYVNGQRRGKVMEKPFCMGDSIAKENFVS-NSRRLIPTLDVENEMKLALESKEFSTD  316

Query  1099  GAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPF  1278
             G +AQKMKELGLERA K+GWQDTYVFTKAMGEM+IDNMRG+IPVVI+RPSVIEST KEPF
Sbjct  317   GEVAQKMKELGLERARKYGWQDTYVFTKAMGEMVIDNMRGDIPVVIIRPSVIESTCKEPF  376

Query  1279  PGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT  1458
              GWMEGNRMMDPIIL+YGKGQLTGFLVDPNG+LDVVPADMVVNATLAA+A+HG   KP  
Sbjct  377   SGWMEGNRMMDPIILYYGKGQLTGFLVDPNGILDVVPADMVVNATLAAIAQHGMIQKPDI  436

Query  1459  SIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRD  1638
             ++Y IASSVVNPLVF DLARLL+EH+ + P +D+KG+PI VP MKLFSSME  S+HLWRD
Sbjct  437   NVYQIASSVVNPLVFQDLARLLHEHYSASPCVDTKGRPIRVPSMKLFSSMEDFSAHLWRD  496

Query  1639  AIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC  1818
             AI +SGLT+  +  GKL  KLE ICRKSVEQAK+LA IYEPYTFYGGRFDNSN ++LME 
Sbjct  497   AIQRSGLTSTANLNGKLPQKLETICRKSVEQAKHLADIYEPYTFYGGRFDNSNTERLMEK  556

Query  1819  MSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             MS+EE+ +FGF+V SIDWK+YI+NVHIPGLRRHVMKGRG
Sbjct  557   MSEEEKRKFGFDVGSIDWKEYITNVHIPGLRRHVMKGRG  595



>ref|XP_006481696.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X1 [Citrus 
sinensis]
Length=677

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/579 (68%), Positives = 473/579 (82%), Gaps = 11/579 (2%)
 Frame = +1

Query  202   LCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAAL-MEAGSLLLAPNGNAQaaaassas  378
             LCL  +  ++++CQGGG    ++G +     ++      AGSL+L+PNG   A       
Sbjct  106   LCLLRKKRSIMHCQGGGKTTRSSGVSPALKERSTVTDTAAGSLVLSPNGKGHAEIVVQ--  163

Query  379   asasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPD  558
                   + V      +S VE  +DGIGIV+FL+ K+F +TG TGFL KVLIEKILRTVPD
Sbjct  164   ------DLVPFGGQATSLVEL-QDGIGIVKFLKAKNFFVTGATGFLAKVLIEKILRTVPD  216

Query  559   VHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESD  738
             V KI++LIKA N+E AMERLK EII+AELFK LKQTYGKSYQ FMLSKLVP VGNVCE++
Sbjct  217   VGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYGKSYQAFMLSKLVPAVGNVCENN  276

Query  739   LGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLH  918
             LG+++  A++IAKEVD+IVNSAANTTFDERYD+A+DINT GP RLM+FA QC+KLKLF+ 
Sbjct  277   LGLEEDLADVIAKEVDVIVNSAANTTFDERYDIAIDINTRGPCRLMEFAKQCNKLKLFVQ  336

Query  919   VSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSD  1098
             VSTAYVNGQR+GK++EKPFC+G+SIA E+ V+ N    +P L+VE+EM++ L +K+  +D
Sbjct  337   VSTAYVNGQRRGKVMEKPFCMGDSIAKENFVS-NSRRLIPTLDVENEMKLALESKEFSTD  395

Query  1099  GAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPF  1278
             G +AQKMKELGLERA K+GWQDTYVFTKAMGEM+IDNMRG+IPVVI+RPSVIEST KEPF
Sbjct  396   GEVAQKMKELGLERARKYGWQDTYVFTKAMGEMVIDNMRGDIPVVIIRPSVIESTCKEPF  455

Query  1279  PGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT  1458
              GWMEGNRMMDPIIL+YGKGQLTGFLVDPNG+LDVVPADMVVNATLAA+A+HG   KP  
Sbjct  456   SGWMEGNRMMDPIILYYGKGQLTGFLVDPNGILDVVPADMVVNATLAAIAQHGMIQKPDI  515

Query  1459  SIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRD  1638
             ++Y IASSVVNPLVF DLARLL+EH+ + P +D+KG+PI VP MKLFSSME  S+HLWRD
Sbjct  516   NVYQIASSVVNPLVFQDLARLLHEHYSASPCVDTKGRPIRVPSMKLFSSMEDFSAHLWRD  575

Query  1639  AIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC  1818
             AI +SGLT+  +  GKL  KLE ICRKSVEQAK+LA IYEPYTFYGGRFDNSN ++LME 
Sbjct  576   AIQRSGLTSTANLNGKLPQKLETICRKSVEQAKHLADIYEPYTFYGGRFDNSNTERLMEK  635

Query  1819  MSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             MS+EE+ +FGF+V SIDWK+YI+NVHIPGLRRHVMKGRG
Sbjct  636   MSEEEKRKFGFDVGSIDWKEYITNVHIPGLRRHVMKGRG  674



>ref|XP_006429946.1| hypothetical protein CICLE_v10011332mg [Citrus clementina]
 ref|XP_006429947.1| hypothetical protein CICLE_v10011332mg [Citrus clementina]
 gb|ESR43186.1| hypothetical protein CICLE_v10011332mg [Citrus clementina]
 gb|ESR43187.1| hypothetical protein CICLE_v10011332mg [Citrus clementina]
Length=598

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/581 (68%), Positives = 473/581 (81%), Gaps = 15/581 (3%)
 Frame = +1

Query  202   LCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAALME---AGSLLLAPNGNAQaaaass  372
             LCL  R  ++++CQGGG    ++G  V  A K  + +    AGSL+L+PNG   A     
Sbjct  27    LCLLRRKRSIMHCQGGGKTTRSSG--VSSALKERSTVTDTAAGSLVLSPNGKGHAEIVVQ  84

Query  373   asasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTV  552
                     + V      +S VE  +DGIGIV+FL+ K+F +TG TGFL KVLIEKILRTV
Sbjct  85    --------DLVPFGGQATSLVE-LQDGIGIVKFLKAKNFFVTGATGFLAKVLIEKILRTV  135

Query  553   PDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCE  732
             PDV KI++LIKA N+E AMERLK EII+AELFK LKQTYGKSYQ FMLSKLVP VGNVCE
Sbjct  136   PDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYGKSYQAFMLSKLVPAVGNVCE  195

Query  733   SDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLF  912
             ++LG+++  A++IAKEVD+IVNSAANTTFDERYD+A+DINT GP RLM+FA QC+KLKLF
Sbjct  196   NNLGLEEDLADVIAKEVDVIVNSAANTTFDERYDIAIDINTRGPCRLMEFAKQCNKLKLF  255

Query  913   LHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL  1092
             + VSTAYVNGQRQGK++EK FC+G+SIA E+ V+ N    +P L+VE+EM++   +K+  
Sbjct  256   VQVSTAYVNGQRQGKVMEKTFCMGDSIAKENFVS-NSRRLIPTLDVENEMKLAWESKEFS  314

Query  1093  SDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKE  1272
             +DG +AQKMK LGLERA K+GWQDTYVFTKAMGEM+IDNMRG+IPVVI+RPSVIEST KE
Sbjct  315   TDGEVAQKMKGLGLERARKYGWQDTYVFTKAMGEMVIDNMRGDIPVVIIRPSVIESTCKE  374

Query  1273  PFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKP  1452
             PFPGWMEGNRMMDPIIL+YGKGQLTGFLVDPNG+LDVVPADMVVNATLAA+A HG   KP
Sbjct  375   PFPGWMEGNRMMDPIILYYGKGQLTGFLVDPNGILDVVPADMVVNATLAAIAHHGMIQKP  434

Query  1453  GTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW  1632
               ++Y IASSVVNPLVF DLARLL+EH+ + P +D+KG+PI VP MKLFSSME  S+HLW
Sbjct  435   DINVYQIASSVVNPLVFQDLARLLHEHYSASPCVDTKGRPIRVPSMKLFSSMEDFSAHLW  494

Query  1633  RDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLM  1812
             RDAI +SGLT+  +  GKL  KLE ICRKSVEQAK+LA+IYEPYTFYGGRFDNSN +KLM
Sbjct  495   RDAIQRSGLTSTANLNGKLPQKLETICRKSVEQAKHLANIYEPYTFYGGRFDNSNTEKLM  554

Query  1813  ECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             E MS+EE+ +FGF+V SIDWK+YI+NVHIPGLRRHVMKGRG
Sbjct  555   EKMSEEEKRKFGFDVGSIDWKEYITNVHIPGLRRHVMKGRG  595



>gb|EYU20678.1| hypothetical protein MIMGU_mgv1a003493mg [Erythranthe guttata]
Length=581

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/502 (74%), Positives = 435/502 (87%), Gaps = 4/502 (1%)
 Frame = +1

Query  433   VEKHEDG-IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAM  609
             VE H++G IGIV+FL+GK+FLITGGTGFLGKVLIEK+LRT PDV K+Y+LIKA N E A+
Sbjct  80    VEMHDEGSIGIVKFLKGKTFLITGGTGFLGKVLIEKMLRTAPDVQKMYVLIKAKNSEAAL  139

Query  610   ERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDI  789
             ERLK E+I+AELFK LK+ +GKSYQ FMLSKL+PVVGNVCE++LG+D HT + +  E+D+
Sbjct  140   ERLKNEVINAELFKNLKEKHGKSYQGFMLSKLIPVVGNVCETNLGLDKHTFDFMTNELDV  199

Query  790   IVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEK  969
             I+NSAANTTFDERYD ALDINTGGP RL+ FA QC KLKLFL VSTAYVNGQRQG+I+EK
Sbjct  200   IINSAANTTFDERYDTALDINTGGPTRLIGFAKQCLKLKLFLQVSTAYVNGQRQGRIMEK  259

Query  970   PFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANK  1149
             PFC GESI+ E+V+      S+P L VEDE+++++ +KQ L D ++  KMKELG++RA K
Sbjct  260   PFCAGESISAEAVL---HNGSLPNLIVEDEIKLLVESKQSLQDSSLLHKMKELGMQRAKK  316

Query  1150  FGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHY  1329
             +GWQDTYVFTKAMGEMMIDN+RG +PVV++RPSVIEST+KEPFPGWMEGNRMMDPIIL Y
Sbjct  317   YGWQDTYVFTKAMGEMMIDNLRGEVPVVVIRPSVIESTYKEPFPGWMEGNRMMDPIILQY  376

Query  1330  GKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDD  1509
             GKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG AGKP  +IY +ASSVVNPLVF D
Sbjct  377   GKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGEAGKPEYNIYQVASSVVNPLVFRD  436

Query  1510  LARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKL  1689
             LA LLY+HF S P++DS G P+ VP+MKLF SME  SSHLWR AI+++GL AL +  GKL
Sbjct  437   LADLLYQHFNSSPFMDSTGNPVRVPKMKLFHSMEDFSSHLWRHAINRTGLGALANLDGKL  496

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESID  1869
             S KLE ICRKSVEQAKYLA+IYE YTFYGGRFDNSN ++LM CMSKEER +FGF+VE ID
Sbjct  497   SQKLETICRKSVEQAKYLANIYESYTFYGGRFDNSNTKRLMGCMSKEERQEFGFDVEKID  556

Query  1870  WKDYISNVHIPGLRRHVMKGRG  1935
             W+DYISNVHIPGLRRHVMKGRG
Sbjct  557   WEDYISNVHIPGLRRHVMKGRG  578



>ref|XP_007145718.1| hypothetical protein PHAVU_007G262300g [Phaseolus vulgaris]
 gb|ESW17712.1| hypothetical protein PHAVU_007G262300g [Phaseolus vulgaris]
Length=608

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/589 (66%), Positives = 462/589 (78%), Gaps = 27/589 (5%)
 Frame = +1

Query  217   RINNMVYCQGGGSNIVTTGRA---------VDQASKAAALMEAGSLLLAPNGNAQaaaas  369
             R  N+VYCQGGG+ I ++G +         V   + A  LMEAGSL+L+ NG  QA    
Sbjct  33    RKTNVVYCQGGGNVIKSSGLSSVLTERSSLVGTDNAATTLMEAGSLVLSQNGKTQA----  88

Query  370   sasasasaaENVGMKELVS----SYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEK  537
                        + +K+LV     + +   EDG GIV+FLRGK F ITG TGFL KV IEK
Sbjct  89    ----------EIAVKDLVPYGGPTTLIGLEDGTGIVKFLRGKKFFITGATGFLAKVFIEK  138

Query  538   ILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVV  717
             ILRT PDV K+Y+LIKADNK+ AM+RL+ EII+ +LF+ L+Q +GKSYQ FMLSKLVPVV
Sbjct  139   ILRTEPDVGKMYLLIKADNKQAAMDRLQNEIINTDLFRCLQQVHGKSYQAFMLSKLVPVV  198

Query  718   GNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCH  897
             GN+CE +LG+D+  + +I +EVD+IVNSAANTTFDERYD A++INT GP RLM  A +C 
Sbjct  199   GNICEHNLGLDEDISNVIEEEVDVIVNSAANTTFDERYDTAININTLGPCRLMNIAKKCK  258

Query  898   KLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLS  1077
              L+LFLHVSTAYVNGQRQG+I+E+PF IGE IA E  ++      +P L++E E+ +V +
Sbjct  259   NLRLFLHVSTAYVNGQRQGRIMERPFSIGECIAKEKFISEISPKYLPTLDIEGEINLVSN  318

Query  1078  AKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIE  1257
              K  + D  +AQKMKE+GLERA ++GWQDTYVFTKAMGEMMID +RG+IPVVI+RPSVIE
Sbjct  319   YKGDIEDSLLAQKMKEIGLERARRYGWQDTYVFTKAMGEMMIDKLRGDIPVVIMRPSVIE  378

Query  1258  STHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG  1437
             ST  EPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMA+HG
Sbjct  379   STFSEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMARHG  438

Query  1438  AAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEAL  1617
              + K   ++Y IASSVVNPLVF DLA+LLYEH+ S P+IDSKG+PI VP MKLFSS E  
Sbjct  439   VSQKSDLNVYQIASSVVNPLVFQDLAKLLYEHYSSSPWIDSKGRPIQVPLMKLFSSTEEF  498

Query  1618  SSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSN  1797
             S HLWRDAI K GLTA+  SKGK+S KLEN+CRKSVEQA YLA+IYEPYTFYGGRFDNSN
Sbjct  499   SGHLWRDAIQKRGLTAMASSKGKMSQKLENMCRKSVEQANYLANIYEPYTFYGGRFDNSN  558

Query  1798  AQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
              Q+LME MS+EE+ +FGF+V+SIDWKDYI+NVHIPGLRRHVMKGRG  S
Sbjct  559   TQRLMESMSEEEKRKFGFDVKSIDWKDYITNVHIPGLRRHVMKGRGMSS  607



>ref|XP_004305541.1| PREDICTED: fatty acyl-CoA reductase 2-like [Fragaria vesca subsp. 
vesca]
Length=591

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/582 (69%), Positives = 462/582 (79%), Gaps = 25/582 (4%)
 Frame = +1

Query  205   CLPLRI-NNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasa  381
             CL  R  +++  CQG  S      + +   S AA LM+AGSL+L+PN             
Sbjct  29    CLLRRKKSSLAVCQGASSG--GNAKKISGFSSAATLMDAGSLVLSPNDQ-----------  75

Query  382   sasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDV  561
                   N  +KELV  +VE H DGIGIV+FLRGK F ITGGTGFL KVLIEKILRT PDV
Sbjct  76    KVKKENNTAVKELVP-FVEMH-DGIGIVKFLRGKGFFITGGTGFLAKVLIEKILRTAPDV  133

Query  562   HKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDL  741
              KIY+LIKA  KE AMERL  EII+ ELFK L+QTYGKSYQ FMLSKLVPVVGNVC+SDL
Sbjct  134   GKIYLLIKAKTKEAAMERLNTEIINTELFKGLRQTYGKSYQAFMLSKLVPVVGNVCDSDL  193

Query  742   GIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHV  921
             G+ D  A +IAKEVD+++NSAANTTF ERYDVALDINT GP  LM FA +C KLKLFL V
Sbjct  194   GLGDDVAALIAKEVDVVINSAANTTFHERYDVALDINTKGPCNLMAFAKKCKKLKLFLQV  253

Query  922   STAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVP----KLNVEDEMEMVLSAKQG  1089
             STAYVNGQRQG+I+EKPFCIGESI GE     N  S  P     L+VE+EM++ +++K  
Sbjct  254   STAYVNGQRQGRIMEKPFCIGESIIGE-----NSTSETPPGFESLDVENEMKLAMNSKGA  308

Query  1090  LSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHK  1269
               D  ++QKMK+LGLERA K+GWQDTYVFTKAMGEM+ID+MRG++PVVI+RPSVIEST K
Sbjct  309   YEDNEVSQKMKDLGLERARKYGWQDTYVFTKAMGEMVIDDMRGDLPVVIIRPSVIESTCK  368

Query  1270  EPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGK  1449
             EPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVVPADMVVNATLAA+AKHG A K
Sbjct  369   EPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAIAKHGMAQK  428

Query  1450  PGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL  1629
             P  ++Y I SSVVNPL F DL++LLYEH+ S P +DSKG+PI+VP MKLFSSME  S H+
Sbjct  429   PDINVYQITSSVVNPLDFQDLSKLLYEHYNSSPCMDSKGRPINVPSMKLFSSMEDFSDHI  488

Query  1630  WRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKL  1809
             WRDA  +SGLTAL  S GKLS KLE +CRKSVEQAKYLASIYEPYTFYGGRFDNSN ++L
Sbjct  489   WRDATQRSGLTALASSNGKLSQKLETMCRKSVEQAKYLASIYEPYTFYGGRFDNSNTERL  548

Query  1810  MECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             M+ MS+EER +FGF+V S+DWKDYI+NVHIPGL+RHV+KGRG
Sbjct  549   MDSMSEEERKKFGFDVGSLDWKDYITNVHIPGLKRHVLKGRG  590



>ref|XP_010101094.1| Fatty acyl-CoA reductase 2 [Morus notabilis]
 gb|EXB86906.1| Fatty acyl-CoA reductase 2 [Morus notabilis]
Length=606

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/586 (67%), Positives = 463/586 (79%), Gaps = 25/586 (4%)
 Frame = +1

Query  223   NNMVYCQGGGSNIVTTGRAVDQASKAAAL---MEAGSLLLAPNGNAQaaaassasasasa  393
             + +V+CQGGG+ I T+  +    S        ++ G+L+L+PNG +QA            
Sbjct  34    STLVHCQGGGNAIKTSSNSSSGFSSILTTRKDLDKGNLVLSPNGKSQAE-----------  82

Query  394   aENVGMKELV---------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILR  546
               N+ +K+LV         ++ VE H DGIGI+ FLRGKSF +TG TGFL KVLIEK+LR
Sbjct  83    -NNIAVKDLVPFGGSQSQSTASVEMH-DGIGILHFLRGKSFFVTGATGFLAKVLIEKMLR  140

Query  547   TVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNV  726
             T PDV KIY+LIKA NKE AM RLK EII+ ELFK L+QTYGKSYQ FMLSKLVPVVGNV
Sbjct  141   TTPDVGKIYLLIKAKNKEAAMGRLKNEIINTELFKRLQQTYGKSYQAFMLSKLVPVVGNV  200

Query  727   CESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLK  906
             CESDLG+DD  A  IAKEVD+IVNSAANTTFDERYDVAL INT GP  LM F+ +C KLK
Sbjct  201   CESDLGLDDALAGTIAKEVDVIVNSAANTTFDERYDVALSINTKGPCHLMNFSKKCKKLK  260

Query  907   LFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQ  1086
             LFL VSTAYVNGQRQG+I+EKPF IGE+IAGE  ++      +P L+V++EM++  ++K+
Sbjct  261   LFLQVSTAYVNGQRQGRIMEKPFRIGETIAGEKFISETPPGRLPMLDVKNEMKLAWTSKE  320

Query  1087  GLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTH  1266
                + AM QKMKELGL+RA ++GWQDTYVFTKAMGEMMID+MRG++PVVI+RPSVIEST 
Sbjct  321   AFENNAMTQKMKELGLQRAQQYGWQDTYVFTKAMGEMMIDSMRGDVPVVIIRPSVIESTC  380

Query  1267  KEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG  1446
             KEPFPGWMEGNRMMDPIIL+YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG + 
Sbjct  381   KEPFPGWMEGNRMMDPIILYYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGLSQ  440

Query  1447  KPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSH  1626
             KP  ++Y IASSVVNPLVF DLARLLY+H+ S P +D  GKPI VP MKLF SM+  S H
Sbjct  441   KPDINVYQIASSVVNPLVFQDLARLLYQHYNSSPCVDPSGKPIHVPSMKLFRSMDDFSEH  500

Query  1627  LWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQK  1806
             LWRD   ++GLT++  S  KLS KLE ICRKSVEQAK+LA+IYEPYTFYGGRFDNSN Q 
Sbjct  501   LWRDTAQRNGLTSMASSNMKLSQKLEVICRKSVEQAKHLANIYEPYTFYGGRFDNSNTQI  560

Query  1807  LMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             LME MS+EE+ +FGF+VE+IDW DYI+NVHIPGLRRHVMKGRG  S
Sbjct  561   LMESMSEEEKRKFGFDVENIDWTDYITNVHIPGLRRHVMKGRGMPS  606



>ref|XP_008371142.1| PREDICTED: fatty acyl-CoA reductase 2 [Malus domestica]
Length=599

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/593 (69%), Positives = 464/593 (78%), Gaps = 34/593 (6%)
 Frame = +1

Query  193   KHRLCLPLRINNMVYCQGGGS-NIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaas  369
             K   CL  R  ++V CQG  S N+V TG        +AA+M+AGSL+L PN         
Sbjct  27    KRNWCLLRRKKSVVLCQGSSSGNVVKTG-----GFSSAAVMDAGSLVLTPNDQKSPKE--  79

Query  370   sasasasaaENVGMKELV-------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVL  528
                       N+ +K+LV       SS VE H DGIGIV+FLRGK F ITG TGFL KVL
Sbjct  80    ---------SNIAVKDLVPFGGSSSSSLVEMH-DGIGIVKFLRGKGFFITGATGFLAKVL  129

Query  529   IEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLV  708
             IEKILRT PDV KI++LIKA NKE AMERLK EII+AELFK L+QTYGKSYQ FMLSKLV
Sbjct  130   IEKILRTAPDVGKIFLLIKAKNKEAAMERLKTEIINAELFKCLRQTYGKSYQSFMLSKLV  189

Query  709   PVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAH  888
             PVVGNVCESDLGI+D  A +IAKEVD+IVNSAANTTF ERYDVA+DINT GP  LM FA 
Sbjct  190   PVVGNVCESDLGIEDDVAGLIAKEVDVIVNSAANTTFHERYDVAIDINTKGPCHLMAFAK  249

Query  889   QCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVP----KLNVED  1056
             +C KLKLFL VSTAYVNGQRQG+I+EKPF IGESIAGES +     S  P     L+V++
Sbjct  250   KCKKLKLFLQVSTAYVNGQRQGRIMEKPFYIGESIAGESHI-----SETPPGFFSLDVKN  304

Query  1057  EMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVI  1236
             E+++ L +K    +  +AQKMKELGLERA K+GWQDTYVFTKAMGEMMIDNMRG+IPVVI
Sbjct  305   EIKLALDSKGAYENNEVAQKMKELGLERARKYGWQDTYVFTKAMGEMMIDNMRGDIPVVI  364

Query  1237  VRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATL  1416
             +RPSVIEST KEPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVVPADMV NATL
Sbjct  365   IRPSVIESTCKEPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVVPADMVANATL  424

Query  1417  AAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKL  1596
             AA+A HG A K   +IY I SSV NPL F +L+ LLYEH+ S P  D+KG+PI VP MKL
Sbjct  425   AAIANHGMAQKQDINIYQITSSVANPLDFQELSELLYEHYNSSPCKDAKGRPIQVPSMKL  484

Query  1597  FSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYG  1776
             FSSME  S+H+WRDA+ +SGLTAL  S GKLS KLE ICRKSVEQAKYLA IYEPYTFYG
Sbjct  485   FSSMEDFSAHIWRDALQRSGLTALSSSNGKLSQKLEMICRKSVEQAKYLAGIYEPYTFYG  544

Query  1777  GRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             GRFDNSN Q+LME MS+EE+ +FGF+V SIDWKDYI+NVHIPGL+RHV+KGRG
Sbjct  545   GRFDNSNTQRLMERMSEEEKRKFGFDVGSIDWKDYITNVHIPGLKRHVLKGRG  597



>ref|XP_009335888.1| PREDICTED: fatty acyl-CoA reductase 2 [Pyrus x bretschneideri]
Length=599

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/592 (69%), Positives = 463/592 (78%), Gaps = 32/592 (5%)
 Frame = +1

Query  193   KHRLCLPLRINNMVYCQGGGS-NIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaas  369
             K   CL  R  ++V CQG  S N+V TG        +AA+ +AGSL+L PN         
Sbjct  27    KRNWCLLRRKKSVVLCQGSSSGNVVKTG-----GFSSAAVRDAGSLVLTPNDQKSPKE--  79

Query  370   sasasasaaENVGMKELV-------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVL  528
                       N+ +K+LV       SS VE H DGIGIV+FLRGK F ITG TGFL KVL
Sbjct  80    ---------SNIAVKDLVPFGGSSSSSLVEMH-DGIGIVKFLRGKGFFITGATGFLAKVL  129

Query  529   IEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLV  708
             IEKILRT PDV KI++LIKA NKE AMERLK EII+AELFK L+QTYGKSYQ FMLSKLV
Sbjct  130   IEKILRTAPDVGKIFLLIKARNKEAAMERLKTEIINAELFKCLRQTYGKSYQSFMLSKLV  189

Query  709   PVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAH  888
             PVVGNVCESDLGI+D  A +IAKEVD+IVNSAANTTF ERYDVA+DINT GP  LM FA 
Sbjct  190   PVVGNVCESDLGIEDDVAGLIAKEVDVIVNSAANTTFHERYDVAIDINTKGPCHLMAFAK  249

Query  889   QCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVP---KLNVEDE  1059
             +C KLKLFL VSTAYVNGQRQG+I+EKPF IGESIAGE    G+   + P    L+VE+E
Sbjct  250   KCKKLKLFLQVSTAYVNGQRQGRIMEKPFYIGESIAGE----GHISETPPGFFSLDVENE  305

Query  1060  MEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIV  1239
             +++ L +K    +  +AQKMKELGLERA K+GWQDTYVFTKAMGEMMIDNMRG+IPVVI+
Sbjct  306   IKLALDSKGAYENNEVAQKMKELGLERARKYGWQDTYVFTKAMGEMMIDNMRGDIPVVII  365

Query  1240  RPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLA  1419
             RPSVIEST KEPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVVPADMV NATLA
Sbjct  366   RPSVIESTCKEPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVVPADMVANATLA  425

Query  1420  AMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLF  1599
             A+A HG A K   +IY I SSV NPL F +L+ LLYEH+ S P  D+KG+PI VP MKLF
Sbjct  426   AIANHGMAQKQDINIYQITSSVANPLDFQELSELLYEHYNSSPCKDAKGRPIQVPSMKLF  485

Query  1600  SSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGG  1779
             SSME  S+H+WRDA+ +SGLTAL  S GKLS KLE ICRKSVEQAKYLA IYEPYTFYGG
Sbjct  486   SSMEDFSAHIWRDALQRSGLTALSSSNGKLSQKLEMICRKSVEQAKYLAGIYEPYTFYGG  545

Query  1780  RFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             RFDNSN Q+LME MS+EE+ +FGF+V SIDWK+YI+NVHIPGL+RHV+KGRG
Sbjct  546   RFDNSNTQRLMERMSEEEKRKFGFDVGSIDWKEYITNVHIPGLKRHVLKGRG  597



>gb|KHG30562.1| Fatty acyl-CoA reductase 2 [Gossypium arboreum]
Length=588

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/590 (65%), Positives = 458/590 (78%), Gaps = 51/590 (9%)
 Frame = +1

Query  223   NNMVYCQG-GGSNIVTTG---------RAVDQASKAAALMEAGSLLLAPNGNAQaaaass  372
             ++ V+CQG GG  I T G         + V+   ++AALM+AGSL+++PN          
Sbjct  30    SSFVHCQGSGGKAIKTAGVSSVVKERSKMVNGGDRSAALMDAGSLIVSPN----------  79

Query  373   asasasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIE  534
                      ++ +K+LV      +S VE  +DGIGIV+FLRGK F ITG TGFL KVLIE
Sbjct  80    -------QADIAVKDLVPYGGSTTSLVE-LQDGIGIVKFLRGKEFFITGSTGFLAKVLIE  131

Query  535   KILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPV  714
             KILRTVPDV KI++L+KA +KE AMERLK EII+AELF  L+QTYG SYQ FMLSKLVPV
Sbjct  132   KILRTVPDVGKIFVLVKAKSKEAAMERLKTEIINAELFNCLQQTYGNSYQSFMLSKLVPV  191

Query  715   VGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQC  894
             VGNVCESDLG+DD  A +I+KEVDIIVNSAANTTFDERYDVA+DINT G + LM      
Sbjct  192   VGNVCESDLGLDDELANLISKEVDIIVNSAANTTFDERYDVAMDINTKGASHLM------  245

Query  895   HKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVL  1074
                        AYVNGQRQG+++EKPF IG+ IA E+++      S+P+L++E+E  +  
Sbjct  246   -----------AYVNGQRQGRVMEKPFDIGDCIARENLIAETTPRSIPELDIEEEFGLAR  294

Query  1075  SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVI  1254
               K+G  +  +AQKMKELGL+RA K+GWQDTYVFTKAMGEMMI+NMRG IPVVI+RPSVI
Sbjct  295   DTKEGCHERELAQKMKELGLQRARKYGWQDTYVFTKAMGEMMINNMRGEIPVVIIRPSVI  354

Query  1255  ESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKH  1434
             EST KEPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAA+A+H
Sbjct  355   ESTCKEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAIARH  414

Query  1435  GAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEA  1614
             G   KP  +IYHIASSVVNPLVF DLAR+L+EH+ S+P++DSKG PI VP MKLFSSME 
Sbjct  415   GMTPKPDINIYHIASSVVNPLVFQDLARMLHEHYNSRPFLDSKGTPIHVPSMKLFSSMED  474

Query  1615  LSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNS  1794
              S+HLWRDA+ ++GL AL    GKLS KLE +CRKSVEQAKYLA+IYEPYTFYGGRFDNS
Sbjct  475   FSAHLWRDAMHQTGLPALASWSGKLSQKLEAVCRKSVEQAKYLANIYEPYTFYGGRFDNS  534

Query  1795  NAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             N ++L+E MS+EE+  FGF+VE+IDWKDYI NVHIPGLRRHVMKGRG CS
Sbjct  535   NTKRLLETMSEEEKVSFGFDVETIDWKDYIKNVHIPGLRRHVMKGRGMCS  584



>ref|XP_004514155.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X1 [Cicer 
arietinum]
Length=602

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/582 (65%), Positives = 464/582 (80%), Gaps = 23/582 (4%)
 Frame = +1

Query  214   LRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasasasa  393
             +   N+V+CQGGG    ++  + +  +    LM+AGSL+L+ NG +QA            
Sbjct  32    MTTTNVVFCQGGGKRSSSSLVSAEHGA-TTTLMDAGSLVLSQNGKSQA------------  78

Query  394   aENVGMKELV-------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTV  552
               ++ +K+LV       ++ +   +DGIGIV+FLRGK F ITG TGFL KVLIEKILRT 
Sbjct  79    --DIVVKDLVPYGGPTSTTLIGLEDDGIGIVKFLRGKKFFITGATGFLAKVLIEKILRTE  136

Query  553   PDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCE  732
             PDV K+YILIKA NK+VAMERL+KEII+ ELF+ L+Q +GKSYQ FMLSKLVP+VG++CE
Sbjct  137   PDVGKMYILIKAKNKQVAMERLQKEIINTELFRCLRQIHGKSYQAFMLSKLVPIVGDICE  196

Query  733   SDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLF  912
             ++LG+D+  +++IA EVD+IVNSAANTTFDERYD A++INT GP+RLM  A +C KLKLF
Sbjct  197   TNLGLDEDLSDVIADEVDVIVNSAANTTFDERYDTAININTRGPSRLMAIAKKCKKLKLF  256

Query  913   LHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAK-QG  1089
             LHVSTAYVNGQRQG+I+E+PF IG+ IA E +++G     +P L++E+E+ MVL  K   
Sbjct  257   LHVSTAYVNGQRQGRIMERPFSIGDCIAREKLISGVPPKYLPTLDIENEINMVLKNKGNN  316

Query  1090  LSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHK  1269
             + +  +AQKM+E+GLERA ++GWQDTYVFTKAMGEMMID +R +IPVVI+RPSVIEST  
Sbjct  317   IEENLLAQKMREMGLERAKRYGWQDTYVFTKAMGEMMIDKLRDDIPVVIIRPSVIESTLS  376

Query  1270  EPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGK  1449
             EPFPGWMEGNRMMDP++L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG   K
Sbjct  377   EPFPGWMEGNRMMDPVVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGMTQK  436

Query  1450  PGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL  1629
                ++Y IASSVVNPL F DL RLLYEH+ S P+IDSKG+PI VP MKLFSS E  S HL
Sbjct  437   ADINVYQIASSVVNPLAFQDLTRLLYEHYSSSPFIDSKGRPIQVPIMKLFSSSEEFSGHL  496

Query  1630  WRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKL  1809
             WRD I+KSGLT++  SKGK+S KLENICRKSVEQAKYLA IYEPYTFYGGRFDNSN Q+L
Sbjct  497   WRDVINKSGLTSMASSKGKMSQKLENICRKSVEQAKYLAKIYEPYTFYGGRFDNSNTQRL  556

Query  1810  MECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             ME MS+EE+ +F F+V+ IDW DYI+NVHIPGLRR+VMKGRG
Sbjct  557   MEIMSEEEKTEFDFDVKGIDWTDYITNVHIPGLRRYVMKGRG  598



>ref|XP_002323348.2| Male sterility protein 2 [Populus trichocarpa]
 gb|EEF05109.2| Male sterility protein 2 [Populus trichocarpa]
Length=610

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/599 (65%), Positives = 458/599 (76%), Gaps = 26/599 (4%)
 Frame = +1

Query  178   CFVVSKHRLCLPLRINNMVYCQGGGSNI--------VTTGRA--VDQASKAAALMEAGSL  327
             CF+  + R       N +VYCQGGG           V T R+  V      A++ +AGSL
Sbjct  26    CFLRWRKR-------NVVVYCQGGGGKAIRSSGFPSVLTERSAVVSDQEHIASVRDAGSL  78

Query  328   LLAPNGNAQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGT  507
             +L+PN   Q   A          + V      SS + + +DGIGIV+FLRGK   I+G T
Sbjct  79    VLSPNEKGQPEIAVE--------DFVPYGGPTSSSLLEMQDGIGIVKFLRGKGLFISGAT  130

Query  508   GFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQV  687
             GFL KVLIEKILRT+PDV KIY+LIKA++KE A+ RLK EII+AELFK L+QT+GKSYQ 
Sbjct  131   GFLAKVLIEKILRTMPDVGKIYVLIKAESKEAAITRLKNEIINAELFKCLRQTHGKSYQS  190

Query  688   FMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPN  867
             FML+KLVPVVGNVCES+LG+++  A+ IA EVDIIVNSAANTTFDERYDVA+D+NT G  
Sbjct  191   FMLNKLVPVVGNVCESNLGLEEDLADKIANEVDIIVNSAANTTFDERYDVAIDVNTRGTC  250

Query  868   RLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGES-VVNGNQESSVPKL  1044
              LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF  G+ IA E+ +++ +     P L
Sbjct  251   HLMSFAKKCPKLKLFLQVSTAYVNGQRQGRIMEKPFLFGDCIARENLIISESTPGFAPAL  310

Query  1045  NVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNI  1224
             ++E EM + L +K+   +  +AQKMKELGLERA K+GWQDTYVFTKAMGEM++DNMRG+I
Sbjct  311   DIEHEMNLALDSKEAFQENEVAQKMKELGLERARKYGWQDTYVFTKAMGEMVVDNMRGDI  370

Query  1225  PVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVV  1404
             PVVI+RPSVIEST KEPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVVPADMVV
Sbjct  371   PVVIIRPSVIESTCKEPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVVPADMVV  430

Query  1405  NATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVP  1584
             NATLAAMA HG   KP  ++Y IASSVVNPLVF DLA LL+EH+ S PY+DS G+PI VP
Sbjct  431   NATLAAMAWHGMEQKPDINVYQIASSVVNPLVFQDLATLLHEHYNSSPYMDSNGRPIHVP  490

Query  1585  RMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPY  1764
              MKLFSSME  S+HLWR    +S L  +  S  KLS K ENICRKSVEQAKYLASIYEPY
Sbjct  491   SMKLFSSMEEFSAHLWRYVTQRSRLAGMATSDRKLSQKHENICRKSVEQAKYLASIYEPY  550

Query  1765  TFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSC  1941
             TFYGGRFDNSN QKLME MS+ E+  FGF+V SIDW+DYI+NVHIPGLRRHVMKGRG C
Sbjct  551   TFYGGRFDNSNTQKLMERMSENEKGIFGFDVGSIDWRDYITNVHIPGLRRHVMKGRGMC  609



>gb|KHN00025.1| Fatty acyl-CoA reductase 2 [Glycine soja]
Length=609

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/591 (66%), Positives = 464/591 (79%), Gaps = 28/591 (5%)
 Frame = +1

Query  205   CLPLRINNMVYCQGGGSNI--------VTTGRA--VDQASKAAALMEAGSLLLAPNGNAQ  354
             C   R   +VYCQGGG+ I        V T R+  V     AA LM+AGSL+L+ NG +Q
Sbjct  29    CPSRRKACVVYCQGGGNVIKSSSGLSSVLTERSALVGTDHAAAVLMDAGSLVLSQNGKSQ  88

Query  355   aaaassasasasaaENVGMKELVS----SYVEKHEDGIGIVRFLRGKSFLITGGTGFLGK  522
             A               + +K+LV     + +   EDGIGIV+FL GK F ITG TGFL K
Sbjct  89    A--------------EILVKDLVPYDGPTTLIGVEDGIGIVKFLGGKKFFITGATGFLAK  134

Query  523   VLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSK  702
             V IEKILRT PDV K+Y+LIKA NK+ AMERL+ EII+ ELF+ L++ +GKSYQ FMLSK
Sbjct  135   VFIEKILRTEPDVGKMYLLIKAKNKQAAMERLQNEIINTELFRCLQEIHGKSYQAFMLSK  194

Query  703   LVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKF  882
             LVPVVGN+CE +LG+D+  +++IA+EVD+IVNSAANTTFDERYD A++INT GP RLM  
Sbjct  195   LVPVVGNICEHNLGLDEGISDVIAEEVDVIVNSAANTTFDERYDTAININTIGPCRLMNI  254

Query  883   AHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEM  1062
             A +C KLKLFLHVSTAYVNGQRQG+I+E+PF IGE IA E  ++      +P L++E E+
Sbjct  255   AKKCKKLKLFLHVSTAYVNGQRQGRIMERPFSIGECIAREKYISEVSPKYLPTLDIEGEI  314

Query  1063  EMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVR  1242
              +V + K  + D  +AQKMKE+GLERA ++GWQDTYVFTKAMGEMMID +RG+IPVV++R
Sbjct  315   NLVSNYKGDIEDNLLAQKMKEIGLERARRYGWQDTYVFTKAMGEMMIDKLRGDIPVVVMR  374

Query  1243  PSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAA  1422
             PSVIEST  EPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAA
Sbjct  375   PSVIESTFSEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAA  434

Query  1423  MAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFS  1602
             MA+HG + KP  ++Y IASSVVNPLVF DLARLLYEH+ S P IDSKG+PI VP MKLFS
Sbjct  435   MARHGVSQKPDINVYQIASSVVNPLVFQDLARLLYEHYSSSPCIDSKGRPIQVPLMKLFS  494

Query  1603  SMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGR  1782
             S E  S HLWRDAI K GLTA+  SKGK+S KLEN+CRKSVEQAKYLA+IYEPYTFYGGR
Sbjct  495   STEEFSGHLWRDAIQKRGLTAVASSKGKMSQKLENMCRKSVEQAKYLANIYEPYTFYGGR  554

Query  1783  FDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             FDNSN Q+LME MS++E+ +FGF+V+SIDW DYI+NVHIPGLRRHVMKGRG
Sbjct  555   FDNSNTQRLMESMSEKEKREFGFDVKSIDWNDYITNVHIPGLRRHVMKGRG  605



>ref|XP_003520320.1| PREDICTED: fatty acyl-CoA reductase 2-like [Glycine max]
Length=609

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/591 (66%), Positives = 464/591 (79%), Gaps = 28/591 (5%)
 Frame = +1

Query  205   CLPLRINNMVYCQGGGSNI--------VTTGRA--VDQASKAAALMEAGSLLLAPNGNAQ  354
             C   R   +VYCQGGG+ I        V T R+  V     AA LM+AGSL+L+ NG +Q
Sbjct  29    CPSRRKACVVYCQGGGNVIKSSSGLSSVLTERSALVGTDHAAAVLMDAGSLVLSQNGKSQ  88

Query  355   aaaassasasasaaENVGMKELVS----SYVEKHEDGIGIVRFLRGKSFLITGGTGFLGK  522
             A               + +K+LV     + +   EDGIGIV+FL GK F ITG TGFL K
Sbjct  89    A--------------EILVKDLVPYDGPTTLIGVEDGIGIVKFLGGKKFFITGATGFLAK  134

Query  523   VLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSK  702
             V IEKILRT PDV K+Y+LIKA NK+ AMERL+ EII+ ELF+ L++ +GKSYQ FMLSK
Sbjct  135   VFIEKILRTEPDVGKMYLLIKAKNKQAAMERLQNEIINTELFRCLQEIHGKSYQAFMLSK  194

Query  703   LVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKF  882
             LVPVVGN+CE +LG+D+  +++IA+EVD+IVNSAANTTFDERYD A++INT GP RLM  
Sbjct  195   LVPVVGNICEHNLGLDEGISDVIAEEVDVIVNSAANTTFDERYDTAININTIGPCRLMNI  254

Query  883   AHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEM  1062
             A +C KLKLFLHVSTAYVNGQRQG+I+E+PF IGE IA E  ++      +P L++E E+
Sbjct  255   AKKCKKLKLFLHVSTAYVNGQRQGRIMERPFSIGECIAREKYISEVSPKYLPTLDIEGEI  314

Query  1063  EMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVR  1242
              +V + K  + D  +AQKMKE+GLERA ++GWQDTYVFTKAMGEMMID +RG+IPVV++R
Sbjct  315   NLVSNYKGDIEDNLLAQKMKEIGLERARRYGWQDTYVFTKAMGEMMIDKLRGDIPVVVMR  374

Query  1243  PSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAA  1422
             PSVIEST  EPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAA
Sbjct  375   PSVIESTFSEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAA  434

Query  1423  MAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFS  1602
             MA+HG + KP  ++Y IASSVVNPLVF DLARLLYEH+ S P IDSKG+PI VP MKLFS
Sbjct  435   MARHGVSQKPDINVYQIASSVVNPLVFQDLARLLYEHYSSSPCIDSKGRPIQVPLMKLFS  494

Query  1603  SMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGR  1782
             S E  S HLWRDAI K GLTA+  SKGK+S KLEN+CRKSVEQAKYLA+IYEPYTFYGGR
Sbjct  495   STEEFSGHLWRDAIQKRGLTAVASSKGKMSQKLENMCRKSVEQAKYLANIYEPYTFYGGR  554

Query  1783  FDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             FDNSN Q+LME MS++E+ +FGF+V+SIDW DYI+NVHIPGLRRHVMKGRG
Sbjct  555   FDNSNTQRLMESMSEKEKREFGFDVKSIDWNDYITNVHIPGLRRHVMKGRG  605



>ref|XP_011039509.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X1 [Populus 
euphratica]
Length=610

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/605 (64%), Positives = 461/605 (76%), Gaps = 38/605 (6%)
 Frame = +1

Query  178   CFVVSKHRLCLPLRINNMVYCQGGGSNI--------VTTGRA--VDQASKAAALMEAGSL  327
             CF+  + R       N  V+CQGGG           V T R+  V      A++ ++GSL
Sbjct  26    CFLRWRKR-------NVAVHCQGGGGKAIRSSGFPSVLTERSAVVSDQEHIASVRDSGSL  78

Query  328   LLAPNGNAQaaaassasasasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSF  489
             +L+PN   Q                + +K+LV      SS + + +DGIGIV+FLRGK F
Sbjct  79    VLSPNEKGQ--------------PEIAVKDLVPYGGPTSSSLLEMQDGIGIVKFLRGKGF  124

Query  490   LITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTY  669
              I+G TGFL KVLIEKILRT+PDV KIY+LIKA++KE A+ RLK EII+AELFK L+QT+
Sbjct  125   FISGATGFLAKVLIEKILRTMPDVGKIYVLIKAESKEAAIARLKNEIINAELFKCLRQTH  184

Query  670   GKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDI  849
             GKSYQ FML+KLVPVVGNVCES+LG+++  A+ IA EVDII+NSAANTTFDERYDVA+D+
Sbjct  185   GKSYQSFMLNKLVPVVGNVCESNLGLEEDLADKIANEVDIIINSAANTTFDERYDVAIDV  244

Query  850   NTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGES-VVNGNQE  1026
             NT G   LM+FA +C KLKLFL VSTAYVNGQRQG+I+EKPF  G+ +A E+ +++ +  
Sbjct  245   NTRGTCHLMRFAKKCQKLKLFLQVSTAYVNGQRQGRIMEKPFLFGDCLARENLIISESTP  304

Query  1027  SSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMID  1206
                P L++E EM + L +K+   +  +AQKMKELGLERA K GWQDTYVFTKAMGEM++D
Sbjct  305   RLAPALDIEHEMNLALDSKEAFQENEVAQKMKELGLERARKHGWQDTYVFTKAMGEMVVD  364

Query  1207  NMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVV  1386
             NMRG+IPVV++RPSVIEST KEPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVV
Sbjct  365   NMRGDIPVVVIRPSVIESTCKEPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVV  424

Query  1387  PADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKG  1566
             PADMVVNATLAAMA HG   KP  ++Y IASSVVNPLVF DLA LL+EH+ S PY+DS G
Sbjct  425   PADMVVNATLAAMAWHGMEQKPDINVYQIASSVVNPLVFQDLATLLHEHYNSSPYMDSNG  484

Query  1567  KPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLA  1746
             +PI VP MKLFSSME  S+HLWR    +S L  +  S  KLS K EN+CRKSVEQAKYLA
Sbjct  485   RPIHVPSMKLFSSMEEFSAHLWRYVTQRSRLAGMATSDRKLSQKHENLCRKSVEQAKYLA  544

Query  1747  SIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMK  1926
             SIYEPYTFYGGRFDNSN QKLME MS+ E+  FGF+V SIDW+DYI+NVHIPGLRRHVMK
Sbjct  545   SIYEPYTFYGGRFDNSNTQKLMERMSENEKGIFGFDVGSIDWRDYITNVHIPGLRRHVMK  604

Query  1927  GRGSC  1941
             GRG C
Sbjct  605   GRGMC  609



>ref|XP_008241158.1| PREDICTED: fatty acyl-CoA reductase 2 [Prunus mume]
Length=599

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/600 (67%), Positives = 466/600 (78%), Gaps = 36/600 (6%)
 Frame = +1

Query  187   VSKHR--LCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaa  360
             VS H+   CL  R  +++ CQG G N + T         + A+ +AGSL+L+PN      
Sbjct  22    VSDHKRGWCLLRRKKSVILCQGSGGNAIKT-----SGFSSKAVKDAGSLVLSPNDQKSQK  76

Query  361   aassasasasaaENVGMKELV--------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFL  516
                          N+ +K+LV        +S +E H DGIGIV+FLRGK F ITG TGFL
Sbjct  77    E-----------NNIAVKDLVPFGGSPPSTSLMEMH-DGIGIVKFLRGKGFFITGATGFL  124

Query  517   GKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFML  696
              KVLIEKILRT PDV KI++LIKA NKE AMERLK EII+AELFK L+QTYGKSYQ FML
Sbjct  125   AKVLIEKILRTQPDVGKIFLLIKAKNKEAAMERLKSEIINAELFKCLRQTYGKSYQAFML  184

Query  697   SKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLM  876
             SKLVPVVGNV +SDLG++   A +IAKEVD+IVNSAANTTF ERYDVA+DINT GP  LM
Sbjct  185   SKLVPVVGNVSDSDLGLEHDIAGLIAKEVDVIVNSAANTTFHERYDVAIDINTKGPCHLM  244

Query  877   KFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPK----L  1044
              FA +C KLKLFL VSTAYVNGQRQG+I+EKPF IGESIAGE     N +S  P     L
Sbjct  245   AFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFYIGESIAGE-----NYKSETPPGFYPL  299

Query  1045  NVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNI  1224
             +VE+E+ + L++K   ++  +AQKMKELGLERA K+GWQDTYVFTKAMGEM+IDNMRG+I
Sbjct  300   DVENEINLALNSKGAYANNEVAQKMKELGLERARKYGWQDTYVFTKAMGEMLIDNMRGDI  359

Query  1225  PVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVV  1404
             PVVI+RPSVIEST+KEPF GWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDV+PADMV 
Sbjct  360   PVVIIRPSVIESTYKEPFAGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVIPADMVA  419

Query  1405  NATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVP  1584
             NATLAA+A HG A K   +IY I SSV NPL F +L+ LLYEH+ S P +DSKG+PI VP
Sbjct  420   NATLAAIANHGMAQKKDINIYQITSSVANPLNFQELSTLLYEHYNSSPCVDSKGRPIQVP  479

Query  1585  RMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPY  1764
              MKLFSSME  S+H+WRDA+ +S LTAL  S GKLS KLE ICRKSVEQAKYLA+IYEPY
Sbjct  480   SMKLFSSMEDFSAHIWRDALQRSQLTALNSSNGKLSRKLEMICRKSVEQAKYLAAIYEPY  539

Query  1765  TFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             TFYGGRFDNSN Q+LME MS+EE+ +FGF+V SIDWKDYI+NVHIPGL+RHV+KGRG CS
Sbjct  540   TFYGGRFDNSNTQRLMERMSEEEKRKFGFDVGSIDWKDYITNVHIPGLKRHVLKGRGVCS  599



>ref|XP_007204810.1| hypothetical protein PRUPE_ppa026306mg [Prunus persica]
 gb|EMJ06009.1| hypothetical protein PRUPE_ppa026306mg [Prunus persica]
Length=599

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/596 (67%), Positives = 467/596 (78%), Gaps = 28/596 (5%)
 Frame = +1

Query  187   VSKHR--LCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaa  360
             VS H+   CL  R  +++ CQG G N + T   +  +SKA  + +AG+L+L+PN      
Sbjct  22    VSDHKRGWCLLRRKKSVILCQGSGGNAIKT---IGFSSKA--VKDAGNLVLSPNDQKSQK  76

Query  361   aassasasasaaENVGMKELVS--------SYVEKHEDGIGIVRFLRGKSFLITGGTGFL  516
                          N+ +K+LVS        S VE H DGIGIV+FLRGK F ITG TGFL
Sbjct  77    E-----------NNIAVKDLVSFGGSPPSTSLVEMH-DGIGIVKFLRGKGFFITGATGFL  124

Query  517   GKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFML  696
              KVLIEKILRT PDV KI++LIKA NKE AMERLK EII+AELFK L+QTYGKSYQ FML
Sbjct  125   AKVLIEKILRTQPDVGKIFLLIKAKNKEAAMERLKSEIINAELFKCLRQTYGKSYQAFML  184

Query  697   SKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLM  876
             SKLVPVVGNV +SDLG++   A +IAKEVD+IVNSAANTTF ERYDVA+DINT GP  LM
Sbjct  185   SKLVPVVGNVSDSDLGLEHDIAGLIAKEVDVIVNSAANTTFHERYDVAIDINTKGPCHLM  244

Query  877   KFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVED  1056
              FA +C KLKLFL VSTAYVNGQRQG+I+EKPF IGESIAGE+ ++       P L+VE+
Sbjct  245   AFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFYIGESIAGENYISETPPGFYP-LDVEN  303

Query  1057  EMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVI  1236
             E+ + L++K   ++  +AQKMKELGLERA K+GWQDTYVFTKAMGEM+ID MRG+IPVVI
Sbjct  304   EINLALNSKGAYANNEVAQKMKELGLERARKYGWQDTYVFTKAMGEMLIDKMRGDIPVVI  363

Query  1237  VRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATL  1416
             +RPSVIEST KEPF GWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVVPADMV NATL
Sbjct  364   IRPSVIESTCKEPFAGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVVPADMVANATL  423

Query  1417  AAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKL  1596
             AA+A HG A K   +IY I SSV NPL F +L+ LLYEH+ S P +DSKG+PI VP MKL
Sbjct  424   AAIANHGMAQKKDINIYQITSSVANPLNFQELSTLLYEHYSSSPCVDSKGRPIQVPSMKL  483

Query  1597  FSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYG  1776
             FSSME  S+H+WRDA+ +S LTAL  S GKLS KLE ICRKSVEQAKYLA+IYEPYTFYG
Sbjct  484   FSSMEDFSAHIWRDALQRSQLTALNSSNGKLSRKLEMICRKSVEQAKYLAAIYEPYTFYG  543

Query  1777  GRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             GRFDNSN Q+LME MS+EE+ +FGF+V SIDWKDYI+NVHIPGL+RHV+KGRG CS
Sbjct  544   GRFDNSNTQRLMERMSEEEKRKFGFDVGSIDWKDYITNVHIPGLKRHVLKGRGVCS  599



>gb|ACA28679.1| male sterility-related protein [Linum usitatissimum]
 gb|ACA28680.1| male sterility-related protein [Linum usitatissimum]
Length=535

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/547 (67%), Positives = 437/547 (80%), Gaps = 22/547 (4%)
 Frame = +1

Query  316   AGSLLLAPNGNAQaaaassasasasaaENVGMKELVSSYVE---KHEDGIGIVRFLRGKS  486
             A SL+L+PNG  Q                + +K+L+  Y E     +DGIGIVRFLRGK 
Sbjct  4     ASSLVLSPNGKGQ--------------PEIAVKDLIPPYGEPTSSSQDGIGIVRFLRGKG  49

Query  487   FLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQT  666
             F ITG TGFL KVLIEKILRT+PD+ KIY+LIKA NK+ AM RLK EI++AELF  L+QT
Sbjct  50    FFITGATGFLAKVLIEKILRTMPDIGKIYLLIKAKNKDAAMSRLKTEILNAELFTSLRQT  109

Query  667   YGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALD  846
             YGKSY  FMLSKLVPV G+VC+S+LG++   A++IA +VD+IVNSAANTTFDERYDVA+D
Sbjct  110   YGKSYHTFMLSKLVPVAGDVCKSNLGLEQEIADLIADDVDVIVNSAANTTFDERYDVAID  169

Query  847   INTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQE  1026
             INT GP+ LM FA +C KLKLFL VSTAYVNGQRQG+I+E+ F +G+ IA E   N N  
Sbjct  170   INTRGPSNLMSFAKKCEKLKLFLQVSTAYVNGQRQGRIMERAFGMGDCIAEE---NSNPA  226

Query  1027  SSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMID  1206
             S    L++E E+++VL +K+      +A KM+ELGLERA K+GWQDTYVFTKAMGEM+ID
Sbjct  227   SRF-TLDIEGEVKLVLDSKEAFHPDEIATKMRELGLERARKYGWQDTYVFTKAMGEMVID  285

Query  1207  NMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVV  1386
             NMRG IPVVI+RPSVIEST+KEPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVV
Sbjct  286   NMRGEIPVVILRPSVIESTYKEPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVV  345

Query  1387  PADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKG  1566
             PADMVVNATLAAMA+HG   KP  ++Y IASSVVNPL+F DLA LLYEH+ + PY+DS G
Sbjct  346   PADMVVNATLAAMARHGMDQKPEINVYQIASSVVNPLIFKDLATLLYEHYNTSPYMDSNG  405

Query  1567  KPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALGDSKGKLSTKLENICRKSVEQAKYL  1743
              PI VP MKLFSSM+  S HLW+D + ++GLT A+  S GKLS K E ICRKSVEQAKYL
Sbjct  406   FPITVPLMKLFSSMDEFSDHLWKDVVQRNGLTAAVASSDGKLSQKHEFICRKSVEQAKYL  465

Query  1744  ASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVM  1923
             A+IYEPYTFYGGRFDNSN + LME MS+ E+ +FGF+V SIDW+DYI+NVHIPGLRRHVM
Sbjct  466   ANIYEPYTFYGGRFDNSNGEGLMEMMSEVEKRKFGFDVGSIDWRDYITNVHIPGLRRHVM  525

Query  1924  KGRGSCS  1944
             KGRG+ S
Sbjct  526   KGRGTSS  532



>gb|AHJ37516.1| fatty acyl-CoA reductase 2-like protein [Vitis vinifera]
Length=584

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/584 (65%), Positives = 449/584 (77%), Gaps = 39/584 (7%)
 Frame = +1

Query  217   RINNMVYCQGGGSNIVTTGRAV---DQASKAAALMEAGSLLLAPNGNAQaaaassasasa  387
             R  ++V+CQ  G+ + ++G +    +++  A+    AGSL+L+ NG              
Sbjct  28    RRKSVVHCQTSGNGVRSSGVSSVLSERSMLASKDHSAGSLVLSQNG--------------  73

Query  388   saaENVGMKELV---------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKI  540
                     K+LV         +S+VE + DGIGI  FLRGKSFLITG TGFL KVLIEKI
Sbjct  74    --------KDLVPYGPPSPSTTSFVEMN-DGIGIDEFLRGKSFLITGATGFLAKVLIEKI  124

Query  541   LRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVG  720
             LRT PDV KIY+LIKA N+E AMERLK EII+AE+F  L+Q YGKSYQ FMLSKLVPV G
Sbjct  125   LRTEPDVGKIYLLIKAKNQEAAMERLKNEIINAEVFDCLQQAYGKSYQAFMLSKLVPVAG  184

Query  721   NVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHK  900
             +VC S LG++   AE IAKEVD+IVNSAANTTFDERYD+A+DINT GP  LM FA  C K
Sbjct  185   DVCGSSLGLEKDFAEAIAKEVDVIVNSAANTTFDERYDIAIDINTKGPCHLMNFAKNCKK  244

Query  901   LKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSA  1080
             LKLFL VSTAYVNGQRQG+I+EKPFCIG+SIA ES ++      +P LN+E E+++ L +
Sbjct  245   LKLFLQVSTAYVNGQRQGRIMEKPFCIGDSIARESNISEAPPRLLPTLNIEAEIKLALDS  304

Query  1081  KQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIES  1260
             K+      +AQKMKELGLERA K GWQDTYVFTKAMGEM+ID MRG IPVVI+RPSVIES
Sbjct  305   KEAFKGSTLAQKMKELGLERAKKHGWQDTYVFTKAMGEMVIDQMRGEIPVVIIRPSVIES  364

Query  1261  THKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGA  1440
             T +EPFPGWMEGNRMMDPI+L+YGKGQLTGF+ DPNGVLDVVPADMVVNATLAAMA+HG 
Sbjct  365   TRREPFPGWMEGNRMMDPIVLYYGKGQLTGFVADPNGVLDVVPADMVVNATLAAMARHGG  424

Query  1441  AGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALS  1620
             +GK  TSIY IASSVVNPL+F DL    YEHF+S P +D+KG PI VP MKLFSS+E  S
Sbjct  425   SGKAETSIYQIASSVVNPLIFQDLTSHFYEHFKSSPCLDNKGNPIHVPIMKLFSSIEDFS  484

Query  1621  SHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNA  1800
             SHLWRDAI +SGL+A+    G+L  KLE    K+V+QAKYLA IY+PYTFYGGRFDNSN 
Sbjct  485   SHLWRDAILRSGLSAMPSQTGRLLRKLE----KTVKQAKYLADIYQPYTFYGGRFDNSNT  540

Query  1801  QKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             Q+LM+CM +EE+ +FGF+V SIDWKDYISNVHIPGLRRHVMKGR
Sbjct  541   QRLMDCMCEEEKSKFGFDVGSIDWKDYISNVHIPGLRRHVMKGR  584



>ref|XP_002276588.1| PREDICTED: fatty acyl-CoA reductase 2 [Vitis vinifera]
Length=584

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/584 (65%), Positives = 449/584 (77%), Gaps = 39/584 (7%)
 Frame = +1

Query  217   RINNMVYCQGGGSNIVTTGRAV---DQASKAAALMEAGSLLLAPNGNAQaaaassasasa  387
             R  ++V+CQ  G+ + ++G +    +++  A+    AGSL+L+PNG              
Sbjct  28    RRKSVVHCQTSGNGVRSSGVSSVLSERSMLASKDHSAGSLVLSPNG--------------  73

Query  388   saaENVGMKELV---------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKI  540
                     K+LV         + +VE + DGIGI  FLRGKSFLITG TGFL KVLIEKI
Sbjct  74    --------KDLVPYGPPSPSTTPFVEMN-DGIGIDNFLRGKSFLITGATGFLAKVLIEKI  124

Query  541   LRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVG  720
             LRT PDV KIY+LIKA N+E AMERLK EII+AE+F  L+Q YGKSYQ FMLSKLVPV G
Sbjct  125   LRTEPDVGKIYLLIKAKNQEAAMERLKNEIINAEVFDCLQQAYGKSYQAFMLSKLVPVAG  184

Query  721   NVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHK  900
             +VC S LG++   AE IAKEVD+IVNSAANTTFDERYD+A+DINT GP  LM FA  C K
Sbjct  185   DVCGSSLGLEKDFAEAIAKEVDVIVNSAANTTFDERYDIAIDINTKGPCHLMNFAKNCKK  244

Query  901   LKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSA  1080
             LKLFL VSTAYVNGQRQG+I+EKPFCIG+SIA ES ++      +P LN+E E+++ L +
Sbjct  245   LKLFLQVSTAYVNGQRQGRIMEKPFCIGDSIARESNISEAPPRLLPTLNIEAEIKLALDS  304

Query  1081  KQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIES  1260
             K+      +AQKMKELGLERA K GWQDTYVFTKAMGEM+ID MRG IPVVI+RPSVIES
Sbjct  305   KEAFKGSTLAQKMKELGLERAKKHGWQDTYVFTKAMGEMVIDQMRGEIPVVIIRPSVIES  364

Query  1261  THKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGA  1440
             T +EPFPGWMEGNRMMDPI+L+YGKGQLTGF+ DPNGVLDVVPADMVVNATLAAMA+HG 
Sbjct  365   TCREPFPGWMEGNRMMDPIVLYYGKGQLTGFVADPNGVLDVVPADMVVNATLAAMARHGG  424

Query  1441  AGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALS  1620
             +GK  T+IY IASSVVNPL+F DL    YEHF+S P +D+KG PI VP MKLFSS+E  S
Sbjct  425   SGKAETNIYQIASSVVNPLIFQDLTSHFYEHFKSSPCLDNKGNPIHVPIMKLFSSIEDFS  484

Query  1621  SHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNA  1800
             SHLWRDAI +SGL+A+    GKL  KLE    K+V+QAKYLA IY+PYTFYGGRFDNSN 
Sbjct  485   SHLWRDAILRSGLSAMPSQTGKLLRKLE----KTVKQAKYLADIYQPYTFYGGRFDNSNT  540

Query  1801  QKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             Q+LM+CM +EE+ +FGF+V SIDWKDYISNVHIPGLRRHVMKGR
Sbjct  541   QRLMDCMCEEEKSKFGFDVGSIDWKDYISNVHIPGLRRHVMKGR  584



>gb|KHN43996.1| Fatty acyl-CoA reductase 2 [Glycine soja]
Length=608

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/605 (63%), Positives = 459/605 (76%), Gaps = 32/605 (5%)
 Frame = +1

Query  184   VVSKHRLCLPLRINNMVYCQGGGSNI-----------VTTGRAV---DQASKAAALMEAG  321
             V   + LC   R  N+VYCQGGG N+           V T R+         A  LM+AG
Sbjct  17    VSHNNELCHSRRKGNVVYCQGGGKNVIKSSSSGSLSSVLTERSSLVGTDHEAAVTLMDAG  76

Query  322   SLLLAPNGNAQaaaassasasasaaENVGMKELV----SSYVEKHEDGIGIVRFLRGKSF  489
             SL+L+ NG +QA               + +K+LV    ++ +   EDGIGIV+FL GK F
Sbjct  77    SLVLSQNGKSQA--------------EIVVKDLVPYGGTTTLIGLEDGIGIVKFLGGKKF  122

Query  490   LITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTY  669
              ITG TGFL KV IEKILRT PDV K+Y+LIKA N + AMERL+ EII+ +LF+ L++ +
Sbjct  123   FITGATGFLAKVFIEKILRTEPDVGKMYLLIKAKNNQAAMERLQNEIINTQLFRCLQEIH  182

Query  670   GKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDI  849
             GKSYQ FMLSKLVPVVGN+CE +LG+D+  + +IA+EVD+ VNSAANTTFDERYD A++I
Sbjct  183   GKSYQAFMLSKLVPVVGNICEHNLGLDEDISNVIAEEVDVFVNSAANTTFDERYDTAINI  242

Query  850   NTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQES  1029
             NT GP RLM  A +C KLKLFLHVSTAYVNGQ+QG+I+E+PF IGE IA E  ++     
Sbjct  243   NTIGPCRLMNIAKKCKKLKLFLHVSTAYVNGQKQGRIMERPFSIGECIAREKYISEVSPK  302

Query  1030  SVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDN  1209
              +P L++E E+ +V + K  + D  + QKMKE+GLERA ++GWQDTYVFTKAMGEMMID 
Sbjct  303   YLPTLDIEGEINLVSNYKGDIEDNLLTQKMKEIGLERARRYGWQDTYVFTKAMGEMMIDK  362

Query  1210  MRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVP  1389
             +RG+IPVV++RPSVIEST  EPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVP
Sbjct  363   LRGDIPVVVMRPSVIESTFSEPFPGWMEGNRMMDPIVLWYGKGQLTGFLVDPNGVLDVVP  422

Query  1390  ADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGK  1569
             ADMVVNATLAAMA+HG   KP  ++Y IASSVVNPLVF DLARLLYEH+ S P IDS G+
Sbjct  423   ADMVVNATLAAMARHGMNQKPDINVYQIASSVVNPLVFQDLARLLYEHYSSSPCIDSMGR  482

Query  1570  PIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLAS  1749
             PI VP MK FSS E  S HLWRDAI K G+TA+  SK K+S KLEN+CRKSVEQAKYLA+
Sbjct  483   PIQVPLMKFFSSTEEFSGHLWRDAIQKRGITAMASSKAKMSQKLENMCRKSVEQAKYLAN  542

Query  1750  IYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKG  1929
             IYEPYTFYGGRFDNSN Q+LME MS+EE+ +F F+V+SIDW DYI+NVHIPGLRRHVMKG
Sbjct  543   IYEPYTFYGGRFDNSNTQRLMESMSEEEKREFDFDVKSIDWNDYITNVHIPGLRRHVMKG  602

Query  1930  RGSCS  1944
             RG  S
Sbjct  603   RGMGS  607



>emb|CBI29968.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/575 (66%), Positives = 447/575 (78%), Gaps = 21/575 (4%)
 Frame = +1

Query  217   RINNMVYCQGGGSNIVTTGRAV---DQASKAAALMEAGSLLLAPNGNAQaaaassasasa  387
             R  ++V+CQ  G+ + ++G +    +++  A+    AGSL+L+PNG         + +  
Sbjct  76    RRKSVVHCQTSGNGVRSSGVSSVLSERSMLASKDHSAGSLVLSPNGKDLVPYGPPSPS--  133

Query  388   saaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHK  567
                         + +VE + DGIGI  FLRGKSFLITG TGFL KVLIEKILRT PDV K
Sbjct  134   -----------TTPFVEMN-DGIGIDNFLRGKSFLITGATGFLAKVLIEKILRTEPDVGK  181

Query  568   IYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI  747
             IY+LIKA N+E AMERLK EII+AE+F  L+Q YGKSYQ FMLSKLVPV G+VC S LG+
Sbjct  182   IYLLIKAKNQEAAMERLKNEIINAEVFDCLQQAYGKSYQAFMLSKLVPVAGDVCGSSLGL  241

Query  748   DDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVST  927
             +   AE IAKEVD+IVNSAANTTFDERYD+A+DINT GP  LM FA  C KLKLFL VST
Sbjct  242   EKDFAEAIAKEVDVIVNSAANTTFDERYDIAIDINTKGPCHLMNFAKNCKKLKLFLQVST  301

Query  928   AYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAM  1107
             AYVNGQRQG+I+EKPFCIG+SIA ES ++      +P LN+E E+++ L +K+      +
Sbjct  302   AYVNGQRQGRIMEKPFCIGDSIARESNISEAPPRLLPTLNIEAEIKLALDSKEAFKGSTL  361

Query  1108  AQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGW  1287
             AQKMKELGLERA K GWQDTYVFTKAMGEM+ID MRG IPVVI+RPSVIEST +EPFPGW
Sbjct  362   AQKMKELGLERAKKHGWQDTYVFTKAMGEMVIDQMRGEIPVVIIRPSVIESTCREPFPGW  421

Query  1288  MEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIY  1467
             MEGNRMMDPI+L+YGKGQLTGF+ DPNGVLDVVPADMVVNATLAAMA+HG +GK  T+IY
Sbjct  422   MEGNRMMDPIVLYYGKGQLTGFVADPNGVLDVVPADMVVNATLAAMARHGGSGKAETNIY  481

Query  1468  HIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAID  1647
              IASSVVNPL+F DL    YEHF+S P +D+KG PI VP MKLFSS+E  SSHLWRDAI 
Sbjct  482   QIASSVVNPLIFQDLTSHFYEHFKSSPCLDNKGNPIHVPIMKLFSSIEDFSSHLWRDAIL  541

Query  1648  KSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK  1827
             +SGL+A+    GKL  KLE    K+V+QAKYLA IY+PYTFYGGRFDNSN Q+LM+CM +
Sbjct  542   RSGLSAMPSQTGKLLRKLE----KTVKQAKYLADIYQPYTFYGGRFDNSNTQRLMDCMCE  597

Query  1828  EERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             EE+ +FGF+V SIDWKDYISNVHIPGLRRHVMKGR
Sbjct  598   EEKSKFGFDVGSIDWKDYISNVHIPGLRRHVMKGR  632



>gb|KEH41771.1| fatty acyl-CoA reductase-like protein [Medicago truncatula]
Length=615

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/592 (64%), Positives = 458/592 (77%), Gaps = 33/592 (6%)
 Frame = +1

Query  217   RINNMVYC-QGGGSNI--------VTTGRA---VDQASKAAALMEAGSLLLAPNGNAQaa  360
             R N +V+  QGGG N+        V T R+   V     A  LM+AG+L+L+ NG  Q  
Sbjct  34    RTNVVVFSHQGGGGNVIKSSNLSSVLTERSSSLVSSDHAATTLMDAGNLVLSQNGKNQT-  92

Query  361   aassasasasaaENVGMKELV-------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLG  519
                          ++ +K++V       ++ +   +DGIGIV+FLRGK F +TG TGFL 
Sbjct  93    -------------DIVVKDIVPYGGPTTTTTLIGLDDGIGIVKFLRGKKFFVTGSTGFLA  139

Query  520   KVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLS  699
             KVLIEKILRT PDV K+Y+LIKA NK+ AMERL+ EII+ ELF+ L+Q +GKSYQ FMLS
Sbjct  140   KVLIEKILRTEPDVGKMYLLIKAKNKQAAMERLQNEIINTELFRCLRQIHGKSYQAFMLS  199

Query  700   KLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMK  879
             KLVP+VG++CE++LG+D+   ++IA EVD+IVNSAANTTFDERYD A++INT GP RLM 
Sbjct  200   KLVPIVGDICETNLGLDEELYDIIADEVDVIVNSAANTTFDERYDTAININTRGPCRLMA  259

Query  880   FAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDE  1059
              A +C KLKLFLHVSTAYVNGQRQG+I+E+PF IG+ IA E ++ G     +P L++E+E
Sbjct  260   IAKKCKKLKLFLHVSTAYVNGQRQGRIMERPFSIGDCIAREKLIPGVPPKYLPTLDIENE  319

Query  1060  MEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIV  1239
             + M+L  K  + D  +AQKMKE+GLERA ++GWQDTYVFTKAMGEMMID +R +IPVV++
Sbjct  320   INMILKNKGNIEDNLLAQKMKEMGLERARRYGWQDTYVFTKAMGEMMIDKLREDIPVVVI  379

Query  1240  RPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLA  1419
             RPSVIEST  EPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLA
Sbjct  380   RPSVIESTLNEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLA  439

Query  1420  AMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLF  1599
             AMAKHG   K   ++Y IASSVVNPLVF DL RLLYEH+ S P IDSKG PI VP MKLF
Sbjct  440   AMAKHGTTQKRDINVYQIASSVVNPLVFQDLTRLLYEHYTSSPCIDSKGNPIQVPIMKLF  499

Query  1600  SSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGG  1779
             SS E  S HLWRDAI K+GLTA+  S GK+S K+ENICRKSVEQAKYLA IYEPYTFYGG
Sbjct  500   SSSEEFSGHLWRDAIQKTGLTAMASSNGKMSQKIENICRKSVEQAKYLAKIYEPYTFYGG  559

Query  1780  RFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             RFDNSN Q+L+E MS+EE+ +F F+V+ IDWKDYI+NVHIPGLRR+VMKGRG
Sbjct  560   RFDNSNTQRLIEMMSEEEKREFRFDVKGIDWKDYITNVHIPGLRRYVMKGRG  611



>ref|XP_004514156.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X2 [Cicer 
arietinum]
Length=581

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/582 (63%), Positives = 446/582 (77%), Gaps = 44/582 (8%)
 Frame = +1

Query  214   LRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasasasa  393
             +   N+V+CQGGG    ++  + +  +    LM+AGSL+L+ NG +QA            
Sbjct  32    MTTTNVVFCQGGGKRSSSSLVSAEHGA-TTTLMDAGSLVLSQNGKSQA------------  78

Query  394   aENVGMKELV-------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTV  552
               ++ +K+LV       ++ +   +DGIGIV+FLRGK F ITG TGFL KVLIEKILRT 
Sbjct  79    --DIVVKDLVPYGGPTSTTLIGLEDDGIGIVKFLRGKKFFITGATGFLAKVLIEKILRTE  136

Query  553   PDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCE  732
             PDV K+YILIKA NK+VAMERL+KEII+ ELF+ L+Q +GKSYQ FMLSKLVP+VG++CE
Sbjct  137   PDVGKMYILIKAKNKQVAMERLQKEIINTELFRCLRQIHGKSYQAFMLSKLVPIVGDICE  196

Query  733   SDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLF  912
             ++LG+D+  +++IA EVD+IVNSAANTTFDERYD A++INT GP                
Sbjct  197   TNLGLDEDLSDVIADEVDVIVNSAANTTFDERYDTAININTRGP----------------  240

Query  913   LHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAK-QG  1089
                   YVNGQRQG+I+E+PF IG+ IA E +++G     +P L++E+E+ MVL  K   
Sbjct  241   -----TYVNGQRQGRIMERPFSIGDCIAREKLISGVPPKYLPTLDIENEINMVLKNKGNN  295

Query  1090  LSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHK  1269
             + +  +AQKM+E+GLERA ++GWQDTYVFTKAMGEMMID +R +IPVVI+RPSVIEST  
Sbjct  296   IEENLLAQKMREMGLERAKRYGWQDTYVFTKAMGEMMIDKLRDDIPVVIIRPSVIESTLS  355

Query  1270  EPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGK  1449
             EPFPGWMEGNRMMDP++L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG   K
Sbjct  356   EPFPGWMEGNRMMDPVVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGMTQK  415

Query  1450  PGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL  1629
                ++Y IASSVVNPL F DL RLLYEH+ S P+IDSKG+PI VP MKLFSS E  S HL
Sbjct  416   ADINVYQIASSVVNPLAFQDLTRLLYEHYSSSPFIDSKGRPIQVPIMKLFSSSEEFSGHL  475

Query  1630  WRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKL  1809
             WRD I+KSGLT++  SKGK+S KLENICRKSVEQAKYLA IYEPYTFYGGRFDNSN Q+L
Sbjct  476   WRDVINKSGLTSMASSKGKMSQKLENICRKSVEQAKYLAKIYEPYTFYGGRFDNSNTQRL  535

Query  1810  MECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             ME MS+EE+ +F F+V+ IDW DYI+NVHIPGLRR+VMKGRG
Sbjct  536   MEIMSEEEKTEFDFDVKGIDWTDYITNVHIPGLRRYVMKGRG  577



>ref|XP_003535102.1| PREDICTED: fatty acyl-CoA reductase 2-like [Glycine max]
Length=536

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/549 (67%), Positives = 437/549 (80%), Gaps = 18/549 (3%)
 Frame = +1

Query  310   MEAGSLLLAPNGNAQaaaassasasasaaENVGMKELV----SSYVEKHEDGIGIVRFLR  477
             M+AGSL+L+ NG +QA               + +K+LV    ++ +   EDGIGIV+FL 
Sbjct  1     MDAGSLVLSQNGKSQA--------------EIVVKDLVPYGGTTTLIGLEDGIGIVKFLG  46

Query  478   GKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFL  657
             GK F ITG TGFL KV IEKILRT PDV K+Y+LIKA N + AMERL+ EII+ +LF+ L
Sbjct  47    GKKFFITGATGFLAKVFIEKILRTEPDVGKMYLLIKAKNNQAAMERLQNEIINTQLFRCL  106

Query  658   KQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDV  837
             ++ +GKSYQ FMLSKLVPVVGN+CE +LG+D+  + +IA+EVD+ VNSAANTTFDERYD 
Sbjct  107   QEIHGKSYQAFMLSKLVPVVGNICEHNLGLDEDISNVIAEEVDVFVNSAANTTFDERYDT  166

Query  838   ALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNG  1017
             A++INT GP RLM  A +C KLKLFLHVSTAYVNGQ+QG+I+E+PF IGE IA E  ++ 
Sbjct  167   AININTIGPCRLMNIAKKCKKLKLFLHVSTAYVNGQKQGRIMERPFSIGECIAREKYISE  226

Query  1018  NQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEM  1197
                  +P L++E E+ +V + K  + D  + QKMKE+GLERA ++GWQDTYVFTKAMGEM
Sbjct  227   VSPKYLPTLDIEGEINLVSNYKGDIEDNLLTQKMKEIGLERARRYGWQDTYVFTKAMGEM  286

Query  1198  MIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVL  1377
             MID +RG+IPVV++RPSVIEST  EPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVL
Sbjct  287   MIDKLRGDIPVVVMRPSVIESTFSEPFPGWMEGNRMMDPIVLWYGKGQLTGFLVDPNGVL  346

Query  1378  DVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYID  1557
             DVVPADMVVNATLAAMA+HG   KP  ++Y IASSVVNPLVF DLARLLYEH+ S P ID
Sbjct  347   DVVPADMVVNATLAAMARHGMNQKPDINVYQIASSVVNPLVFQDLARLLYEHYSSSPCID  406

Query  1558  SKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAK  1737
             S G+PI VP MK FSS E  S HLWRDAI K G+TA+  SK K+S KLEN+CRKSVEQAK
Sbjct  407   SMGRPIQVPLMKFFSSTEEFSGHLWRDAIQKRGITAMASSKAKMSQKLENMCRKSVEQAK  466

Query  1738  YLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRH  1917
             YLA+IYEPYTFYGGRFDNSN Q+LME MS+EE+ +F F+V+SIDW DYI+NVHIPGLRRH
Sbjct  467   YLANIYEPYTFYGGRFDNSNTQRLMESMSEEEKREFDFDVKSIDWNDYITNVHIPGLRRH  526

Query  1918  VMKGRGSCS  1944
             VMKGRG  S
Sbjct  527   VMKGRGMGS  535



>ref|XP_010024331.1| PREDICTED: fatty acyl-CoA reductase 2 [Eucalyptus grandis]
Length=599

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/584 (65%), Positives = 456/584 (78%), Gaps = 15/584 (3%)
 Frame = +1

Query  193   KHRLCLPLRINNMVYCQGGGSNIVTTGRAVDQAS----KAAALMEAGSLLLAPNGNAQaa  360
             KH  C   +  +++ CQG GS I +T      AS    +++AL++AGSL+ +PNGN+QA 
Sbjct  23    KHDQCSLGKKKSLMCCQGSGSAIKSTVLKETSASVCTNQSSALIDAGSLVTSPNGNSQAE  82

Query  361   aassasasasaaENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKI  540
                +  A  +        E   S VE  +DGIGIVRFLRGK F ITG TGFL KVL+EKI
Sbjct  83    ICVNDLAPHA--------EHSHSLVE-MDDGIGIVRFLRGKRFFITGATGFLAKVLVEKI  133

Query  541   LRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVG  720
             LRTVPDV KI++L+KA +K+ A  RL  EII +ELFK L+QTYGKSY+ FMLSKL+PVVG
Sbjct  134   LRTVPDVGKIFLLMKAKDKDAAKARLSSEIIYSELFKNLQQTYGKSYEAFMLSKLIPVVG  193

Query  721   NVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHK  900
             +V ES+LG+ D   + IA EVDIIVNSAANT FDERYDVA++INT GP  LM FA +C +
Sbjct  194   DVSESNLGLGDELVDFIANEVDIIVNSAANTKFDERYDVAININTKGPYHLMSFAKRCSQ  253

Query  901   LKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSA  1080
             LK+FL VSTAYVNGQRQGKI+EKPFC+G+SI  ES  +    +S+P+L+VE E+ + L +
Sbjct  254   LKVFLQVSTAYVNGQRQGKIMEKPFCVGDSIVTESY-SAEPPTSLPQLDVESEIHLALES  312

Query  1081  KQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIES  1260
             K+ L D A+A+KMKELGL RA KFGWQDTYVFTKAMGEM+ID+MRG +PV+I+RPSVIES
Sbjct  313   KKALEDHAVAKKMKELGLNRAKKFGWQDTYVFTKAMGEMLIDDMRGEVPVIIIRPSVIES  372

Query  1261  THKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGA  1440
             T KEPFPGWMEGNRMMDPIIL+YGKGQLTGFLVDPNGV+DVVPAD+VVNATLAA+A+HG 
Sbjct  373   TIKEPFPGWMEGNRMMDPIILYYGKGQLTGFLVDPNGVIDVVPADIVVNATLAAIARHGM  432

Query  1441  AGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALS  1620
             AGK G +IY IASSVVNPLVF DLARLLYEH+ + P  DSKG+PI VP MKLF+SM+  S
Sbjct  433   AGKSGVNIYQIASSVVNPLVFQDLARLLYEHYNTSPCFDSKGRPIPVPSMKLFTSMDEFS  492

Query  1621  SHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNA  1800
             ++L  DA   SGL A+  S  KLS KLE +CR+SVEQ K LA+IYEPY FY GRFDNSN 
Sbjct  493   AYLSGDASQISGLRAM-TSDAKLSKKLEIVCRRSVEQIKKLANIYEPYAFYRGRFDNSNT  551

Query  1801  QKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             ++LME MS+EE+ +FGF+V SIDWKDYI NVHIPGLR HVMK R
Sbjct  552   ERLMERMSEEEKRRFGFDVGSIDWKDYIINVHIPGLRWHVMKER  595



>ref|XP_010520001.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
 ref|XP_010520003.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
 ref|XP_010520004.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
 ref|XP_010520005.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
 ref|XP_010520006.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
 ref|XP_010520007.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
Length=618

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/555 (65%), Positives = 440/555 (79%), Gaps = 20/555 (4%)
 Frame = +1

Query  283   DQASKAAALMEAGSLLLAPNGNAQaaaassasasasaaENVGMKELV----SSYVEKHED  450
             +++S  AA M+A +L+L+PNGN + A            E  G K LV    ++ +   ++
Sbjct  80    EESSSTAAAMDADTLVLSPNGNGRTAI-----------EINGAKSLVPFNGTASLVGLKE  128

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             G+GIV +L+GKSF ITG TGFL KVLIEKILRT PDV KIY+LIKADN+E A+ERLK E+
Sbjct  129   GLGIVNYLQGKSFFITGSTGFLAKVLIEKILRTAPDVAKIYLLIKADNREAAVERLKNEV  188

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             + AELFK LK+ +G +Y+ FMLSKLVPV GN+C+SD+G+    AE IA++VD+I+NSAAN
Sbjct  189   LDAELFKILKEAHGPAYKAFMLSKLVPVTGNICDSDIGLQSDYAEEIARDVDVIINSAAN  248

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TTF+ERYD+ALDINT GP  LMKFA +C+ LKLFL VSTAYVNGQRQG+I+EKPF +G+ 
Sbjct  249   TTFNERYDIALDINTRGPCNLMKFAKKCNNLKLFLQVSTAYVNGQRQGRIMEKPFSMGDC  308

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             I  E+  +G      P L+VE EM +   A  G  D   AQKMK+LGLERA  FGWQDTY
Sbjct  309   IETENFTHG-----TPFLDVEKEMMLASDAINGFQDHEEAQKMKDLGLERARTFGWQDTY  363

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEMMI+N+RG++PVVI+RPSVIEST+++PFPGWMEGNRMMDPI+L YGKGQLTG
Sbjct  364   VFTKAMGEMMINNIRGDVPVVIIRPSVIESTYRDPFPGWMEGNRMMDPIVLCYGKGQLTG  423

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             FLVDP GVLDVVPADMVVNATLAA+AKHG   +P  ++Y IASS++NPL+F+DLA LLYE
Sbjct  424   FLVDPKGVLDVVPADMVVNATLAAIAKHGMDQEPEINVYQIASSLINPLIFEDLAILLYE  483

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENI  1710
             H++S P +DSKG PI V  MKLF S++  S HLW+DA ++SGLTA+  S GK+  KLE I
Sbjct  484   HYKSSPCVDSKGTPIAVRLMKLFDSVDDFSDHLWKDAQERSGLTAMTSSDGKMMQKLEFI  543

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISN  1890
             CRKSVEQAKYLA IYEPYTFYGGRFDNSN Q+LME MS++E+ +FGF+V SI W+DYI+N
Sbjct  544   CRKSVEQAKYLADIYEPYTFYGGRFDNSNMQRLMESMSEKEKREFGFDVGSIVWRDYITN  603

Query  1891  VHIPGLRRHVMKGRG  1935
             VHIPGLRRHV+KGR 
Sbjct  604   VHIPGLRRHVLKGRA  618



>gb|KCW90352.1| hypothetical protein EUGRSUZ_A02497 [Eucalyptus grandis]
Length=564

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/574 (65%), Positives = 447/574 (78%), Gaps = 25/574 (4%)
 Frame = +1

Query  238   CQGGGSNIVTTGRAVDQAS----KAAALMEAGSLLLAPNGNAQaaaassasasasaaENV  405
             CQG GS I +T      AS    +++AL++AGSL+ +PNGN+QA               +
Sbjct  3     CQGSGSAIKSTVLKETSASVCTNQSSALIDAGSLVTSPNGNSQA--------------EI  48

Query  406   GMKELVSSYVEKH-----EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKI  570
              + +L       H     +DGIGIVRFLRGK F ITG TGFL KVL+EKILRTVPDV KI
Sbjct  49    CVNDLAPHAEHSHSLVEMDDGIGIVRFLRGKRFFITGATGFLAKVLVEKILRTVPDVGKI  108

Query  571   YILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGID  750
             ++L+KA +K+ A  RL  EII +ELFK L+QTYGKSY+ FMLSKL+PVVG+V ES+LG+ 
Sbjct  109   FLLMKAKDKDAAKARLSSEIIYSELFKNLQQTYGKSYEAFMLSKLIPVVGDVSESNLGLG  168

Query  751   DHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTA  930
             D   + IA EVDIIVNSAANT FDERYDVA++INT GP  LM FA +C +LK+FL VSTA
Sbjct  169   DELVDFIANEVDIIVNSAANTKFDERYDVAININTKGPYHLMSFAKRCSQLKVFLQVSTA  228

Query  931   YVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMA  1110
             YVNGQRQGKI+EKPFC+G+SI  ES  +    +S+P+L+VE E+ + L +K+ L D A+A
Sbjct  229   YVNGQRQGKIMEKPFCVGDSIVTESY-SAEPPTSLPQLDVESEIHLALESKKALEDHAVA  287

Query  1111  QKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWM  1290
             +KMKELGL RA KFGWQDTYVFTKAMGEM+ID+MRG +PV+I+RPSVIEST KEPFPGWM
Sbjct  288   KKMKELGLNRAKKFGWQDTYVFTKAMGEMLIDDMRGEVPVIIIRPSVIESTIKEPFPGWM  347

Query  1291  EGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYH  1470
             EGNRMMDPIIL+YGKGQLTGFLVDPNGV+DVVPAD+VVNATLAA+A+HG AGK G +IY 
Sbjct  348   EGNRMMDPIILYYGKGQLTGFLVDPNGVIDVVPADIVVNATLAAIARHGMAGKSGVNIYQ  407

Query  1471  IASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDK  1650
             IASSVVNPLVF DLARLLYEH+ + P  DSKG+PI VP MKLF+SM+  S++L  DA   
Sbjct  408   IASSVVNPLVFQDLARLLYEHYNTSPCFDSKGRPIPVPSMKLFTSMDEFSAYLSGDASQI  467

Query  1651  SGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE  1830
             SGL A+  S  KLS KLE +CR+SVEQ K LA+IYEPY FY GRFDNSN ++LME MS+E
Sbjct  468   SGLRAM-TSDAKLSKKLEIVCRRSVEQIKKLANIYEPYAFYRGRFDNSNTERLMERMSEE  526

Query  1831  ERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             E+ +FGF+V SIDWKDYI NVHIPGLR HVMK R
Sbjct  527   EKRRFGFDVGSIDWKDYIINVHIPGLRWHVMKER  560



>ref|XP_002308347.2| Male sterility protein 2 [Populus trichocarpa]
 gb|EEE91870.2| Male sterility protein 2 [Populus trichocarpa]
Length=593

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/591 (62%), Positives = 443/591 (75%), Gaps = 50/591 (8%)
 Frame = +1

Query  223   NNMVYCQGGGS----------NIVTTGRAV--DQASKAAALMEAGSLLLAPNGNAQaaaa  366
             N +VYCQGGG           +++T   AV  DQ    AA+ ++GSL+L+PNG  Q    
Sbjct  34    NVVVYCQGGGGKAIILSSGFPSVLTERSAVGSDQ-DHNAAVRDSGSLVLSPNGKGQ----  88

Query  367   ssasasasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVL  528
                         + + +LV      SS + + +DGIGIV+FLRGK F I+G TGFL KVL
Sbjct  89    ----------PEIAVTDLVPCGGPTSSSLVETQDGIGIVKFLRGKCFFISGATGFLAKVL  138

Query  529   IEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLV  708
             IEKILRT+PDV KIY+ IKA +KE A+ RLK EII+AELFK L++TYG SYQ FMLSKLV
Sbjct  139   IEKILRTMPDVGKIYLFIKAKDKEAAIARLKNEIINAELFKCLRETYGVSYQSFMLSKLV  198

Query  709   PVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAH  888
             PVVGNVCES+LG ++  A+ IA EVD+I+NSAANT+FDERYDVA+D+NT G   L++FA 
Sbjct  199   PVVGNVCESNLGFEEDLADEIANEVDVIINSAANTSFDERYDVAIDVNTRGTCHLVRFA-  257

Query  889   QCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEM  1068
             +C KLKLFL VSTAYVNGQRQG+I+EKP C+G+ IA E+ +     S    L++E+E+++
Sbjct  258   KCQKLKLFLQVSTAYVNGQRQGRIMEKPLCLGDCIARENPI----VSESTTLDIENEVKL  313

Query  1069  VLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPS  1248
              +++K+   +                ++GWQDTYVFTKAM EM++DNMRG+IPVV++RPS
Sbjct  314   AVNSKEDFQE------------NEGKRYGWQDTYVFTKAMREMVVDNMRGDIPVVVIRPS  361

Query  1249  VIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMA  1428
             VIEST KEPFPGWMEGNRMMDPI+L YGKGQLTGFL DPNGVLDVVPADMVVNATLAA+A
Sbjct  362   VIESTWKEPFPGWMEGNRMMDPIVLCYGKGQLTGFLADPNGVLDVVPADMVVNATLAAIA  421

Query  1429  KHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSM  1608
              HG   K   ++Y IASSVVNPLVF DLA LLYEH+ S PY+DS G+PI VP M+LFSSM
Sbjct  422   WHGMEQKSDINVYQIASSVVNPLVFQDLATLLYEHYNSSPYMDSNGRPIHVPSMQLFSSM  481

Query  1609  EALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFD  1788
             E  S HLWRD I +S L  +  S  KLS K ENICRKS+EQAKYLA+IYEPYTFYGGRFD
Sbjct  482   EDFSVHLWRDVIQQSRLAEMASSDRKLSQKHENICRKSLEQAKYLANIYEPYTFYGGRFD  541

Query  1789  NSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSC  1941
             NSN QKLME MS+ E+ +FGF+V S+DW+DYI+NVHIPGLRRHVMKGRG C
Sbjct  542   NSNTQKLMERMSENEKGEFGFDVGSMDWRDYITNVHIPGLRRHVMKGRGMC  592



>ref|XP_010673235.1| PREDICTED: fatty acyl-CoA reductase 2 [Beta vulgaris subsp. vulgaris]
Length=612

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/609 (56%), Positives = 452/609 (74%), Gaps = 44/609 (7%)
 Frame = +1

Query  196   HRLCLPLRINNMVYCQGGGSNIVTTGRAVDQASKAAALM-----------------EAGS  324
              R     +  + ++CQ        +GR V ++ K A ++                  +G 
Sbjct  24    QRFLAKTKKKDFIHCQ--------SGRNVTKSDKFAPVLPERSTPKIPSHGTTIIDSSGG  75

Query  325   LLLAPNGNAQaaaassasasasaaENVGMKEL------VSSYVEKHEDGIGIVRFLRGKS  486
             L+++PNG              ++ + + +K+L      VS+ + + ++GIGIV+FLR K+
Sbjct  76    LVMSPNGK-------------NSGDQILVKDLTPPYNGVSTTLGQVQEGIGIVKFLREKT  122

Query  487   FLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQT  666
             F +TG TGFL KVLIEKILRTVPDV KIY+LIKA++KEVA++RLK EII+ E+FK L+Q 
Sbjct  123   FFVTGATGFLAKVLIEKILRTVPDVGKIYVLIKANDKEVALKRLKNEIINTEIFKCLQQI  182

Query  667   YGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALD  846
             +GKSY+ FMLSKL+PVVGN+C+SDLG+D+ +  MIA++VD+IVNSAANT F ERYDVA+D
Sbjct  183   HGKSYETFMLSKLIPVVGNICDSDLGLDEASMSMIAQDVDVIVNSAANTNFHERYDVAID  242

Query  847   INTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQE  1026
             INT GP R+M FA +C KLKLFL VSTAYVNGQRQG+I+E+PF IGESI  E++VNGNQ 
Sbjct  243   INTRGPGRVMSFAKKCMKLKLFLQVSTAYVNGQRQGRIMERPFRIGESITKENLVNGNQP  302

Query  1027  SSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMID  1206
             +S P L+VE E+ +   + +   +  +AQKMKELGLERA K GWQDTYVFTKAMGEM++ 
Sbjct  303   NSRPNLDVEAELNLAYRSAEDFEENKVAQKMKELGLERARKHGWQDTYVFTKAMGEMLLG  362

Query  1207  NMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVV  1386
             +MRG++PVVI+RPSVIEST+++PFPGW+EGNRMMDP++ +YGKG L+GF VDPNGV+DVV
Sbjct  363   SMRGDVPVVILRPSVIESTYRDPFPGWIEGNRMMDPVVTYYGKGLLSGFPVDPNGVIDVV  422

Query  1387  PADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKG  1566
             PADMVVNATLAA+AKHG +GKP  S+Y +ASSVVNPL++ DL  LL+++F   P +D++G
Sbjct  423   PADMVVNATLAAIAKHGMSGKPEISVYQVASSVVNPLIYGDLGDLLHQYFTRWPCLDTQG  482

Query  1567  KPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLA  1746
             +PI+V   K + SM+  SSH+WR+ +     + +    GK S K+ENICRK+VEQAK+LA
Sbjct  483   RPINVEPFKFYGSMDDFSSHIWRETVRYISSSMIPSPNGKQSKKIENICRKAVEQAKHLA  542

Query  1747  SIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMK  1926
             S+YEPY+FYGGRFDNS+   LME MS EER  F F+V SI+W DYI ++HIPGLRRHVMK
Sbjct  543   SVYEPYSFYGGRFDNSSTSSLMESMSDEERRTFYFDVGSINWTDYICSIHIPGLRRHVMK  602

Query  1927  GRGSCS*GP  1953
             GRG  +  P
Sbjct  603   GRGQSAEQP  611



>ref|XP_006407385.1| hypothetical protein EUTSA_v10020305mg [Eutrema salsugineum]
 gb|ESQ48838.1| hypothetical protein EUTSA_v10020305mg [Eutrema salsugineum]
Length=620

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/571 (63%), Positives = 449/571 (79%), Gaps = 27/571 (5%)
 Frame = +1

Query  253   SNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVS  426
             S+++T    V    +++  MEA +L+L+PNGN +A   + A+     + A  VGMKE   
Sbjct  67    SSLLTDRGQVLIREQSSPAMEAETLVLSPNGNGRAIDINGATTLMPFNGAAMVGMKE---  123

Query  427   SYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVA  606
                     G+GI+ FL+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A
Sbjct  124   --------GLGIISFLQGKKFLITGSTGFLAKVLIEKVLRIAPDVGKIYLLIKAKNKEAA  175

Query  607   MERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVD  786
             +ERLK E++ AELF  L++T+G SYQ FML KL+PV GN+C+S++G++  +AE IAK+VD
Sbjct  176   IERLKNEVLDAELFNTLRETHGASYQSFMLDKLIPVTGNICDSNIGLEADSAEEIAKDVD  235

Query  787   IIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIE  966
             +I+NSAANTTF+ERYDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+E
Sbjct  236   VIINSAANTTFNERYDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIME  295

Query  967   KPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSA-KQGLSDGAMAQKMKELGLERA  1143
             KPF +GE IA E+ + GN+++    L+V+ EM++ L A ++G  D   AQKMK+LGLERA
Sbjct  296   KPFSMGECIATENFLEGNRKA----LDVDREMKLALDATRKGTQDQEEAQKMKDLGLERA  351

Query  1144  NKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIIL  1323
               +GWQDTYVFTKAMGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L
Sbjct  352   RSYGWQDTYVFTKAMGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVL  411

Query  1324  HYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNP  1494
              YGKGQLTGFLVDP GVLDVVPADMVVNATLAA+AKHG A    KP  ++Y IASS +NP
Sbjct  412   CYGKGQLTGFLVDPKGVLDVVPADMVVNATLAAIAKHGMATSDPKPEINVYQIASSAINP  471

Query  1495  LVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL----T  1662
             LVF+DLA LLY H++S P +DSKG PI V  MKLF+S++  S HLWRDA ++SGL    +
Sbjct  472   LVFEDLAELLYNHYKSTPCVDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMNGVS  531

Query  1663  ALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ  1842
             +  DS  K+  KL+ IC+KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+LME MS+EE+ +
Sbjct  532   SAADS--KMLQKLKFICKKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMENMSEEEKRE  589

Query  1843  FGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             FGF+V SI+WKDYI+NVHIPGLRRHV+KGR 
Sbjct  590   FGFDVGSINWKDYITNVHIPGLRRHVLKGRA  620



>ref|XP_010498380.1| PREDICTED: fatty acyl-CoA reductase 2 isoform X2 [Camelina sativa]
Length=534

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/549 (63%), Positives = 437/549 (80%), Gaps = 22/549 (4%)
 Frame = +1

Query  310   MEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVSSYVEKHEDGIGIVRFLRGK  483
             M+A +L+L+PNGN +    +        S A  VGMKE           G+GI+ FL+GK
Sbjct  1     MDAETLVLSPNGNGRTIEINGVKTLMPFSGAAMVGMKE-----------GLGIISFLQGK  49

Query  484   SFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQ  663
              FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A+ERLK E++ AELF  L++
Sbjct  50    KFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKNKEAAIERLKNEVLDAELFNTLRE  109

Query  664   TYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVAL  843
             T+G SY  FML+KL+PV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ERYDVAL
Sbjct  110   THGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAANTTFNERYDVAL  169

Query  844   DINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQ  1023
             DINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ + GN+
Sbjct  170   DINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENFLEGNR  229

Query  1024  ESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMM  1200
             ++    L+V+ EM++ L +A++G+ +   AQKMK+LGLERA  +GWQDTYVFTKAMGEMM
Sbjct  230   KA----LDVDKEMKLALEAARKGIQNQDEAQKMKDLGLERARSYGWQDTYVFTKAMGEMM  285

Query  1201  IDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLD  1380
             I+++RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP GVLD
Sbjct  286   INSIRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPKGVLD  345

Query  1381  VVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPY  1551
             VVPADMVVNATLAA+AKHG +    +P  ++Y IASS +NPLVF+DLA L Y H++S P 
Sbjct  346   VVPADMVVNATLAAIAKHGMSTTDPEPDINVYQIASSAINPLVFEDLAELFYNHYKSSPC  405

Query  1552  IDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENICRKSVE  1728
             +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + L  +  K+  KL+ IC+KSVE
Sbjct  406   MDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGLSSADSKMMQKLKFICKKSVE  465

Query  1729  QAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGL  1908
             QAK+LA+IYEPYTFYGGRFDNSN ++LME MS++E+ +FGF+V SI+WKDYI+NVHIPGL
Sbjct  466   QAKHLATIYEPYTFYGGRFDNSNTERLMEKMSEDEKREFGFDVGSINWKDYITNVHIPGL  525

Query  1909  RRHVMKGRG  1935
             RRHV+KGR 
Sbjct  526   RRHVLKGRA  534



>ref|XP_008776229.1| PREDICTED: uncharacterized protein LOC103696395 [Phoenix dactylifera]
Length=1209

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/586 (62%), Positives = 436/586 (74%), Gaps = 29/586 (5%)
 Frame = +1

Query  223   NNMVYCQGGGSNIVTTGRA-VDQASKAAALMEAGSLLLAPNGNAQaaaassasasasaaE  399
              N+V CQG G+     G   V     AAA +    ++ + N   +              +
Sbjct  42    TNIVRCQGNGNVRNPNGYPPVVTERPAAATVTEDHMVFSSNVKIR--------------K  87

Query  400   NVGMKELVS-----------SYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILR  546
             +VGM +L S           +YV    +GIGIVRFLRGK FLITG TGFLGKVLIEKILR
Sbjct  88    DVGMMDLTSYKETTAPGTSETYVS---EGIGIVRFLRGKKFLITGATGFLGKVLIEKILR  144

Query  547   TVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNV  726
             T  DV KIY+LIKA +KE AMERLK EI++ ELF+ LK+ +G +YQ FML KL+PVVGNV
Sbjct  145   TNTDVSKIYVLIKAKDKEAAMERLKCEIVNTELFRCLKEIHGSNYQAFMLRKLIPVVGNV  204

Query  727   CESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLK  906
              E++LG++   A+ I++EVD+I+NSAANTTFDERYDVALDINT GP R+M FA +  +LK
Sbjct  205   REANLGLEAGLADKISEEVDVIINSAANTTFDERYDVALDINTIGPCRIMSFAKRFKRLK  264

Query  907   LFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQ  1086
             LFLHVSTAYVNGQRQG+I+EKPF IG+++A E+  +     S P L++E E+++ L +K+
Sbjct  265   LFLHVSTAYVNGQRQGRILEKPFLIGDTLATETSFSEFSAKSTPLLDIETEIKLALDSKK  324

Query  1087  GLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTH  1266
                  +  Q+MK+LGLERA   GWQDTYVFTKAMGEM+++ MRG+IPVV +RPSVIES  
Sbjct  325   TSHYSSTTQEMKDLGLERAKIHGWQDTYVFTKAMGEMVVNCMRGDIPVVTIRPSVIESAC  384

Query  1267  KEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG  1446
             KEPFPGWMEGNRMMDPI+L+YGKGQLTGFL DPNGVLDVVP DMVVNATLAAMAKHG++ 
Sbjct  385   KEPFPGWMEGNRMMDPIVLYYGKGQLTGFLADPNGVLDVVPVDMVVNATLAAMAKHGSSR  444

Query  1447  KPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSH  1626
             +PG  IY IASSV+NPLVF DLARLL+EHF++ P +D KG+PI V  MKLFS M   SS+
Sbjct  445   EPGMHIYQIASSVINPLVFKDLARLLFEHFKTFPCMDPKGRPITVHPMKLFSDMNEFSSY  504

Query  1627  LWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQK  1806
             +W DA  +SG      S  KLS +L+N C KSVEQAKYLA+IYEPYTFYGGRFDN+N QK
Sbjct  505   VWMDASQRSGRVTAAISHEKLSKRLQNKCMKSVEQAKYLANIYEPYTFYGGRFDNANTQK  564

Query  1807  LMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             LME MS+EER  F F V SI WKDYISNVHIPGLRRHVMKGRG C+
Sbjct  565   LMEEMSEEERTSFDFNVGSISWKDYISNVHIPGLRRHVMKGRGMCT  610



>ref|XP_008442196.1| PREDICTED: fatty acyl-CoA reductase 2 isoform X1 [Cucumis melo]
Length=557

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/570 (61%), Positives = 421/570 (74%), Gaps = 50/570 (9%)
 Frame = +1

Query  229   MVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAP-NGNAQaaaassasasasaaENV  405
             +V C G     ++T R    +    A   A S++LAP NG +               + +
Sbjct  32    VVACSGALKPSISTERVSSSSVVVRA---AESVVLAPPNGKS---------------DEI  73

Query  406   GMKELVSSYVEKHEDG-IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILI  582
              +K LV  YV+  EDG IGIV+FLRGK F ITG TGFLGKVLIEKILRT PDV KIY+LI
Sbjct  74    AVKSLVP-YVDMDEDGGIGIVKFLRGKVFFITGATGFLGKVLIEKILRTAPDVGKIYVLI  132

Query  583   KADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA  762
             KA ++E A ERLK +II+ +LFK L+Q +GK Y  FM+SKL+PVVGNVCESD+G+    +
Sbjct  133   KAKDEEAAAERLKNDIINTQLFKCLRQIHGKYYMSFMMSKLIPVVGNVCESDVGLHVDFS  192

Query  763   EMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNG  942
              +IA +VD+IVNSAANTTFDERYDVA+DINT GP+ LM+FA +C KLKLFL +STAYVNG
Sbjct  193   HLIANDVDVIVNSAANTTFDERYDVAIDINTKGPSNLMEFAKKCSKLKLFLQISTAYVNG  252

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             QRQG+I+EKPFC                    +L+VE EM++         D  M Q MK
Sbjct  253   QRQGRIMEKPFC-------------------KELDVESEMKL------AFEDNGMGQNMK  287

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELGL+RA ++GWQDTYVFTKAMGEM+ID MRG +PV I+RPSVIEST K+PFPGWMEGNR
Sbjct  288   ELGLQRAKRYGWQDTYVFTKAMGEMVIDEMRGEVPVAIIRPSVIESTFKDPFPGWMEGNR  347

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
             MMDPI+L+YGKGQLTGFLVDPNGV+DVVPADMVVNATLAAMA+HG A +P  +IYH+ASS
Sbjct  348   MMDPIVLYYGKGQLTGFLVDPNGVIDVVPADMVVNATLAAMARHGRAPRPSMNIYHVASS  407

Query  1483  VVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT  1662
             V NPLVF  LA LL++H+ S P +D  G PI VP MKLF S++  S+HLW+DA  +   T
Sbjct  408   VANPLVFHRLADLLHQHYDSSPCLDVDGTPIRVPSMKLFDSVDDFSNHLWQDAARRCAST  467

Query  1663  ALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ  1842
                   GKLS KLE IC+K+VEQ K+LA IY+PYTF+ GRFDNSN Q LME MS+EE+ +
Sbjct  468   P----DGKLSKKLEAICKKTVEQLKHLADIYQPYTFFNGRFDNSNVQGLMEIMSEEEKRE  523

Query  1843  FGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             FGF+VESIDWKDYI+NVHIPGLRRHVMKG+
Sbjct  524   FGFDVESIDWKDYITNVHIPGLRRHVMKGK  553



>ref|XP_006299443.1| hypothetical protein CARUB_v10015607mg [Capsella rubella]
 gb|EOA32341.1| hypothetical protein CARUB_v10015607mg [Capsella rubella]
Length=618

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/553 (63%), Positives = 437/553 (79%), Gaps = 22/553 (4%)
 Frame = +1

Query  298   AAALMEAGSLLLAPNGNAQaaaassasasasaaEN--VGMKELVSSYVEKHEDGIGIVRF  471
             ++  ++A +L+L+PNGN +    +        ++   VGMKE           G+GI+ F
Sbjct  81    SSPAVDAETLVLSPNGNGRTIEINGVKTLMPFSDAAMVGMKE-----------GLGIISF  129

Query  472   LRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFK  651
             L+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A+ERLK E++ AELF 
Sbjct  130   LQGKKFLITGSTGFLAKVLIEKVLRIAPDVSKIYLLIKAKNKEAAIERLKNEVLDAELFN  189

Query  652   FLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERY  831
              L++T+G SY  FML+KL+PV GN+C+SD+G+   +AE IAKEVD+I+NSAANTTF+ERY
Sbjct  190   TLRETHGSSYMSFMLTKLIPVTGNICDSDIGLQADSAEEIAKEVDVIINSAANTTFNERY  249

Query  832   DVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVV  1011
             DVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ +
Sbjct  250   DVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENFI  309

Query  1012  NGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAM  1188
              GN+++    L+V+ EME+ L +A +G  +   AQKMK+LGLERA  +GWQDTYVFTKAM
Sbjct  310   EGNRKA----LDVDREMELALEAATKGAQNQDEAQKMKDLGLERARSYGWQDTYVFTKAM  365

Query  1189  GEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPN  1368
             GEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP 
Sbjct  366   GEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPK  425

Query  1369  GVLDVVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNPLVFDDLARLLYEHFQ  1539
             GVLDVVPADMVVNATLAA+AKHG +    +P  ++Y IASS +NPLVF++LA LLY H++
Sbjct  426   GVLDVVPADMVVNATLAAIAKHGMSTTDPEPEINVYQIASSAINPLVFEELAELLYNHYK  485

Query  1540  SKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENICR  1716
             S P +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + +  +  K+  KL+ IC+
Sbjct  486   SSPCMDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSADSKMMQKLKFICK  545

Query  1717  KSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVH  1896
             KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+LME MS++E+ +FGF+V SI+WKDYI+NVH
Sbjct  546   KSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMEKMSEDEKREFGFDVGSINWKDYITNVH  605

Query  1897  IPGLRRHVMKGRG  1935
             IPGLRRHV+KGR 
Sbjct  606   IPGLRRHVLKGRA  618



>ref|XP_004144700.1| PREDICTED: fatty acyl-CoA reductase 2-like [Cucumis sativus]
 gb|KGN54850.1| hypothetical protein Csa_4G551130 [Cucumis sativus]
Length=559

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/572 (61%), Positives = 418/572 (73%), Gaps = 52/572 (9%)
 Frame = +1

Query  229   MVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAP-NGNAQaaaassasasasaaENV  405
             +V C G     ++T R    +    A   A S++LAP NG +               + +
Sbjct  32    VVACSGALKPSISTERVSSSSVVVRA---AESVVLAPPNGKS---------------DEI  73

Query  406   GMKELVSSYVEKHED---GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYI  576
             G+K LV  YV+  ED   GIGIV+FLRGK F ITG TGFL KVLIEKILRT PDV KIY+
Sbjct  74    GVKSLVP-YVDLDEDEDGGIGIVKFLRGKVFFITGATGFLAKVLIEKILRTAPDVGKIYV  132

Query  577   LIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDH  756
             LIKA ++E A +RLK +II+A+LFK L+Q +GK Y  FM SKL+PVVGNVCESD+GI   
Sbjct  133   LIKAKDEEAAADRLKNDIINAQLFKCLRQIHGKYYMSFMTSKLIPVVGNVCESDVGIHVD  192

Query  757   TAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYV  936
              A +IA +VD+IVNSAANTTFDERYDVA+DINT GP+ LM+FA +C KLKLFL +STAYV
Sbjct  193   FAHLIASDVDVIVNSAANTTFDERYDVAIDINTKGPSNLMEFAKKCSKLKLFLQISTAYV  252

Query  937   NGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK  1116
             NGQRQG+I+EKPFC                    +L+VE EM++            M Q 
Sbjct  253   NGQRQGRIMEKPFC-------------------KELDVESEMKLAFEGN------GMGQN  287

Query  1117  MKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEG  1296
             MKELGLERA ++GWQDTYVFTKAMGEM+ID MRG +PV I+RPSVIEST K+PFPGWMEG
Sbjct  288   MKELGLERAKRYGWQDTYVFTKAMGEMVIDEMRGEVPVAIIRPSVIESTFKDPFPGWMEG  347

Query  1297  NRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIA  1476
             NRMMDPI+L+YGKGQLTGFLVDPNGV+DVVPADMVVNATLAAMA+HG A +P  +IYH+A
Sbjct  348   NRMMDPIVLYYGKGQLTGFLVDPNGVIDVVPADMVVNATLAAMARHGRAPRPSMNIYHVA  407

Query  1477  SSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSG  1656
             SSV NPLVF+ LA LL++H+ S P +D  G PI V  MKLF S++  S HLWRDA  +  
Sbjct  408   SSVANPLVFNRLADLLHQHYNSSPCLDVDGTPIRVSSMKLFDSVDDFSEHLWRDAARRCA  467

Query  1657  LTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEER  1836
              T      GKLS KLE IC+K+VEQ KYLA IY+PYTF+ GRFDNSN Q LME MS+EE+
Sbjct  468   STP----DGKLSKKLEAICKKTVEQLKYLAHIYQPYTFFNGRFDNSNVQGLMEIMSEEEK  523

Query  1837  WQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
              +FGF+VE+IDW DYI+NVHIPGLRRHVMKG+
Sbjct  524   REFGFDVENIDWTDYITNVHIPGLRRHVMKGK  555



>ref|XP_009121004.1| PREDICTED: fatty acyl-CoA reductase 2 [Brassica rapa]
 gb|ABO14927.1| male sterility 2 [Brassica rapa subsp. chinensis]
Length=616

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/554 (63%), Positives = 436/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPN--GNAQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PN  G A            + A  VG+K+           G+GIV 
Sbjct  78    QSSPAMDAETLVLSPNVNGTAIEMNGVKTLMPFNGAAMVGIKQ-----------GLGIVS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             +L+GK+FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A++RLK E++ AELF
Sbjct  127   YLQGKTFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLIKAKNKEAAIQRLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             K L++T+G SYQ FML KLVPV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   KNLRETHGASYQSFMLDKLVPVTGNICDSNIGLQTDSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ 
Sbjct  247   YDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+++ EM++ L +A++G  D   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   MEGNRKA----LDIDKEMKLALDAARKGTQDQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAKADTEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             +S P +DSKG PI VP MKLF S++  S HLWRDA ++SGL   +  S  K+  KL+ IC
Sbjct  483   KSTPCMDSKGVPIRVPLMKLFDSVDDFSDHLWRDAQERSGLMNGMDSSDSKILQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KS+EQAK+LA+IYEPYTFYGGRFDNSN  +LME MS+EE+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSIEQAKHLATIYEPYTFYGGRFDNSNTHRLMENMSEEEKLEFGFDVGSINWNDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>ref|XP_010498364.1| PREDICTED: fatty acyl-CoA reductase 2 isoform X1 [Camelina sativa]
 ref|XP_010498373.1| PREDICTED: fatty acyl-CoA reductase 2 isoform X1 [Camelina sativa]
Length=616

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/549 (63%), Positives = 437/549 (80%), Gaps = 22/549 (4%)
 Frame = +1

Query  310   MEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVSSYVEKHEDGIGIVRFLRGK  483
             M+A +L+L+PNGN +    +        S A  VGMKE           G+GI+ FL+GK
Sbjct  83    MDAETLVLSPNGNGRTIEINGVKTLMPFSGAAMVGMKE-----------GLGIISFLQGK  131

Query  484   SFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQ  663
              FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A+ERLK E++ AELF  L++
Sbjct  132   KFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKNKEAAIERLKNEVLDAELFNTLRE  191

Query  664   TYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVAL  843
             T+G SY  FML+KL+PV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ERYDVAL
Sbjct  192   THGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAANTTFNERYDVAL  251

Query  844   DINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQ  1023
             DINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ + GN+
Sbjct  252   DINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENFLEGNR  311

Query  1024  ESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMM  1200
             ++    L+V+ EM++ L +A++G+ +   AQKMK+LGLERA  +GWQDTYVFTKAMGEMM
Sbjct  312   KA----LDVDKEMKLALEAARKGIQNQDEAQKMKDLGLERARSYGWQDTYVFTKAMGEMM  367

Query  1201  IDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLD  1380
             I+++RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP GVLD
Sbjct  368   INSIRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPKGVLD  427

Query  1381  VVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPY  1551
             VVPADMVVNATLAA+AKHG +    +P  ++Y IASS +NPLVF+DLA L Y H++S P 
Sbjct  428   VVPADMVVNATLAAIAKHGMSTTDPEPDINVYQIASSAINPLVFEDLAELFYNHYKSSPC  487

Query  1552  IDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENICRKSVE  1728
             +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + L  +  K+  KL+ IC+KSVE
Sbjct  488   MDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGLSSADSKMMQKLKFICKKSVE  547

Query  1729  QAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGL  1908
             QAK+LA+IYEPYTFYGGRFDNSN ++LME MS++E+ +FGF+V SI+WKDYI+NVHIPGL
Sbjct  548   QAKHLATIYEPYTFYGGRFDNSNTERLMEKMSEDEKREFGFDVGSINWKDYITNVHIPGL  607

Query  1909  RRHVMKGRG  1935
             RRHV+KGR 
Sbjct  608   RRHVLKGRA  616



>ref|XP_010464945.1| PREDICTED: fatty acyl-CoA reductase 2-like [Camelina sativa]
 ref|XP_010464946.1| PREDICTED: fatty acyl-CoA reductase 2-like [Camelina sativa]
Length=616

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/549 (63%), Positives = 437/549 (80%), Gaps = 22/549 (4%)
 Frame = +1

Query  310   MEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVSSYVEKHEDGIGIVRFLRGK  483
             M+A SL+L+PNGN +    +        S A  VGMKE           G+GI+ FL+GK
Sbjct  83    MDAESLVLSPNGNGRTIEINGVKTLIPFSGAAMVGMKE-----------GLGIISFLQGK  131

Query  484   SFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQ  663
              FLITG TGFL KVLIEK+LR  PDV KIY+LIKA +KE A+ERLK E++ AELF  L++
Sbjct  132   KFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKSKEAAIERLKNEVLDAELFNTLRE  191

Query  664   TYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVAL  843
             T+G SY  FML+KL+PV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ERYDVAL
Sbjct  192   THGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAANTTFNERYDVAL  251

Query  844   DINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQ  1023
             DINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ + GN+
Sbjct  252   DINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENFLEGNR  311

Query  1024  ESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMM  1200
             ++    L+V+ EM++ L +A++G+ +   AQKMK+LGLERA  +GWQDTYVFTKAMGEMM
Sbjct  312   KA----LDVDREMKLALEAARKGIQNQDEAQKMKDLGLERARSYGWQDTYVFTKAMGEMM  367

Query  1201  IDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLD  1380
             I++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP GVLD
Sbjct  368   INSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPKGVLD  427

Query  1381  VVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPY  1551
             VVPADMVVNATLAA+AKHG +    +P  ++Y IASS +NPLVF+DLA LLY H++S P 
Sbjct  428   VVPADMVVNATLAAIAKHGMSTTDPEPDINVYQIASSAINPLVFEDLAELLYNHYKSSPC  487

Query  1552  IDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENICRKSVE  1728
             +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + +  +  K+  KL+ IC+KSVE
Sbjct  488   MDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSADSKMMQKLKFICKKSVE  547

Query  1729  QAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGL  1908
             QAK+LA+IYEPYTFYGGRFDNSN ++LME MS++E+ +FGF+V SI+WKDYI+NVHIPGL
Sbjct  548   QAKHLATIYEPYTFYGGRFDNSNTERLMEKMSEDEKREFGFDVGSINWKDYITNVHIPGL  607

Query  1909  RRHVMKGRG  1935
             RRHV+KGR 
Sbjct  608   RRHVLKGRA  616



>emb|CAA52019.1| male sterility 2 (MS2) protein [Arabidopsis thaliana]
 prf||1916413A male sterility 2 gene
Length=616

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/554 (63%), Positives = 438/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PNGN +    +        S A  VGMKE           G+GI+ 
Sbjct  78    QSSPAMDAETLVLSPNGNGRTIEINGVKTLMPFSGASMVGMKE-----------GLGIIS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             FL+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA +KE A+ERLK E++ AELF
Sbjct  127   FLQGKKFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKSKEAAIERLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
               LK+T+G SY  FML+KL+PV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   NTLKETHGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ 
Sbjct  247   YDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+V+ EM++ L +A++G  +   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   LEGNRKA----LDVDREMKLALEAARKGTQNQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAMSDPEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             ++ P +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + +  +  K+  KL+ IC
Sbjct  483   KTSPCMDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSADSKMMQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+LME MS++E+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMENMSEDEKREFGFDVGSINWTDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>ref|XP_002882759.1| hypothetical protein ARALYDRAFT_478549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59018.1| hypothetical protein ARALYDRAFT_478549 [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/554 (63%), Positives = 436/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PNGN +    +        S A  VGMKE           G+GI+ 
Sbjct  78    QSSPAMDAETLVLSPNGNGRTIEINGVKTLMPFSGAAMVGMKE-----------GLGIIS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             FL+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A+ERLK E++ AELF
Sbjct  127   FLQGKKFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKNKEAAIERLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
               LK+T+G SY  FML+KL+PV GN+C+SD+G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   NSLKETHGASYMSFMLTKLIPVTGNICDSDIGLQADSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+E PF +G+ IA E+ 
Sbjct  247   YDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEMPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+V+ EM++ L +A++G  +   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   LEGNRKA----LDVDREMKLALEAARKGTQNQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAMSDPEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             +S P +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + +     K+  KL+ IC
Sbjct  483   KSSPCMDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSVDNKMMQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+LME MS++E+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMEKMSEDEKREFGFDVGSINWTDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>emb|CAA68190.1| male sterility protein 2 [Brassica napus]
 gb|AAP81865.1| male sterility protein 2 [Brassica napus]
Length=616

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/554 (62%), Positives = 436/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPN--GNAQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PN  G A            + A+ VG+K+           G+GIV 
Sbjct  78    QSSPAMDAETLVLSPNVNGTAIEMNGVKTLMPFNGADMVGIKQ-----------GLGIVS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             +L+GK+FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A++RLK E++ AELF
Sbjct  127   YLQGKTFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLIKAKNKEAAIQRLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             K L++T+G S+  FML KLVPV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   KNLRETHGASFMSFMLDKLVPVTGNICDSNIGLQTDSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ 
Sbjct  247   YDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+++ EM++ L +A++G  D   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   MEGNRKA----LDIDKEMKLALDAARKGTQDQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAKADTEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             +S P +DSKG PI VP MKLF S++  S HLWRDA ++SGL   +  S  K+  KL+ IC
Sbjct  483   KSTPCMDSKGVPIRVPLMKLFDSVDDFSDHLWRDAQERSGLMNGMDSSDSKILQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KS+EQAK+LA+IYEPYTFYGGRFDNSN  +LME MS+EE+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSIEQAKHLATIYEPYTFYGGRFDNSNTHRLMENMSEEEKLEFGFDVGSINWNDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>ref|NP_187805.1| fatty acyl-CoA reductase 2 [Arabidopsis thaliana]
 sp|Q08891.2|FACR2_ARATH RecName: Full=Fatty acyl-CoA reductase 2; AltName: Full=Fatty 
acid reductase 2; AltName: Full=Male sterility protein 2 [Arabidopsis 
thaliana]
 gb|AAG51054.1|AC069473_16 male sterility protein 2 (MS2); 67648-65205 [Arabidopsis thaliana]
 dbj|BAB03110.1| male sterility protein 2 [Arabidopsis thaliana]
 gb|ABZ10952.1| fatty acyl CoA reductase [Arabidopsis thaliana]
 gb|AEE75132.1| fatty acyl-CoA reductase 2 [Arabidopsis thaliana]
Length=616

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/554 (63%), Positives = 437/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPNGNAQaaaassasasa--saaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PNGN +    +        S A  VGMKE           G+GI+ 
Sbjct  78    QSSPAMDAETLVLSPNGNGRTIEINGVKTLMPFSGASMVGMKE-----------GLGIIS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             FL+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA +KE A+ERLK E++ AELF
Sbjct  127   FLQGKKFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKSKEAAIERLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
               LK+T+G SY  FML+KL+PV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   NTLKETHGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ 
Sbjct  247   YDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+V+ EM++ L +A++G  +   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   LEGNRKA----LDVDREMKLALEAARKGTQNQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAMSDPEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             ++ P +DSKG PI V  MKLF+S++  S HLWRDA ++SGL + +     K+  KL+ IC
Sbjct  483   KTSPCMDSKGDPIMVRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSVDSKMMQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+LME MS++E+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMENMSEDEKREFGFDVGSINWTDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>gb|AAZ06658.1| male sterility protein 2-2 [Brassica napus]
 gb|AAZ06659.1| male sterility protein 2-2 [Brassica napus]
Length=616

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/554 (62%), Positives = 436/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPN--GNAQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PN  G A            + A+ VG+K+           G+GIV 
Sbjct  78    QSSPAMDAETLVLSPNVNGTAIEMNGVKTLMPFNGADMVGIKQ-----------GLGIVS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             +L+GK+FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A++RLK E++ AELF
Sbjct  127   YLQGKTFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLIKAKNKEAAIQRLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             K L++T+G S+  FML KLVPV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   KNLRETHGASFMSFMLDKLVPVTGNICDSNIGLQTDSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ 
Sbjct  247   YDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+++ EM++ L +A++G  D   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   MEGNRKA----LDIDKEMKLALDAARKGTQDQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAKADTEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             +S P +DSKG PI VP MKLF S++  S HLWRDA ++SGL   +  S  K+  KL+ IC
Sbjct  483   KSTPCMDSKGVPIRVPLMKLFDSVDDFSDHLWRDAQERSGLMNGMDSSDSKILQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KS+EQAK+LA+IYEPYTFYGGRFDNSN  +LME MS+EE+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSIEQAKHLATIYEPYTFYGGRFDNSNTHRLMENMSEEEKVEFGFDVGSINWNDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>gb|AAQ81302.2| male sterility protein 2-1 mutant [Brassica napus]
Length=616

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/554 (62%), Positives = 435/554 (79%), Gaps = 22/554 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPN--GNAQaaaassasasasaaENVGMKELVSSYVEKHEDGIGIVR  468
             +++  M+A +L+L+PN  G A            + A+ VG+K+           G+GIV 
Sbjct  78    QSSPAMDAETLVLSPNVNGTAIEMNGVKTLMPFNGADMVGIKQ-----------GLGIVS  126

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             +L+GK+FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A++RLK E++ AELF
Sbjct  127   YLQGKTFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLIKAKNKEAAIQRLKNEVLDAELF  186

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             K L++T+G S+  FML KLVPV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+ER
Sbjct  187   KNLRETHGASFMSFMLDKLVPVTGNICDSNIGLQTDSAEEIAKEVDVIINSAANTTFNER  246

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVALDI T GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E+ 
Sbjct  247   YDVALDITTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENF  306

Query  1009  VNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             + GN+++    L+++ EM++ L +A++G  D   AQKMK+LGLERA  +GWQDTYVFTKA
Sbjct  307   MEGNRKA----LDIDKEMKLALDAARKGTQDQDEAQKMKDLGLERARSYGWQDTYVFTKA  362

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLVDP
Sbjct  363   MGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDP  422

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAA---GKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              GVLDVVPADMVVNATLAA+AKHG A    +P  ++Y IASS +NPLVF+DLA LLY H+
Sbjct  423   KGVLDVVPADMVVNATLAAIAKHGMAKADTEPEINVYQIASSAINPLVFEDLAELLYNHY  482

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENIC  1713
             +S P +DSKG PI VP MKLF S++  S HLWRDA ++SGL   +  S  K+  KL+ IC
Sbjct  483   KSTPCMDSKGVPIRVPLMKLFDSVDDFSDHLWRDAQERSGLMNGMDSSDSKILQKLKFIC  542

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNV  1893
             +KS+EQAK+LA+IYEPYTFYGGRFDNSN  +LME MS+EE+ +FGF+V SI+W DYI+NV
Sbjct  543   KKSIEQAKHLATIYEPYTFYGGRFDNSNTHRLMENMSEEEKLEFGFDVGSINWNDYITNV  602

Query  1894  HIPGLRRHVMKGRG  1935
             HIPGLRRHV+KGR 
Sbjct  603   HIPGLRRHVLKGRA  616



>ref|XP_011039510.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X2 [Populus 
euphratica]
Length=556

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/552 (63%), Positives = 415/552 (75%), Gaps = 38/552 (7%)
 Frame = +1

Query  178   CFVVSKHRLCLPLRINNMVYCQGGGSNI--------VTTGRA--VDQASKAAALMEAGSL  327
             CF+  + R       N  V+CQGGG           V T R+  V      A++ ++GSL
Sbjct  26    CFLRWRKR-------NVAVHCQGGGGKAIRSSGFPSVLTERSAVVSDQEHIASVRDSGSL  78

Query  328   LLAPNGNAQaaaassasasasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSF  489
             +L+PN   Q                + +K+LV      SS + + +DGIGIV+FLRGK F
Sbjct  79    VLSPNEKGQ--------------PEIAVKDLVPYGGPTSSSLLEMQDGIGIVKFLRGKGF  124

Query  490   LITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTY  669
              I+G TGFL KVLIEKILRT+PDV KIY+LIKA++KE A+ RLK EII+AELFK L+QT+
Sbjct  125   FISGATGFLAKVLIEKILRTMPDVGKIYVLIKAESKEAAIARLKNEIINAELFKCLRQTH  184

Query  670   GKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDI  849
             GKSYQ FML+KLVPVVGNVCES+LG+++  A+ IA EVDII+NSAANTTFDERYDVA+D+
Sbjct  185   GKSYQSFMLNKLVPVVGNVCESNLGLEEDLADKIANEVDIIINSAANTTFDERYDVAIDV  244

Query  850   NTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGES-VVNGNQE  1026
             NT G   LM+FA +C KLKLFL VSTAYVNGQRQG+I+EKPF  G+ +A E+ +++ +  
Sbjct  245   NTRGTCHLMRFAKKCQKLKLFLQVSTAYVNGQRQGRIMEKPFLFGDCLARENLIISESTP  304

Query  1027  SSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMID  1206
                P L++E EM + L +K+   +  +AQKMKELGLERA K GWQDTYVFTKAMGEM++D
Sbjct  305   RLAPALDIEHEMNLALDSKEAFQENEVAQKMKELGLERARKHGWQDTYVFTKAMGEMVVD  364

Query  1207  NMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVV  1386
             NMRG+IPVV++RPSVIEST KEPFPGWMEGNRMMDPI+L+YGKGQLTGFLVDPNGVLDVV
Sbjct  365   NMRGDIPVVVIRPSVIESTCKEPFPGWMEGNRMMDPIVLYYGKGQLTGFLVDPNGVLDVV  424

Query  1387  PADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKG  1566
             PADMVVNATLAAMA HG   KP  ++Y IASSVVNPLVF DLA LL+EH+ S PY+DS G
Sbjct  425   PADMVVNATLAAMAWHGMEQKPDINVYQIASSVVNPLVFQDLATLLHEHYNSSPYMDSNG  484

Query  1567  KPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLA  1746
             +PI VP MKLFSSME  S+HLWR    +S L  +  S  KLS K EN+CRKSVEQAKYLA
Sbjct  485   RPIHVPSMKLFSSMEEFSAHLWRYVTQRSRLAGMATSDRKLSQKHENLCRKSVEQAKYLA  544

Query  1747  SIYEPYTFYGGR  1782
             SIYEPYTFYGGR
Sbjct  545   SIYEPYTFYGGR  556



>emb|CDY01079.1| BnaC05g41210D [Brassica napus]
Length=612

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/585 (61%), Positives = 452/585 (77%), Gaps = 38/585 (6%)
 Frame = +1

Query  211   PLRINNMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasasas  390
             PLR+++++  +G           V    +++  ++A +L+++PNGN +A           
Sbjct  56    PLRVSSLLKDRG----------QVLIREQSSPAVDADTLVVSPNGNERAI----------  95

Query  391   aaENVGMKELVS-SYVEK--HEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDV  561
               E  G+K L+  S   K   ++G+GIV FL+GK FLITG TGFL KVLIEK+LR  PDV
Sbjct  96    --EINGVKTLMPFSGAAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDV  153

Query  562   HKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDL  741
              KIY+LIKA NKE A+ RLK E++  ELFK L++T+G SYQ FML KLVPV GN+C+S++
Sbjct  154   GKIYLLIKAKNKEAAIARLKSEVLDTELFKTLRETHGASYQSFMLDKLVPVTGNICDSNI  213

Query  742   GIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHV  921
             G+   +AE IAKEVD+I+NSAANTTF+ERYDVALDINT GP  LM FA +C KLKLFL V
Sbjct  214   GLQIDSAEEIAKEVDVIINSAANTTFNERYDVALDINTRGPGNLMGFAKKCKKLKLFLQV  273

Query  922   STAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVL-SAKQGLSD  1098
             STAYVNGQRQG+I+EKPF +G+ IA E+ + GN+++    L+V+ EM++ L +A++G  D
Sbjct  274   STAYVNGQRQGRIMEKPFSMGDCIATENFLEGNRKA----LDVDREMKLALDAARKGTQD  329

Query  1099  GAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPF  1278
                AQKMK+LGLERA  +GWQDTYVFTKAMGEMMI++ RG++PVVI+RPSVIEST+K+PF
Sbjct  330   QEKAQKMKDLGLERARSYGWQDTYVFTKAMGEMMINSTRGDVPVVIIRPSVIESTYKDPF  389

Query  1279  PGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG---K  1449
             PGWMEGNRMMDPI+L YGKGQLTGFLVDP GVLDVVPADMVVNATLAA+AKHG A    +
Sbjct  390   PGWMEGNRMMDPIVLCYGKGQLTGFLVDPKGVLDVVPADMVVNATLAAIAKHGVAKTDQE  449

Query  1450  PGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL  1629
             P  ++Y IASS +NPLVF++LA LLY H++S P +DSKG PI VP MKLF S++  S HL
Sbjct  450   PEINVYQIASSAINPLVFENLAELLYNHYKSTPCMDSKGVPIMVPLMKLFDSVDDFSDHL  509

Query  1630  WRDAIDKSGL---TALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNA  1800
             W+DA ++SGL    +L DS  K+  KL+ IC+KSVEQAK+LA+IYEPYTFYGGRFDNSN 
Sbjct  510   WKDAQERSGLMNGVSLADS--KMLQKLKFICKKSVEQAKHLATIYEPYTFYGGRFDNSNT  567

Query  1801  QKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             Q+L+E MS+ E+ +FGF+V +I+WKDYI+NVHIPGLR+HV+KGR 
Sbjct  568   QRLLEYMSEAEKNEFGFDVGNINWKDYITNVHIPGLRKHVLKGRA  612



>ref|XP_010557956.1| PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana]
Length=617

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/496 (67%), Positives = 410/496 (83%), Gaps = 7/496 (1%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             ++G+GI+ +L+GK FLITG TGFL KVLIEKILR  PDV +IY+LIKA++KE A+ERLK 
Sbjct  128   KEGLGIINYLQGKRFLITGATGFLAKVLIEKILRMAPDVGRIYLLIKAESKEAAVERLKN  187

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             E++ AELFK L++T+G SY+ FMLSKLVPV GN+C+SD+  ++  AE IA++VD+I+NSA
Sbjct  188   EVLDAELFKILRETHGPSYKPFMLSKLVPVPGNICDSDILPENFAAE-IARDVDVIINSA  246

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             ANTTF+ERYD+AL INT GP  LM+FA +C  LKLFL VSTAYVNGQRQG+I+EKPF +G
Sbjct  247   ANTTFNERYDIALGINTRGPCNLMRFAKKCKNLKLFLQVSTAYVNGQRQGRIMEKPFSMG  306

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
             + IA E + NG        L+V+ E+++   A+ G  D     KMKELGLERA  +GWQD
Sbjct  307   DCIATE-ISNGTD-----LLDVDKELKLASDARNGFQDHEEVHKMKELGLERARTYGWQD  360

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEMMI+++RG++P+VI+RPSVIEST+++PFPGWMEGNRMMDPI+L YGKGQL
Sbjct  361   TYVFTKAMGEMMINSIRGDVPLVIIRPSVIESTYRDPFPGWMEGNRMMDPIVLCYGKGQL  420

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
             TGFLVDP GVLDVVPADMVVNATLAA+AKHG   +P T++Y IASSV+NPLVF+DLA LL
Sbjct  421   TGFLVDPKGVLDVVPADMVVNATLAAIAKHGTGPEPETNVYQIASSVINPLVFEDLAVLL  480

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE  1704
             Y+H++S P +DSKG PI V  MKLF S E  S HLW+D  ++SGLTA   S GK+  KLE
Sbjct  481   YQHYKSSPCVDSKGTPITVRLMKLFDSAEDFSDHLWKDVRERSGLTATSSSDGKMMQKLE  540

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYI  1884
              +CRKSVEQAKYLA+IY+PYTFYGGRFDNSN Q+LME MS+EER +FGF+V SI+W+DYI
Sbjct  541   FVCRKSVEQAKYLAAIYKPYTFYGGRFDNSNMQRLMESMSEEERREFGFDVGSINWRDYI  600

Query  1885  SNVHIPGLRRHVMKGR  1932
             +NVHIPGLRRHV+KGR
Sbjct  601   TNVHIPGLRRHVLKGR  616



>gb|KHG30561.1| Fatty acyl-CoA reductase 2 [Gossypium arboreum]
Length=601

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/556 (63%), Positives = 416/556 (75%), Gaps = 61/556 (11%)
 Frame = +1

Query  223   NNMVYCQG-GGSNIVTTG---------RAVDQASKAAALMEAGSLLLAPNGNAQaaaass  372
             ++ V+CQG GG  I T G         + V+   ++AALM+AGSL+++PN          
Sbjct  30    SSFVHCQGSGGKAIKTAGVSSVVKERSKMVNGGDRSAALMDAGSLIVSPN----------  79

Query  373   asasasaaENVGMKELV------SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIE  534
                      ++ +K+LV      +S VE  +DGIGIV+FLRGK F ITG TGFL KVLIE
Sbjct  80    -------QADIAVKDLVPYGGSTTSLVEL-QDGIGIVKFLRGKEFFITGSTGFLAKVLIE  131

Query  535   KILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPV  714
             KILRTVPDV KI++L+KA +KE AMERLK EII+AELF  L+QTYG SYQ FMLSKLVPV
Sbjct  132   KILRTVPDVGKIFVLVKAKSKEAAMERLKTEIINAELFNCLQQTYGNSYQSFMLSKLVPV  191

Query  715   VGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQC  894
             VGNVCESDLG+DD  A +I+KEVDIIVNSAANTTFDERYDVA+DINT G + LM      
Sbjct  192   VGNVCESDLGLDDELANLISKEVDIIVNSAANTTFDERYDVAMDINTKGASHLM------  245

Query  895   HKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVL  1074
                        AYVNGQRQG+++EKPF IG+ IA E+++      S+P+L++E+E  +  
Sbjct  246   -----------AYVNGQRQGRVMEKPFDIGDCIARENLIAETTPRSIPELDIEEEFGLAR  294

Query  1075  SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVI  1254
               K+G  +  +AQKMKELGL+RA K+GWQDTYVFTKAMGEMMI+NMRG IPVVI+RPSVI
Sbjct  295   DTKEGCHERELAQKMKELGLQRARKYGWQDTYVFTKAMGEMMINNMRGEIPVVIIRPSVI  354

Query  1255  ESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKH  1434
             EST KEPFPGWMEGNRMMDPI+L YGKGQLTGFLVDPNGVLDVVPADMVVNATLAA+A+H
Sbjct  355   ESTCKEPFPGWMEGNRMMDPIVLCYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAIARH  414

Query  1435  GAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEA  1614
             G   KP  +IYHIASSVVNPLVF DLAR+L+EH+ S+P++DSKG PI VP MKLFSSME 
Sbjct  415   GMTPKPDINIYHIASSVVNPLVFQDLARMLHEHYNSRPFLDSKGTPIHVPSMKLFSSMED  474

Query  1615  LSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNS  1794
              S+HLWRDA+ ++GL AL    GKLS KLE +CRKSVEQAKYLA+IYEPYTFYGG     
Sbjct  475   FSAHLWRDAMHQTGLPALASWSGKLSQKLEAVCRKSVEQAKYLANIYEPYTFYGG-----  529

Query  1795  NAQKLMECMSKEERWQ  1842
              +Q L+    K   WQ
Sbjct  530   -SQSLL----KRRHWQ  540



>emb|CDY08472.1| BnaA05g27080D [Brassica napus]
Length=613

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/556 (62%), Positives = 433/556 (78%), Gaps = 25/556 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPNGNAQaaaassasasasaaENVGMKELVSSYVEK----HEDGIGI  462
             +++  M+A +L+L+PN N +              E  G+K L+  +        ++G+GI
Sbjct  74    QSSPAMDAETLVLSPNENGRYI------------EVNGVKTLLPPFSGAAKVGSKEGLGI  121

Query  463   VRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAE  642
             V FL+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A+ERLKKE++  E
Sbjct  122   VSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLIKAKNKEAAIERLKKEVLDTE  181

Query  643   LFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFD  822
             LF  L++T+G SY  FML KLVPV GN+C+S++G+   +AE IAKEVD+I+NSAANTTF+
Sbjct  182   LFNTLRETHGASYMSFMLEKLVPVTGNICDSNIGLQVDSAEEIAKEVDVIINSAANTTFN  241

Query  823   ERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGE  1002
             ERYDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E
Sbjct  242   ERYDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATE  301

Query  1003  SVVNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFT  1179
             + + GN+++    L+V  E+++ L +A++G  D   AQKMK+LGLERA  +GWQDTYVFT
Sbjct  302   NFLEGNKKA----LDVAKELKLALDAAREGTQDQEEAQKMKDLGLERARSYGWQDTYVFT  357

Query  1180  KAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLV  1359
             KAMGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLV
Sbjct  358   KAMGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLV  417

Query  1360  DPNGVLDVVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             DP GVLDVVPADMVVNATLAA+AKHG      +P  ++Y IASS +NPLVF+DLA LLY 
Sbjct  418   DPKGVLDVVPADMVVNATLAAIAKHGVVNTDQEPEINVYQIASSAINPLVFEDLAELLYN  477

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLEN  1707
             H++S P +DSKG PI VP MKLF S++  S HLW+DA ++SGL   +     K+  K++ 
Sbjct  478   HYKSTPCMDSKGVPIMVPLMKLFDSVDDFSDHLWKDAQERSGLMNDVSSVDSKMLQKIKF  537

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYIS  1887
             IC+KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+L+E MS+ E+ +FGF+V +I+WKDYI+
Sbjct  538   ICKKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLLEYMSEAEKNEFGFDVGNINWKDYIT  597

Query  1888  NVHIPGLRRHVMKGRG  1935
             NVHIPGLR+HV+KGR 
Sbjct  598   NVHIPGLRKHVLKGRA  613



>ref|XP_009146656.1| PREDICTED: fatty acyl-CoA reductase 2-like [Brassica rapa]
Length=614

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/556 (61%), Positives = 433/556 (78%), Gaps = 25/556 (4%)
 Frame = +1

Query  295   KAAALMEAGSLLLAPNGNAQaaaassasasasaaENVGMKELVSSYVEK----HEDGIGI  462
             +++  M+A +L+L+PN N +              E  G+K L+  +        ++G+GI
Sbjct  75    QSSPAMDAETLVLSPNENGRYI------------EVNGVKTLLPPFSGAAKVGSKEGLGI  122

Query  463   VRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAE  642
             V FL+GK FLITG TGFL KVLIEK+LR  PDV KIY+LIKA NKE A+ERLKKE++  E
Sbjct  123   VSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLIKAKNKEAAIERLKKEVLDTE  182

Query  643   LFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFD  822
             LF  L++T+G SY  FML KLVPV GN+C+S++G+   +AE IAKE+D+I+NSAANTTF+
Sbjct  183   LFNTLRETHGASYMSFMLEKLVPVTGNICDSNIGLQVDSAEEIAKEIDVIINSAANTTFN  242

Query  823   ERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGE  1002
             ERYDVALDINT GP  LM FA +C KLKLFL VSTAYVNGQRQG+I+EKPF +G+ IA E
Sbjct  243   ERYDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATE  302

Query  1003  SVVNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFT  1179
             + + GN+++    L+V  E+++ L +A++G  D   AQKMK+LGLERA  +GWQDTYVFT
Sbjct  303   NFLEGNRKA----LDVAKELKLALDAAREGTQDQEEAQKMKDLGLERARSYGWQDTYVFT  358

Query  1180  KAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLV  1359
             KAMGEMMI++ RG++PVVI+RPSVIEST+K+PFPGWMEGNRMMDPI+L YGKGQLTGFLV
Sbjct  359   KAMGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMDPIVLCYGKGQLTGFLV  418

Query  1360  DPNGVLDVVPADMVVNATLAAMAKHGAAG---KPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             DP GVLDVVPADMVVNATLAA+AKHG      +P  ++Y IASS +NPLVF+DLA LLY 
Sbjct  419   DPKGVLDVVPADMVVNATLAAIAKHGVVNTDQEPEINVYQIASSAINPLVFEDLAELLYN  478

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLEN  1707
             H++S P +DSKG PI VP MKLF S++  S HLW+DA ++SGL   +     K+  K++ 
Sbjct  479   HYKSTPCMDSKGVPIMVPLMKLFDSVDDFSDHLWKDAQERSGLMNGVSSVDSKMLQKIKF  538

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYIS  1887
             IC+KSVEQAK+LA+IYEPYTFYGGRFDNSN Q+L+E MS+ E+ +FGF+V +I+W+DYI+
Sbjct  539   ICKKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLLEYMSEAEKNEFGFDVGNINWQDYIT  598

Query  1888  NVHIPGLRRHVMKGRG  1935
             NVHIPGLR+HV+KGR 
Sbjct  599   NVHIPGLRKHVLKGRA  614



>ref|XP_006842773.1| hypothetical protein AMTR_s00133p00107670 [Amborella trichopoda]
 gb|ERN04448.1| hypothetical protein AMTR_s00133p00107670 [Amborella trichopoda]
Length=597

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/577 (59%), Positives = 430/577 (75%), Gaps = 33/577 (6%)
 Frame = +1

Query  226   NMVYCQGGGSNIVTT---GRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasasasaa  396
             N     GG ++++ T   G+A+ Q           + +L+PNG  Q              
Sbjct  48    NCTASNGGATSLLITEPNGKAMVQ-----------NFVLSPNGTTQEE------------  84

Query  397   ENVGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYI  576
                 M E  S      + GIGIV FL  KSFLITG TGF+ KVLIEKILRT P+V ++++
Sbjct  85    ----MMEDFSKNQMGFDQGIGIVSFLERKSFLITGATGFVAKVLIEKILRTQPEVGRLFL  140

Query  577   LIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDH  756
             LI+A+++E A+ER+K EII+ ELF+ +++ +G+SY  FM SKLVP+VG+V +++LGI+  
Sbjct  141   LIRAESREAALERIKSEIINTELFRLVQEIHGESYNDFMSSKLVPIVGDVTKTNLGIEVD  200

Query  757   TAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYV  936
              A  IA EVD+IVNS+ANTTFDERYDVAL+INT GP RLM+FA +C KLKLFLHVSTAYV
Sbjct  201   IAGAIADEVDVIVNSSANTTFDERYDVALNINTRGPCRLMRFAKRCKKLKLFLHVSTAYV  260

Query  937   NGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAM-AQ  1113
             NGQRQG+++EK F  G+SIA E  ++G   + +  L+VE E+++ +       D  + A 
Sbjct  261   NGQRQGRVMEKAFSKGDSIARERNLSGFPSNPLQGLDVEAELKLAMDLLDTFQDDKLVAN  320

Query  1114  KMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWME  1293
             KMKELGLERA  +GWQDTYVFTKAM EM+ID+M+G +PVVI+RPSVIEST  +PFPGWME
Sbjct  321   KMKELGLERARMYGWQDTYVFTKAMAEMVIDSMKGALPVVIMRPSVIESTAHDPFPGWME  380

Query  1294  GNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHI  1473
             GNRMMDPIIL+YGKG LTGFL DP GVLDVVPADMVVNATLAAMA HG  GK G ++Y +
Sbjct  381   GNRMMDPIILYYGKGLLTGFLADPQGVLDVVPADMVVNATLAAMATHGREGKAGINVYQV  440

Query  1474  ASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS  1653
             ASS+ NPLVF++LA L++ HF + P++DSKG+ I VP MKLF SME  SSH+W DA+ +S
Sbjct  441   ASSLTNPLVFEELASLMHHHFSTSPHVDSKGRSIHVPIMKLFRSMEDFSSHVWSDALQRS  500

Query  1654  GLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE  1833
             G  A   +  KL  +L+NI  KSVEQAKYLA+IY+PYTFYGGRFDN+N ++LME MS+EE
Sbjct  501   GGRA--STLEKLPQRLQNIFLKSVEQAKYLANIYQPYTFYGGRFDNTNTRRLMEEMSEEE  558

Query  1834  RWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
             R  FGF+VESI+WKDYISNVHIPGLRRHVMKGRG+CS
Sbjct  559   RRSFGFDVESINWKDYISNVHIPGLRRHVMKGRGTCS  595



>ref|XP_009391351.1| PREDICTED: fatty acyl-CoA reductase 2 [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/498 (62%), Positives = 387/498 (78%), Gaps = 1/498 (0%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI  FL GK  L+TG TGFL KVL+EKILR  PDV KIY+LIKAD+KE A++RL+ EI
Sbjct  19    GIGIAGFLEGKQLLVTGATGFLAKVLVEKILRIAPDVGKIYVLIKADDKEAAVKRLEFEI  78

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+ ELF+ L++ +GK Y  FM SKLVPV+GN+ E+++GI+   A+ I+KEVD+I+NSAAN
Sbjct  79    INTELFRCLREIHGKDYHEFMSSKLVPVIGNIREANVGIEPELADEISKEVDVIINSAAN  138

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T FDERYDVALD NT GP RLM FA +C KLKLFLHVSTAYVNGQRQG+I+EKPF +G++
Sbjct  139   TAFDERYDVALDTNTIGPFRLMSFARRCEKLKLFLHVSTAYVNGQRQGRILEKPFGMGDT  198

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             I  E+    + +++ P L++E E+ +  S  +   D  + QKMK+LGLERA   GWQD+Y
Sbjct  199   IKRETSPEFSAKAT-PILDIESEIRLAFSWAKTSWDAPLVQKMKDLGLERAKIHGWQDSY  257

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM+I+ MRG+IPVV +RPS+IEST+ EPFPGWMEG+RMMDP++L YGKGQLTG
Sbjct  258   VFTKAMGEMVINCMRGDIPVVTIRPSIIESTYSEPFPGWMEGSRMMDPVVLQYGKGQLTG  317

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             FL DPN VLDVVPADMVV+A +AAMAKHG+   PG  IY I SSVVNPLV  DLA+L+++
Sbjct  318   FLADPNAVLDVVPADMVVSAMVAAMAKHGSTSNPGMHIYQITSSVVNPLVIQDLAKLIFQ  377

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENI  1710
             HF + P +D+KG+PI V  +K F      S+++  DA+ ++   A   S  K+S  L++ 
Sbjct  378   HFSAFPCMDAKGRPIAVSPIKFFDDANEFSAYVSTDAVRRNERLAAAISNEKISRSLKSF  437

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISN  1890
             C +SVEQAK+LA IYEPYTFYGGRFDN N Q+LM  MS+EER  FGF+V SIDW+ YIS+
Sbjct  438   CLRSVEQAKHLAKIYEPYTFYGGRFDNKNTQELMVEMSEEERRSFGFDVGSIDWEHYISD  497

Query  1891  VHIPGLRRHVMKGRGSCS  1944
             VH+PGLRRHVMKGRG  +
Sbjct  498   VHVPGLRRHVMKGRGRST  515



>ref|XP_003562031.1| PREDICTED: fatty acyl-CoA reductase 2-like [Brachypodium distachyon]
Length=592

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/506 (60%), Positives = 390/506 (77%), Gaps = 10/506 (2%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             E G+GI  FL GK+FL+TGGTGFL KVLIEKILRT PDV KIY++IKA + E A++RL+ 
Sbjct  75    EAGLGIQEFLGGKNFLVTGGTGFLAKVLIEKILRTNPDVGKIYVVIKAKDSEAALQRLRN  134

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             E++  ELF+ L++ +GK Y  F+ +KLVPVVG+V E+++GI    A+ IA+ VDIIVNSA
Sbjct  135   EVVDTELFRCLQEIHGKDYHSFVAAKLVPVVGDVREANIGIAPELADEIAERVDIIVNSA  194

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             ANTTFDERYDVA+DINT GP R+M FAH+  +LKLFL VSTAYVNGQ QG ++EKPF +G
Sbjct  195   ANTTFDERYDVAMDINTVGPFRIMSFAHRFRRLKLFLQVSTAYVNGQTQGVVLEKPFRLG  254

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGA-MAQKMKELGLERANKFGWQ  1161
             ++I  +S  +  Q  + P L++E E+++   +++   D A  +Q+MK+LGLERA   GWQ
Sbjct  255   DTIRKDSSDSSEQHKN-PMLDIEAEIKLAFDSRRHSDDSASFSQEMKDLGLERAKLHGWQ  313

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             DTYVFTKAMGEM+I++MRG IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGKGQ
Sbjct  314   DTYVFTKAMGEMVINSMRGEIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGKGQ  373

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHG--AAGKPGTS------IYHIASSVVNPL  1497
             L+GFL DP GVLDVVPADMVVNATLAAMAKHG  +    GT+      +YH+ASS VNPL
Sbjct  374   LSGFLADPYGVLDVVPADMVVNATLAAMAKHGRPSEASEGTTMKQKQWVYHVASSTVNPL  433

Query  1498  VFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDS  1677
             VF DL+RLL++HF   PY D+ G+PI VP M+LF +M+  +S++  DA+ +S     G +
Sbjct  434   VFGDLSRLLFQHFTRSPYSDAAGQPIAVPPMRLFDTMDQFASYVETDALVRSAAARAGPA  493

Query  1678  KGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEV  1857
               +LS +L+ +C KSVEQ  +L  IY+PYTFY GRFDN N + LM  M+ EE+ +F F+V
Sbjct  494   GERLSQRLQELCAKSVEQTIHLGCIYQPYTFYPGRFDNGNTEALMAEMTAEEKARFHFDV  553

Query  1858  ESIDWKDYISNVHIPGLRRHVMKGRG  1935
              SIDW DYI+NVHIPGLR+HVMKGRG
Sbjct  554   RSIDWTDYITNVHIPGLRKHVMKGRG  579



>dbj|BAK05128.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=617

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/500 (61%), Positives = 386/500 (77%), Gaps = 9/500 (2%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             +GI  FL GK+FLITGGTGFL KVLIEKILRT  DV KIY+LIKA + E A++RL+ E++
Sbjct  96    LGIQEFLGGKNFLITGGTGFLAKVLIEKILRTNTDVGKIYVLIKAKDSETALQRLQNEVV  155

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANT  813
               ELFK L++ +GK Y  F+ +KLVPVVG+V E+++GI    A+ IA+ VDIIVNSAANT
Sbjct  156   DTELFKRLQEIHGKDYHGFIATKLVPVVGDVREANIGIAPELADEIAERVDIIVNSAANT  215

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
             TFDERYDVA+DINT GP R+M FAH+  +LKLFL VSTAYVNGQRQG ++EKPF +G++I
Sbjct  216   TFDERYDVAMDINTVGPFRIMSFAHRFRRLKLFLQVSTAYVNGQRQGIVLEKPFRLGDTI  275

Query  994   AGESVVNGNQESSVPK----LNVEDEMEMVLSAKQGLSD--GAMAQKMKELGLERANKFG  1155
               ES   G+ +SS       L++E E+++   ++    D   + +Q+MK+LGLERA   G
Sbjct  276   GKESA--GSSDSSEQHKNAVLDIEAEIKLAFDSRSRADDDPASFSQEMKDLGLERAKLHG  333

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             WQDTYVFTKAMGEM+I++MRG IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGK
Sbjct  334   WQDTYVFTKAMGEMVINSMRGEIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGK  393

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             GQL+GFL DP GVLDVVPADMVVNATLAAMAKHG A + G  +YH+ASS VNPLVF DL+
Sbjct  394   GQLSGFLADPAGVLDVVPADMVVNATLAAMAKHGRAAEGGMHVYHVASSTVNPLVFGDLS  453

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLST  1695
             R L+ HF S PY D+ G+PI VP M+LF +ME  +S++  DA+ +S   A   +  +LS 
Sbjct  454   RFLFRHFTSSPYSDAAGQPIAVPPMRLFDTMEQFASYVETDALLRSA-RAGAPAGERLSQ  512

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
             +L+ +C KSVEQ  +L SIY+PYTFY GRFDN N + LM  MS +E+  F F+V SIDW 
Sbjct  513   RLQELCAKSVEQTIHLGSIYQPYTFYTGRFDNCNTEGLMAEMSAQEKAGFHFDVRSIDWT  572

Query  1876  DYISNVHIPGLRRHVMKGRG  1935
             DYI+NVHIPGLR+HVMKGRG
Sbjct  573   DYITNVHIPGLRKHVMKGRG  592



>ref|XP_004987158.1| PREDICTED: fatty acyl-CoA reductase 2-like [Setaria italica]
Length=562

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/509 (59%), Positives = 384/509 (75%), Gaps = 19/509 (4%)
 Frame = +1

Query  442   HEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLK  621
             H  GIGI  FL  K+FLITGGTGFL KVLIEKILRT PDV KIY+LIKA + E A+ RL+
Sbjct  49    HAGGIGIAEFLGAKNFLITGGTGFLAKVLIEKILRTNPDVGKIYVLIKAKDSEAALRRLQ  108

Query  622   KEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNS  801
              E++  ELFK L++ +G  Y  F+  KLVPVVG+V E+++GI    A+ IA +VDIIVNS
Sbjct  109   NEVVDTELFKCLQEIHGNDYSSFIARKLVPVVGDVREANIGIAPELADEIADQVDIIVNS  168

Query  802   AANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCI  981
             AANTTFDERYDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF +
Sbjct  169   AANTTFDERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGLVLEKPFRM  228

Query  982   GESIAGESVVNGNQESSVPKLNVEDEMEMVL--SAKQGLSDGAMAQKMKELGLERANKFG  1155
             G++IA E    G+ E S   L++E E+++    S ++ +   +  Q+MK+LGLERAN  G
Sbjct  229   GDTIAKEL---GSSEHSSTVLDIEAEIKLAFDYSRRRSVDSASFTQEMKDLGLERANLHG  285

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             WQDTYVFTKAMGEM+I++MRG +PVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGK
Sbjct  286   WQDTYVFTKAMGEMVINSMRGEVPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGK  345

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHG---------AAGKPGTSIYHIASSVV  1488
             GQL+GFL DP GVLDVVPADMVVNATLA+MAKHG         AAG  G  +YH++SS V
Sbjct  346   GQLSGFLADPEGVLDVVPADMVVNATLASMAKHGGTSSSSPPAAAGPGGMHVYHVSSSTV  405

Query  1489  NPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTAL  1668
             NPLVF +L+R L++HF   PY D+ G+PI VP M+LF SM+  ++++  DA+ +S     
Sbjct  406   NPLVFGELSRFLFQHFTRCPYSDAAGRPIPVPPMRLFDSMDQFAAYVETDALLRS-----  460

Query  1669  GDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFG  1848
                + +LS +   +C +SVEQA +L SIY+PYTFYGGRFDN N + L+  MS  E+ +F 
Sbjct  461   EQQRRRLSQRARELCARSVEQAVHLGSIYQPYTFYGGRFDNGNTEALLAAMSVAEKARFH  520

Query  1849  FEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             F+V S+DW DYI+NVHIPGLR+HVMKGRG
Sbjct  521   FDVRSVDWADYITNVHIPGLRKHVMKGRG  549



>ref|XP_002468445.1| hypothetical protein SORBIDRAFT_01g046030 [Sorghum bicolor]
 gb|EER95443.1| hypothetical protein SORBIDRAFT_01g046030 [Sorghum bicolor]
Length=592

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/500 (60%), Positives = 384/500 (77%), Gaps = 7/500 (1%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             IG+  FL  K+FLITGGTGFL KVLIEKILRT P+V KIY+LIKA + E A+ RL+ E++
Sbjct  82    IGVAEFLGAKNFLITGGTGFLAKVLIEKILRTNPNVGKIYVLIKAKDGEAALRRLQNEVV  141

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANT  813
               ELFK L++ +G+ Y  F+  KLVPVVG+V E+++GI    A+ IA +VD+I+NSAANT
Sbjct  142   DTELFKCLQEIHGEGYDSFIAKKLVPVVGDVREANVGISPDLADEIADQVDVIINSAANT  201

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
             TFDERYDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF +G++I
Sbjct  202   TFDERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGLVLEKPFRMGDTI  261

Query  994   AGE----SVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGA--MAQKMKELGLERANKFG  1155
             A E    S  +  Q  ++P L++E E+++   +++ L + +   AQ+MK+LGLERA   G
Sbjct  262   AKELGSSSSGSSEQGHNIPVLDIEAEIKLAFYSRRHLDNNSPSFAQEMKDLGLERAKLHG  321

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             WQDTYVFTKAMGEM+I++MRG IPVV +RPSVIEST ++PFPGWMEGNRMMDP+IL+YGK
Sbjct  322   WQDTYVFTKAMGEMVINSMRGEIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVILYYGK  381

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             GQL+GFL DP+GVLDVVPADMVVNATLA+MAKHG A  PG  +YH++SS VNPLVF DL+
Sbjct  382   GQLSGFLADPDGVLDVVPADMVVNATLASMAKHGGAAGPGMHVYHVSSSTVNPLVFGDLS  441

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLST  1695
             R L+ HF   PY D+ G+PI VP M+LF +ME  +S++  DA+    + A   S   ++ 
Sbjct  442   RFLFHHFTRCPYSDAAGQPILVPPMRLFDTMEQFASYVETDAL-LRSVRASSSSSPAVAQ  500

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
             +  ++C +SVEQ  +L SIY+PYTFYGGRFDN N + L   MS  ER +F F+V S+DW+
Sbjct  501   RARDLCARSVEQTVHLGSIYQPYTFYGGRFDNGNTEALFAAMSPAERARFHFDVRSVDWR  560

Query  1876  DYISNVHIPGLRRHVMKGRG  1935
             DYI+NVHIPGLR+HVMKGRG
Sbjct  561   DYITNVHIPGLRKHVMKGRG  580



>ref|XP_006651074.1| PREDICTED: fatty acyl-CoA reductase 2-like [Oryza brachyantha]
Length=610

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/504 (61%), Positives = 387/504 (77%), Gaps = 9/504 (2%)
 Frame = +1

Query  436   EKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMER  615
             E H DGIGI +FL GK+FLITGGTGFL KVLIEKILRT PDV KIY+LIKA + + A++R
Sbjct  81    EVHADGIGIAQFLGGKNFLITGGTGFLAKVLIEKILRTNPDVGKIYVLIKAKDSDAALKR  140

Query  616   LKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIV  795
             L+ E++  ELF+ L++ +GK Y  F+  KLVPVVG+V E+++GI    A +IA+EVDIIV
Sbjct  141   LQNEVVDTELFRCLQEIHGKDYHSFVARKLVPVVGDVREANVGIAPELASVIAEEVDIIV  200

Query  796   NSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPF  975
             NSAANTTFDERYDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF
Sbjct  201   NSAANTTFDERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGVVLEKPF  260

Query  976   CIGESIAGE-SVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGA-MAQKMKELGLERANK  1149
              +G++IA E    + ++E     L++E E+++    ++   D A  +++MKELGLERA  
Sbjct  261   RLGDTIAKELGSSSDSEEHKNTILDIEAEIKLAFDHRRHSDDSASFSEEMKELGLERAKL  320

Query  1150  FGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHY  1329
              GWQDTYVFTKAMGEM+I++MRG+IPVV +RPSVIEST  +PFPGWMEGNRMMDP++L+Y
Sbjct  321   HGWQDTYVFTKAMGEMVINSMRGDIPVVTIRPSVIESTWSDPFPGWMEGNRMMDPVVLYY  380

Query  1330  GKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT----SIYHIASSVVNPL  1497
             GKGQL+GFL DP GVLDVVPADMVVNATLA+MAKHG  G         +YH+ASS VNPL
Sbjct  381   GKGQLSGFLADPEGVLDVVPADMVVNATLASMAKHGRGGAAAAAEGMQVYHVASSTVNPL  440

Query  1498  VFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSG-LTALGD  1674
             VF +L+R L++HF   PY D+ G+PI VP M+LF SME  +S++  DA+ +S  L   GD
Sbjct  441   VFGELSRFLFQHFTRAPYSDAAGRPIHVPPMRLFDSMEQFASYVETDALLRSTRLAGAGD  500

Query  1675  SKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFE  1854
                +LS ++  +C KSVEQ  +L SIY+PYTFYGGRFDN N + ++  MS+ E+ QF F+
Sbjct  501   E--RLSQRVRELCAKSVEQTVHLGSIYQPYTFYGGRFDNGNTEAMIAEMSEAEKTQFHFD  558

Query  1855  VESIDWKDYISNVHIPGLRRHVMK  1926
             V SIDW DYI+NVHIPGLR+HVMK
Sbjct  559   VRSIDWTDYITNVHIPGLRKHVMK  582



>gb|EMT31062.1| Fatty acyl-CoA reductase 2 [Aegilops tauschii]
Length=592

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/544 (56%), Positives = 388/544 (71%), Gaps = 46/544 (8%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             G     FL GK+ LITGGTGFL KVLIEKILRT PDV KIY+LIKA + E A++RL+ E+
Sbjct  40    GCYATEFLGGKTCLITGGTGFLAKVLIEKILRTNPDVGKIYVLIKAKDSETALQRLQNEV  99

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             +  ELFK L++ +GK YQ F+ +KLVPVVG+V E+++GI    A+ IA+ VDIIVNSAAN
Sbjct  100   VDTELFKRLQEIHGKDYQDFIATKLVPVVGDVREANIGIAPELADEIAERVDIIVNSAAN  159

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TTFDERYDVA+DINT GP R+M FAH+  +LKLFL VSTAYVNGQRQG ++EKPF +G++
Sbjct  160   TTFDERYDVAMDINTVGPFRIMSFAHRFRRLKLFLQVSTAYVNGQRQGVVLEKPFRLGDT  219

Query  991   I----AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSD--GAMAQKMKELGLERANKF  1152
             I    AG S  +   +++V  L++E E+++   +++   D   + +Q+MK+LGLERA   
Sbjct  220   IGKGSAGSSDSSEQHKNAV--LDIEAEIKLAFDSRRRADDDSASFSQEMKDLGLERAKLH  277

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GWQDTYVFTKAMGEM+I++MRG IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YG
Sbjct  278   GWQDTYVFTKAMGEMVINSMRGEIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYG  337

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDL  1512
             KGQL+GFL DP GVLDVVPADMVVNATLA MAKHG A + G  +YH+ASS VNPLVF DL
Sbjct  338   KGQLSGFLADPAGVLDVVPADMVVNATLATMAKHGRAAEGGMHVYHVASSTVNPLVFGDL  397

Query  1513  ARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS  1692
             +R L++HF   PY D+ G+PI VP M+LF +ME  +S++  DA+ +S    +   + +LS
Sbjct  398   SRFLFQHFTRSPYSDAAGQPIAVPPMRLFDTMEQFASYVETDALLRSARAGVPAGE-RLS  456

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGG-------------------------------  1779
              +L+ +C KSVEQ  +L SIY+PYTFY G                               
Sbjct  457   QRLQELCAKSVEQTIHLGSIYQPYTFYTGRSSLSLPPMAEQAHVASFICFVCSSCYHASP  516

Query  1780  ------RFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSC  1941
                   RF+N N + LM  MS EE+  F F+V SIDW DYI+NVHIPGLR+HVMKGRG  
Sbjct  517   AMNDVCRFNNGNTEGLMAEMSAEEKAAFHFDVRSIDWTDYITNVHIPGLRKHVMKGRGIA  576

Query  1942  S*GP  1953
             +  P
Sbjct  577   AESP  580



>ref|XP_008442197.1| PREDICTED: fatty acyl-CoA reductase 2 isoform X2 [Cucumis melo]
Length=504

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/519 (59%), Positives = 374/519 (72%), Gaps = 50/519 (10%)
 Frame = +1

Query  229   MVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAP-NGNAQaaaassasasasaaENV  405
             +V C G     ++T R    +    A   A S++LAP NG +               + +
Sbjct  32    VVACSGALKPSISTERVSSSSVVVRA---AESVVLAPPNGKS---------------DEI  73

Query  406   GMKELVSSYVEKHEDG-IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILI  582
              +K LV  YV+  EDG IGIV+FLRGK F ITG TGFLGKVLIEKILRT PDV KIY+LI
Sbjct  74    AVKSLVP-YVDMDEDGGIGIVKFLRGKVFFITGATGFLGKVLIEKILRTAPDVGKIYVLI  132

Query  583   KADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA  762
             KA ++E A ERLK +II+ +LFK L+Q +GK Y  FM+SKL+PVVGNVCESD+G+    +
Sbjct  133   KAKDEEAAAERLKNDIINTQLFKCLRQIHGKYYMSFMMSKLIPVVGNVCESDVGLHVDFS  192

Query  763   EMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNG  942
              +IA +VD+IVNSAANTTFDERYDVA+DINT GP+ LM+FA +C KLKLFL +STAYVNG
Sbjct  193   HLIANDVDVIVNSAANTTFDERYDVAIDINTKGPSNLMEFAKKCSKLKLFLQISTAYVNG  252

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             QRQG+I+EKPFC                    +L+VE EM++         D  M Q MK
Sbjct  253   QRQGRIMEKPFC-------------------KELDVESEMKL------AFEDNGMGQNMK  287

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELGL+RA ++GWQDTYVFTKAMGEM+ID MRG +PV I+RPSVIEST K+PFPGWMEGNR
Sbjct  288   ELGLQRAKRYGWQDTYVFTKAMGEMVIDEMRGEVPVAIIRPSVIESTFKDPFPGWMEGNR  347

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
             MMDPI+L+YGKGQLTGFLVDPNGV+DVVPADMVVNATLAAMA+HG A +P  +IYH+ASS
Sbjct  348   MMDPIVLYYGKGQLTGFLVDPNGVIDVVPADMVVNATLAAMARHGRAPRPSMNIYHVASS  407

Query  1483  VVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT  1662
             V NPLVF  LA LL++H+ S P +D  G PI VP MKLF S++  S+HLW+DA  +   T
Sbjct  408   VANPLVFHRLADLLHQHYDSSPCLDVDGTPIRVPSMKLFDSVDDFSNHLWQDAARRCAST  467

Query  1663  ALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGG  1779
                   GKLS KLE IC+K+VEQ K+LA IY+PYTF+ G
Sbjct  468   P----DGKLSKKLEAICKKTVEQLKHLADIYQPYTFFNG  502



>ref|XP_008660506.1| PREDICTED: fatty acyl-CoA reductase 2-like [Zea mays]
 gb|AFW89580.1| hypothetical protein ZEAMMB73_884169 [Zea mays]
Length=593

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/498 (59%), Positives = 379/498 (76%), Gaps = 10/498 (2%)
 Frame = +1

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             FL  K+FLITGGTGFL KVLIEKILRT PDV K+Y+LIKA + E A+ RL+ E++  ELF
Sbjct  91    FLGAKNFLITGGTGFLAKVLIEKILRTNPDVGKVYVLIKAKDSEAALARLRNEVVDTELF  150

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             K L+  +G+ Y  F+  KLVPVVG+V E+++GI    A+ IA +VD+I+NSAANTTFDER
Sbjct  151   KCLQDIHGEGYDGFIARKLVPVVGDVREANVGIAPDLADEIADQVDVIINSAANTTFDER  210

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF +G++IA E  
Sbjct  211   YDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGLVLEKPFRMGDTIAKE--  268

Query  1009  VNGNQES---SVPKLNVEDEMEMVLSAKQGLSDG--AMAQKMKELGLERANKFGWQDTYV  1173
             + G   S    +P L++E E+++   + +   D   + AQ+MK+LGLERA   GWQDTYV
Sbjct  269   LPGWSSSPGHKIPVLDIEAEIKLAFYSTRHRPDDSPSFAQEMKDLGLERAKLHGWQDTYV  328

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM+I++MRG IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGKGQLTGF
Sbjct  329   FTKAMGEMVINSMRGEIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGKGQLTGF  388

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKH-GAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             L DP+GVLDVVPADMVVNATLA+MAKH G A  PG  +YH++SS VNPLVF DL+R L++
Sbjct  389   LADPDGVLDVVPADMVVNATLASMAKHGGGAAGPGMHVYHVSSSTVNPLVFGDLSRFLFQ  448

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENI  1710
             HF   PY D+ G+PI VP M+LF +ME  +S++  DA+ +S  +    S   L+ +  ++
Sbjct  449   HFTRCPYSDAAGQPILVPPMRLFDTMEQFASYVETDALLRSARSTS--SSSSLAQRARDL  506

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISN  1890
             C +SVEQ  +L SIY PYTFYGGRFDN+N + L+  MS  ER +F F+V  +DW DYI+N
Sbjct  507   CARSVEQTVHLGSIYRPYTFYGGRFDNANTEALLAAMSPAERARFHFDVRGVDWADYITN  566

Query  1891  VHIPGLRRHVMKGRGSCS  1944
             VHIPGLR+HVMKGRG  +
Sbjct  567   VHIPGLRKHVMKGRGVAA  584



>dbj|BAM71700.1| hypothetical protein [Cryptomeria japonica]
Length=642

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/518 (57%), Positives = 382/518 (74%), Gaps = 30/518 (6%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             +G+GIV FL+GK+FLITG TGFL KVLIEKILR  P V K++++IKA + E A+ER+K E
Sbjct  131   NGLGIVEFLKGKNFLITGATGFLAKVLIEKILRMQPHVGKLFLIIKAKDYESALERMKNE  190

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +I +ELF+ +++T+G  Y+ FM+ KLVPV+GN+   +LGI    AE ++KEVDI+VNSAA
Sbjct  191   VIYSELFRCVQETHGSKYEEFMMKKLVPVMGNITGHNLGIQPDIAEEVSKEVDIVVNSAA  250

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYDVALDINT G   ++ FA  C +L+LFL +STAYVNGQRQG+++EKPF +G+
Sbjct  251   NTTFDERYDVALDINTNGTRHILDFAKGCKRLQLFLQISTAYVNGQRQGRVLEKPFQMGD  310

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK----------------M  1119
             +IA E   +     S P L++E E E+   AK+ L D ++  +                M
Sbjct  311   NIASEK-AHLELVQSPPMLDIEAEFEL---AKRTLEDNSIDLRSNGHSSLNVEKQLVLTM  366

Query  1120  KELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGN  1299
             K LG+ERA K+GWQDTYVFTKAMGEM+ID  RG++PV IVRPSVIEST+ +PFPGWMEGN
Sbjct  367   KNLGMERAQKYGWQDTYVFTKAMGEMIIDYGRGDLPVAIVRPSVIESTYSDPFPGWMEGN  426

Query  1300  RMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS  1479
             RMMDPIIL+YGKGQL GFL DPNGVLDVVPADMVVNAT+AAMAKH  AGK G  +YH+ S
Sbjct  427   RMMDPIILYYGKGQLCGFLADPNGVLDVVPADMVVNATVAAMAKH--AGKSGLGVYHVGS  484

Query  1480  SVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL  1659
             SV NPL+F  LA L+ +HF+S PY+D KG+P+ V +++LF  ++  S+H+W      S L
Sbjct  485   SVANPLMFGQLAGLVTQHFKSNPYVDGKGEPVSVKKLQLFRDVDDFSTHMWSHL---SNL  541

Query  1660  TALGDSKGKLSTKL-----ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMS  1824
                  S G   +K+     + IC KS+EQAKYLA+IY+PYTFY GRFD SN + L + +S
Sbjct  542   LPDMRSNGSSHSKMMIERHQKICAKSIEQAKYLANIYKPYTFYQGRFDISNTEGLFQRLS  601

Query  1825  KEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGS  1938
             +EE+  F F+V  I+W DYIS  HIPGLR+HVMKGRG+
Sbjct  602   EEEKQNFNFDVRRINWMDYISKTHIPGLRQHVMKGRGT  639



>ref|NP_001049083.1| Os03g0167600 [Oryza sativa Japonica Group]
 gb|AAL84297.1|AC073556_14 putative male sterility protein [Oryza sativa Japonica Group]
 gb|ABF94174.1| Male sterility protein 2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10997.1| Os03g0167600 [Oryza sativa Japonica Group]
 dbj|BAH00399.1| unnamed protein product [Oryza sativa Japonica Group]
Length=608

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/503 (60%), Positives = 380/503 (76%), Gaps = 17/503 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I  FL GK+FLITGGTGFL KVLIEKILRT PDV KIY+LIKA + + A++RL  E++  
Sbjct  85    IAEFLGGKNFLITGGTGFLAKVLIEKILRTNPDVGKIYVLIKAKDGDAALKRLHNEVVDT  144

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             ELF  L++ +GK Y  F   KLVPVVG+V E+++GI    A +IA EVDIIVNSAANTTF
Sbjct  145   ELFSRLQEIHGKDYHSFAARKLVPVVGDVREANVGIAPELAGVIADEVDIIVNSAANTTF  204

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
             DERYDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF +G++IA 
Sbjct  205   DERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGVVLEKPFRLGDTIAK  264

Query  1000  ESVVNGNQESSVPK---LNVEDEMEMVLSAKQGLSDGA-MAQKMKELGLERANKFGWQDT  1167
             E    G+ +SS  K   L++E E+++    ++   D A  +++MKELGLERA   GWQDT
Sbjct  265   EL---GSPDSSQHKNTMLDIEAEIKLAFDHRRHGDDSASFSEEMKELGLERAKLHGWQDT  321

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM+I++MRG+IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGKGQL+
Sbjct  322   YVFTKAMGEMVINSMRGDIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGKGQLS  381

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG-------KPGTSIYHIASSVVNPLVFD  1506
             GFL DP GVLDVVPADMVVNATLA+MAKHG  G         G  +YH+ASS VNPL F 
Sbjct  382   GFLADPEGVLDVVPADMVVNATLASMAKHGRGGAAAAAAAAEGMHVYHVASSTVNPLAFG  441

Query  1507  DLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKG-  1683
             DL+R L++HF   PY D+ G+PI VP M+LF +ME  +S++  DA+ ++G  A   +   
Sbjct  442   DLSRFLFQHFTGSPYSDAAGRPIHVPPMRLFDTMEQFASYVETDALLRAGRLAGAGAGAG  501

Query  1684  --KLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEV  1857
               ++S +L  +C KSVEQ  YL SIY+PYTFYGGRFDN N + L+  MS+EE+ +F F+V
Sbjct  502   DERVSQRLRELCAKSVEQTIYLGSIYQPYTFYGGRFDNGNTEALIGEMSEEEKARFHFDV  561

Query  1858  ESIDWKDYISNVHIPGLRRHVMK  1926
              SI+W DYI+NVHIPGLR+HVMK
Sbjct  562   RSIEWTDYITNVHIPGLRKHVMK  584



>gb|EEC74588.1| hypothetical protein OsI_10168 [Oryza sativa Indica Group]
Length=611

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/505 (60%), Positives = 380/505 (75%), Gaps = 19/505 (4%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I  FL GK+FLITGGTGFL KVLIEKILRT PDV KIY+LIKA + + A++RL  E++  
Sbjct  86    IAEFLGGKNFLITGGTGFLAKVLIEKILRTNPDVGKIYVLIKAKDSDAALKRLHNEVVDT  145

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             ELF  L++ +GK Y  F   KLVPVVG+V E+++GI    A +IA EVDIIVNSAANTTF
Sbjct  146   ELFSRLQEIHGKDYHSFAARKLVPVVGDVREANVGIAPELAGVIADEVDIIVNSAANTTF  205

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
             DERYDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF +G++IA 
Sbjct  206   DERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGVVLEKPFRLGDTIAK  265

Query  1000  ESVVNGNQESSVPK---LNVEDEMEMVLSAKQGLSDGA-MAQKMKELGLERANKFGWQDT  1167
             E    G+ +SS  K   L++E E+++    ++   D A  +++MKELGLERA   GWQDT
Sbjct  266   EL---GSPDSSQHKNTMLDIEAEIKLAFDHRRHGDDSASFSEEMKELGLERAKLHGWQDT  322

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM+I++MRG+IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGKGQL+
Sbjct  323   YVFTKAMGEMVINSMRGDIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGKGQLS  382

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG-------KPGTSIYHIASSVVNPLVFD  1506
             GFL DP GVLDVVPADMVVNATLA+MAKHG  G         G  +YH+ASS VNPL F 
Sbjct  383   GFLADPEGVLDVVPADMVVNATLASMAKHGRGGAAAAAAAAEGMHVYHVASSTVNPLAFG  442

Query  1507  DLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKG-  1683
             DL+R L++HF   PY D+ G+PI VP M+LF +ME  +S++  DA+ ++G  A   +   
Sbjct  443   DLSRFLFQHFTGSPYSDAAGRPIHVPPMRLFDTMEQFASYVETDALLRAGRLAGAGAGAG  502

Query  1684  ----KLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGF  1851
                 ++S +L  +C KSVEQ  YL SIY+PYTFYGGRFDN N + L+  MS+EE+ +F F
Sbjct  503   AGDERVSQRLRELCAKSVEQTIYLGSIYQPYTFYGGRFDNGNTEALIGEMSEEEKARFHF  562

Query  1852  EVESIDWKDYISNVHIPGLRRHVMK  1926
             +V SI+W DYI+NVHIPGLR+HVMK
Sbjct  563   DVRSIEWTDYITNVHIPGLRKHVMK  587



>ref|XP_006429861.1| hypothetical protein CICLE_v10011477mg [Citrus clementina]
 gb|ESR43101.1| hypothetical protein CICLE_v10011477mg [Citrus clementina]
Length=523

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/496 (60%), Positives = 383/496 (77%), Gaps = 14/496 (3%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI +FL GKSF +TG TGFL KVLIEKILRT P+V KI++LIKA+++E A +RLK E+
Sbjct  13    GIGIEKFLVGKSFFVTGATGFLAKVLIEKILRTAPEVGKIFLLIKAESEEAASKRLKDEV  72

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+AELFK L+QTYG+ YQ FML+KLVPVVGN+ ES+LG++   A++IA EVD+I+NSAAN
Sbjct  73    INAELFKCLQQTYGECYQDFMLNKLVPVVGNISESNLGLEGDLAKVIANEVDVIINSAAN  132

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TT  ERYD+A+DINT GP+ +M FA +C K+K+F+H+STAYVNG+RQG+I+EKPF +G++
Sbjct  133   TTLHERYDIAIDINTRGPSHVMNFAKKCKKIKVFVHMSTAYVNGKRQGRIMEKPFYMGDT  192

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQDT  1167
             IA E  +N N     PKL+VE E+E+ + +K+ L +D    +KMKELGLERA K+GW  T
Sbjct  193   IARE--LNFNNSKIEPKLDVEKEIELAMKSKKALENDEDARKKMKELGLERARKYGWDVT  250

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEMMID ++ NIPVVI+RPS+I+ST+K+PF GW++GNR++D +IL+YG+GQL 
Sbjct  251   YVFTKAMGEMMIDTLKENIPVVIIRPSMIQSTYKKPFAGWIQGNRILDLMILYYGRGQLN  310

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLARL  1521
              F+ DP+G+LDVVP DMVVNATLAA+AKHG     KP   +Y IASSV NPLV   L  L
Sbjct  311   EFVGDPSGILDVVPVDMVVNATLAAIAKHGQVVIQKPEVKVYQIASSVTNPLVTKYLLSL  370

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGK-LSTK  1698
             L+EHF S P +DSKG PI VP MKLF+SME  S+HL   A+ +S    +G S G+ L+ K
Sbjct  371   LHEHFDSSPVLDSKGSPIRVPVMKLFTSMEDFSAHLLDGAMQRS---IIGSSNGELLAQK  427

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
                I R+     K  A++Y PY  Y GRFD SN   LM+ M++EE+ +FGF++ SIDWK 
Sbjct  428   QYEILRR-----KEFANVYLPYGLYAGRFDCSNTLGLMQIMNEEEKKKFGFDMGSIDWKH  482

Query  1879  YISNVHIPGLRRHVMK  1926
             YI+NVH+PGLRRHVMK
Sbjct  483   YITNVHVPGLRRHVMK  498



>gb|EYU39978.1| hypothetical protein MIMGU_mgv1a020686mg [Erythranthe guttata]
Length=442

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/460 (64%), Positives = 349/460 (76%), Gaps = 35/460 (8%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
              DGIGIV+FL GKSFLITGGTGFLGKVLIEKILRT PDV KI++LIKA +KE A +RLK 
Sbjct  4     RDGIGIVQFLTGKSFLITGGTGFLGKVLIEKILRTAPDVSKIFVLIKAKSKEAAAQRLKN  63

Query  625   EIISAE-LFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNS  801
             EII  E LFK L+Q +GKSYQ FMLSKLVPVVGNVC     +D+  A  IAKEVD+I+NS
Sbjct  64    EIIDEEELFKGLRQIHGKSYQAFMLSKLVPVVGNVC-----VDEDEANFIAKEVDVIINS  118

Query  802   AANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVST-------------AYVNG  942
             AANTTFDERYD ALDINT GP R + FA +C KLKLFL VST             AYVNG
Sbjct  119   AANTTFDERYDTALDINTLGPKRTIGFAKKCDKLKLFLQVSTGNRRCLIRVLFASAYVNG  178

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             QRQGKI+EKPFC G+SI           SS+PKL++EDE+++V  + +       +QKMK
Sbjct  179   QRQGKIMEKPFCFGQSI---------HTSSLPKLSIEDEIKLVSQSNE-------SQKMK  222

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELG  RAN FGWQDTYVFTKAMGEMMID++RG+IPVVI+RPS+IEST+ EPFPGW+EGN+
Sbjct  223   ELGKHRANSFGWQDTYVFTKAMGEMMIDSLRGDIPVVIIRPSIIESTYTEPFPGWIEGNK  282

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
             +MDP+IL YGKG LTGFL D +GVLDVVPADMVVNATLAAMAKHG + KPG +IY +ASS
Sbjct  283   VMDPLILFYGKGHLTGFLGDDDGVLDVVPADMVVNATLAAMAKHGTSAKPGCNIYQVASS  342

Query  1483  VVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT  1662
             V NPL   +L + +Y+HF S P+IDSKG P+ VP ++L  S E  S++L R   +++GL 
Sbjct  343   VANPLFLKELVQFVYQHFTSSPFIDSKGIPVRVPPLQLHMSKEDFSTYLLRHTKNRTGLG  402

Query  1663  ALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGR  1782
              L  +  KLS KL  IC+K VEQA YLA +Y PYTFYGGR
Sbjct  403   NLSKTDEKLSRKLNIICKKLVEQANYLADVYGPYTFYGGR  442



>gb|AFW89578.1| hypothetical protein ZEAMMB73_884169 [Zea mays]
Length=582

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/498 (59%), Positives = 372/498 (75%), Gaps = 21/498 (4%)
 Frame = +1

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             FL  K+FLITGGTGFL KVLIEKILRT PDV K+Y+LIKA + E A+ RL+ E I     
Sbjct  91    FLGAKNFLITGGTGFLAKVLIEKILRTNPDVGKVYVLIKAKDSEAALARLRNEDI-----  145

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
                   +G+ Y  F+  KLVPVVG+V E+++GI    A+ IA +VD+I+NSAANTTFDER
Sbjct  146   ------HGEGYDGFIARKLVPVVGDVREANVGIAPDLADEIADQVDVIINSAANTTFDER  199

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDVA+DINT GP R+M FA +  +LKLFL VSTAYVNGQRQG ++EKPF +G++IA E  
Sbjct  200   YDVAMDINTVGPFRIMSFAQRFRRLKLFLQVSTAYVNGQRQGLVLEKPFRMGDTIAKE--  257

Query  1009  VNGNQESS---VPKLNVEDEMEMVLSAKQGLSDGA--MAQKMKELGLERANKFGWQDTYV  1173
             + G   S    +P L++E E+++   + +   D +   AQ+MK+LGLERA   GWQDTYV
Sbjct  258   LPGWSSSPGHKIPVLDIEAEIKLAFYSTRHRPDDSPSFAQEMKDLGLERAKLHGWQDTYV  317

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM+I++MRG IPVV +RPSVIEST ++PFPGWMEGNRMMDP++L+YGKGQLTGF
Sbjct  318   FTKAMGEMVINSMRGEIPVVTIRPSVIESTWRDPFPGWMEGNRMMDPVVLYYGKGQLTGF  377

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKH-GAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             L DP+GVLDVVPADMVVNATLA+MAKH G A  PG  +YH++SS VNPLVF DL+R L++
Sbjct  378   LADPDGVLDVVPADMVVNATLASMAKHGGGAAGPGMHVYHVSSSTVNPLVFGDLSRFLFQ  437

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENI  1710
             HF   PY D+ G+PI VP M+LF +ME  +S++  DA+ +S  +    S   L+ +  ++
Sbjct  438   HFTRCPYSDAAGQPILVPPMRLFDTMEQFASYVETDALLRSARSTS--SSSSLAQRARDL  495

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISN  1890
             C +SVEQ  +L SIY PYTFYGGRFDN+N + L+  MS  ER +F F+V  +DW DYI+N
Sbjct  496   CARSVEQTVHLGSIYRPYTFYGGRFDNANTEALLAAMSPAERARFHFDVRGVDWADYITN  555

Query  1891  VHIPGLRRHVMKGRGSCS  1944
             VHIPGLR+HVMKGRG  +
Sbjct  556   VHIPGLRKHVMKGRGVAA  573



>ref|XP_006492869.1| PREDICTED: fatty acyl-CoA reductase 2-like [Citrus sinensis]
Length=524

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/497 (59%), Positives = 380/497 (76%), Gaps = 15/497 (3%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI +F  GKSF +TG TGFL KVLIEKILRT P+V KI++LIKA+++E A +RLK E+
Sbjct  13    GIGIEKFFVGKSFFVTGATGFLAKVLIEKILRTAPEVGKIFLLIKAESEEAASKRLKDEV  72

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+AELFK L+QTYG+ YQ FML+KLVPVVGN+ ES+LG++   A++IA EVD+I+NSAAN
Sbjct  73    INAELFKCLQQTYGECYQDFMLNKLVPVVGNISESNLGLEGDLAKVIANEVDVIINSAAN  132

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVN-GQRQGKIIEKPFCIGE  987
             TT  ERYD+A+DINT GP+ +M FA +C K+K+F+H+STAYVN G+RQG+I+EKPF +G+
Sbjct  133   TTLHERYDIAIDINTRGPSHVMNFAKKCKKIKVFVHMSTAYVNDGKRQGRIMEKPFYMGD  192

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQD  1164
             +IA E  +N N     P L+VE E+E+ + +K+ L +D    +KMKELGLERA K+GW  
Sbjct  193   TIARE--LNFNNSKIEPNLDVEKEIELAMKSKKALENDEDARKKMKELGLERARKYGWDV  250

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEMMID ++ NIPVVI+RPS+I+ST+KEPF GW++GNR++D +IL+YG+GQL
Sbjct  251   TYVFTKAMGEMMIDTLKENIPVVIIRPSMIQSTYKEPFAGWIQGNRILDLMILYYGRGQL  310

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLAR  1518
               F+  P+G+LDV+P DMVVNATLAA+AKHG     KP   +Y IASSV NPLV   L  
Sbjct  311   NEFVGVPSGILDVIPVDMVVNATLAAIAKHGQVVIQKPEVKVYQIASSVTNPLVTKYLLS  370

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGK-LST  1695
             LL+EHF S P++DS G PI VP MKLF+SME  S+HL   A+ +S    +G S G+ L+ 
Sbjct  371   LLHEHFDSSPFLDSMGSPIRVPLMKLFTSMEDFSAHLLDGAMQRS---IIGSSNGELLAQ  427

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
             K   I R+     K  A++Y PY FY GRFD SN   LM+ M++EE+ +FGF++ SIDWK
Sbjct  428   KQYEILRR-----KEFANVYLPYGFYAGRFDCSNTLGLMQIMNEEEKKKFGFDMGSIDWK  482

Query  1876  DYISNVHIPGLRRHVMK  1926
              YI+NVH+PGL R+VMK
Sbjct  483   HYITNVHVPGLMRNVMK  499



>ref|XP_006429858.1| hypothetical protein CICLE_v10011476mg [Citrus clementina]
 gb|ESR43098.1| hypothetical protein CICLE_v10011476mg [Citrus clementina]
Length=523

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/500 (59%), Positives = 383/500 (77%), Gaps = 14/500 (3%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             +DGIGI +FL GKSF +TG TGFL KVLIEKILR  P+V KI++LIKA+++E A +RLK 
Sbjct  11    QDGIGIEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKD  70

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             E+I+AELFK L+QTYG+ YQ FML+KLVPVVGN+ ES+LG++ + A +IA EVD+I+NSA
Sbjct  71    EVINAELFKCLQQTYGECYQDFMLNKLVPVVGNISESNLGLEGNLATVIANEVDVIINSA  130

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             A+ TF ERY++A+DINT GP+ +M FA +C K+K+F+H+STA+ NG+RQG+I+EKPF +G
Sbjct  131   ASITFHERYEIAIDINTRGPSHVMNFAKKCKKVKVFVHMSTAFANGKRQGRIMEKPFYMG  190

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQ  1161
             ++IA E  +N N   + PKL+VE E+E+ + +K+ L +D    +KMKELGLERA K+GW 
Sbjct  191   DTIARE--LNFNNSKTEPKLDVEKEIELAMKSKKALENDEDARKKMKELGLERARKYGWH  248

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             DTY FTKAMGEMMID M+ NI VVI+RP++I+ST+KEPFPGW+EG R++D +IL+YG+GQ
Sbjct  249   DTYSFTKAMGEMMIDTMKENISVVIIRPTLIQSTYKEPFPGWIEGIRLLDLMILYYGRGQ  308

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLA  1515
             L   + DPNG+LD VP DMVVNATLAA+AKHG     KP   +Y IASSV NPLV   L 
Sbjct  309   LNELVGDPNGLLDAVPVDMVVNATLAAIAKHGQVVIQKPEVKVYQIASSVTNPLVTKYLM  368

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGK-LS  1692
              LL+EHF S P++DS G PI VP MKLF+SME  S+HL   A+ +S    +G S G+ L+
Sbjct  369   SLLHEHFDSLPFLDSNGSPIRVPLMKLFTSMEDFSAHLLDGAMQRS---IIGSSNGELLA  425

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              K   I R+     K  A++Y PY FY GRFD SN   LM+ M++EE+ +FGF++ SIDW
Sbjct  426   QKQYEILRR-----KEFANVYLPYGFYAGRFDCSNTLGLMQIMNEEEKKKFGFDMGSIDW  480

Query  1873  KDYISNVHIPGLRRHVMKGR  1932
             K YI+NVH+PGLRRHVMK R
Sbjct  481   KHYITNVHVPGLRRHVMKER  500



>ref|XP_006492917.1| PREDICTED: fatty acyl-CoA reductase 2-like [Citrus sinensis]
Length=514

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/495 (59%), Positives = 378/495 (76%), Gaps = 14/495 (3%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GI I +FL GKSF +TG TGFL KVLIEKILRTVP+V KI++LIKA++KE A ERLK E+
Sbjct  4     GIDIEKFLVGKSFFVTGATGFLAKVLIEKILRTVPEVGKIFLLIKAESKEAASERLKNEV  63

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+AELFK ++QTYG+ Y  FML+KLVPV+GN+ ES+LG++   A +IA EVD+I+NSAA+
Sbjct  64    INAELFKCIQQTYGECYHDFMLNKLVPVIGNISESNLGLEGDLATVIANEVDVIINSAAS  123

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
              TF ERYD+A+DINT GP  +M FA +C K+K+F+HVSTAYVNG+RQG+I+EKPFC+G++
Sbjct  124   ITFHERYDIAIDINTRGPAHIMTFAKKCKKVKVFVHVSTAYVNGKRQGRIMEKPFCMGDT  183

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQDT  1167
             IA E  +N +   +  KL+V  E+E+ + +K+ L +D    +KMKELGLERA K  WQDT
Sbjct  184   IARE--LNFSNFKTETKLDVGKEIELAVKSKKALENDEDALKKMKELGLERARKHRWQDT  241

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y+FTKAMGEM+ID M+ NIP+VI+RP +IEST+KEPFPGW+EGNRM+D II +YGKGQL 
Sbjct  242   YIFTKAMGEMLIDTMKENIPIVIIRPGIIESTYKEPFPGWIEGNRMLDLIISYYGKGQLN  301

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLARL  1521
             GF+ DP+G++D+VP DMVVNA LAA+AKHG A   KP   +Y IASSV NPLV      L
Sbjct  302   GFVGDPSGIIDLVPVDMVVNAMLAAIAKHGQAIIQKPEIKVYQIASSVTNPLVIKYFTSL  361

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
             L+EHF S P++DSKG PI VP +KLF+S E  S+H    A+ +S    +G S G+L  + 
Sbjct  362   LHEHFDSSPFLDSKGSPIRVPLVKLFTSREDFSAHFLEGAMQRS---IIGSSTGELLVQN  418

Query  1702  E-NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
             +  I R+     K  A+IY PY  Y GRFD+SN   LM+ M++EE+ +FGF++ SIDWK 
Sbjct  419   QYEILRR-----KEFANIYHPYGIYAGRFDSSNTLGLMQIMNEEEKKKFGFDMGSIDWKH  473

Query  1879  YISNVHIPGLRRHVM  1923
             YI+NVH+PGLRRHVM
Sbjct  474   YITNVHVPGLRRHVM  488



>ref|XP_006492870.1| PREDICTED: fatty acyl-CoA reductase 2-like [Citrus sinensis]
Length=523

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/496 (58%), Positives = 375/496 (76%), Gaps = 14/496 (3%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI +FL GKSF +TG TGFL KVLIEKILR  P+V KI++LIKA+++E A +RLK E+
Sbjct  13    GIGIEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEV  72

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+AELFK L+QTYG+ YQ FML+ LVPVVGN+ E +LG++ + A +IA EVD+I+NSAA+
Sbjct  73    INAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEGNLATVIANEVDVIINSAAS  132

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
              TF ERYD+A+DINT GP+ +M F  +C K+K+F+H+STA+ NG+RQG+ +EKPF +G++
Sbjct  133   ITFHERYDIAIDINTRGPSHVMNFTKKCKKVKVFVHMSTAFANGKRQGRTMEKPFYMGDT  192

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQDT  1167
             IA E  +N N   + PKL+VE E+ + + +K+ L +D    +KMKELGLERA K+GW DT
Sbjct  193   IARE--LNFNNSKTEPKLDVEKEIGLAMKSKKALENDEDARKKMKELGLERARKYGWHDT  250

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGEMMID M+ NI VVI+RP++I+ST+KEPFPGW+EGNR+ D +IL+YG+GQL 
Sbjct  251   YSFTKAMGEMMIDTMKENISVVIIRPTLIQSTYKEPFPGWIEGNRLWDLMILYYGRGQLN  310

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLARL  1521
               + DPNG+LD VP DMVVNATLAA+AKHG     KP   +Y IASSV NPLV   L  L
Sbjct  311   ELVGDPNGLLDAVPVDMVVNATLAAIAKHGQVVIQKPEVKVYQIASSVTNPLVTKYLMSL  370

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKG-KLSTK  1698
             L+EHF S P++DSKG PI VP MKLF+SME  S+HL   A+ +S    +G S G +L+ K
Sbjct  371   LHEHFDSSPFLDSKGSPIRVPLMKLFTSMEDFSAHLLDGAMQRS---IIGSSNGEQLAQK  427

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
                I R+     K  A++Y PY FY GRFD SN   LM+ M++EE+ +FGF++ SIDWK 
Sbjct  428   QYEILRR-----KEFANVYLPYGFYAGRFDCSNTMGLMQIMNEEEKKKFGFDMGSIDWKH  482

Query  1879  YISNVHIPGLRRHVMK  1926
             YI+NVH+PGL R+VMK
Sbjct  483   YITNVHVPGLMRNVMK  498



>ref|XP_006429863.1| hypothetical protein CICLE_v10013412mg, partial [Citrus clementina]
 gb|ESR43103.1| hypothetical protein CICLE_v10013412mg, partial [Citrus clementina]
Length=485

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/498 (58%), Positives = 371/498 (74%), Gaps = 25/498 (5%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI +FL GKSF +TG T FL KVLIEKILRTVP+V KI++LIKA+++E A ERLK E+
Sbjct  4     GIGIEKFLVGKSFFVTGATWFLAKVLIEKILRTVPEVGKIFLLIKAESEEAASERLKNEV  63

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+AELFK ++QTYG+ Y  FML+KLVPV+GN+ ES+LG++   A +IA EVD+I+NSAA+
Sbjct  64    INAELFKCIQQTYGECYHDFMLNKLVPVIGNISESNLGLEGDLATVIANEVDVIINSAAS  123

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
              TF ERYD+A+DINT GP  +M FA +C K+K+F+HVSTAYVNG+RQG+I+EKPFC+G++
Sbjct  124   ITFHERYDIAIDINTRGPAHIMTFAKKCKKVKVFVHVSTAYVNGKRQGRIMEKPFCMGDT  183

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQDT  1167
             IA E  +N +   +  KL+V  E+E+ + +K+ L +D    +KMKELGLERA K GWQDT
Sbjct  184   IARE--LNFSNSKTETKLDVGKEIELAVKSKKALENDEDALKKMKELGLERARKHGWQDT  241

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y+FTKAMGEM+ID M+ NIP+VI+RP +IEST+KEPFPGW+EGNRM+D I+ +YGK    
Sbjct  242   YIFTKAMGEMLIDTMKENIPIVIIRPGIIESTYKEPFPGWIEGNRMLDLIVSYYGK----  297

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLARL  1521
                    G+   VP DMVVNA LAA+AKHG A   KP   +Y IASSV NPLV      L
Sbjct  298   -------GLAKWVPVDMVVNAMLAAIAKHGQAIIQKPEIKVYQIASSVTNPLVIKYFTSL  350

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
             L+EHF S P++DSKG PI VP MKLF+SME  S+H    A+ +S    +G SKG+L  + 
Sbjct  351   LHEHFDSSPFLDSKGSPIRVPLMKLFTSMEDFSAHFLEGAMQRS---IIGSSKGELLVQN  407

Query  1702  E-NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
             +  I R+     K  A+IY PY  Y GRFD+SN   LM+ M++EE+ +FGF++ SIDWK 
Sbjct  408   QYEILRR-----KEFANIYHPYGIYVGRFDSSNTLGLMQIMNEEEKKKFGFDMGSIDWKH  462

Query  1879  YISNVHIPGLRRHVMKGR  1932
             YI+NVH+PGLRRHVMK R
Sbjct  463   YITNVHVPGLRRHVMKER  480



>gb|EMS49198.1| Fatty acyl-CoA reductase 2 [Triticum urartu]
Length=580

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/502 (55%), Positives = 359/502 (72%), Gaps = 10/502 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGI+ FL GK+FLITGGTGFL KV+IEKILRT PDV KIY+LIKA + + A++RL+ E
Sbjct  81    DGIGIIEFLGGKNFLITGGTGFLAKVIIEKILRTTPDVGKIYVLIKAKDSKAALKRLQIE  140

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  ELFK L+Q +GK Y+ F+  KLV VVGNV E+++GI    A+ I K VDII+NSAA
Sbjct  141   IVGTELFKCLEQLHGKDYRHFLARKLVTVVGNVREANMGIAPELADEIVKTVDIIINSAA  200

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD+A+D+NT GP RLM FA +  KLKLFLHVSTAYVNG+RQG ++EKPF +G+
Sbjct  201   NTTFDERYDIAMDVNTMGPFRLMSFARRFSKLKLFLHVSTAYVNGRRQGVVLEKPFSLGD  260

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGA-MAQKMKELGLERANKFGWQD  1164
             +I  E   + +       L++E E+++   ++   +D A  +Q+MK+LG+ERA   GWQD
Sbjct  261   TITKELGYSDSSGLQNTVLDIEAEIKLAFCSRHNSNDAASFSQEMKDLGIERAKLHGWQD  320

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEM++D+MRG IPVV +RPS+IE T  EP PGW+EG RM+DPI+L+Y KG+L
Sbjct  321   TYVFTKAMGEMVLDSMRGEIPVVTIRPSIIEGTCSEPIPGWIEGIRMLDPIMLYYAKGRL  380

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLAR  1518
             +GF  D +GV+DVVPADMV NATLAA+AKH  A        IYH+ SS  NPL++  +  
Sbjct  381   SGFPADGDGVVDVVPADMVANATLAAVAKHAQAIGAAQEMHIYHVGSSTANPLIWRSMFT  440

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTK  1698
               ++HF   P+  + G+PI V  M+LF SM   +S+L RD +    L   G++   LS +
Sbjct  441   FFFQHFTRYPFNLASGQPIKVAPMRLFGSMLQFNSNLERDML----LWGAGET---LSPR  493

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
                +  K  E+  +LA +Y+PY FYG RFDN+N + L   MS EE+ QF F+V SI+WKD
Sbjct  494   ARMLFSKYAEKIIHLARMYQPYGFYGCRFDNANTEALFAEMSVEEKAQFHFDVRSIEWKD  553

Query  1879  YISNVHIPGLRRHVMKGRGSCS  1944
             Y +NVHIPG  +HVMKGRG  S
Sbjct  554   YFTNVHIPGFLKHVMKGRGGSS  575



>ref|XP_007048737.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOX92894.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=584

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/498 (55%), Positives = 359/498 (72%), Gaps = 13/498 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GIV FL+GK++ ITG TGF+GKV +EK+LR VP+V KI++LIKA +KE A +RL+ +
Sbjct  81    DGLGIVDFLQGKNYFITGATGFVGKVFVEKMLRAVPNVGKIFLLIKAKDKEAATKRLQDQ  140

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  ELFK L++ +G SY+ FM +KLVPVVGNV E DLG+D   A  IA EVDIIVNSAA
Sbjct  141   IMDTELFKSLEKVHGTSYKTFMKNKLVPVVGNVNEPDLGMDADMASEIANEVDIIVNSAA  200

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFD+RYD  L+ NT GP RL+ FA +C KL LFLH STAYV+G+R+G I+E+P C G+
Sbjct  201   NTTFDDRYDATLNTNTMGPYRLLGFAKKCKKLSLFLHFSTAYVHGKRKGIILERPLCEGQ  260

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMA--QKMKELGLERANKFGWQ  1161
             S+A         E S P L++E E+++ L+ K+  S   +A  QKMKELG+ERA  +GWQ
Sbjct  261   SVA-------EAEESSPVLDIEAEIKLALNLKRSFSGTEIAWNQKMKELGMERARAYGWQ  313

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             +TY FTKAMGEM+I++ RG+IPVVI+RPS+IEST +EPFPGW+EG+RM+DPII+ + KG 
Sbjct  314   NTYSFTKAMGEMLINSTRGDIPVVIIRPSIIESTFREPFPGWIEGSRMLDPIIIGHAKGH  373

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
             LTGF+  P  V+DVVP DMVVNA++AAMAK G AGKPG  +YHI SSV NP+ F  + + 
Sbjct  374   LTGFVGHPETVIDVVPVDMVVNASMAAMAKQGLAGKPGLIVYHITSSVANPVNFHTILKF  433

Query  1522  LYEHFQSKPYIDSKG-KPIDVPRMKLFSSMEALSSHLWRDA-IDKSGLT-ALGDSKGKLS  1692
               +HF   P    KG K      +KLF S +  SS++W ++ + ++ L  A   S  KL 
Sbjct  434   SSDHFNCFPIKGLKGLKTTGTTDIKLFRSADIFSSNIWGESTVGQNELKGAAAPSDPKLR  493

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              + E   RK ++   +LA +YEPY+ YGG FD+ N  KL+  MS EER  FGF+V+SIDW
Sbjct  494   RRQETEYRK-IKLYIHLAKLYEPYSHYGGWFDSGNTIKLIRDMSMEERENFGFDVQSIDW  552

Query  1873  KDYISNVHIPGLRRHVMK  1926
             + Y  N+HIPGLRRHVMK
Sbjct  553   EHYFLNIHIPGLRRHVMK  570



>ref|XP_001771307.1| predicted protein [Physcomitrella patens]
 gb|EDQ63867.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   535 bits (1378),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 266/507 (52%), Positives = 347/507 (68%), Gaps = 25/507 (5%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             G+GI++FL+GK+ L+TG TGFL KV++EKILR  PDV ++Y+LI+      A ERLK  +
Sbjct  1     GLGILKFLKGKNLLVTGATGFLAKVMVEKILRVQPDVGQLYLLIQPQKNVTAEERLKNNV  60

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             IS+ LF  LK ++G +Y+ FM +KL  V G +    LGI +  AE I+K V IIVNSAA 
Sbjct  61    ISSPLFSVLKDSFGDAYEEFMNNKLTAVSGTISADGLGIANDKAEEISKTVHIIVNSAAT  120

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TTFDERYD+AL++NT GP R+++FA  C  L+LFLHVSTA+VNGQR+G   EKPF +G+S
Sbjct  121   TTFDERYDIALNVNTQGPRRIIEFARGCPNLQLFLHVSTAFVNGQRRGDTPEKPFRMGDS  180

Query  991   IAGESVVNGNQESSVPKLNVEDEMEM-------VLSAKQGLSDGAMAQ------KMKELG  1131
             IA E       E  +P L+V  E+ +       V++     S  A  Q      KMKELG
Sbjct  181   IAKEM-----SEDCIPDLHVASELALCAKTLQEVVAEVSRTSVSASEQQLIVDKKMKELG  235

Query  1132  LERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMD  1311
             + RA  FGWQDTYVF+KAMGEM+++++RG IPVV++RPSV+EST  +PFPGWMEG RMMD
Sbjct  236   MTRAKLFGWQDTYVFSKAMGEMLVESLRGEIPVVVLRPSVVESTLAQPFPGWMEGIRMMD  295

Query  1312  PIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVN  1491
             PI+L Y KGQ+TGFL DP GVLDV+PAD+VVNA LAAM KH  A  PG  +Y +ASSVVN
Sbjct  296   PIVLAYAKGQMTGFLADPRGVLDVIPADLVVNALLAAMTKH--AQNPGLQVYQVASSVVN  353

Query  1492  PLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALG  1671
             P+ F+ LA +  E F   P ID  G+P+ + RM+   SM A + +LW  +     +    
Sbjct  354   PMTFELLADVALELFTKDPMIDRAGQPVKLQRMRFVQSMTAFNLYLWFLSKILPWM----  409

Query  1672  DSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGF  1851
               +GK S + E I +K++EQ KYLA IY+PYTFY GRF   N + L + +S+EE   F F
Sbjct  410   -KRGKSSARRELIVKKTLEQFKYLAYIYKPYTFYAGRFGIENTESLSQELSEEELNMFAF  468

Query  1852  EVESIDWKDYISNVHIPGLRRHVMKGR  1932
              +  IDW DY+SNVHIPGLR +V+KGR
Sbjct  469   NIRQIDWADYLSNVHIPGLRNYVLKGR  495



>emb|CDP14283.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   529 bits (1363),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 248/340 (73%), Positives = 290/340 (85%), Gaps = 0/340 (0%)
 Frame = +1

Query  913   LHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL  1092
             L +  AYVNG+RQG ++EKPF  GESIA ES++ G   + +P LNVEDE+++VL +KQ +
Sbjct  2     LFLPAAYVNGRRQGTVMEKPFSAGESIARESLLFGADCTFLPTLNVEDEIKLVLESKQAI  61

Query  1093  SDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKE  1272
              D  +AQ+MK LGLERANKFGWQDTYVFTKAMGEMMID++RG+IPVVI+RPSVIEST++E
Sbjct  62    DDSVLAQRMKSLGLERANKFGWQDTYVFTKAMGEMMIDSLRGDIPVVIIRPSVIESTYRE  121

Query  1273  PFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKP  1452
             PFPGW+EG+RMMDP++L+YGKGQL+GFL DPNGVLDVVPADMVVNA LAAMAKHG AGK 
Sbjct  122   PFPGWIEGSRMMDPVLLYYGKGQLSGFLADPNGVLDVVPADMVVNAILAAMAKHGEAGKS  181

Query  1453  GTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW  1632
              ++IY IASSVVNPLVF DLA LLYEHF S P  DSKGKPI VP+M+LF SME  S+HL 
Sbjct  182   ESNIYQIASSVVNPLVFKDLATLLYEHFNSSPCFDSKGKPIRVPKMELFRSMEDFSTHLR  241

Query  1633  RDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLM  1812
             RDAI +SGL A     GK+S KLE+ICRKSVEQA+YLA++YEPYTFYGGRFDNSN   LM
Sbjct  242   RDAISRSGLAASPHPGGKMSGKLESICRKSVEQAEYLANLYEPYTFYGGRFDNSNTHLLM  301

Query  1813  ECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
               MSKEER +FGF+VE+IDWKDYISN+HIPGLRRHVMKGR
Sbjct  302   GYMSKEERRKFGFDVENIDWKDYISNIHIPGLRRHVMKGR  341



>ref|XP_002323221.2| hypothetical protein POPTR_0016s03140g [Populus trichocarpa]
 gb|EEF04982.2| hypothetical protein POPTR_0016s03140g [Populus trichocarpa]
Length=510

 Score =   532 bits (1370),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 257/499 (52%), Positives = 358/499 (72%), Gaps = 11/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIV FL+GK++ ITG TGFLGK L+EK+LR +PDV K+++LIK  +KE  M+RLK E
Sbjct  10    DGIGIVEFLQGKNYFITGATGFLGKALVEKMLRGIPDVGKLFLLIKGKDKEATMKRLKSE  69

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+AE+FK LK  +G SY+ FM+SKLVPV G+VC ++LGID  T   IAKE+D+I+NSAA
Sbjct  70    IINAEVFKILKAIHGSSYEAFMMSKLVPVCGDVCSANLGIDADTTNEIAKEIDVIINSAA  129

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TT+D RYDVA++INT GP R+++F  +C KL+LFLHVS+AYVNG RQG   EKPFC+  
Sbjct  130   KTTWDTRYDVAININTKGPARVLEFGKKCKKLRLFLHVSSAYVNGTRQGVFFEKPFCLEP  189

Query  988   SIA-GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
               A  +++ +  QE SVP L+++ E+++   A + +   A  + M+ELG+ERA   GW  
Sbjct  190   RTARRDTITSKAQEISVPFLDIDAEIKLASVAVESIGRNA-DRIMRELGMERARIHGWCS  248

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TY  TKAMGEM+ID+MR +IP VI+RPS+IEST++EPFPGW++G ++  PI+  YG+ QL
Sbjct  249   TYEMTKAMGEMLIDSMRSSIPTVIIRPSLIESTYREPFPGWIQGYKV--PILAAYGQCQL  306

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
              GF+ DP+ + D VP DMVVNATL A+AKHG  GKP   +YH+A+SV NP  F D     
Sbjct  307   PGFVGDPDTIADTVPMDMVVNATLTALAKHGIDGKPELHVYHVATSVANPHSFKDAFNYA  366

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-----LGDSKGKL  1689
             Y++F S P +DSKGK I +  MK  +SM++ +  +  +   +SGLT      + D K  L
Sbjct  367   YDYFSSSPLLDSKGKKIAIRPMKFLASMDSFTDFIKNEVAQRSGLTPDDNVYMSDPKRYL  426

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESID  1869
               +L   C K+V +   +A++Y+ Y FY GRFD +N ++L+E MS EER +F F++ESI+
Sbjct  427   RMQLA--CFKTVHRFMRIANLYKAYMFYKGRFDVTNTKRLIEDMSIEERKRFNFDIESIN  484

Query  1870  WKDYISNVHIPGLRRHVMK  1926
             W+ YI +VHIPG+R+H+++
Sbjct  485   WEHYIKSVHIPGVRKHLLR  503



>ref|XP_002534422.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF27960.1| Male sterility protein, putative [Ricinus communis]
Length=442

 Score =   528 bits (1359),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 250/442 (57%), Positives = 331/442 (75%), Gaps = 4/442 (1%)
 Frame = +1

Query  607   MERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVD  786
             ME LK EII+A++FK LKQ YG+SYQ FMLSKLVPVVGN+CESDLG++   A +I++EV 
Sbjct  1     MEILKTEIINADVFKCLKQKYGQSYQNFMLSKLVPVVGNICESDLGLEATMANVISREVH  60

Query  787   IIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIE  966
             +I+NSAANT F+ERYDV++D NT G   LM FA  C  L LFL +S+AY NG R+G I+E
Sbjct  61    VIINSAANTRFNERYDVSIDTNTRGTYHLMNFAKYCKNLSLFLQISSAYANGPRKGIIME  120

Query  967   KPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERAN  1146
             K F +G++I GE   + N+ +S+P LNVE E+++   A     D ++ Q +K+LGLERA 
Sbjct  121   KKFSMGDTITGEKSNSENRSTSLPILNVEKEIQLAFDAIDTFQDNSLTQNLKKLGLERAE  180

Query  1147  KFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILH  1326
             ++GW DTY FTKAMGEM+ID+MRG IPVVI+RPS+IEST+++PFPGW++GNRM+DP++++
Sbjct  181   RYGWHDTYAFTKAMGEMIIDSMRGEIPVVIIRPSIIESTYRDPFPGWIQGNRMLDPLMVY  240

Query  1327  YGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFD  1506
             YGKGQLT FL DPN V+D+VPAD VVNATLAA+AKHG   +P  +IY + SSVVNPL   
Sbjct  241   YGKGQLTCFLADPNCVVDIVPADTVVNATLAAVAKHGMTREPVINIYQVGSSVVNPLTLQ  300

Query  1507  DLARLLYEHFQSKPYIDSKGKPIDVPR-MKLFSSMEALSSHLWRDAIDKSGLTALGDSKG  1683
             +L  L++EHF+  P++DSKG PI+V   MKL +S+E  S+HL  D   +    A+   + 
Sbjct  301   ELVTLVFEHFKCNPFLDSKGNPINVTAPMKLCTSVEEFSTHLKTDVAKQREFMAM---EF  357

Query  1684  KLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVES  1863
             K S + E   +K +E  + LA+IY+PY FY GRFD SN Q LME MS+EE+ +FGF+V+S
Sbjct  358   KNSKRPEIYAQKLMELVRQLATIYKPYGFYKGRFDCSNLQGLMENMSEEEKIEFGFDVKS  417

Query  1864  IDWKDYISNVHIPGLRRHVMKG  1929
             IDW  YI NVH+PGLR HVM+ 
Sbjct  418   IDWGHYIKNVHVPGLRMHVMQS  439



>ref|XP_011041378.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X1 [Populus 
euphratica]
Length=509

 Score =   530 bits (1364),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 256/499 (51%), Positives = 355/499 (71%), Gaps = 11/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIV FL+GK++ ITG TGFLGK L+EK+LR +PDV K+++LIK  +KE  M+RLK E
Sbjct  9     DGIGIVEFLQGKNYFITGATGFLGKALVEKMLRAIPDVGKLFLLIKGKDKEATMKRLKIE  68

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+AE+FK LK  +G SY+ FM+SKLVPV G+VC ++LGID  T   IAKE+D+I+NSAA
Sbjct  69    IINAEVFKILKAIHGSSYEAFMMSKLVPVCGDVCSANLGIDADTTSEIAKEIDVIINSAA  128

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TT+D RYDVA++INT GP R+++F  +C KL LFLHVS+AYVNG RQG   EKPFC+ +
Sbjct  129   KTTWDTRYDVAININTKGPARVLEFGKKCKKLGLFLHVSSAYVNGTRQGVFFEKPFCLEQ  188

Query  988   SIA-GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
               A  +++ +  QE SVP L+++ E+++   A + +   A  + M+ELG+ERA   GW  
Sbjct  189   RTAMRDTITSKAQEISVPFLDIDAEIKLASVAVESIDRNA-DRIMRELGMERARIHGWCS  247

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TY  TKAMGEM+ID+MR +IP VI+RPS+IEST++EPFPGW++G ++  PI+  YG+ QL
Sbjct  248   TYEMTKAMGEMLIDSMRSSIPTVIIRPSLIESTYREPFPGWIQGYKV--PILAAYGQCQL  305

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
              GF+ DP+ + D VP DMVVNATL A+AKHG  GKP   +YH+A+SV NP  F D     
Sbjct  306   PGFVGDPDTIADTVPMDMVVNATLTALAKHGIDGKPELHVYHVATSVANPHSFKDAFNYA  365

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-----LGDSKGKL  1689
             Y++F S P +DSKGK I +  MK   SM++ +  +  +   +SGL+      + D K  L
Sbjct  366   YDYFSSSPLLDSKGKKIAIRPMKFLVSMDSFTDFIKNEVAQRSGLSPDDNVYMSDPKRYL  425

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESID  1869
                L   C  +V +   +A++Y+PY FY GRFD  N ++L+E MS EER +F F++ESI+
Sbjct  426   RMHLA--CFDTVHRFMRIANLYKPYMFYKGRFDVRNTKRLIEDMSSEERKKFNFDIESIN  483

Query  1870  WKDYISNVHIPGLRRHVMK  1926
             W+ YI +VHIPG+R+H+++
Sbjct  484   WEHYIKSVHIPGVRKHLLR  502



>gb|KCW65408.1| hypothetical protein EUGRSUZ_G02832 [Eucalyptus grandis]
Length=505

 Score =   526 bits (1354),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 257/499 (52%), Positives = 350/499 (70%), Gaps = 10/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGI+ FL G++FL+TG TGFL KVLIEKILR  P+V KI++LIKA +K+ AM+R+K E
Sbjct  9     DGIGILNFLEGRNFLVTGATGFLAKVLIEKILRVSPNVGKIFLLIKAKDKQAAMDRVKDE  68

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELFK L+Q YG+ Y  FMLSKLVPV G++ ES++GI D +   I +EVD+I+NSAA
Sbjct  69    IIGCELFKCLRQQYGEGYTNFMLSKLVPVNGDIRESNMGIGDDSFCQITQEVDVIINSAA  128

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTT DERYD AL  NT  P+RL+ FA +C KL LFLH+ST YVNG+R G ++EK F +G+
Sbjct  129   NTTLDERYDAALVANTIAPSRLLSFAKKCKKLSLFLHLSTTYVNGERPGILMEKAFEMGD  188

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S    S           KL+V  E+ +     + L    + QK+KE+GL R   +GWQ+ 
Sbjct  189   SRIDSSTQG--------KLDVHHEINLASDLIETLPPNEVPQKLKEIGLARPRMYGWQNV  240

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G R++DP+IL YGKG+L 
Sbjct  241   YQMTKAMGEMMINADRGRVPVVIVRPSVIESTFQEPFPGWIQGYRVLDPLILSYGKGRLP  300

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLV+P+ V+DVVPAD+V N  +AAMAKHG    PG  +YH ASS VNP+   D+    +
Sbjct  301   GFLVNPDTVMDVVPADLVANVIIAAMAKHGIVTSPGIDVYHAASSTVNPMTMCDMFNYSH  360

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALGDS-KGKLSTKL  1701
             ++F + P +D++G  I +  M+ FSS+++ SS++ +D  +K GL+  +G +   K  ++L
Sbjct  361   DYFAASPLMDNQGDEIQIADMEYFSSIDSFSSYIQKDIAEKGGLSEEIGPNLNPKQRSRL  420

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLM  MS EE  +F  +++S++W+DY
Sbjct  421   EARCKRMTENLIHLAKLYEPYMFYRARFDSWNTRKLMRQMSTEESNKFPMDLKSVNWEDY  480

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
              +N HIPGL+RHV+K   S
Sbjct  481   FANAHIPGLKRHVIKKPSS  499



>gb|KCW45312.1| hypothetical protein EUGRSUZ_L01017 [Eucalyptus grandis]
Length=500

 Score =   525 bits (1353),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 258/500 (52%), Positives = 347/500 (69%), Gaps = 10/500 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FL+TG TGF+ KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  9     DGVGIIDFLERRNFLVTGATGFVAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMDRVKDE  68

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI   +   I +EVD+IVNSAA
Sbjct  69    IIGCELFICLQQKYGEEYTSFMLSKLVPVKGDIRESNMGIGHDSFRQITQEVDVIVNSAA  128

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  129   NTTFDERYDKALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  188

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +GW + 
Sbjct  189   SRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEIGLARARMYGWHNV  240

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSV+EST +EPFPGW++GNRM+DP+IL YGKG+L 
Sbjct  241   YEMTKAMGEMMINADRGRVPVVIVRPSVVESTFREPFPGWIQGNRMLDPLILSYGKGRLP  300

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDPN V+DV+PAD+V N  +AAMAKHG    P   +Y  ASS VNP++  D+     
Sbjct  301   GFLVDPNTVMDVIPADLVANVIIAAMAKHGTTASPSIDVYDAASSTVNPIMMCDVFNYSR  360

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D  +KSGL+  +G +S  K  ++L
Sbjct  361   DYFAASPLTDDQGDGIQITDMEYFSSIDSFSSYIQKDIAEKSGLSKEIGPNSNLKQRSRL  420

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLME MS EE  +F  ++ SI+W+DY
Sbjct  421   EARCKRMAESITHLAKLYEPYMFYRARFDSWNTRKLMEQMSTEEGNKFPIDLRSINWEDY  480

Query  1882  ISNVHIPGLRRHVMKGRGSC  1941
              +N HIPGL+RHV+K   S 
Sbjct  481   FANAHIPGLKRHVIKKASSS  500



>emb|CBI39166.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   528 bits (1360),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 267/488 (55%), Positives = 342/488 (70%), Gaps = 26/488 (5%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             G+GI++FL GK++ ITG TG L K ++EKILR  PDV KI+ILIKA NKE A++RLK EI
Sbjct  87    GLGILQFLAGKTYFITGATGLLAKAVVEKILRRAPDVGKIFILIKAKNKEAAVDRLKTEI  146

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I++ELF+ LKQ +GK YQ FMLSKL PVVGN+CESDLGID +    IA+EVD+I+NSAAN
Sbjct  147   INSELFECLKQRHGKYYQDFMLSKLAPVVGNLCESDLGIDANLISEIAEEVDVIINSAAN  206

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQ-CHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             T F+ERYDV+L  NT GP RLM FA + C  L++FLHVSTAYVNG+R+G I EKPF +GE
Sbjct  207   TNFEERYDVSLHANTIGPCRLMDFAKKYCKNLRVFLHVSTAYVNGEREGMITEKPFYMGE  266

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             SIA E V +     S P L+V+DE+++ L +K         QKMKELGLERA   GW + 
Sbjct  267   SIAREKVASEFLPLSYPALDVDDEIKIALDSKVAFEGNLEDQKMKELGLERARIHGWHNP  326

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR---------------  1302
             Y FTKAMGEMMI++MRG+IP+VI+RP+ IEST ++PFPGW++GNR               
Sbjct  327   YEFTKAMGEMMINSMRGDIPLVIIRPTAIESTLEDPFPGWIQGNRYLISLPFSCPCTKSH  386

Query  1303  ------MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSI  1464
                   M+DP+IL YGKG L  FLV+P  V+D++P DMVVNA +AAMAKHG AGKPG  +
Sbjct  387   IFSYNQMLDPMILSYGKGNLPSFLVNPEVVIDMIPVDMVVNAIIAAMAKHGIAGKPGIKV  446

Query  1465  YHIASSVVNPLVFDDLARLLYEHFQSKPY-IDSKGKPIDVPRMKLFSSMEALSSHLWRDA  1641
             YH+ SS VN L   DL +  YEHF   P  +D++GK  D+  MK FSSM+  SSH+  + 
Sbjct  447   YHVGSSAVNLLPLGDLFKYSYEHFICSPINMDTEGKTTDMKEMKFFSSMDDFSSHMQTEI  506

Query  1642  IDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECM  1821
             + +  L   G++    S +LE  C+  VE A  LA +Y+P+ F+ GRFDNSN  K+ME M
Sbjct  507   VQQRRLAISGNNA---SQRLERKCKMIVEHAINLARVYQPHMFFRGRFDNSNTHKIMEGM  563

Query  1822  SKEERWQF  1845
             S+EE  +F
Sbjct  564   SEEEMKRF  571



>ref|XP_010067301.1| PREDICTED: fatty acyl-CoA reductase 2-like [Eucalyptus grandis]
Length=573

 Score =   528 bits (1359),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 260/499 (52%), Positives = 348/499 (70%), Gaps = 10/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  82    DGVGIIDFLERRNFLITGATGFLAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMQRVKNE  141

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  142   IIGCELFICLQQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  201

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             N T DERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  202   NATLDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  261

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S    S  +        KL+V  E+ +V    + L    + QK+KE+GL RA  +GWQ+ 
Sbjct  262   SRIDSSTQS--------KLDVHHEISLVSDLIETLPPNEVPQKLKEIGLARARMYGWQNV  313

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  314   YEMTKAMGEMMINADRGRVPVVIVRPSVIESTFREPFPGWIQGYRMLDPLILSYGKGRLP  373

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDP+ VLDVVPAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  374   GFLVDPDTVLDVVPADLVANVIIAAMAKHGITASPSIDVYHAASSTVNPVMACDIFDYSR  433

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D ++KSGL+  +G +S  K  ++L
Sbjct  434   DYFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIVEKSGLSKEIGPNSNPKQRSRL  493

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLME MS +E  +F  ++ SI+W+DY
Sbjct  494   EARCKRMAESIIHLAKLYEPYAFYRARFDSWNTRKLMEQMSTKEGNKFPIDLRSINWEDY  553

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
              +N HIPGL+RHV+K   S
Sbjct  554   FTNAHIPGLKRHVIKKASS  572



>gb|KCW65407.1| hypothetical protein EUGRSUZ_G02831 [Eucalyptus grandis]
Length=591

 Score =   528 bits (1360),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 260/499 (52%), Positives = 348/499 (70%), Gaps = 10/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  100   DGVGIIDFLERRNFLITGATGFLAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMQRVKNE  159

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  160   IIGCELFICLQQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  219

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             N T DERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  220   NATLDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  279

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S    S  +        KL+V  E+ +V    + L    + QK+KE+GL RA  +GWQ+ 
Sbjct  280   SRIDSSTQS--------KLDVHHEISLVSDLIETLPPNEVPQKLKEIGLARARMYGWQNV  331

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  332   YEMTKAMGEMMINADRGRVPVVIVRPSVIESTFREPFPGWIQGYRMLDPLILSYGKGRLP  391

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDP+ VLDVVPAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  392   GFLVDPDTVLDVVPADLVANVIIAAMAKHGITASPSIDVYHAASSTVNPVMACDIFDYSR  451

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-LG-DSKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D ++KSGL+  +G +S  K  ++L
Sbjct  452   DYFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIVEKSGLSKEIGPNSNPKQRSRL  511

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLME MS +E  +F  ++ SI+W+DY
Sbjct  512   EARCKRMAESIIHLAKLYEPYAFYRARFDSWNTRKLMEQMSTKEGNKFPIDLRSINWEDY  571

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
              +N HIPGL+RHV+K   S
Sbjct  572   FTNAHIPGLKRHVIKKASS  590



>ref|XP_001758118.1| predicted protein [Physcomitrella patens]
 gb|EDQ76940.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   523 bits (1348),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 267/515 (52%), Positives = 348/515 (68%), Gaps = 26/515 (5%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             G+GIV FL+GK+ L+TG TGFL KV++EKILR  PDV ++Y+LI+        ERLK  +
Sbjct  1     GLGIVEFLKGKNLLVTGATGFLAKVMVEKILRVQPDVGQLYLLIQPQKDVTVEERLKNNV  60

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I++ LFK LKQ YG  Y+ FM  KL  V G +    LGI++  +E I+K+V +IVNSAA 
Sbjct  61    INSPLFKVLKQIYGDDYEEFMNKKLTAVSGTISTDGLGIENIVSEDISKQVQVIVNSAAI  120

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TTFDERYD+AL++NT GP R+++FA  C  L+LFLH+STA+VNGQRQG   EKPF +G+S
Sbjct  121   TTFDERYDIALNVNTQGPRRIIEFARGCPNLQLFLHISTAFVNGQRQGATPEKPFKMGDS  180

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMV---------------LSAKQGLSDGAMAQKMKE  1125
             IA E          +P+LNV  E+E+                LSA + L    + +KMKE
Sbjct  181   IAKEM-----SHDRIPELNVAAELELCAKTLQDATAEVSLTNLSADKKLQ--VVGKKMKE  233

Query  1126  LGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRM  1305
             LG+ RA  FGWQDTYVF+KAMGEM+++++RGN+PVV++RPSV+EST  +PFPGWMEG RM
Sbjct  234   LGMTRAKLFGWQDTYVFSKAMGEMLVESLRGNMPVVVLRPSVVESTLSQPFPGWMEGLRM  293

Query  1306  MDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV  1485
             MDPI++ Y KGQ+TGFL DP GVLDV+PAD+VVNA LAAM KH  A  P   +Y +ASSV
Sbjct  294   MDPIVVAYAKGQMTGFLADPRGVLDVIPADLVVNALLAAMTKH--AQTPRLKVYQVASSV  351

Query  1486  VNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW--RDAIDKSGL  1659
             VNP+ F+ LA +  E F   P +D  G+PI V RM    SM A + +LW       K   
Sbjct  352   VNPMSFNILADVSLELFTKDPMMDKNGQPIRVQRMNFVQSMTAFNLYLWFVYQLPLKVRP  411

Query  1660  TALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERW  1839
                   KGK   + E I +K++EQ KYLA IY+PYTFY GRF   N + L++ +S+EE  
Sbjct  412   ACTTCRKGKSFARQELIVKKTLEQFKYLAYIYKPYTFYSGRFGIENTESLLKELSEEELE  471

Query  1840  QFGFEVESIDWKDYISNVHIPGLRRHVMKGRGSCS  1944
              F F V  IDW DY+ N+HIPGLR +V+KGRG+ +
Sbjct  472   SFAFNVRQIDWADYLYNIHIPGLRNYVLKGRGTTN  506



>emb|CAN83375.1| hypothetical protein VITISV_003906 [Vitis vinifera]
Length=561

 Score =   524 bits (1349),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 264/512 (52%), Positives = 350/512 (68%), Gaps = 25/512 (5%)
 Frame = +1

Query  409   MKEL-VSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIK  585
             +KE+ VS+      +G+GI++FL GK++ ITGGTGFL K +IEK+LRT PDV KI++LIK
Sbjct  69    LKEMEVSTTNTSITNGLGILQFLPGKTYFITGGTGFLAKAVIEKMLRTAPDVGKIFVLIK  128

Query  586   ADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAE  765
             A NKE A +RLK EII +ELF+ LKQ +GK Y+ FMLSKL PVVGN+CESDLGID ++  
Sbjct  129   AKNKEAATDRLKTEIIDSELFECLKQRHGKYYEDFMLSKLAPVVGNLCESDLGIDANSIS  188

Query  766   MIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQ-CHKLKLFLHVSTAYVNG  942
              IA+EVD+I+NSAANT F+ERYDV+L  N  GP RLM F ++ C  L++FLHVSTAYV+G
Sbjct  189   EIAEEVDVIINSAANTNFEERYDVSLSTNVLGPRRLMDFTNKYCKNLRVFLHVSTAYVSG  248

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             +R+G I+EKPF +GE IA E   +     + P L+V+ E+E+ L +K         +KMK
Sbjct  249   EREGMIMEKPFHMGERIAREKAASEFPPLAYPVLDVDGEIEIALDSKVAFEGNLEDEKMK  308

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
              LGLERA   GW + Y FTKAMGEM I++MRG+IP+VI+RP+ I ST  +PFPGW++GNR
Sbjct  309   ALGLERARIHGWHNPYEFTKAMGEMXINSMRGDIPLVIIRPTXIGSTLXDPFPGWIQGNR  368

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
             M DP+IL YG G L  FL +P  V+D+V                    KPG  +YH+ S 
Sbjct  369   MADPLILSYGXGNLPSFLXNPEAVIDMV-------------------RKPGIKVYHVGSX  409

Query  1483  VVNPLVFDDLARLLYEHFQSKPY-IDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL  1659
              VNPL   DL +  YEHF   P  +D++GK + +  MK+FS M+  SSH+  + + +  L
Sbjct  410   AVNPLPLGDLFKHSYEHFICSPINMDTEGKTVXMKEMKIFSXMDDFSSHMQTEIVQQRRL  469

Query  1660  TALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERW  1839
             T  G+     S +LE  C   VE A  LA +Y+PY F+ GRFDNSN   LME MS+EE  
Sbjct  470   TISGNXA---SQRLEXKCXMIVEHAINLARVYQPYXFFRGRFDNSNTHNLMEGMSEEEMK  526

Query  1840  QFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             +F  +VE++DW+DYI+N+HI GL++HVMKGRG
Sbjct  527   RFRLDVENVDWEDYITNIHISGLKKHVMKGRG  558



>gb|KCW65406.1| hypothetical protein EUGRSUZ_G02831 [Eucalyptus grandis]
Length=596

 Score =   521 bits (1343),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 260/504 (52%), Positives = 348/504 (69%), Gaps = 15/504 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  100   DGVGIIDFLERRNFLITGATGFLAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMQRVKNE  159

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  160   IIGCELFICLQQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  219

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             N T DERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  220   NATLDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  279

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S    S  +        KL+V  E+ +V    + L    + QK+KE+GL RA  +GWQ+ 
Sbjct  280   SRIDSSTQS--------KLDVHHEISLVSDLIETLPPNEVPQKLKEIGLARARMYGWQNV  331

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  332   YEMTKAMGEMMINADRGRVPVVIVRPSVIESTFREPFPGWIQGYRMLDPLILSYGKGRLP  391

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDP+ VLDVVPAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  392   GFLVDPDTVLDVVPADLVANVIIAAMAKHGITASPSIDVYHAASSTVNPVMACDIFDYSR  451

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D ++KSGL+  +G +S  K  ++L
Sbjct  452   DYFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIVEKSGLSKEIGPNSNPKQRSRL  511

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGG-----RFDNSNAQKLMECMSKEERWQFGFEVESI  1866
             E  C++  E   +LA +YEPY FY       RFD+ N +KLME MS +E  +F  ++ SI
Sbjct  512   EARCKRMAESIIHLAKLYEPYAFYRARLYIDRFDSWNTRKLMEQMSTKEGNKFPIDLRSI  571

Query  1867  DWKDYISNVHIPGLRRHVMKGRGS  1938
             +W+DY +N HIPGL+RHV+K   S
Sbjct  572   NWEDYFTNAHIPGLKRHVIKKASS  595



>gb|EPS67970.1| hypothetical protein M569_06803, partial [Genlisea aurea]
Length=365

 Score =   511 bits (1317),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/369 (66%), Positives = 290/369 (79%), Gaps = 7/369 (2%)
 Frame = +1

Query  826   RYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGES  1005
             RYD ALDINT GP R++ FA  C +LKLF+  S AYVNG+RQG+ +EKPF  GESI GE 
Sbjct  4     RYDTALDINTFGPTRILGFAKTCRRLKLFVQFSAAYVNGERQGRTMEKPFGNGESIRGER  63

Query  1006  VVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKA  1185
             +   NQE     L++E+EM++V   K+     ++ QKMKELG +RANKFGWQDTYVFTKA
Sbjct  64    IPFENQEP----LSIENEMKLVHETKRASEGNSVPQKMKELGKQRANKFGWQDTYVFTKA  119

Query  1186  MGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDP  1365
             MGEMMI++ RGNIPVVI+RPSVIEST+ +PFPGWMEGNRM+DP+I  YGKG LTGFLVDP
Sbjct  120   MGEMMIESRRGNIPVVIIRPSVIESTYNDPFPGWMEGNRMLDPVIQRYGKGHLTGFLVDP  179

Query  1366  NGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSK  1545
             NG++DVVPADMVVNA LAA AKHG  GK  T+IY +ASSVVNPLVF +LA+L+YEHF   
Sbjct  180   NGIIDVVPADMVVNAILAATAKHGQEGKRETNIYQVASSVVNPLVFRELAKLIYEHFALS  239

Query  1546  PYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSV  1725
             P  DS G+ + V  MKLF+ M+  SSHLWR A + SG    G S  +L  KL+ ICRKSV
Sbjct  240   PISDSAGRKVCVSPMKLFTCMDDFSSHLWRQATEPSG---SGLSDRRLLGKLDAICRKSV  296

Query  1726  EQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPG  1905
             EQAKYLA+IYE YTFYGGRFDNSN Q+L+ECM++EE  QFGF+V+SIDWKDYI  VHIPG
Sbjct  297   EQAKYLANIYEQYTFYGGRFDNSNTQRLIECMNEEETQQFGFDVKSIDWKDYIPKVHIPG  356

Query  1906  LRRHVMKGR  1932
             LRRHVMK R
Sbjct  357   LRRHVMKER  365



>ref|XP_010040308.1| PREDICTED: fatty acyl-CoA reductase 2-like [Eucalyptus grandis]
Length=532

 Score =   517 bits (1331),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 258/509 (51%), Positives = 347/509 (68%), Gaps = 20/509 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FL+TG TGF+ KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  31    DGVGIIDFLERRNFLVTGATGFVAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMDRVKDE  90

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI   +   I +EVD+IVNSAA
Sbjct  91    IIGCELFICLQQKYGEEYTSFMLSKLVPVKGDIRESNMGIGHDSFRQITQEVDVIVNSAA  150

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  151   NTTFDERYDKALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  210

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +GW + 
Sbjct  211   SRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEIGLARARMYGWHNV  262

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSV+EST +EPFPGW++GNRM+DP+IL YGKG+L 
Sbjct  263   YEMTKAMGEMMINADRGRVPVVIVRPSVVESTFREPFPGWIQGNRMLDPLILSYGKGRLP  322

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDPN V+DV+PAD+V N  +AAMAKHG    P   +Y  ASS VNP++  D+     
Sbjct  323   GFLVDPNTVMDVIPADLVANVIIAAMAKHGTTASPSIDVYDAASSTVNPIMMCDVFNYSR  382

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D  +KSGL+  +G +S  K  ++L
Sbjct  383   DYFAASPLTDDQGDGIQITDMEYFSSIDSFSSYIQKDIAEKSGLSKEIGPNSNLKQRSRL  442

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGG----------RFDNSNAQKLMECMSKEERWQFGF  1851
             E  C++  E   +LA +YEPY FY            RFD+ N +KLME MS EE  +F  
Sbjct  443   EARCKRMAESITHLAKLYEPYMFYRARIYMDIPYIDRFDSWNTRKLMEQMSTEEGNKFPI  502

Query  1852  EVESIDWKDYISNVHIPGLRRHVMKGRGS  1938
             ++ SI+W+DY +N HIPGL+RHV+K   S
Sbjct  503   DLRSINWEDYFANAHIPGLKRHVIKKASS  531



>ref|XP_010559061.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Tarenaya 
hassleriana]
Length=535

 Score =   514 bits (1325),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 245/495 (49%), Positives = 339/495 (68%), Gaps = 25/495 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG  IV F++GK++ ITG TGFL KV IEK+LR  P+  KI++L+KAD+++ A +RL  E
Sbjct  64    DGNRIVSFMKGKNYFITGATGFLAKVFIEKLLRATPETGKIFLLMKADDQQAARKRLHDE  123

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+++LF+ LKQT+G SY+ FM SKL+PVVG++ +++LG+D  TA+MI KE+D+I++SAA
Sbjct  124   IINSDLFELLKQTHGDSYEAFMTSKLIPVVGDISQNNLGMDSETADMIFKEIDVIISSAA  183

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL  NT GP++ M+F+ +C +L L LH STAYVNG RQG + E P     
Sbjct  184   RTTFDDRYDLALGTNTMGPHQFMRFSKKCERLNLVLHFSTAYVNGTRQGIVPETP-----  238

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
                            +P+L +E E+++   A +      MAQKMKELG ERA   G+Q+T
Sbjct  239   ---------------LPRLEIESELKLASEAARTFHHREMAQKMKELGRERATIHGYQNT  283

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGEM+ID+ RG++PVVI+RP V+ES++ EPFPGWM+GNRM +P+IL YGKG L+
Sbjct  284   YTFTKAMGEMVIDSSRGDVPVVIIRPGVVESSYIEPFPGWMQGNRMAEPLILAYGKGHLS  343

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             G L DP  V+D+VP DMVVN  +AAMAKHG   KPG ++YH  SSVV PL+  +L  L+Y
Sbjct  344   GLLGDPQTVIDIVPVDMVVNTAMAAMAKHGIEAKPGLNVYHSTSSVVTPLLLFELCNLVY  403

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLEN  1707
              HF   P  DSKG+ I +      SS+E  SS++  + I +  +T  G+ + +   K   
Sbjct  404   RHFCCSPLKDSKGEDITIEPFTFHSSLEDFSSYI-SNTITEKEMTKDGELRAESKMK---  459

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYIS  1887
              C + ++  + +A  YE   F   RFDN+NAQ+L+E M+ EER  F F     DW+ YI 
Sbjct  460   -CERKIKYLEGMAKTYETVLFTKARFDNTNAQRLLEEMTMEERSMFEFNTGRTDWEHYIM  518

Query  1888  NVHIPGLRRHVMKGR  1932
             NVH+PGLR+HV++GR
Sbjct  519   NVHLPGLRKHVLRGR  533



>ref|XP_006373689.1| hypothetical protein POPTR_0016s03140g [Populus trichocarpa]
 gb|ERP51486.1| hypothetical protein POPTR_0016s03140g [Populus trichocarpa]
Length=509

 Score =   511 bits (1316),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 351/499 (70%), Gaps = 12/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIV FL+GK++ ITG TGFLGK L+EK+LR +PDV K+++LIK  +KE  M+RLK E
Sbjct  10    DGIGIVEFLQGKNYFITGATGFLGKALVEKMLRGIPDVGKLFLLIKGKDKEATMKRLKSE  69

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+AE+FK LK  +G SY+ FM+SKLVPV G+VC ++LGID  T   IAKE+D+I+NSAA
Sbjct  70    IINAEVFKILKAIHGSSYEAFMMSKLVPVCGDVCSANLGIDADTTNEIAKEIDVIINSAA  129

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TT+D RYDVA++INT GP R+++F  +C KL+LFLHVS+AYVNG RQG   EKPFC+  
Sbjct  130   KTTWDTRYDVAININTKGPARVLEFGKKCKKLRLFLHVSSAYVNGTRQGVFFEKPFCLEP  189

Query  988   SIA-GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
               A  +++ +  QE SVP L+++ E+++   A + +   A  + M+ELG+ERA   GW  
Sbjct  190   RTARRDTITSKAQEISVPFLDIDAEIKLASVAVESIGRNA-DRIMRELGMERARIHGWCS  248

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TY  TKAMGEM+ID+MR +IP VI+RPS+IEST++EPFPGW++G ++  PI+  YG+ QL
Sbjct  249   TYEMTKAMGEMLIDSMRSSIPTVIIRPSLIESTYREPFPGWIQGYKV--PILAAYGQCQL  306

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
              GF+ DP+ + D VP DMVVNATL A+AKHG  GKP   +YH+A+SV NP  F D     
Sbjct  307   PGFVGDPDTIADTVPMDMVVNATLTALAKHGIDGKPELHVYHVATSVANPHSFKDAFNYA  366

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-----LGDSKGKL  1689
             Y++F S P +DSKGK I +  MK  +SM++ +  +  +   +SGLT      + D K  L
Sbjct  367   YDYFSSSPLLDSKGKKIAIRPMKFLASMDSFTDFIKNEVAQRSGLTPDDNVYMSDPKRYL  426

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESID  1869
               +L   C   + +A  +  I     ++  RFD +N ++L+E MS EER +F F++ESI+
Sbjct  427   RMQLACFCFVLMLKANQIMGI---NLWFVVRFDVTNTKRLIEDMSIEERKRFNFDIESIN  483

Query  1870  WKDYISNVHIPGLRRHVMK  1926
             W+ YI +VHIPG+R+H+++
Sbjct  484   WEHYIKSVHIPGVRKHLLR  502



>ref|XP_010325916.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X1 [Solanum 
lycopersicum]
Length=581

 Score =   510 bits (1313),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 355/508 (70%), Gaps = 7/508 (1%)
 Frame = +1

Query  412   KELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKAD  591
             KE++S   +   +GIGIV F  GK+ L+TGGTGFL K LIEK+LRT P ++KIYILI+A 
Sbjct  76    KEIIS---QNANNGIGIVEFFEGKNILVTGGTGFLAKALIEKMLRTTPKINKIYILIRAK  132

Query  592   NKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMI  771
             +KE A  RLK EII +ELFK L++ +G+ Y+ F+L+KL+P+VGN+ E +LG+D  T++ I
Sbjct  133   DKEAAFNRLKSEIIESELFKCLEEIHGEYYKPFILNKLIPIVGNIYEPNLGMDIITSQQI  192

Query  772   AKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQ  951
             A+++D+I++SAANTTFDERYD+ALD N  GP +LM FA +C  LKL +H STAY NG+R+
Sbjct  193   AQQIDLIIDSAANTTFDERYDLALDANVNGPYQLMMFAKKCKNLKLLMHYSTAYANGERE  252

Query  952   GKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDG-AMAQKMKEL  1128
             G I+EKPF +GESI  E + + +  ++ P L+V++E++++   K  +++   + Q MK L
Sbjct  253   GLILEKPFSMGESITKEKINSISPFTNFPSLHVDNEIDLISKLKNNITNNIGLEQIMKNL  312

Query  1129  GLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMM  1308
             G+E A  +GWQDTY FTKA+GEM+I+NMR  IP++I+RPSVI S++KEPFPGW++G R++
Sbjct  313   GVESAKLYGWQDTYTFTKAIGEMIINNMRDEIPILILRPSVITSSYKEPFPGWIQGYRVI  372

Query  1309  DPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVV  1488
             DP I  YGKG+L     D +  +D++P D+VVNAT+AA+AKHG    P  ++YH+A+++V
Sbjct  373   DPSIFLYGKGELPAIYCDQDTDVDLIPVDVVVNATMAAIAKHGYLQSPQLNVYHLATTLV  432

Query  1489  NPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTAL  1668
             NP+    L    YE+F   P+++SKG  I+V  MK F  +   S+++W     +  +  L
Sbjct  433   NPVAIHQLFDYCYEYFTLFPFVNSKGDKIEVKEMKYFDKISDFSNYIWEVLSKQHKVQDL  492

Query  1669  GDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFG  1848
              +   K   K+    ++ VE     + +YEPY FY GRF   N + LME MS+EER  F 
Sbjct  493   SE---KELLKIHMRFKRKVEFLNNFSKLYEPYGFYRGRFHTGNMRILMEEMSEEERKNFE  549

Query  1849  FEVESIDWKDYISNVHIPGLRRHVMKGR  1932
              +  +I+WKDY++ +HI G+++HV +G+
Sbjct  550   IDASNINWKDYLTRIHISGVKKHVFEGK  577



>ref|XP_010068865.1| PREDICTED: fatty acyl-CoA reductase 2-like, partial [Eucalyptus 
grandis]
Length=488

 Score =   504 bits (1297),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 255/502 (51%), Positives = 341/502 (68%), Gaps = 23/502 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGI+ FL  ++FLITG TGFL KVLIEKILR  P V KI++LIKA +++ AM+R K E
Sbjct  4     DGIGIIDFLERRNFLITGATGFLAKVLIEKILRVAPTVGKIFLLIKAKDEQAAMDRFKGE  63

Query  628   ---IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVN  798
                II  ELFK L+Q YG+ Y  FMLSKLVPV G++ E ++GI D+    I +EVD+I+N
Sbjct  64    DGDIIGCELFKCLQQKYGEGYTNFMLSKLVPVKGDIRELNMGIGDNLLCQITQEVDVIIN  123

Query  799   SAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFC  978
             SAANTT DERYD AL  N   P+RL+ FA +C KL LFLH+ST +VNG+R G ++EK F 
Sbjct  124   SAANTTLDERYDAALVANAIAPSRLLCFAKKCRKLSLFLHLSTTFVNGERPGILMEKAFQ  183

Query  979   IGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGW  1158
             +GES            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +GW
Sbjct  184   MGESRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEVGLARARMYGW  235

Query  1159  QDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKG  1338
             Q+ Y  TKAMGEMMI+  RG +PVVIVRPSVIEST ++PFPGW++G R++DP+IL YGKG
Sbjct  236   QNVYQMTKAMGEMMINAGRGRVPVVIVRPSVIESTFRQPFPGWIQGYRVLDPLILSYGKG  295

Query  1339  QLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLAR  1518
             +L GFLV+P+ V+DVVPAD+V N  +AAMAKHG A  P  ++YH ASS VNP+   D+  
Sbjct  296   RLPGFLVNPDTVMDVVPADLVANVIIAAMAKHGTAASPSINVYHAASSTVNPMTMCDMFN  355

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-LG-DSKGKLS  1692
                ++F   P  D++G  I +  M+ FSS+++ SS++ +D  +KSGL+  +G +S  K  
Sbjct  356   YSRDYFAESPLTDNQGDEIQIADMEYFSSIDSFSSYIQKDIAEKSGLSKEIGPNSNPKQR  415

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              +LE  C++  E   +LA +YEPY FY  RFD+ N +KLM+ MS            SI+W
Sbjct  416   CRLEARCKRMAENLIHLAKLYEPYMFYRARFDSWNTRKLMKQMS----------TRSINW  465

Query  1873  KDYISNVHIPGLRRHVMKGRGS  1938
             +DY +N HIPGL+RHV+K   S
Sbjct  466   EDYFANAHIPGLKRHVIKKASS  487



>ref|XP_002974648.1| hypothetical protein SELMODRAFT_101717 [Selaginella moellendorffii]
 gb|EFJ24168.1| hypothetical protein SELMODRAFT_101717 [Selaginella moellendorffii]
Length=503

 Score =   504 bits (1297),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 263/503 (52%), Positives = 340/503 (68%), Gaps = 18/503 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             +G+GI  FL+ K+ LITG TGFL KVL+EKILRT PDV  +++LI A + + A ERL+KE
Sbjct  4     EGLGIKHFLKDKNILITGATGFLAKVLVEKILRTQPDVGHLFLLINAKSSQSASERLRKE  63

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +  + LF+ L+  +G  Y+ F+ +KL  V GNV + D+GID   A+ +A E+D+IVNSAA
Sbjct  64    VQCSRLFQVLQDKHGDEYEDFIQAKLTAVAGNVAKEDVGIDKDVAQALASEIDVIVNSAA  123

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYD ALDINT GP  L++FA +CH+LKLFLHVSTAYVNG+R G+ +EKPF + E
Sbjct  124   TTNFIERYDTALDINTKGPFHLLEFAKRCHRLKLFLHVSTAYVNGKRVGRALEKPFRMDE  183

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMV----LSAKQGLSDGAMAQK--MKELGLERANK  1149
             SIA ES+  GN+  S P L+V  E+E V    L A     D    Q   MKELGL+RA  
Sbjct  184   SIARESL--GNE--SAPPLSVAQEIESVCKLSLLAPAHDKDEVAQQTAFMKELGLKRAAL  239

Query  1150  FGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHY  1329
              GWQDTYVFTKAMGEM++   R ++PVVIVRP+V+E T  +PF GWMEG RMMDPI+L Y
Sbjct  240   HGWQDTYVFTKAMGEMLVCENRQDVPVVIVRPTVVEGTFNQPFSGWMEGIRMMDPILLTY  299

Query  1330  GKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFD  1506
             GKGQ + F VDPNGVLDVVPADMVVN  LA+MAKH  AGK G  ++Y + SSVVNPL FD
Sbjct  300   GKGQTSSFYVDPNGVLDVVPADMVVNTILASMAKH--AGKKGCLNVYQVGSSVVNPLTFD  357

Query  1507  DLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEA--LSSHLWRDAIDKSGLTALGDSK  1680
              LA+  YEHF+S+P++D KG P+ +P+M   ++     L ++L  +              
Sbjct  358   KLAKYTYEHFRSQPFVDQKGNPVMIPKMTFITNKYTLFLYNYLQFNLPISRLFPWFQRED  417

Query  1681  GKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVE  1860
              +   K  +   + V Q   L   Y  YTFY GRFD SN ++L + +S EER +FGF V 
Sbjct  418   TQRRLKYLSYASQRVNQ---LIDTYAAYTFYKGRFDISNLERLYKELSAEERDEFGFAVW  474

Query  1861  SIDWKDYISNVHIPGLRRHVMKG  1929
             SIDW  YI +VH+PGLR++ + G
Sbjct  475   SIDWDKYIKDVHLPGLRKYTLDG  497



>ref|XP_002963359.1| hypothetical protein SELMODRAFT_80322 [Selaginella moellendorffii]
 gb|EFJ35230.1| hypothetical protein SELMODRAFT_80322 [Selaginella moellendorffii]
Length=503

 Score =   504 bits (1297),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 264/503 (52%), Positives = 344/503 (68%), Gaps = 18/503 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             +G+GI  FL+ K+ LITG TGFL KVL+EKILRT PDV  +++LI A + + A ERL+KE
Sbjct  4     EGLGIKHFLKDKNILITGATGFLAKVLVEKILRTQPDVGHLFLLINAKSSQSASERLRKE  63

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +  + LF+ L+  +G  Y+ F+ +KL  V GNV + D+GID   A+ +A E+D+IVNSAA
Sbjct  64    VQCSRLFQVLQDKHGDEYEDFIQAKLTAVAGNVAKEDVGIDKDVAQALASEIDVIVNSAA  123

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYD ALDINT GP  L++FA +CH+LKLFLHVSTAYVNG+R G+ +EKPF + E
Sbjct  124   TTNFIERYDTALDINTKGPFHLLEFAKRCHRLKLFLHVSTAYVNGKRVGRALEKPFRMDE  183

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMV--LSAKQGLSD-GAMAQK---MKELGLERANK  1149
             SIA ES+  GN+  S P L+V  E+E V  LS+     D   +AQ+   MKELGL+RA  
Sbjct  184   SIARESL--GNE--SAPLLSVAQEIESVCKLSSLAPAHDKDEVAQQTAFMKELGLKRAAL  239

Query  1150  FGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHY  1329
              GWQDTYVFTKAMGEM++   R ++PVVIVRP+V+E T  +PF GWMEG RMMDPI+L Y
Sbjct  240   HGWQDTYVFTKAMGEMLVCENRQDVPVVIVRPTVVEGTFNQPFSGWMEGIRMMDPILLTY  299

Query  1330  GKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFD  1506
             GKGQ + F VDPNGVLDVVPADMVVN  LA+MAKH  AGK G  ++Y + SSVVNPL FD
Sbjct  300   GKGQTSSFYVDPNGVLDVVPADMVVNTILASMAKH--AGKKGCLNVYQVGSSVVNPLTFD  357

Query  1507  DLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEA--LSSHLWRDAIDKSGLTALGDSK  1680
              LA+  YEHF+S+P++D KG P+ +P+M   ++     L ++L  +              
Sbjct  358   KLAKYTYEHFRSQPFVDQKGNPVMIPKMTFITNKYTLFLYNYLQFNLPISRLFPWFQRED  417

Query  1681  GKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVE  1860
              +   K  +   + V Q   L   Y  YTFY GRFD SN ++L + +S EER +FGF V 
Sbjct  418   TQRRLKYLSYASQRVNQ---LIDTYAAYTFYKGRFDISNLERLYKELSAEERDEFGFAVW  474

Query  1861  SIDWKDYISNVHIPGLRRHVMKG  1929
             SIDW  YI +VH+PGLR++ + G
Sbjct  475   SIDWDKYIKDVHLPGLRKYTLDG  497



>ref|XP_004246728.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X1 [Solanum 
lycopersicum]
Length=563

 Score =   506 bits (1302),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 242/497 (49%), Positives = 349/497 (70%), Gaps = 9/497 (2%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             ++ IGI+ F   K+ L+TG TGFL KVLIEKILRT P ++KIY+LI+A +KE A +RL  
Sbjct  74    KNEIGIIDFFEAKNLLVTGATGFLAKVLIEKILRTTPKINKIYLLIRAKDKEAAFDRLTS  133

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             EII ++LFK LK+ +G+SY+ F+ SKL+PVVGN+ E +LG+D   ++ IA+E+D+I++SA
Sbjct  134   EIIESKLFKCLKEIHGESYESFIRSKLIPVVGNIDEPNLGMDCIISQQIAQEIDLIIDSA  193

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             ANTTFD RYD+ALD +  G  +LM FA +C  LKL +H STAY NG+R+G   EKPF +G
Sbjct  194   ANTTFDLRYDLALDAHVNGAYQLMMFAKKCINLKLLIHYSTAYANGEREGLQYEKPFIMG  253

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK-MKELGLERANKFGWQ  1161
             ESI  E + + +  +  P LN  +E++ V   K  + +     K +KELG ERA  +GW 
Sbjct  254   ESITKEKLTSHSPSAKFPLLNAANELDFVSKLKNSIKNNDEFNKIIKELGDERAKLYGWH  313

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             DTY FTKAMGEM+ID+MR NIP+VI+RPS+I S++++PFPGW++G R++DP I+ YGKG+
Sbjct  314   DTYSFTKAMGEMVIDSMRENIPIVIIRPSIITSSYEQPFPGWIQGLRIIDPAIVFYGKGE  373

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
               G   +P  ++D+VP DMVVNAT+AA+AKHG    P  ++YH+ASS VNPL+   ++  
Sbjct  374   FPGVYTNPYCLIDMVPVDMVVNATMAAIAKHGNLQSPELNVYHVASSYVNPLLSSQISNY  433

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
              YE F S P+++SKG  + V +MK F +M   S+++ ++ +++     + DS      K+
Sbjct  434   CYEFFSSFPFVNSKGDQVKVQKMKYFDNMLDYSNYISKELLNRHH--EVEDS------KM  485

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             + + ++ VE  K  + +YEPYTFY G F N N QKLME MS+EER  F  ++  I+W+DY
Sbjct  486   QKLFKRKVEFLKNCSKVYEPYTFYKGWFHNGNMQKLMEDMSEEERKSFDIDLSKINWRDY  545

Query  1882  ISNVHIPGLRRHVMKGR  1932
             I  +HIPG++ +V+KGR
Sbjct  546   IIGIHIPGVKENVLKGR  562



>ref|XP_010040311.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 2-like 
[Eucalyptus grandis]
Length=589

 Score =   503 bits (1295),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 255/509 (50%), Positives = 341/509 (67%), Gaps = 37/509 (7%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  105   DGVGIIDFLERRNFLITGATGFLAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMQRVKNE  164

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  165   IIGCELFICLQQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  224

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             N T DE                  FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  225   NATLDE-----------------SFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  267

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S    S  +        KL+V  E+ +V    + L    + QK+KE+GL RA  +GWQ+ 
Sbjct  268   SRIDSSTQS--------KLDVHHEISLVSDLIETLPPNEVPQKLKEIGLARARMYGWQNV  319

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++GNRM+DP+IL YGKG+L 
Sbjct  320   YEMTKAMGEMMINADRGRVPVVIVRPSVIESTFREPFPGWIQGNRMVDPLILSYGKGRLP  379

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDP+ VLDVVPAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+  L  
Sbjct  380   GFLVDPDTVLDVVPADLVANVIIAAMAKHGITASPSIDVYHAASSTVNPVMACDIFXLFR  439

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-LG-DSKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D ++KSGL+  +G +S  K  ++L
Sbjct  440   DYFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIVEKSGLSKEIGPNSNPKQRSRL  499

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGG----------RFDNSNAQKLMECMSKEERWQFGF  1851
             E  C++  E   +LA +YEPY FY            RFD+SN +KLME MS +E  +F  
Sbjct  500   EARCKRMAESIIHLAKLYEPYAFYRARTYMDRLYIDRFDSSNTRKLMEQMSTKEGNKFPI  559

Query  1852  EVESIDWKDYISNVHIPGLRRHVMKGRGS  1938
             ++ SI+W+DY +NVHIPGL+RHV+K   S
Sbjct  560   DLRSINWEDYFANVHIPGLKRHVIKKASS  588



>ref|XP_006345722.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum tuberosum]
Length=953

 Score =   512 bits (1319),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 239/501 (48%), Positives = 343/501 (68%), Gaps = 10/501 (2%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             ++GIGI  F   K+ L+TG TGFL KVLIEK+LRT P ++KIY+L++A +KE A +RL  
Sbjct  459   KNGIGIADFFEAKNLLVTGVTGFLAKVLIEKMLRTTPKINKIYLLVRAKDKEAAFDRLTT  518

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             EII + LFK LK+ +G+SY+ F+ SKL+PVVGN+ E +LG+D   ++ IA+E+D+I++SA
Sbjct  519   EIIESTLFKCLKEMHGESYESFIRSKLIPVVGNIHEPNLGMDSIISQQIAQEIDLIIDSA  578

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             ANTT D RYD+ALD N  GP +LMKFA +C  LKL +H STAY NG+R+G + EKPF +G
Sbjct  579   ANTTLDLRYDLALDANVNGPYQLMKFAKKCKNLKLLIHYSTAYANGEREGLLYEKPFIMG  638

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
             ESI  E + + +  +  P LN  +E+E V   K  + +    + MKELG ERA  +GW D
Sbjct  639   ESITKEKLTSHSSSAKFPSLNAANELEFVSKLKNSIENNEFKKIMKELGAERAKLYGWHD  698

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TY FTKAM EM+ID+MR +IP+VI+RPS+I +++++PFPGW++G R++DPII  YGKG  
Sbjct  699   TYSFTKAMSEMVIDSMREDIPIVIIRPSIITTSYEQPFPGWIQGFRVIDPIITFYGKGVF  758

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
                  DPN ++DVVP DMVVNAT+AA+AKHG    P  ++YH+ASS VNPL+   L    
Sbjct  759   PSIFADPNCLIDVVPVDMVVNATMAAIAKHGYLQSPELNVYHVASSSVNPLLMSQLFEYC  818

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKL----S  1692
             YE F   P+++SKG  ++V +M+ F+++   S+++    + +       D +  L     
Sbjct  819   YEFFHYFPFVNSKGDQVEVRKMRYFNNILDFSNYILEQLLKQH------DEEQDLIEAEH  872

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
             +K++   +K V+  +  +++YEPY FY G F N N QKLME MS+EER  F  ++  I+W
Sbjct  873   SKMQMHLKKKVQYLENFSNLYEPYAFYKGWFHNGNMQKLMEDMSEEERKSFDIDLSKINW  932

Query  1873  KDYISNVHIPGLRRHVMKGRG  1935
             +DY   +HIPG++ HV+K  G
Sbjct  933   RDYFIGIHIPGVKEHVLKKAG  953


 Score =   336 bits (861),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 190/451 (42%), Positives = 269/451 (60%), Gaps = 65/451 (14%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             ++G+GIV F   K+ L+TG TGFL KVL+EK+LRT P ++KIY+LI+A +KE A +RL  
Sbjct  34    KNGVGIVDFFEAKNLLVTGATGFLAKVLVEKMLRTTPKINKIYLLIRAKDKEAAFDRLTS  93

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             EII ++LFK LK+  G+SY+ F+ SKL+PVVGN  E +LG+D   ++ I++E+D+I++SA
Sbjct  94    EIIESKLFKCLKEMNGESYESFIRSKLIPVVGNTHEPNLGMDSIISQEISQEIDLIIDSA  153

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             ANTTFD RYD+ALD +  G  +LMKFA++C  LKL +H STAY NG+R+G + EKPF +G
Sbjct  154   ANTTFDLRYDLALDAHVNGSYQLMKFANKCKNLKLLIHYSTAYANGEREGLLYEKPFMMG  213

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
             ESI  E + + +  +  P LN  +E++ V   K  + +    + MKELG ER        
Sbjct  214   ESITKEKLTSHSPSAKFPSLNAANELDFVSKLKNSIKNNEFKKIMKELGAER--------  265

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
                        +ID                                   P I+ YGKG L
Sbjct  266   -----------VID-----------------------------------PAIVFYGKGDL  279

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
              G L DPN ++DVVP DMVVNAT+AA+AKHG    P  ++YH+ASS VNPL    L    
Sbjct  280   PGVLADPNCLVDVVPVDMVVNATMAAIAKHGYLQSPELNVYHVASSYVNPLSSSQLLNYS  339

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE  1704
             YE F S P+++SKG  + V +MK F +M   S+++ ++ + K       D  G+LS ++E
Sbjct  340   YEFFSSFPFVNSKGDQVKVNKMKYFDNMLDYSNYISKELLKKH------DEVGELSHEVE  393

Query  1705  N-----ICRKSVEQAKYLASIYEPYTFYGGR  1782
             N     + ++ VE  K  + +YEPY FY GR
Sbjct  394   NSKMQMLFKRKVEYLKNFSKVYEPYGFYKGR  424



>ref|XP_010040307.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 2-like 
[Eucalyptus grandis]
Length=522

 Score =   497 bits (1280),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 252/499 (51%), Positives = 336/499 (67%), Gaps = 10/499 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  31    DGVGIIDFLERRNFLITGATGFLAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMDRVKNE  90

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  +LF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  91    IIGCKLFICLQQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  150

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  151   NTTFDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  210

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
                  S       S+  KLNV  E+ +V    + L    + QK+KE+GL RA  +GWQ+ 
Sbjct  211   XAEXIS-------STQSKLNVHHEINLVSDLIETLPPNEVPQKLKEIGLARARMYGWQNV  263

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSV+EST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  264   YEMTKAMGEMMINADRGRVPVVIVRPSVVESTFREPFPGWIQGYRMLDPLILSYGKGRLP  323

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDP+ V+DV+PAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  324   GFLVDPDTVIDVIPADLVANVIIAAMAKHGTTASPSIDVYHAASSTVNPIMMCDVFNYSR  383

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGD--SKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D  +KSGL+   D  S  K  ++L
Sbjct  384   DYFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIAEKSGLSKEIDPNSNPKQRSRL  443

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLME M  EE   F  E E     + 
Sbjct  444   EARCKRMAESIIHLAKLYEPYAFYRARFDSWNTRKLMEQMLTEEAMNFPIEFEKHKIGEE  503

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
             + +  I  L+RHV+K   S
Sbjct  504   LLH-RIAHLKRHVIKKASS  521



>ref|XP_010326151.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum lycopersicum]
Length=554

 Score =   496 bits (1276),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 348/500 (70%), Gaps = 5/500 (1%)
 Frame = +1

Query  436   EKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMER  615
             +K  +GIGI+ F  GK+  +TGGTGFL K LIEKILRT P ++KIY+LI+A +KE A  R
Sbjct  57    QKGNNGIGIIDFFEGKNIFVTGGTGFLAKALIEKILRTTPKINKIYLLIRAKDKEAAFHR  116

Query  616   LKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIV  795
             LK EI+ +ELFK  ++ +G+SY++F+ +KL+P+VGN+ E +LG+D  T++ IA+++D+IV
Sbjct  117   LKFEIMESELFKCPEEIHGESYKLFIQNKLIPIVGNIYEPNLGMDIITSQQIAQQIDLIV  176

Query  796   NSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPF  975
             +SAA TTFDERYD+ALD N  GP +LM FA +C KLKL +H STAY NG+R+G I+EKPF
Sbjct  177   DSAAITTFDERYDLALDANVNGPYQLMIFAKKCKKLKLLMHYSTAYANGEREGLILEKPF  236

Query  976   CIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDG-AMAQKMKELGLERANKF  1152
              +GESI  E + + +  ++ P L+V++E+E++   K  +++   + Q MK  G+ERA  +
Sbjct  237   SMGESITKEKINSISPYTNFPSLHVDNEIELISKLKNNITNNIGLEQIMKNFGVERAKLY  296

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GWQDTY FTKA+GEMMI++MR  IP++I+RPS+I S++KEPF GWM+G R +DPII  YG
Sbjct  297   GWQDTYSFTKAIGEMMINSMRHEIPILIIRPSIITSSYKEPFLGWMQGFRTIDPIIFFYG  356

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDL  1512
             KG L+    DPN ++D+VP DMVVNAT+AAMAKHG    P  +IYH+ASS +NPL    +
Sbjct  357   KGDLSCIFGDPNCLVDLVPVDMVVNATMAAMAKHGYLQTPQLNIYHVASSSINPLTLSQI  416

Query  1513  ARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS  1692
                 Y +F+  P+++SKG   +V +M+ F  +    +++W + + K      G    K  
Sbjct  417   CDYFYNYFKLFPFVNSKGDKFEVKKMRFFDKISDCENYIW-EVLSKKHEVQDGKELTKTQ  475

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              +L    +K VE  K    +YEPY FY G FDN N +KLM  MS+EE+  F  +V  I+W
Sbjct  476   IRL---IKKKVEYLKNFNKLYEPYVFYKGWFDNGNIRKLMGDMSEEEKGSFEIDVTKINW  532

Query  1873  KDYISNVHIPGLRRHVMKGR  1932
             + YI  +HIPG++ +V++ +
Sbjct  533   RYYIEKIHIPGVQEYVLEKK  552



>ref|XP_006429860.1| hypothetical protein CICLE_v10011477mg [Citrus clementina]
 gb|ESR43100.1| hypothetical protein CICLE_v10011477mg [Citrus clementina]
Length=431

 Score =   489 bits (1259),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/416 (58%), Positives = 316/416 (76%), Gaps = 14/416 (3%)
 Frame = +1

Query  691   MLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNR  870
             ML+KLVPVVGN+ ES+LG++   A++IA EVD+I+NSAANTT  ERYD+A+DINT GP+ 
Sbjct  1     MLNKLVPVVGNISESNLGLEGDLAKVIANEVDVIINSAANTTLHERYDIAIDINTRGPSH  60

Query  871   LMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNV  1050
             +M FA +C K+K+F+H+STAYVNG+RQG+I+EKPF +G++IA E  +N N     PKL+V
Sbjct  61    VMNFAKKCKKIKVFVHMSTAYVNGKRQGRIMEKPFYMGDTIARE--LNFNNSKIEPKLDV  118

Query  1051  EDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIP  1227
             E E+E+ + +K+ L +D    +KMKELGLERA K+GW  TYVFTKAMGEMMID ++ NIP
Sbjct  119   EKEIELAMKSKKALENDEDARKKMKELGLERARKYGWDVTYVFTKAMGEMMIDTLKENIP  178

Query  1228  VVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVN  1407
             VVI+RPS+I+ST+K+PF GW++GNR++D +IL+YG+GQL  F+ DP+G+LDVVP DMVVN
Sbjct  179   VVIIRPSMIQSTYKKPFAGWIQGNRILDLMILYYGRGQLNEFVGDPSGILDVVPVDMVVN  238

Query  1408  ATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDV  1581
             ATLAA+AKHG     KP   +Y IASSV NPLV   L  LL+EHF S P +DSKG PI V
Sbjct  239   ATLAAIAKHGQVVIQKPEVKVYQIASSVTNPLVTKYLLSLLHEHFDSSPVLDSKGSPIRV  298

Query  1582  PRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGK-LSTKLENICRKSVEQAKYLASIYE  1758
             P MKLF+SME  S+HL   A+ +S    +G S G+ L+ K   I R+     K  A++Y 
Sbjct  299   PVMKLFTSMEDFSAHLLDGAMQRS---IIGSSNGELLAQKQYEILRR-----KEFANVYL  350

Query  1759  PYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMK  1926
             PY  Y GRFD SN   LM+ M++EE+ +FGF++ SIDWK YI+NVH+PGLRRHVMK
Sbjct  351   PYGLYAGRFDCSNTLGLMQIMNEEEKKKFGFDMGSIDWKHYITNVHVPGLRRHVMK  406



>ref|XP_006345721.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum tuberosum]
Length=503

 Score =   489 bits (1259),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 243/493 (49%), Positives = 342/493 (69%), Gaps = 11/493 (2%)
 Frame = +1

Query  481   KSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLK  660
             K+ LITG TGFL KVLIEK+LRT P ++KIY+LI+A +KE A +RL  EII ++LFK LK
Sbjct  17    KNLLITGATGFLAKVLIEKVLRTTPKINKIYLLIRAKDKEAAFDRLTSEIIESKLFKCLK  76

Query  661   QTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVA  840
             + +G+SY+ F+ SKL+PVVGN+ ES+LG+D   ++ IA+E+D+IV+SAANT FD RYD+A
Sbjct  77    EMHGESYESFIGSKLIPVVGNIHESNLGMDIIISQQIAQEIDLIVDSAANTIFDLRYDLA  136

Query  841   LDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGN  1020
             LD N  G  +LM FA +C  LKL +H STAY NG+R+G + EKPF +GESI  E + + +
Sbjct  137   LDANVNGSYQLMMFAKKCKNLKLLIHYSTAYANGEREGLLYEKPFMMGESITKEKLTSHS  196

Query  1021  QESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMM  1200
               +  P LN  +E++ V   K  + +    + MKELG ERAN +GW DTY FTKAMGEM+
Sbjct  197   PSAKFPSLNAANELDFVSKLKNSIKNNEFKKIMKELGAERANLYGWHDTYSFTKAMGEMV  256

Query  1201  IDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLD  1380
             ID+MR NIP+VI+RPS I S++++PFPGW++G R++DP I+ YGKG     L DPN ++D
Sbjct  257   IDSMRENIPIVIIRPSTITSSYEQPFPGWIQGLRVIDPAIVFYGKGDFPCVLADPNCLVD  316

Query  1381  VVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDS  1560
             VVP D+VVNAT+AA+AKHG    P  ++YH+ASS VN L+   L    YE F S P++ S
Sbjct  317   VVPVDVVVNATMAAIAKHGNLQSPELNVYHVASSFVNTLLSSQLMDYCYEFFSSFPFVTS  376

Query  1561  KGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS-----TKLENICRKSV  1725
             KG  + V +MK F +M   S+++ ++ + +       D  G+L+     +K++ + ++ V
Sbjct  377   KGDQVKVKKMKHFDNMSDFSNYISKELLKQH------DEVGELTHEVEHSKMQILFKRKV  430

Query  1726  EQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPG  1905
             E  +  + +YEPY FY GRF N N QKLME MS+EER  F  ++  I+W+DY   +HIPG
Sbjct  431   EYLENFSKVYEPYAFYKGRFHNGNMQKLMENMSEEERKSFDIDLSKINWRDYFIGIHIPG  490

Query  1906  LRRHVMKGRGSCS  1944
             ++ HV+K + S S
Sbjct  491   VKEHVLKCKISSS  503



>ref|XP_010544518.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Tarenaya 
hassleriana]
Length=537

 Score =   489 bits (1260),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 250/489 (51%), Positives = 333/489 (68%), Gaps = 25/489 (5%)
 Frame = +1

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             F++GKS+ ITG TGFL KV IEK+LR  P+  KI++L+KA ++E   +RL  EII+++LF
Sbjct  73    FMQGKSYFITGATGFLAKVFIEKLLRAAPETGKIFLLMKAKDQEATKKRLYDEIINSDLF  132

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             + LKQT+  SY+ FM SKL+PVVG++ +++LG+D  TA+ IAKE+D+IV+SAA+TTFD+R
Sbjct  133   ELLKQTHQNSYEAFMTSKLIPVVGDISQNNLGMDPETAKNIAKEIDVIVSSAASTTFDDR  192

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YD AL INT GP++LM F  +C KL LFLH STAYVNG RQG + E P  I         
Sbjct  193   YDFALSINTLGPDQLMGFTKKCEKLNLFLHFSTAYVNGLRQGIVPETPLHI---------  243

Query  1009  VNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAM  1188
                        L VE E+++   A +      + +KMKELG ERA   G+Q+TY FTKAM
Sbjct  244   -----------LKVESEVKLASEAARTFHHREVTRKMKELGHERAIIHGFQNTYTFTKAM  292

Query  1189  GEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPN  1368
             GEM+ID+ RG++PVVI+RPS+IES+++EP PGW++GNRM DP++L YGKGQL GFL DP 
Sbjct  293   GEMVIDSSRGDLPVVIIRPSIIESSYREPVPGWIQGNRMADPVLLAYGKGQLPGFLGDPQ  352

Query  1369  GVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKP  1548
              V+D+VP DM VNA +AAMAKHG   KPG  +YH  SSVVNPL+  +L  L ++HF   P
Sbjct  353   TVVDIVPVDMAVNAAMAAMAKHGIDAKPGLHVYHATSSVVNPLLLYELFDLTHQHFCRSP  412

Query  1549  YIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVE  1728
               D KG+ I +  MKL  S+E  SS++     ++          G+L T  E  C+K ++
Sbjct  413   LRDYKGEDIMIEPMKLHRSLEDFSSYISNTITEQE-----SKKDGELRTITETKCKKKIK  467

Query  1729  QAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGL  1908
                 +A  YEP TF   RFDN+N +KL+E M+ EER  FGF   SIDW+ Y  NVH+PGL
Sbjct  468   YFVDIAEAYEPVTFTKARFDNTNTRKLLEDMTLEERKMFGFNTGSIDWEHYFMNVHLPGL  527

Query  1909  RRHVMKGRG  1935
             +RHVM+GR 
Sbjct  528   KRHVMQGRS  536



>ref|XP_009104026.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X1 [Brassica rapa]
Length=546

 Score =   488 bits (1256),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 241/499 (48%), Positives = 334/499 (67%), Gaps = 22/499 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+RFL+GK++LITG TGFLGKVLIEK+LR  P + KI+ILIK+ ++E A +RL  E
Sbjct  68    DGVGIIRFLKGKTYLITGATGFLGKVLIEKLLRASPGIGKIFILIKSKDQESANKRLYDE  127

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LF  LKQ +G+SY+ FM SKL+P++G + E +LGI    A  I+ E+D++++ A 
Sbjct  128   IISSDLFSHLKQMHGRSYEEFMKSKLIPIIGEIGEENLGIGSEVAANISGEIDVVISCAG  187

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL++N  GP RL+ FA  C KLKLFLH+STAYV G+++G ++E P CIG+
Sbjct  188   RTTFDDRYDLALNVNAFGPGRLLSFAKDCKKLKLFLHISTAYVTGKKEGTVLETPLCIGK  247

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+E E+++   A + L      +K+KELG++RA  +GW++T
Sbjct  248   NITSD-------------LNIEHELKLASEAVRKLHGSGEIKKLKELGIQRAQHYGWENT  294

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGE +I  MR + PVVI+RPS+IES++KEPFPGW++G RM DPIIL YGKGQ++
Sbjct  295   YTFTKAMGETLIQTMREDAPVVIIRPSIIESSYKEPFPGWLQGIRMSDPIILAYGKGQIS  354

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             G   D     D++P DMVVNAT+AAMAKHG  G     +Y++ SS  NPL   +L  L Y
Sbjct  355   GLWGDSQSFADIIPVDMVVNATIAAMAKHG-CGNSDLKVYNVTSSHANPLRVGELMDLCY  413

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS--GLTALGDSKGKLSTKL  1701
             +H    P        ID+ RMK  SS+E+ +S ++ D I K   G    G    +  T L
Sbjct  414   QHLYDFPLT-----VIDLARMKFHSSLESFTSSVF-DIIAKQERGTKNEGGEAEESHTTL  467

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
                 R  +     LA  YEPYTF+  RFD++N + L++ MS EER  F F+++SIDW+ Y
Sbjct  468   SFKGRGILNYFVSLARTYEPYTFFQARFDDTNTRSLIQEMSMEERKIFEFDIKSIDWEHY  527

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
             I NVH+PGL+R + K   S
Sbjct  528   IVNVHLPGLKREICKENSS  546



>ref|XP_010504577.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Camelina 
sativa]
Length=535

 Score =   487 bits (1254),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 241/513 (47%), Positives = 339/513 (66%), Gaps = 31/513 (6%)
 Frame = +1

Query  409   MKELVSSYVEKHEDG-----IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIY  573
             +K   SS   K E G     IGI+RFLRGKS+L+TG TGFL KVLIEK+LR  P++ KI+
Sbjct  48    LKAATSSMKPKAESGPNSDVIGIIRFLRGKSYLVTGATGFLAKVLIEKLLRESPEIGKIF  107

Query  574   ILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD  753
             +L+++ ++E A +RL  EIIS++LF  LKQ +G+SY+ FM SKL+PV+G++ E++LGI+ 
Sbjct  108   LLMRSKDQESANKRLYDEIISSDLFMLLKQMHGRSYEAFMKSKLIPVIGDIGEANLGIEP  167

Query  754   HTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAY  933
               A+MI++E+D+I++    TTFD+RYD AL +N  GPNRL+ F  +C KLKLFLH STAY
Sbjct  168   EIADMISEEIDVIISCGGRTTFDDRYDSALSVNALGPNRLLSFGKECKKLKLFLHFSTAY  227

Query  934   VNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQ  1113
             V G+++G ++E P CIGE+I  +             LN+E E+++   A +         
Sbjct  228   VTGKKEGLVLETPLCIGENITSD-------------LNIEYELKLASEAVREFHGREETN  274

Query  1114  KMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWME  1293
             K+KELG ERA  +GW+++Y FTKAMGE +I + RG++PVVI+RPS+IES++KEPFPGW++
Sbjct  275   KLKELGFERAQHYGWENSYTFTKAMGETLIHSNRGDLPVVIIRPSIIESSYKEPFPGWIQ  334

Query  1294  GNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHI  1473
             G RM+DPII+ YGKGQ++GF  D   +LD+ P DMVVNA + AMAKHG  G P   +Y +
Sbjct  335   GIRMVDPIIVGYGKGQISGFWADSKSLLDITPVDMVVNAAITAMAKHG-CGVPELKVYIV  393

Query  1474  AS-SVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDK  1650
             AS S  NPL F +L  L Y+H +  P  D++   ID+  MK  SS+E+ +S L      K
Sbjct  394   ASTSHANPLRFGELMDLSYQHLRDSPLEDTE---IDLAPMKYHSSLESFTSSLSNKMKRK  450

Query  1651  SGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE  1830
              G++ +     K   +L  +          +A IY+PY F+  RFD++N   LM  MS E
Sbjct  451   EGVSHISTMSDKGKRRLNYLVS--------MARIYKPYMFFQARFDDTNTTSLMHEMSME  502

Query  1831  ERWQFGFEVESIDWKDYISNVHIPGLRRHVMKG  1929
             ER  F F  + IDWK YI+NVH+PGL++    G
Sbjct  503   ERKMFEFNTKGIDWKHYIANVHLPGLKKQFFHG  535



>gb|AEQ33639.1| male sterility protein 2 [Lycium barbarum]
Length=264

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 221/261 (85%), Positives = 240/261 (92%), Gaps = 0/261 (0%)
 Frame = +1

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             DTYVFTKAMGEMMID MR +IPVVI+RPSVIEST++EPFPGWMEGNRMMDPIILHYGKGQ
Sbjct  1     DTYVFTKAMGEMMIDTMRSDIPVVIIRPSVIESTYREPFPGWMEGNRMMDPIILHYGKGQ  60

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
             LTGFLVDPNGVLDVVPADMVVNATLAA+AKHGAAGKPG++IY +ASSVVNPLVF DLA L
Sbjct  61    LTGFLVDPNGVLDVVPADMVVNATLAAIAKHGAAGKPGSNIYQVASSVVNPLVFKDLATL  120

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
             L++HF S PYIDSKG+PI VPRMKL +SME LS HLW+DAI++SGLT   D  GKLS KL
Sbjct  121   LFDHFNSSPYIDSKGRPIHVPRMKLLNSMEDLSFHLWQDAINRSGLTDTADPNGKLSRKL  180

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             ENICRKSVEQAKYLA IYEPYTFYGGRFDNSN Q LMECMSKEERWQFGF+VE+IDWKDY
Sbjct  181   ENICRKSVEQAKYLAHIYEPYTFYGGRFDNSNTQWLMECMSKEERWQFGFDVENIDWKDY  240

Query  1882  ISNVHIPGLRRHVMKGRGSCS  1944
             ISNVHIPGLR++VMKGRG CS
Sbjct  241   ISNVHIPGLRKYVMKGRGLCS  261



>ref|XP_009617271.1| PREDICTED: fatty acyl-CoA reductase 2-like [Nicotiana tomentosiformis]
Length=583

 Score =   488 bits (1256),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 246/497 (49%), Positives = 352/497 (71%), Gaps = 3/497 (1%)
 Frame = +1

Query  439   KHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERL  618
             K  +GIGIV F  GK+ L+TG TGFL K L+EK+LRT P+++KIY+LI+A +K VA +RL
Sbjct  85    KSSNGIGIVEFFEGKNVLVTGATGFLAKALVEKMLRTTPNINKIYLLIRAKDKGVAFDRL  144

Query  619   KKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVN  798
             + EI+ ++LFK L++ +G+ Y+ F+LSKLVPVVGN+ E +LG+D  TA  IA+E+D+IV+
Sbjct  145   RSEIMESKLFKRLEEMHGEYYKPFILSKLVPVVGNIHEPNLGMDIITAHQIAEEIDLIVD  204

Query  799   SAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFC  978
             SAANTTFDERYD+AL+ N  GP +LM FA +C KLKL +H STAY NG+R+G I+EKPF 
Sbjct  205   SAANTTFDERYDLALEANVNGPCQLMMFAKKCKKLKLLMHYSTAYANGEREGCILEKPFT  264

Query  979   IGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGW  1158
             +GESI  E V + +  +  P L+  +EM++V   K  +++ ++ Q MK+LG+ERA  +GW
Sbjct  265   MGESITKEKVTSFSPFTKFPSLHAMNEMDLVSKLKNAITNNSLGQIMKDLGIERAKLYGW  324

Query  1159  QDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKG  1338
             QDTY FTKA+GEMMID+MR  IP++I+RPSVI S+ +EPFPG+++G R++DP +  YGKG
Sbjct  325   QDTYSFTKAIGEMMIDSMREEIPILILRPSVITSSFREPFPGFIQGFRVIDPSVYLYGKG  384

Query  1339  QLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLAR  1518
              L  FL DP+ ++DVVP D+VVNAT+AA+AKHG    P  ++YH+AS+ VNP     L  
Sbjct  385   DLPAFLGDPDCLVDVVPVDLVVNATMAAIAKHGYLQSPEVNVYHVASTFVNPFSLYQLFY  444

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTK  1698
               YE+F S P+++SKG  ++V  MK F  +   S+++W +    S   ++ D   K   K
Sbjct  445   YCYEYFTSFPFVNSKGDKVEVKEMKYFDKISDFSNYIWEEL---SRQHSVQDLTEKELLK  501

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
             ++   ++ VE  K+   +YEPY FY G F   N + LME MS+EER  F  +   I+W+D
Sbjct  502   IQMRFKRKVEYLKHFCKLYEPYAFYRGWFHIGNMRNLMEEMSEEERTSFEIDASKINWRD  561

Query  1879  YISNVHIPGLRRHVMKG  1929
             Y++ +HIPG++ H +KG
Sbjct  562   YLTGIHIPGVKEHELKG  578



>ref|XP_009104027.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X2 [Brassica rapa]
Length=542

 Score =   486 bits (1250),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/493 (48%), Positives = 332/493 (67%), Gaps = 22/493 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+RFL+GK++LITG TGFLGKVLIEK+LR  P + KI+ILIK+ ++E A +RL  E
Sbjct  68    DGVGIIRFLKGKTYLITGATGFLGKVLIEKLLRASPGIGKIFILIKSKDQESANKRLYDE  127

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LF  LKQ +G+SY+ FM SKL+P++G + E +LGI    A  I+ E+D++++ A 
Sbjct  128   IISSDLFSHLKQMHGRSYEEFMKSKLIPIIGEIGEENLGIGSEVAANISGEIDVVISCAG  187

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL++N  GP RL+ FA  C KLKLFLH+STAYV G+++G ++E P CIG+
Sbjct  188   RTTFDDRYDLALNVNAFGPGRLLSFAKDCKKLKLFLHISTAYVTGKKEGTVLETPLCIGK  247

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+E E+++   A + L      +K+KELG++RA  +GW++T
Sbjct  248   NITSD-------------LNIEHELKLASEAVRKLHGSGEIKKLKELGIQRAQHYGWENT  294

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGE +I  MR + PVVI+RPS+IES++KEPFPGW++G RM DPIIL YGKGQ++
Sbjct  295   YTFTKAMGETLIQTMREDAPVVIIRPSIIESSYKEPFPGWLQGIRMSDPIILAYGKGQIS  354

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             G   D     D++P DMVVNAT+AAMAKHG  G     +Y++ SS  NPL   +L  L Y
Sbjct  355   GLWGDSQSFADIIPVDMVVNATIAAMAKHG-CGNSDLKVYNVTSSHANPLRVGELMDLCY  413

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS--GLTALGDSKGKLSTKL  1701
             +H    P        ID+ RMK  SS+E+ +S ++ D I K   G    G    +  T L
Sbjct  414   QHLYDFPLT-----VIDLARMKFHSSLESFTSSVF-DIIAKQERGTKNEGGEAEESHTTL  467

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
                 R  +     LA  YEPYTF+  RFD++N + L++ MS EER  F F+++SIDW+ Y
Sbjct  468   SFKGRGILNYFVSLARTYEPYTFFQARFDDTNTRSLIQEMSMEERKIFEFDIKSIDWEHY  527

Query  1882  ISNVHIPGLRRHV  1920
             I NVH+PGL+R +
Sbjct  528   IVNVHLPGLKREI  540



>ref|XP_010559060.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Tarenaya 
hassleriana]
Length=454

 Score =   482 bits (1240),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 239/487 (49%), Positives = 333/487 (68%), Gaps = 35/487 (7%)
 Frame = +1

Query  472   LRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFK  651
             ++GKSF ITG TGFL K  IEK+LR  P+  KI++L+KAD++E A +RL  EI+++ LF+
Sbjct  1     MKGKSFFITGATGFLAKAFIEKLLRATPETGKIFLLMKADDQEAARKRLHDEIVNSGLFE  60

Query  652   FLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERY  831
              LKQT+G SY+ FM SKL+P+VG++ +++LG+D  TA+MI+KE+D+I++SAA T F++RY
Sbjct  61    LLKQTHGNSYEAFMTSKLIPIVGDISQNNLGMDPETADMISKEIDVIISSAARTIFEDRY  120

Query  832   DVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVV  1011
             D+AL  NT GP++ M+F+ +C KLKL LH ST YVNG R G + E P             
Sbjct  121   DLALSANTMGPDQFMRFSKKCKKLKLVLHFSTVYVNGMRHGIVPETP-------------  167

Query  1012  NGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMG  1191
                    +P+  +E E ++V  A +   +G M +KMKELGLERA   G+ DTY FTKAMG
Sbjct  168   -------LPRFEIEHEGKLVSEAARTFLEGEMTRKMKELGLERAMIHGYHDTYAFTKAMG  220

Query  1192  EMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNG  1371
             EM++D+ RG++PVVIVRP ++ES++ EPFPGW++G+++MDP+IL YGKGQL G   DP  
Sbjct  221   EMVVDSSRGDLPVVIVRPGIVESSYVEPFPGWIQGDKVMDPMILAYGKGQLPGIFGDPQA  280

Query  1372  VLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPY  1551
             VLD+VP DM VNA +AA+AKHG   KPG ++YH  SSVVNPL   +L  L++ HF   P 
Sbjct  281   VLDIVPVDMTVNAAMAAVAKHGVDAKPGLTVYHPTSSVVNPLRLHELFHLVHRHFCHSPM  340

Query  1552  IDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQ  1731
              DSKG+ I    MK + S++  SS++       S + +  + K K   KL+ +       
Sbjct  341   RDSKGEGIMTEPMKFYGSLQDFSSYI-------SKIISEKEQKTKQERKLKYL-------  386

Query  1732  AKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLR  1911
              K +A +Y P  F   R+DN+NA++LME M+ EER  FGF  ESIDW+ YI NVHIPGL+
Sbjct  387   -KDMAKLYGPAMFSKARYDNTNARRLMEEMTMEERRMFGFNTESIDWEHYIMNVHIPGLK  445

Query  1912  RHVMKGR  1932
             +HV++GR
Sbjct  446   KHVLRGR  452



>ref|XP_010412804.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Camelina 
sativa]
Length=544

 Score =   484 bits (1245),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/502 (48%), Positives = 336/502 (67%), Gaps = 35/502 (7%)
 Frame = +1

Query  442   HEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLK  621
             + +GIGIVRFL+GKS+L+TG TGFL KVLIEK+LR  P++ KI++L+++ ++E A +RL 
Sbjct  72    NSEGIGIVRFLKGKSYLVTGATGFLAKVLIEKMLRESPEIGKIFLLMRSKDQESANKRLY  131

Query  622   KEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNS  801
              EIIS++LFK LKQ +G SY+ FM SKLVPV+G++ E +LGI+   A+MI+KE+D+I++ 
Sbjct  132   DEIISSDLFKLLKQMHGSSYETFMKSKLVPVIGDIGEDNLGIEPEIADMISKEIDVIISC  191

Query  802   AANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCI  981
                TTFD+RYD AL +N  GPNRL+ F  +C KLK FLH STAYV G+ +G ++E P CI
Sbjct  192   GGRTTFDDRYDSALSVNALGPNRLLSFGKECKKLKFFLHFSTAYVTGKSEGLVLETPLCI  251

Query  982   GESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQ  1161
             GE+I  +             LN+E E+++   A +     A   K+KELG ERA  +GW 
Sbjct  252   GENITSD-------------LNIESELKLASEAVRKFHGRAETNKLKELGFERAQHYGWD  298

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             ++Y FTKAMGE ++ + RG++PVVI+RPS IES++KEPFPGW++G RM+DPII+ YGKGQ
Sbjct  299   NSYTFTKAMGETILKSNRGDLPVVIIRPSTIESSYKEPFPGWIQGIRMLDPIIVGYGKGQ  358

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDDLAR  1518
             ++GF  D   +LD+ P DMVVNA + AMAKHG  G P   +Y +AS S  NPL F +L  
Sbjct  359   ISGFWADSKSLLDITPVDMVVNAAITAMAKHG-CGVPELKVYIVASTSHANPLRFGELMD  417

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAI-----DKSGLTALGDSKG  1683
             L Y+H +  P  D++   ID+  MK  SS+E+ +S +  + I     D+S ++ + D KG
Sbjct  418   LSYQHLRDSPLEDTE---IDLAPMKYHSSLESFTSSV-SNTIKIKEGDQSHISTMSD-KG  472

Query  1684  KLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVES  1863
             K          + +     +A  Y+PY F+  RFD++N   LM  MS EER  F F  + 
Sbjct  473   K----------RRLNYFVSMARTYKPYMFFQARFDDTNTTSLMHEMSMEERKMFEFNTKD  522

Query  1864  IDWKDYISNVHIPGLRRHVMKG  1929
             IDWK YI+NVH+PGL++   +G
Sbjct  523   IDWKHYIANVHLPGLKKQFFQG  544



>ref|XP_010559064.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Tarenaya 
hassleriana]
Length=519

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 336/506 (66%), Gaps = 41/506 (8%)
 Frame = +1

Query  415   ELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADN  594
             E V S  EK  DG  +V F++GK++ ITG TGFL KV IEK+LR  P+  KI++L+KAD+
Sbjct  53    EAVMSEAEKC-DGNRVVSFMKGKNYFITGATGFLAKVFIEKLLRATPETGKIFLLVKADD  111

Query  595   KEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIA  774
             +E A +RL  EII+++LF+ LK+T+G SY+ FM SKL+P+VG++ +++LG+D  TA+ I+
Sbjct  112   QEAARKRLHDEIINSDLFELLKRTHGNSYEAFMTSKLIPIVGDISQNNLGMDPETADSIS  171

Query  775   KEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQG  954
             KE+D+I++SAA TTFD+RYD+AL  NT GP++ M+F+ +C +L L LH STAYVNG RQG
Sbjct  172   KEIDVIISSAARTTFDDRYDLALSTNTMGPHQFMRFSKKCERLTLVLHFSTAYVNGTRQG  231

Query  955   KIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGL  1134
              + E P                    +P+L +E E+++   A +      MAQKMKELG 
Sbjct  232   IVPETP--------------------LPRLEIESELKLASEAARTFHHREMAQKMKELGR  271

Query  1135  ERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDP  1314
             ERA   G+QDTY   KAMGEM+ID+ RGN+P+VI+RP  IES++ EPFPGW++GNRM DP
Sbjct  272   ERAIIHGFQDTYTLAKAMGEMVIDSSRGNLPIVIIRPGAIESSYTEPFPGWIQGNRMADP  331

Query  1315  IILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNP  1494
             +IL YGKGQL     DP  V+DVVP DMVVN  +AAMAKHG   KPG S+YH  SSV NP
Sbjct  332   LILAYGKGQLPCLFGDPQTVVDVVPVDMVVNFAMAAMAKHGIDPKPGLSVYHPTSSVANP  391

Query  1495  LVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGD  1674
             L   +L  L++ HF   P  DSKG+ I    MK  SS+E   S+                
Sbjct  392   LPLHELFDLVHRHFCHSPLRDSKGEDIVTEPMKFHSSLEDFCSY----------------  435

Query  1675  SKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFE  1854
                 + TK +   ++ ++  + +A  YEP TF   RFDN+NA++L+E M+ EER  FGF 
Sbjct  436   ----IRTKSKTKSQRKIKYFEGIAKAYEPVTFTKARFDNTNARRLVEEMAMEERSMFGFN  491

Query  1855  VESIDWKDYISNVHIPGLRRHVMKGR  1932
              ESIDW  YI NVHIPGL++HV++GR
Sbjct  492   TESIDWPHYIMNVHIPGLKKHVLRGR  517



>ref|XP_009766808.1| PREDICTED: fatty acyl-CoA reductase 2-like [Nicotiana sylvestris]
Length=583

 Score =   484 bits (1247),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 249/498 (50%), Positives = 347/498 (70%), Gaps = 4/498 (1%)
 Frame = +1

Query  439   KHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERL  618
             K  DGIGIV F  GK+ L+TG TGFL K L+EK+LRT P ++KIY+LI+A +K VA +RL
Sbjct  84    KSSDGIGIVDFFGGKNVLVTGATGFLAKALVEKMLRTTPKINKIYLLIRAKDKGVAFDRL  143

Query  619   KKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVN  798
               EII ++LFK L++ +G+ Y+ FMLSKLVPVVGN+ E +LG+D  TA  IA+E D+IV+
Sbjct  144   TSEIIESKLFKGLEEIHGEYYKPFMLSKLVPVVGNIHEPNLGMDIITAHQIAEETDLIVD  203

Query  799   SAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFC  978
             SAANTTFDERYD+AL+ N  GP +LM FA +C KLKL +H STAY NG+R+G I+E PF 
Sbjct  204   SAANTTFDERYDIALEANVNGPCQLMMFAKKCKKLKLLMHYSTAYANGEREGLILEMPFT  263

Query  979   IGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-SDGAMAQKMKELGLERANKFG  1155
             +GESI  E + + +  +  P L+   EM++V   K  + ++  + Q MK+LG+ERA  +G
Sbjct  264   MGESITKEKITSFSPFTKFPSLHAMSEMDLVSKLKNAITTNNGLEQIMKDLGIERAKLYG  323

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             WQDTY FTKA+GEMMID+MR  IP++I+RPS+I S+ KEPFPGW++G R++DP +  YGK
Sbjct  324   WQDTYSFTKAIGEMMIDSMREEIPILILRPSMIASSFKEPFPGWIQGFRVIDPSVFLYGK  383

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             G L  FL DP+ ++DVVP D+VVNAT+AA+AKHG    P  ++YH+AS+ VNP     L 
Sbjct  384   GDLPAFLGDPDCLVDVVPVDLVVNATMAAIAKHGYLQSPEVNVYHVASTFVNPFSLYQLF  443

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLST  1695
                YE+F S P ++SKG  ++V  MK F  +   S+++W +   +  +  L + K  L T
Sbjct  444   NYCYEYFTSFPLVNSKGDKVEVKEMKYFDKISDFSNYIWEELSRQHNVQDLTE-KELLKT  502

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
             ++    ++ VE  K+   +YEPY FY G F   N + LME MS+EER  F  +   I+W+
Sbjct  503   QMR--FKRKVEYLKHFCKLYEPYAFYKGWFHVGNMRNLMEEMSEEERISFEIDASKINWR  560

Query  1876  DYISNVHIPGLRRHVMKG  1929
             DY++ +HIPG++ HV+KG
Sbjct  561   DYLTEIHIPGVKEHVLKG  578



>gb|KCW65405.1| hypothetical protein EUGRSUZ_G02830 [Eucalyptus grandis]
Length=494

 Score =   481 bits (1238),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 247/500 (49%), Positives = 329/500 (66%), Gaps = 16/500 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL K   +K L+     H+  +     N + ++     +
Sbjct  9     DGVGIIGFLERRNFLITGATGFLAKGNGDKPLKMR---HENVLF---SNTKRSLSVFIFQ  62

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  LKQ YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  63    IIGCELFICLKQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  122

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  123   NTTFDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  182

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +GW + 
Sbjct  183   SRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEIGLARARMYGWHNV  234

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI   RG +PVVIVRPSVIEST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  235   YEMTKAMGEMMITADRGRVPVVIVRPSVIESTFREPFPGWIQGYRMLDPLILSYGKGRLP  294

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDPN VLDV+PAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  295   GFLVDPNTVLDVIPADLVANVIIAAMAKHGTTASPSIDVYHAASSTVNPIMMCDVLNYSR  354

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKLSTKL  1701
             +HF + P  D +G  I +  M+ FSS+++ SS++ +D  +KSGL+  +G +S  K  ++L
Sbjct  355   DHFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIAEKSGLSKEIGPNSNPKQRSRL  414

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLME MS EE  +F  ++ SI+W+DY
Sbjct  415   EARCKRMAESIIHLAKLYEPYAFYRARFDSWNTRKLMEQMSTEEGNKFPIDLRSINWEDY  474

Query  1882  ISNVHIPGLRRHVMKGRGSC  1941
              +N HIPGL RHV+K   S 
Sbjct  475   FTNAHIPGLERHVIKKASSS  494



>ref|XP_010427503.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Camelina 
sativa]
Length=544

 Score =   481 bits (1239),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/496 (47%), Positives = 332/496 (67%), Gaps = 27/496 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIVRFL+GKS+L+TG TGFL KVLIEK+LR  P++ KI++L+++ ++E A +RL  E
Sbjct  74    DGIGIVRFLKGKSYLVTGATGFLAKVLIEKMLREGPEIGKIFLLMRSKDQESANKRLYFE  133

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II ++LFK LKQ +G SY+ FM SKL+PV+G++ E +LGI+   A+MI++E+D+I++   
Sbjct  134   IIRSDLFKLLKQMHGSSYETFMKSKLIPVIGDIGEDNLGIEPEIADMISEEIDVIISCGG  193

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD AL +N  GPNRL+ F  +C KLKLFLH STAYV G+ +G ++E P CIGE
Sbjct  194   RTTFDDRYDSALSVNALGPNRLLSFGKECKKLKLFLHFSTAYVTGKNEGLVLETPLCIGE  253

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+E E+++   A +         K+KELG ERA  +GW ++
Sbjct  254   NITSD-------------LNIESELKLASEAVRKFHGREKTNKLKELGFERAQHYGWDNS  300

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIIL-HYGKGQL  1344
             Y FTKAMGE +I++ RG++PVVI+RPS+IES++KEPFPGW++G RM+DPII+ +YGKGQ+
Sbjct  301   YTFTKAMGETIINSNRGDLPVVIIRPSIIESSYKEPFPGWIQGIRMVDPIIVGYYGKGQI  360

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLARL  1521
             +GF  D   +LD+ P DM+VNA + AMAKHG  G P   +Y + SS   NPL F +L  L
Sbjct  361   SGFWADSKSLLDITPVDMLVNAAITAMAKHG-CGVPELKVYTVTSSSHANPLRFGELMDL  419

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
              Y+H +  P  +++   ID+  MK  SS+E+ +S L      K G + +     K   +L
Sbjct  420   SYQHLRDSPMENTE---IDLAPMKYHSSLESFTSSLSNKMKRKEGESHISTMSDKQKRRL  476

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             + +          +A IY+PY F+  RFD++N   LM  MS EER  F F  + IDWK Y
Sbjct  477   KYLVS--------MARIYKPYMFFQARFDDTNTTSLMHEMSMEERKMFEFNTKDIDWKHY  528

Query  1882  ISNVHIPGLRRHVMKG  1929
             I+NVH+PGL++   +G
Sbjct  529   IANVHLPGLKKQFFQG  544



>ref|XP_009104015.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X1 [Brassica rapa]
Length=549

 Score =   481 bits (1238),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/500 (47%), Positives = 338/500 (68%), Gaps = 23/500 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+RFL+GK++LITG TGFLGKVLIEK+LR  PD+ KI+ILIK+ ++E A +RL  E
Sbjct  70    DGVGIIRFLKGKTYLITGATGFLGKVLIEKLLRASPDIGKIFILIKSKDQESANKRLYDE  129

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+++LF  LKQ +G+SY+ FM SKL+P++G++ E +LGI    A  I+ E+D++++ A 
Sbjct  130   IITSDLFNHLKQMHGRSYEEFMKSKLIPIIGDIGEDNLGIGSEIAANISGEIDVVISCAG  189

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL++N  GP RL+ FA  C KLKLFLH+STAYV G+++G ++E P CIG+
Sbjct  190   RTTFDDRYDLALNVNAFGPGRLLSFAKDCKKLKLFLHISTAYVTGKKEGTVLETPLCIGK  249

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+E E+++   A + L      +K+KELG++RA  +GW++T
Sbjct  250   NITSD-------------LNIEHELKLASEAVRKLHGSGEIKKLKELGIQRAQHYGWENT  296

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGE +I  MR ++P+VI+RPS+IES++KEPFPGW++G RM DP+IL YGKGQ++
Sbjct  297   YTFTKAMGETLIQTMREDVPIVIIRPSIIESSYKEPFPGWLQGIRMTDPMILAYGKGQIS  356

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLARLL  1524
             GF  D    LD++P DMVVNAT+AAMAKHG  G     +Y++ SS   +PL   +   L 
Sbjct  357   GFWGDSQSFLDIIPVDMVVNATIAAMAKHG-CGNSDLKVYNVTSSSHAHPLRAGEYMDLC  415

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS--GLTALGDSKGKLSTK  1698
             Y+H    P        ID+ R K  SS++  +S ++ D I K   G    G    +  T 
Sbjct  416   YQHLCDFPLT-----VIDLTRWKFHSSLDGFTSSVF-DIIAKQERGTKNEGGEAEESHTT  469

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
             L    ++ ++    LA  YEPYTF+  RFD++N + L++ MS EE   F F+++SIDWK 
Sbjct  470   LSFKGKRILDYFVSLARTYEPYTFFQARFDDTNTRSLIQEMSIEEIEMFEFDIKSIDWKH  529

Query  1879  YISNVHIPGLRRHVMKGRGS  1938
             YI NVH+PGL+R  +K R +
Sbjct  530   YIVNVHLPGLKRESLKERSN  549



>gb|EYU36637.1| hypothetical protein MIMGU_mgv1a003539mg [Erythranthe guttata]
Length=579

 Score =   481 bits (1237),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 228/497 (46%), Positives = 335/497 (67%), Gaps = 14/497 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIV F +GK+ LITG TG LGKV++EKILR+ P V KIY+LIKA +K+ A  RL  E
Sbjct  89    DGIGIVDFFQGKNILITGATGLLGKVIVEKILRSTP-VGKIYLLIKAKDKDAAFHRLTNE  147

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II ++LFK LK  +G+SY+ F+  KL+PVVG++CE ++G+D  +A+ + K+V +++ SAA
Sbjct  148   IIDSDLFKCLKDEHGESYEAFVREKLIPVVGDICEPNMGLDSDSADALRKDVHVVIQSAA  207

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             +TT +ERYDV ++ N   P R+M+FA  C  LKLF  +STAYVNG+R+G ++E P  +G+
Sbjct  208   STTLNERYDVLIEANVTAPQRVMRFAKTCKNLKLFAQISTAYVNGRREGVMLEDPLIMGD  267

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
             +   E       ++++P+L++ DE+ + L S     SD  + + +K+LGLERA  FGW +
Sbjct  268   NRRKEDC-----DANIPRLDIADEINLALKSCSAAASDYDVTKDLKKLGLERAELFGWYN  322

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TY  TKAMGEM+++ +RG++PV+I+RP+VIES+ KEP PGW++GNRM DP+I+ YGKGQL
Sbjct  323   TYHLTKAMGEMVLNEIRGDVPVLIIRPTVIESSFKEPVPGWIQGNRMFDPVIISYGKGQL  382

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
               F  +P   +D++P DMV N T+AA+AK     KP  ++YH+ASS  NPL + D    L
Sbjct  383   PAFFGNPEVTMDIIPVDMVANTTIAAIAKEANKNKPQLNVYHVASSNRNPLKYTDFFEYL  442

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT--ALGDSKGKLSTK  1698
             YE+F S P ++S+    ++ R++ FS     S +  R  I +   T   +GD  G +  K
Sbjct  443   YEYFNSSPLVESQ----NISRIEYFSDFNDFSEYT-RGEISQQLETNNVVGDEHGNVIRK  497

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
              +N CR  V  A+ L  +YE   F+  RFD  N +KL++ MSKEER  F  +V +IDW+ 
Sbjct  498   AQNKCRARVAYAQQLCKMYEFIGFFNARFDTRNTEKLVKEMSKEERINFEVDVMNIDWRK  557

Query  1879  YISNVHIPGLRRHVMKG  1929
             Y   +HIPG+++H++ G
Sbjct  558   YFQEIHIPGVKKHIING  574



>gb|EYU34259.1| hypothetical protein MIMGU_mgv1a018251mg, partial [Erythranthe 
guttata]
Length=557

 Score =   479 bits (1233),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 232/501 (46%), Positives = 334/501 (67%), Gaps = 15/501 (3%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI++F  GK+  +TGGTG LGKVL+EKILR+ P V KIY+L+KAD++E A++R+ KE+
Sbjct  63    GIGILKFFEGKNIFVTGGTGLLGKVLVEKILRSTP-VGKIYVLVKADDQEAAVDRITKEL  121

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I++ELF+ LK+ +GK YQ ++   L+P+VGN+CE +LG+D  +   I ++V++I+ SAA 
Sbjct  122   INSELFRCLKEKHGKYYQAYIKETLIPIVGNICEPNLGMDSDSTHAIMEDVNVIIESAAI  181

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TT +ERYDV L+ N   P +LM+FA  C  L+LF+H+STAYVNG+R+G I+EKP  +GE+
Sbjct  182   TTLNERYDVLLEANVNSPQQLMRFAKTCKNLELFVHISTAYVNGEREGIILEKPLIMGEN  241

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQ-GLSDGAMAQKMKELGLERANKFGWQDT  1167
                +   N    S  P+L++ DE+ + +S KQ   S+  + + MK LG+ERAN +GW +T
Sbjct  242   RRNDDTCNT---SPFPRLDITDEVNLSVSRKQMASSNYDLTRDMKSLGMERANLYGWYNT  298

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAM EM+I+  RG+IPVVI+RP+VIES  KEP PGW++GNRM DPII+ YGKGQL 
Sbjct  299   YHLTKAMAEMVINETRGDIPVVIIRPTVIESCCKEPIPGWIQGNRMFDPIIVSYGKGQLP  358

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FL  P+  +D +P D+VVN T+AA+AKHG   KP  ++YH++SSV NPL + +    LY
Sbjct  359   AFLGKPDSPMDAIPLDIVVNGTIAAIAKHGYMQKPELNVYHMSSSVTNPLRYSEFFEYLY  418

Query  1528  EHFQSKPYIDSK-----GKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS  1692
             E+F S+P ++S+         D+ ++K F +    S +  R+ I + G    G      +
Sbjct  419   EYFSSEPLVESETLIRVNYYDDIEKIKYFDNFNDFSKYT-REEISRRG----GGENAVAT  473

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              K +  CR  +  A++L  +YE    +  RF   N QKL+  MSKEE   F  +V  I+W
Sbjct  474   KKAQTQCRAKIIYAEHLCKMYEFLGLFKARFHAGNTQKLLYEMSKEEVDNFDIDVSKIEW  533

Query  1873  KDYISNVHIPGLRRHVMKGRG  1935
             + Y   VHIPGLR+HV+  R 
Sbjct  534   RKYFQEVHIPGLRKHVLNDRS  554



>ref|XP_010068863.1| PREDICTED: fatty acyl-CoA reductase 2-like [Eucalyptus grandis]
Length=469

 Score =   475 bits (1222),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 309/447 (69%), Gaps = 10/447 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL KVLIEKILR  P+V KI++LIKA +++ AM+R+K E
Sbjct  31    DGVGIIGFLERRNFLITGATGFLAKVLIEKILRVAPNVGKIFLLIKAKDEQAAMDRVKNE  90

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  ELF  LKQ YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  91    IIGCELFICLKQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  150

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  151   NTTFDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  210

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +GW + 
Sbjct  211   SRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEIGLARARMYGWHNV  262

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI   RG +PVVIVRPSVIEST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  263   YEMTKAMGEMMITADRGRVPVVIVRPSVIESTFREPFPGWIQGYRMLDPLILSYGKGRLP  322

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDPN VLDV+PAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  323   GFLVDPNTVLDVIPADLVANVIIAAMAKHGTTASPSIDVYHAASSTVNPIMMCDVLNYSR  382

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA-LG-DSKGKLSTKL  1701
             +HF + P  D +G  I +  M+ FSS+++ SS++ +D  +KSGL+  +G +S  K  ++L
Sbjct  383   DHFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIAEKSGLSKEIGPNSNPKQRSRL  442

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGR  1782
             E  C++  E   +LA +YEPY FY  R
Sbjct  443   EARCKRMAESIIHLAKLYEPYAFYRAR  469



>emb|CDX67654.1| BnaA07g16940D [Brassica napus]
Length=549

 Score =   477 bits (1227),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 235/500 (47%), Positives = 336/500 (67%), Gaps = 23/500 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+RFL+GK++LITG TGFLGKVLIEK+LR  PD+ KI+ILIK+ ++E A +RL  E
Sbjct  70    DGVGIIRFLKGKTYLITGATGFLGKVLIEKLLRASPDIGKIFILIKSKDQESANKRLYDE  129

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+++LF  LKQ +G+SY+ FM SKL+P++G++ E +LGI    A  I+ E+D++++ A 
Sbjct  130   IITSDLFNHLKQMHGRSYEEFMKSKLIPIIGDIGEDNLGIGSEIAANISGEIDVVISCAG  189

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL++N  GP RL+ FA  C KLKLFLH+STAYV G+++G ++E P CIG+
Sbjct  190   RTTFDDRYDLALNVNALGPGRLLSFAKDCKKLKLFLHISTAYVTGKKEGTVLETPLCIGK  249

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+E E+++   A + L      +K+KELG++RA  +GW++T
Sbjct  250   NITSD-------------LNIEHELKLASEAVRKLHGSGEIKKLKELGIQRAQHYGWENT  296

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGE +I  MR ++PVVI+RPS+IES++KEPFPGW++G RM DP+IL YGKGQ++
Sbjct  297   YTFTKAMGETLIQTMREDVPVVIIRPSIIESSYKEPFPGWLQGIRMTDPMILAYGKGQIS  356

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLARLL  1524
             GF  D    LD++P DMVVNAT+A MAKHG  G     +Y++ SS   +PL   +   L 
Sbjct  357   GFWGDSQSFLDIIPVDMVVNATIATMAKHG-CGNSDLKVYNVTSSSHAHPLRAGEYMDLC  415

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS--GLTALGDSKGKLSTK  1698
             Y+H    P        ID+ R K  SS++  +S +  D I K   G    G    +  T 
Sbjct  416   YQHLCDFPLT-----VIDLARWKFHSSLDGFTSSVI-DIIAKQERGTKNEGGEAEESHTT  469

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
             L    ++ ++    LA  YEPYTF+  RFD++N + L++ MS EE   F F+++SIDW+ 
Sbjct  470   LSFKGKRILDYFVSLARTYEPYTFFQARFDDTNTRSLIQEMSIEEIEMFEFDIKSIDWEH  529

Query  1879  YISNVHIPGLRRHVMKGRGS  1938
             YI NVH+PGL+R  +K R +
Sbjct  530   YIVNVHLPGLKRESLKERSN  549



>ref|XP_002960337.1| hypothetical protein SELMODRAFT_270198 [Selaginella moellendorffii]
 gb|EFJ37876.1| hypothetical protein SELMODRAFT_270198 [Selaginella moellendorffii]
Length=581

 Score =   474 bits (1221),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/502 (48%), Positives = 334/502 (67%), Gaps = 35/502 (7%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             +GI+ FL  K  LITG TGFLGKVL+EKILR  P V KIY+L+ AD+ E A +RL+K+I+
Sbjct  77    LGILPFLENKRILITGATGFLGKVLVEKILRAQPKVSKIYLLVHADSHEKARQRLEKDIL  136

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANT  813
              + LF+ +++ YG  Y+ FML KLV + G+V ++DLG++ HT E +  ++D++VNSAA T
Sbjct  137   ESRLFELIREEYGADYRQFMLEKLVAIPGSVEKNDLGLEKHTKEQLLSQLDVVVNSAATT  196

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              F ERYDVAL +NT GP  L++FA +C +L+LFLHVSTAY NG RQG+I+EKP       
Sbjct  197   KFFERYDVALAVNTKGPLNLLEFAKKCSRLQLFLHVSTAYSNGLRQGRILEKPLA-----  251

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
                S+ NG      P L+V  E++ V + K      A ++++KELG++RA   GWQDTYV
Sbjct  252   ---SMSNG----IAPPLDVWKEIDSVRNIK------ATSEELKELGMQRAQLHGWQDTYV  298

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGE ++   RG++PVVI+RPSV+E T  +PF GW++G RMMDP++L YG G LTGF
Sbjct  299   FTKAMGETLVTQSRGDVPVVILRPSVVEGTSAQPFGGWIQGTRMMDPMLLAYGLGHLTGF  358

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
               DP+ VLDV+PADMVVN+ LAAM+ H  AG+PG S+YH+ SS VNPL F +LA    E+
Sbjct  359   YADPDCVLDVIPADMVVNSLLAAMSVH--AGRPGLSVYHVGSSTVNPLTFRELAACTEEY  416

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-----------RDAIDKSGLTALGDSK  1680
             FQS P +D +G P++  RM  + +  A S H +            + +  +   +   ++
Sbjct  417   FQSNPVLDERGNPVE-RRMTFYDNKLAFSVHKFLCYSLPIHVRPPNFLALNSCYSFQVAR  475

Query  1681  GKLSTKLENICRKS---VEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGF  1851
                S KL+N  +++    E+   L   Y  YTFY GRFD +N + L E M  EE+  FGF
Sbjct  476   LSGSRKLQNSAKRTAILAERLDQLVETYSAYTFYKGRFDITNTKTLYEQMLPEEKEGFGF  535

Query  1852  EVESIDWKDYISNVHIPGLRRH  1917
             ++ SI W +YI+NVH+PGLR++
Sbjct  536   DIGSIRWNEYITNVHLPGLRKN  557



>ref|XP_010068864.1| PREDICTED: fatty acyl-CoA reductase 2-like [Eucalyptus grandis]
Length=491

 Score =   471 bits (1212),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/471 (50%), Positives = 321/471 (68%), Gaps = 21/471 (4%)
 Frame = +1

Query  445   EDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
              DGIGI+ FL G++FL+TG TGFL KVLIEKILR  P+V KI++LIKA +K+ AM+R+K 
Sbjct  33    RDGIGILNFLEGRNFLVTGATGFLAKVLIEKILRVSPNVGKIFLLIKAKDKQAAMDRVKD  92

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             EII  ELFK L+Q YG+ Y  FMLSKLVPV G++ ES++GI D +   I +EVD+I+NSA
Sbjct  93    EIIGCELFKCLRQQYGEGYTNFMLSKLVPVNGDIRESNMGIGDDSFCQITQEVDVIINSA  152

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             ANTT DERYD AL  NT  P+RL+ FA +C KL LFLH+ST YVNG+R G ++EK F +G
Sbjct  153   ANTTLDERYDAALVANTIAPSRLLSFAKKCKKLSLFLHLSTTYVNGERPGILMEKAFEMG  212

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
             +S            S+  KL+V  E+ +     + L    + QK+KE+GL R   +GWQ+
Sbjct  213   DSRI--------DSSTQGKLDVHHEINLASDLIETLPPNEVPQKLKEIGLARPRMYGWQN  264

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
              Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G R++DP+IL YGKG+L
Sbjct  265   VYQMTKAMGEMMINADRGRVPVVIVRPSVIESTFQEPFPGWIQGYRVLDPLILSYGKGRL  324

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
              GFLV+P+ V+DVVPAD+V N  +AAMAKHG    PG  +YH ASS VNP+   D+    
Sbjct  325   PGFLVNPDTVMDVVPADLVANVIIAAMAKHGIVTSPGIDVYHAASSTVNPMTMCDMFNYS  384

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALGDS-KGKLSTK  1698
             +++F + P +D++G  I +  M+ FSS+++ SS++ +D  +K GL+  +G +   K  ++
Sbjct  385   HDYFAASPLMDNQGDEIQIADMEYFSSIDSFSSYIQKDIAEKGGLSEEIGPNLNPKQRSR  444

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGF  1851
             LE  C++  E   +LA +YEPY FY  R  N ++           R +FGF
Sbjct  445   LEARCKRMTENLIHLAKLYEPYMFYRARAGNPDS-----------RVEFGF  484



>ref|XP_002967375.1| hypothetical protein SELMODRAFT_270623 [Selaginella moellendorffii]
 gb|EFJ31974.1| hypothetical protein SELMODRAFT_270623 [Selaginella moellendorffii]
Length=582

 Score =   473 bits (1217),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 240/502 (48%), Positives = 333/502 (66%), Gaps = 35/502 (7%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             +GI+ FL  K  LITG TGFLGKVL+EKILR  P V KIY+L+ AD+ E A +RL+K+I+
Sbjct  78    LGILPFLENKRILITGATGFLGKVLVEKILRAQPKVSKIYLLVHADSHEKARQRLEKDIL  137

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANT  813
              + LF+ +++ YG  Y+ FML KLV + G+V ++DLG++ HT E +  ++D++VNSAA T
Sbjct  138   ESRLFELIREEYGADYRQFMLEKLVAIPGSVEKNDLGLEKHTKEQLLSQLDVVVNSAATT  197

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              F ERYDVAL +NT GP  L++FA +C +L+LFLHVSTAY NG RQG+I+EKP       
Sbjct  198   KFFERYDVALAVNTKGPLNLLEFAKKCSRLQLFLHVSTAYSNGLRQGRILEKPLA-----  252

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
                S+ NG      P L+V  E++ V + K      A ++++KELG++RA   GWQDTYV
Sbjct  253   ---SMSNG----IAPPLDVWKEIDSVRNIK------ATSEELKELGMQRAQLHGWQDTYV  299

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGE ++   RG++PVVI+RPSV+E T  +PF GW++G RMMDP++L YG G LTGF
Sbjct  300   FTKAMGETLVTQSRGDVPVVILRPSVVEGTSAQPFGGWIQGTRMMDPMLLAYGLGHLTGF  359

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
               DP+ VLDV+PADMVVN+ LAAM+ H  AG+PG S+YH+ SS VNPL F +LA    E+
Sbjct  360   YADPDCVLDVIPADMVVNSLLAAMSVH--AGRPGLSVYHVGSSTVNPLTFRELAVCTEEY  417

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-----------RDAIDKSGLTALGDSK  1680
             FQS P +D  G P++  RM  + +  A S H +            + +  +   +   ++
Sbjct  418   FQSNPVLDENGNPVE-RRMTFYDNKLAFSVHKFLCYSLPIHVRPPNFLALNSCYSFQVAR  476

Query  1681  GKLSTKLENICRKS---VEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGF  1851
                S KL+N  +++    E+   L   Y  YTFY GRFD +N + L E M  EE+  FGF
Sbjct  477   LSGSRKLQNSAKRTAILAERLDQLVETYSAYTFYKGRFDITNTKTLYEQMLPEEKEGFGF  536

Query  1852  EVESIDWKDYISNVHIPGLRRH  1917
             ++ SI W +YI+NVH+PGLR++
Sbjct  537   DIGSIRWNEYITNVHLPGLRKN  558



>ref|XP_007029095.1| Uncharacterized protein TCM_025012 [Theobroma cacao]
 gb|EOY09597.1| Uncharacterized protein TCM_025012 [Theobroma cacao]
Length=655

 Score =   473 bits (1217),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 315/449 (70%), Gaps = 9/449 (2%)
 Frame = +1

Query  436   EKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMER  615
             E  +DGIGI +FLRGK   I+G TGF+GKVL+EKILR+VP+V K+Y++++A +KE A +R
Sbjct  25    EGKDDGIGIDKFLRGKVIFISGATGFVGKVLVEKILRSVPNVSKMYLMMRAKDKEAAKQR  84

Query  616   LKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIV  795
             LK E I  ELFK +KQ YGK Y+ F +SKLVPV GNVC+SDLG+++  A  I K V II+
Sbjct  85    LKTEAIDFELFKCVKQKYGKYYEAFTMSKLVPVEGNVCQSDLGLEEEIANAIKKGVQIII  144

Query  796   NSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPF  975
             NSAANT+F    +  LDIN  GP  LM FA  C KL+LFLH+STAYVN  R G+I+E+  
Sbjct  145   NSAANTSFYPSCEATLDINAMGPYHLMGFAKMCFKLELFLHLSTAYVNVPRPGRIMEQKL  204

Query  976   CIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFG  1155
             C+  S+  ES+ + +    +P L +E+E ++    K+  ++ A+A+K KELGL+RA +FG
Sbjct  205   CMTNSMGRESLFSKSPGRFLPTLVLENENKVAAECKKTFANNAVAKKSKELGLQRAKEFG  264

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             W + YVFTKA+GEM+ID MR +IPVVI+RP  +E T KEPFPGW+EG++ +DPI+  YGK
Sbjct  265   WTNAYVFTKALGEMIIDTMREDIPVVIIRPPAVEGTCKEPFPGWIEGHKSIDPIVSVYGK  324

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             G+L GF    + V+D+VP DMVVN TLAAM +HG   K   +IYH++SS+ NPL   DL 
Sbjct  325   GKLKGFPGIADNVIDIVPVDMVVNETLAAMTRHGVTRKVDINIYHVSSSISNPLTLQDLC  384

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLST  1695
             +L Y+HF+S P I + GK I++ ++K+F+SME   +HL R+A   S      +  GK+ T
Sbjct  385   QLFYQHFKSLPCIGANGKHINIQKLKIFASMEEFDAHLLREATTNSSDM---NPSGKIET  441

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGR  1782
                   RK +E AKYLA +Y+P+TFY  R
Sbjct  442   ------RKFIELAKYLAKVYKPFTFYHYR  464


 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  1783  FDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             F  +N QKL+E MS+ E+ +FGF+V+SIDWK YI NVHIPGLRR+VMK +G
Sbjct  555   FSTNNTQKLLESMSEVEKEKFGFDVKSIDWKHYIVNVHIPGLRRYVMKEKG  605



>ref|XP_006341245.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum tuberosum]
Length=464

 Score =   466 bits (1198),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 322/460 (70%), Gaps = 7/460 (2%)
 Frame = +1

Query  412   KELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKAD  591
             KE++S   +K  +GIGIV F  GK+ L+TGGTGFL K LIEK+LRT P ++KIYILI+A 
Sbjct  5     KEIIS---QKANNGIGIVEFFEGKNILVTGGTGFLAKALIEKMLRTTPKINKIYILIRAK  61

Query  592   NKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMI  771
             +K  A  RLK EII ++LFK L++ +G+ Y+ F+L+KL+PVVGN+ E +LG+D  T++ I
Sbjct  62    DKGAAFNRLKSEIIESKLFKCLEEMHGEYYKPFILNKLIPVVGNIYEPNLGMDIITSQQI  121

Query  772   AKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQ  951
             A+++D+I++SAANTTFDERYD+ALD N  GP +LM FA +C  LKL +H STAY NG+R+
Sbjct  122   AQQIDLIIDSAANTTFDERYDLALDANVNGPYQLMMFAKKCKNLKLLMHYSTAYANGERE  181

Query  952   GKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDG-AMAQKMKEL  1128
             G I+EKPF +GESI  E + + +  ++ P L+V++EM++V   K  +++   + Q MK L
Sbjct  182   GLILEKPFTMGESITKEKITSISSFTNFPSLHVDNEMDLVSKLKNNITNNIGLEQIMKNL  241

Query  1129  GLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMM  1308
             G+ERA  +GWQDTY FTKA+GEMMI++MR  IP++I+RPS+I S++KEPFPGW++G R++
Sbjct  242   GVERAKLYGWQDTYTFTKAIGEMMINSMRHEIPILILRPSIITSSYKEPFPGWIQGYRVI  301

Query  1309  DPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVV  1488
             DP I  YGKG+L     D N ++DV+P D+VVNAT+AA+AKHG    P  ++YH+A++ V
Sbjct  302   DPSIFLYGKGELPAVYCDQNTLMDVIPVDLVVNATMAAIAKHGYLQSPQLNVYHLATTFV  361

Query  1489  NPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTAL  1668
             NPL    +    YE+F   P+++SKG  I+V  MK F  +   S+++W     +  +  L
Sbjct  362   NPLAIHQIFDYCYEYFTLFPFVNSKGDKIEVKEMKYFDKISDFSNYIWEVLSKQHKVQDL  421

Query  1669  GDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFD  1788
              +   K   K+    ++ VE     +  YEPY FY GR++
Sbjct  422   SE---KELLKIHMRFKRKVEFLNNFSKRYEPYGFYRGRYE  458



>ref|XP_009116368.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic [Brassica 
rapa]
Length=556

 Score =   469 bits (1206),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 233/513 (45%), Positives = 341/513 (66%), Gaps = 22/513 (4%)
 Frame = +1

Query  403   VGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILI  582
             V + E+  +      DG+ I+RFL+GK++L+TG  GFLGKVLIEK+LR  P++ KI++LI
Sbjct  61    VTLFEMPETETSSVSDGVEILRFLKGKNYLVTGAFGFLGKVLIEKLLRVSPEIGKIFLLI  120

Query  583   KADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA  762
             K+ ++E A  RL  EIIS++LFK LK+ +G SY+ FM SKL+PV G++ E +LGI+  TA
Sbjct  121   KSADQESANRRLYDEIISSDLFKLLKKMHGSSYEAFMKSKLIPVTGDIGEDNLGIESVTA  180

Query  763   EMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNG  942
               I+ E+D+I++ A  TTFD+RYD AL++N  GP RL++F   C  LKLFLH STAYV G
Sbjct  181   AKISGEIDVIISCAGRTTFDDRYDFALNVNVLGPGRLLRFGKGCKNLKLFLHFSTAYVTG  240

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             +++G I+E P CIGE+I  +             LN+E E+++   A + L      +K+K
Sbjct  241   KKEGTILETPLCIGENITSD-------------LNIESELKLASEAVRKLHGSEEIKKLK  287

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELG++RA  +GW++TY FTKAMGE +I N RG++PVVI+RPSVIES++KEPFPGW++G R
Sbjct  288   ELGMKRAQHYGWENTYTFTKAMGESVIHNQRGDLPVVIIRPSVIESSYKEPFPGWLQGIR  347

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
             M DPIIL YGKGQ++ F  D   ++D++P DMVVNAT+AAMAKH + G     +Y++ SS
Sbjct  348   MSDPIILAYGKGQISDFWGDYKSLMDIIPVDMVVNATIAAMAKH-SRGVSELKVYNVTSS  406

Query  1483  V-VNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAI--DKS  1653
                NPL   +L  L ++H    P+ ++    +++ RMK  SS+E  +S  +      ++ 
Sbjct  407   SHANPLRAGELMDLSHQHLCDSPFTET---FMELERMKFHSSLEGFTSSAFNRIAKHERE  463

Query  1654  GLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE  1833
                  GD++    T L    ++ ++    LA  YEPYTF+  RFD++N ++L++ +S EE
Sbjct  464   VKNERGDAESH--TALSMKGKRRLDYFVSLARTYEPYTFFQARFDDTNTKRLIQELSVEE  521

Query  1834  RWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
                F F++  IDW+ YI NVH+PGL+R + K R
Sbjct  522   GKMFEFDISGIDWEHYIVNVHLPGLKRELFKER  554



>ref|XP_011085075.1| PREDICTED: fatty acyl-CoA reductase 2-like [Sesamum indicum]
Length=594

 Score =   470 bits (1209),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/507 (46%), Positives = 351/507 (69%), Gaps = 22/507 (4%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI+ F +GK+  ITG TG +GK LIEK+LR+   V KIY+LIKA++KE A++RLKKEI
Sbjct  93    GIGILEFFQGKNIFITGATGLVGKALIEKLLRST-SVGKIYLLIKAEDKEAAVDRLKKEI  151

Query  631   ISAELFKFLKQTYGK--SYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSA  804
             + +ELFK +++ +G   +YQ  +  KL+PVVGN+C+ +LG+D +++  I K+VD+I+ SA
Sbjct  152   VDSELFKCVREKHGNIYNYQELVKEKLIPVVGNICDPNLGMDLNSSRAIMKDVDVIIESA  211

Query  805   ANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
             A+TT ++RYD  LD N   P RLM+FA  C  LKLF+H+STAYVNG+++G I+EKP  +G
Sbjct  212   ASTTLNDRYDFLLDTNVNAPQRLMRFAKTCKNLKLFVHISTAYVNGRKEGLILEKPLIMG  271

Query  985   ESIAGESVVNGNQESSV---PKLNVEDEMEMVL-SAKQGLSDGAMAQKMKELGLERANKF  1152
             E+  G   +N + E S+   P+L++ DE+ + + S  Q   D  + + +K LGLERAN F
Sbjct  272   EN--GRKDINDDDEMSLCSSPRLDLADEISLAMKSTSQHDQDYDVTKNLKRLGLERANIF  329

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GW + Y  TKAMGEM+++ ++ +IP++I+RP+VIES++KEP PGW++GNRM DP+I+ YG
Sbjct  330   GWYNAYHLTKAMGEMVLNEIKEDIPLLIIRPTVIESSYKEPVPGWIQGNRMFDPVIISYG  389

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAG-KPGTSIYHIASSVVNPLVFDD  1509
             KGQL  +L DP   +D++P DMVVN+T+AA+AKH +   K  +++YH+AS VVNPL F D
Sbjct  390   KGQLPAYLADPQVHMDIIPVDMVVNSTIAAIAKHASNSYKAESNVYHVASGVVNPLRFCD  449

Query  1510  LARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDS----  1677
                +L+E+F S P  + K    D+ ++K FS+M  LS +  R+AI  S    +GD+    
Sbjct  450   FFEILHEYFNSTPLFNIKK---DIRKIKCFSNMNELSKYT-REAILLSN--EMGDAIDDD  503

Query  1678  --KGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGF  1851
               + K+  ++++  +  V  A+ L  +YE   F  GRFD SN QKL++ MS+EE+ +F  
Sbjct  504   EIEEKMVGRVKSRAKAKVAYAEQLCKMYEFIGFIQGRFDTSNTQKLLKEMSQEEQLEFEV  563

Query  1852  EVESIDWKDYISNVHIPGLRRHVMKGR  1932
             +   IDW++Y   +HIPGLR++V+  +
Sbjct  564   DATKIDWRNYFLEIHIPGLRKYVLNDK  590



>gb|EYU17600.1| hypothetical protein MIMGU_mgv1a023408mg, partial [Erythranthe 
guttata]
Length=494

 Score =   466 bits (1199),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/501 (46%), Positives = 332/501 (66%), Gaps = 16/501 (3%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI++F + K+  ITGGTG LGKVL+EKILR+ P V KIY+L+KAD++E A++R+ KE+
Sbjct  1     GIGILQFFQRKNIFITGGTGLLGKVLVEKILRSTP-VGKIYVLVKADDQEGAVDRIAKEL  59

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             +++ELF+ L++ +G  YQ F+   L+PV GN+CE +LG+D  +A  I + V++I+ SAA 
Sbjct  60    VNSELFRSLEEKHGNYYQAFIRETLIPVAGNICEPNLGMDSDSAHAIIENVNVIIQSAAI  119

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             TT +ERYDV L+ N      LM FA  C  L+L +H+STAYVNG+++G I+EKP  +GE+
Sbjct  120   TTLNERYDVLLEANVSSLQHLMSFAKTCKNLELLVHISTAYVNGEKEGIILEKPLIMGEN  179

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMV-LSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
                +      + S  P+LN+ DE+ MV LS++   S+  M + MK+LG+ERAN +GW +T
Sbjct  180   RRNDIC----ETSQFPRLNIADEVNMVALSSRTASSNYDMTKDMKKLGMERANLYGWYNT  235

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAM EM+I+  RG+IPVVI+RP+VIES +KEP PGW++GNRM DP+I+ YG+GQL 
Sbjct  236   YHLTKAMAEMVINETRGDIPVVIIRPTVIESCYKEPIPGWIQGNRMFDPVIVSYGRGQLP  295

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FL  P+  +DV+P D+VVN T+AA+AKHG   KP  ++YH++SSV NPL + +    LY
Sbjct  296   AFLGKPDSPMDVIPLDIVVNGTIAAIAKHGYIQKPELNVYHMSSSVTNPLRYSEFFEYLY  355

Query  1528  EHFQSKPYIDSK-----GKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS  1692
             E+F S+P ++S+         D+ ++K F +    S +  R+ I +     +G      +
Sbjct  356   EYFSSEPLVESESLIRVNYYDDIEKIKYFDNFNDFSKYT-REEISRR----VGGGNVVAT  410

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              K +  CR  +  A+ L  +YE    +  RF   N QKL+  MSKEE+  F  +V  I+W
Sbjct  411   KKAQTQCRAKIMYAENLCKMYEFVGLFKARFHAGNTQKLLYEMSKEEQINFDLDVTKIEW  470

Query  1873  KDYISNVHIPGLRRHVMKGRG  1935
             + Y   VHIPGLR+HV+  R 
Sbjct  471   RKYFQEVHIPGLRKHVLNERS  491



>ref|XP_009139082.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X2 [Brassica rapa]
Length=546

 Score =   468 bits (1204),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 227/498 (46%), Positives = 322/498 (65%), Gaps = 16/498 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIVRFLRGKS+ +TG TGFLGKVLIEK+LR  P++ KI+IL+K+ + E A +RL  E
Sbjct  64    DGIGIVRFLRGKSYFVTGATGFLGKVLIEKLLRASPEIGKIFILLKSKDGESANKRLYDE  123

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LKQ +G SY+ FM +KL+PV+G++ E +LGID  TA+ I+ E+D+I+NSA 
Sbjct  124   IISSDLFKLLKQMHGSSYEAFMKNKLIPVIGDIGEENLGIDSETADKISDEIDVIINSAG  183

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD AL +N  GP+RL+ FA +C KLKLFLHVSTA+V G+R+G ++E P CIG+
Sbjct  184   RTTFDDRYDAALSVNALGPDRLLSFAKECKKLKLFLHVSTAFVTGKREGTVLETPLCIGK  243

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  E             L +E+E+++   A +       ++K+KELG ERA  +GW+  
Sbjct  244   NITSE-------------LKIENEVKLASEAARKFHGSEKSKKLKELGYERAQSYGWEKA  290

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGE +I + RG++PVVI+RPS IES++KEPFPGW++G RM  P+IL  GK Q+ 
Sbjct  291   YTFTKAMGESIIYSKRGDMPVVIIRPSCIESSYKEPFPGWLQGIRMTAPLILGNGKDQIP  350

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDDLARLL  1524
               L D     DV+P DMV NA ++ MAKH     P   +Y+I S S  +PL   ++    
Sbjct  351   DLLGDYQSSCDVIPVDMVANAIISVMAKHSCGNVPEVKVYNITSTSHAHPLRMGEIMDFS  410

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE  1704
             Y+H    P  ++  K ++  RMK  SS+E  +S + +    +      G+ + +  T L 
Sbjct  411   YQHLCDSPLTETTTKVLE--RMKFHSSLEEFTSSVSKAIRKQERAMKNGEEEAESHTTLS  468

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYI  1884
                +K ++    LA  Y+PY F+  RFD +N + L   +S EER  F F+   IDW+ Y 
Sbjct  469   MKGKKKLKYFVSLAKTYQPYMFFQARFDETNTRSLRHELSMEERQMFDFDGSCIDWEHYF  528

Query  1885  SNVHIPGLRRHVMKGRGS  1938
              N+H+PGL+R + + R S
Sbjct  529   INIHLPGLKRELFRQRSS  546



>ref|XP_011074249.1| PREDICTED: fatty acyl-CoA reductase 2-like [Sesamum indicum]
Length=564

 Score =   468 bits (1204),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 225/497 (45%), Positives = 326/497 (66%), Gaps = 18/497 (4%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGIV F +GK+  ITGGTG +GKVLIEK+LR+   V KIY+L+KA++KE A +RL +EI
Sbjct  73    GIGIVNFFQGKNIFITGGTGLVGKVLIEKLLRST-SVGKIYVLVKANDKETASQRLSEEI  131

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I +ELF+ +++ YG SY+ F+  KL+P+ GN+C+S+LG+D +    I ++VD+I+ SAA+
Sbjct  132   IHSELFECIREKYGSSYEEFVREKLIPIAGNICKSNLGMDPYYTHTITEQVDVIIGSAAS  191

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVST------AYVNGQRQGKIIEKP  972
             T  ++RYD +LD+N   P RLM+FA  C  LKLF+HVST      AYVNG+R+G I EKP
Sbjct  192   TNLNDRYDFSLDVNVNAPQRLMRFAKTCKNLKLFVHVSTGLRLGVAYVNGRREGIIFEKP  251

Query  973   FCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKF  1152
               +GE+  G+   +G   S  P+L+V DE+ + + +    ++  + + +K LGLERA  +
Sbjct  252   LSMGEN--GKKEDDGTSSSLFPRLDVTDEINLAMKSCIASTENDLTKNLKRLGLERAAFY  309

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GW  TY  TKAMGEM+I+ MRG++PV+IVRPSVIES++KEP PGW++GNRM DP+I+ YG
Sbjct  310   GWYTTYHMTKAMGEMVINEMRGDVPVLIVRPSVIESSYKEPIPGWIQGNRMFDPVIMSYG  369

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDL  1512
             KG L  +L DP+  +D+VP D+V N  +AA+AKHG   KP  ++YH A++ VNPL + D 
Sbjct  370   KGLLPAYLADPDVYMDIVPVDLVANTIIAAIAKHGIVKKPDLNVYHAATNFVNPLQYSDF  429

Query  1513  ARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS  1692
                +YE+F +KP   S      + +MKLF      S ++  + +   G+T          
Sbjct  430   FDYIYEYFNAKPATLSGS----IAKMKLFKEFGDFSKYIRDELLQPDGVT-----NAMTP  480

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDW  1872
              KL+   +  V  A+ L  +YE   F+  RF   N +KL+E MS+EE+  F  +   IDW
Sbjct  481   QKLQKQYKAKVAYAEQLCKMYEFIGFFQARFHTGNTRKLLEEMSEEEKLCFEVDARKIDW  540

Query  1873  KDYISNVHIPGLRRHVM  1923
             + Y   +HIPG R+HV+
Sbjct  541   RKYFVQIHIPGFRKHVL  557



>gb|EYU17592.1| hypothetical protein MIMGU_mgv1a023221mg, partial [Erythranthe 
guttata]
Length=479

 Score =   464 bits (1195),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 225/495 (45%), Positives = 325/495 (66%), Gaps = 25/495 (5%)
 Frame = +1

Query  469   FLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELF  648
             F  GK+  +TGGTG LGKVL+EKILR+ P + KIY+L+KAD++E A++R+ KE+I++ELF
Sbjct  1     FFEGKNIFVTGGTGLLGKVLVEKILRSTP-IGKIYVLVKADDQEAAVDRITKELINSELF  59

Query  649   KFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDER  828
             + LK+ +GK YQ ++   L+P+VGN+CE +LG+D  +A  I ++V++I+ SAA TT +ER
Sbjct  60    RCLKEKHGKYYQAYIRETLIPIVGNICEPNLGMDSDSAHAIMEDVNVIIESAAITTLNER  119

Query  829   YDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESV  1008
             YDV+L+ N   P +LM+FA  C  L+L +H+STAYVNG+R+G I+EKP  +GE+   +  
Sbjct  120   YDVSLEANVNSPQQLMRFAKTCKNLELLVHISTAYVNGEREGIILEKPLIMGENRRKDDT  179

Query  1009  VNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAM  1188
              N    S  P+LN+ DE           S+  + + MK LG+ERAN +GW +TY  TKAM
Sbjct  180   CNT---SRFPQLNITDEAS---------SNYDLTRDMKRLGMERANLYGWYNTYHLTKAM  227

Query  1189  GEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPN  1368
              EM+I+  RG+IPVVI+RP+VIES +KEP PGW++GNRM DP+I+ YG+GQL  FL  P+
Sbjct  228   AEMVINETRGDIPVVIIRPTVIESCYKEPIPGWIQGNRMFDPVIVSYGRGQLPAFLGKPD  287

Query  1369  GVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKP  1548
               +DV+P D+VVN T+AA+AKHG   KP  ++YH++SSV NPL + +    LYE+F S+P
Sbjct  288   SPMDVIPLDIVVNGTIAAIAKHGYIQKPELNVYHMSSSVTNPLRYSEFFEYLYEYFSSEP  347

Query  1549  YIDSK-----GKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLENI  1710
              I+S+         D+ ++K F +    S++   +   +SG    +G  K K        
Sbjct  348   LIESESLIRVNYYDDIEKIKYFDNFNDFSTYTREEISRRSGRENVVGTEKAKKQ------  401

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISN  1890
             CR  +  A++L  +YE    +  RF   N QKL+  MSKEE   F  +V  I+W+ Y   
Sbjct  402   CRAKIMYAEHLCKMYEFLGLFKARFHAGNTQKLLYEMSKEEMDNFDIDVSKIEWRKYFQE  461

Query  1891  VHIPGLRRHVMKGRG  1935
             VHIPGLR+HV+  R 
Sbjct  462   VHIPGLRKHVLNDRS  476



>emb|CDY56772.1| BnaAnng14390D [Brassica napus]
Length=556

 Score =   465 bits (1197),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/513 (45%), Positives = 340/513 (66%), Gaps = 22/513 (4%)
 Frame = +1

Query  403   VGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILI  582
             V + E+  +      DG+ I+RFL+GK++L+TG  GFLGKVLIEK+LR  P++ KI++LI
Sbjct  61    VTLFEMPETETSSVSDGVEILRFLKGKNYLVTGAFGFLGKVLIEKLLRVSPEIGKIFLLI  120

Query  583   KADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA  762
             K+ ++E A  RL  EIIS++LFK LK+ +G SY+ FM SKL+PV G++ E +LGI+  TA
Sbjct  121   KSADQESANRRLYDEIISSDLFKLLKKMHGSSYEAFMKSKLIPVTGDIGEDNLGIEPVTA  180

Query  763   EMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNG  942
               I+ E+D+I++ A  TTFD+RYD AL++N  GP RL+ F   C  LKLFLH STAYV G
Sbjct  181   AKISGEIDVIISCAGRTTFDDRYDFALNVNALGPGRLLSFGKGCKNLKLFLHFSTAYVTG  240

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             +++G I+E P CIGE+I  +             LN+E E+++   A + L      +K+K
Sbjct  241   KKEGTILETPLCIGENITSD-------------LNIESELKLASEAVRKLHGSEEIKKLK  287

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELG++RA  +GW++TY FTKAMGE +I N RG++PVVI+RPSVIES++KEPFPGW++G R
Sbjct  288   ELGMKRAQHYGWENTYTFTKAMGESVIHNQRGDLPVVIIRPSVIESSYKEPFPGWLQGIR  347

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
             M DPIIL YGKGQ++ F  D   ++D++P DMVVNAT+AAMAKH + G     +Y++ SS
Sbjct  348   MSDPIILAYGKGQISDFWGDYKSLMDIIPVDMVVNATIAAMAKH-SRGVSELKVYNVTSS  406

Query  1483  V-VNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAI--DKS  1653
                +PL   +L  L ++H    P+ ++    +++ RMK  SS+E  +S  +      ++ 
Sbjct  407   SHASPLRAGELMDLSHQHLCDSPFTETF---MELERMKFHSSLEGFTSSAFNRIAKHERK  463

Query  1654  GLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE  1833
                  GD++    T L    ++ ++    LA  YEPYTF+  RFD++N ++L++ +S EE
Sbjct  464   VKNERGDAESH--TALSMKGKRRLDYFVSLARTYEPYTFFQARFDDTNTKRLIQELSVEE  521

Query  1834  RWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
                F F++  IDW+ YI NVH+PGL+R + K R
Sbjct  522   GKMFEFDISGIDWEHYIVNVHLPGLKRELFKER  554



>ref|XP_009139081.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X1 [Brassica rapa]
Length=547

 Score =   465 bits (1196),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 323/499 (65%), Gaps = 17/499 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIVRFLRGKS+ +TG TGFLGKVLIEK+LR  P++ KI+IL+K+ + E A +RL  E
Sbjct  64    DGIGIVRFLRGKSYFVTGATGFLGKVLIEKLLRASPEIGKIFILLKSKDGESANKRLYDE  123

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LKQ +G SY+ FM +KL+PV+G++ E +LGID  TA+ I+ E+D+I+NSA 
Sbjct  124   IISSDLFKLLKQMHGSSYEAFMKNKLIPVIGDIGEENLGIDSETADKISDEIDVIINSAG  183

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD AL +N  GP+RL+ FA +C KLKLFLHVSTA+V G+R+G ++E P CIG+
Sbjct  184   RTTFDDRYDAALSVNALGPDRLLSFAKECKKLKLFLHVSTAFVTGKREGTVLETPLCIGK  243

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  E             L +E+E+++   A +       ++K+KELG ERA  +GW+  
Sbjct  244   NITSE-------------LKIENEVKLASEAARKFHGSEKSKKLKELGYERAQSYGWEKA  290

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEG-NRMMDPIILHYGKGQL  1344
             Y FTKAMGE +I + RG++PVVI+RPS IES++KEPFPGW++G +RM  P+IL  GK Q+
Sbjct  291   YTFTKAMGESIIYSKRGDMPVVIIRPSCIESSYKEPFPGWLQGISRMTAPLILGNGKDQI  350

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDDLARL  1521
                L D     DV+P DMV NA ++ MAKH     P   +Y+I S S  +PL   ++   
Sbjct  351   PDLLGDYQSSCDVIPVDMVANAIISVMAKHSCGNVPEVKVYNITSTSHAHPLRMGEIMDF  410

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
              Y+H    P  ++  K ++  RMK  SS+E  +S + +    +      G+ + +  T L
Sbjct  411   SYQHLCDSPLTETTTKVLE--RMKFHSSLEEFTSSVSKAIRKQERAMKNGEEEAESHTTL  468

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
                 +K ++    LA  Y+PY F+  RFD +N + L   +S EER  F F+   IDW+ Y
Sbjct  469   SMKGKKKLKYFVSLAKTYQPYMFFQARFDETNTRSLRHELSMEERQMFDFDGSCIDWEHY  528

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
               N+H+PGL+R + + R S
Sbjct  529   FINIHLPGLKRELFRQRSS  547



>ref|XP_010248281.1| PREDICTED: fatty acyl-CoA reductase 2-like, partial [Nelumbo 
nucifera]
Length=343

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 265/337 (79%), Gaps = 3/337 (1%)
 Frame = +1

Query  925   TAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGA  1104
             TAYVNGQR+GK++EKPF +G+SIA E +      +S+P L+ E E+++   +K+   +  
Sbjct  10    TAYVNGQREGKVMEKPFYMGDSIAREKLSPDTPPASLPVLDFEAELKLASDSKEACDEST  69

Query  1105  MAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPG  1284
             +AQKMKELGLERA  +GWQDTYVFTKAMGEM++++MRG+IPVVI+RPSVIEST +EPFPG
Sbjct  70    VAQKMKELGLERAQLYGWQDTYVFTKAMGEMLLNSMRGDIPVVIMRPSVIESTLREPFPG  129

Query  1285  WMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSI  1464
             W+EG RMMDPIIL YGKGQLTGFL DP  VLDV+PADMVVNAT+AAMAKHGAA KP   +
Sbjct  130   WIEGIRMMDPIILSYGKGQLTGFLTDPKTVLDVIPADMVVNATMAAMAKHGAAQKPELHV  189

Query  1465  YHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAI  1644
             Y +ASSVVNPL + DL RL Y++F S P  DSKG+ + V RMKLFSSM+  SSHL  D I
Sbjct  190   YQVASSVVNPLSYQDLVRLFYDYFTSFPCKDSKGRSVHVSRMKLFSSMDDFSSHLQTDVI  249

Query  1645  DKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMS  1824
              +S       S GKLS K E + +K  +QAK+LA+IYEPYTFYGGRFDN+N + LME MS
Sbjct  250   QRSREVV---SNGKLSKKDEYLFQKLTDQAKHLANIYEPYTFYGGRFDNTNTEMLMEDMS  306

Query  1825  KEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             +EER  FGF+ +SIDWK+Y S +HIPGLRRHVMKGRG
Sbjct  307   EEERRSFGFDAKSIDWKEYFSKIHIPGLRRHVMKGRG  343



>gb|KCW49551.1| hypothetical protein EUGRSUZ_K03070 [Eucalyptus grandis]
Length=468

 Score =   459 bits (1181),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 233/479 (49%), Positives = 321/479 (67%), Gaps = 29/479 (6%)
 Frame = +1

Query  436   EKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMER  615
              + +DGIGI+ FL  ++FL+TG TGFL KVL EKILR  P+V KI++LIKA +++ AM R
Sbjct  5     RESQDGIGIIDFLERRNFLVTGATGFLAKVLTEKILRVAPNVGKIFLLIKAKDEQAAMNR  64

Query  616   LKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIV  795
              K EII  +LFK L+Q YG+ Y  FML+KLVPV G++ E ++GI D+    I +EVD+I+
Sbjct  65    FKGEIIGCDLFKCLQQKYGEGYTNFMLNKLVPVKGDIREMNMGIGDNLLCQITQEVDVII  124

Query  796   NSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPF  975
             NSAANTT DERYD AL  N   P+RL+ FA +C KL LFLH+ST +VNG+R G ++EK F
Sbjct  125   NSAANTTLDERYDAALVANAIAPSRLLCFAKKCRKLSLFLHLSTTFVNGERPGILMEKAF  184

Query  976   CIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFG  1155
              +GES            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +G
Sbjct  185   QMGESRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEVGLARARMYG  236

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             WQ+ Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G  ++DP+IL YGK
Sbjct  237   WQNVYQMTKAMGEMMINAGRGRVPVVIVRPSVIESTFREPFPGWIQGYGVLDPLILSYGK  296

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             G+L GFLV+P+ V+DVVPAD+V N  +AAMAKHG A  PG ++YH  SS           
Sbjct  297   GRLPGFLVNPDTVMDVVPADLVANVIIAAMAKHGTAASPGINVYHAVSS-----------  345

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKL  1689
                     + P  D++G  I +  M+ FSS+++ SS++ +D  +K+GL+  +G +S  K 
Sbjct  346   --------TSPLTDNQGDEIQIADMEYFSSIDSFSSYIQKDIAEKNGLSNEIGPNSNPKQ  397

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESI  1866
              ++LE  C++  E   +LA +YEPY FY  RFD+ N ++LM+ MS EE  +F  ++ SI
Sbjct  398   RSRLEARCKRMAENLIHLAKLYEPYMFYRARFDSWNTRQLMKQMSTEEGNKFPMDLRSI  456



>ref|XP_007048736.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOX92893.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=521

 Score =   461 bits (1185),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 321/449 (71%), Gaps = 13/449 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GIV FL+GK++ ITG TGF+GKV +EK+LR VP+V KI++LIKA +KE A +RL  +
Sbjct  81    DGLGIVDFLQGKNYFITGATGFVGKVFVEKMLRAVPNVGKIFLLIKAKDKEAATKRLHDQ  140

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  ELFK L+Q +G SY+ FM SKLVPVVGNV E DLG+D   A  IA EVDIIVNSAA
Sbjct  141   IMDTELFKSLEQVHGTSYKTFMESKLVPVVGNVNEPDLGMDADMASEIASEVDIIVNSAA  200

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFD+RYD  L  NT GP RL+ FA +C KL LFLH STAYV+G+R+G I+E+P C G+
Sbjct  201   NTTFDDRYDATLSTNTMGPYRLLGFAKKCKKLSLFLHFSTAYVHGKREGIILERPLCEGQ  260

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMA--QKMKELGLERANKFGWQ  1161
             S+A         E S+P L++E E+++ L+ K+  S   +A   KMKELG+ERA  +GWQ
Sbjct  261   SVA-------EAEESIPVLDIEAEIKLALNLKRSFSGTEIACNWKMKELGMERARAYGWQ  313

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             +TY FTKAMGEM++++ RG+IPVVI+RPS+IEST +EPFPGW+EG+RM+DPII+ + KG 
Sbjct  314   NTYSFTKAMGEMLVNSTRGDIPVVIIRPSIIESTFREPFPGWIEGSRMLDPIIIGHAKGH  373

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
             LTGF+ DP  V+DVVP DMVVNA++AAMAK G AGKPG ++YH+ SSV NP+ F  + + 
Sbjct  374   LTGFVGDPETVMDVVPVDMVVNASMAAMAKQGLAGKPGLTVYHVTSSVANPVDFHTILKS  433

Query  1522  LYEHFQSKPYIDSKG-KPIDVPRMKLFSSMEALSSHLWRDA-IDKSGLT-ALGDSKGKLS  1692
               +HF   P  D KG        +KLF S +  SS++W ++ + ++ L  A   S  KL 
Sbjct  434   SSDHFNCFPVKDLKGPNTTGTSDIKLFRSADIFSSYIWGESTVGQNELKGAAASSDPKLR  493

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGG  1779
              + E  CRK ++   +LA +YEP+  Y G
Sbjct  494   RRQETECRK-IKLYIHLAKLYEPFMLYRG  521



>ref|XP_010909720.1| PREDICTED: fatty acyl-CoA reductase 2-like, partial [Elaeis guineensis]
Length=423

 Score =   454 bits (1169),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 232/386 (60%), Positives = 286/386 (74%), Gaps = 5/386 (1%)
 Frame = +1

Query  226   NMVYCQGGGSNIVTTGRAVDQASKAAALMEAGSLLLAPNGNAQaaaassasasasaaENV  405
             N+V CQG G+     G       + AA    G  ++  + NA+           S  E  
Sbjct  43    NIVRCQGNGNVRNPNGYPPTVTERPAAATVTGDHMVF-SSNAKIRKDVDMMDLTSYKEPT  101

Query  406   GMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIK  585
             G+     +Y+    +GIGIVRFLRGK FLITG TGFLGKVLIEKILRT PDV KIY+LIK
Sbjct  102   GLGT-SDTYLS---EGIGIVRFLRGKEFLITGATGFLGKVLIEKILRTNPDVGKIYVLIK  157

Query  586   ADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAE  765
             A +KE AMERLK EI++ ELF+ LK+ +G +YQ FML KL+PVVGNV E++LG++   A+
Sbjct  158   AKDKEAAMERLKCEIVNMELFRCLKEIHGSNYQAFMLRKLIPVVGNVREANLGLEAGVAD  217

Query  766   MIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQ  945
              I++EVD+I+NSAANTTFDERYDVALDINT GP R+M FA +  +LKLFLHVSTAYVNGQ
Sbjct  218   EISEEVDVIINSAANTTFDERYDVALDINTIGPCRIMNFAKRFRRLKLFLHVSTAYVNGQ  277

Query  946   RQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKE  1125
             RQG+I+EKPF IG++IA E+        + P L++E E+++   +K+   D +M Q+MK+
Sbjct  278   RQGRILEKPFFIGDTIARETCSLEFSAKNTPLLDIETEIKLAFDSKKTSRDSSMIQEMKD  337

Query  1126  LGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRM  1305
             LGLERA   GWQDTYVFTKAMGEM+I+ MRG+IPVV +RPSVIEST KEPFPGWMEGNRM
Sbjct  338   LGLERAKIHGWQDTYVFTKAMGEMVINCMRGDIPVVTIRPSVIESTCKEPFPGWMEGNRM  397

Query  1306  MDPIILHYGKGQLTGFLVDPNGVLDV  1383
             MDPI+L+YGKGQLTGFL DPNGVLDV
Sbjct  398   MDPIVLYYGKGQLTGFLADPNGVLDV  423



>sp|B9TSP7.1|FACR6_ARATH RecName: Full=Fatty acyl-CoA reductase 6, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ABZ10953.1| fatty acyl CoA reductase long isoform [Arabidopsis thaliana]
Length=548

 Score =   459 bits (1181),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 231/496 (47%), Positives = 331/496 (67%), Gaps = 24/496 (5%)
 Frame = +1

Query  439   KHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERL  618
             ++ DGIGIVRFL GKS+L+TG TGFL KVLIEK+LR   ++ KI++L+++ ++E A +RL
Sbjct  70    RNSDGIGIVRFLEGKSYLVTGATGFLAKVLIEKLLRESLEIGKIFLLMRSKDQESANKRL  129

Query  619   KKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVN  798
               EIIS++LFK LKQ +G SY+ FM  KL+PV+G++ E +LGI    A MI++E+D+I++
Sbjct  130   YDEIISSDLFKLLKQMHGSSYEAFMKRKLIPVIGDIEEDNLGIKSEIANMISEEIDVIIS  189

Query  799   SAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFC  978
                 TTFD+RYD AL +N  GP RL+ F   C KLKLFLH STAYV G+R+G ++E P C
Sbjct  190   CGGRTTFDDRYDSALSVNALGPGRLLSFGKGCRKLKLFLHFSTAYVTGKREGTVLETPLC  249

Query  979   IGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGW  1158
             IGE+I  +             LN++ E+++   A +        +K+KELG ERA  +GW
Sbjct  250   IGENITSD-------------LNIKSELKLASEAVRKFRGREEIKKLKELGFERAQHYGW  296

Query  1159  QDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKG  1338
             +++Y FTKA+GE +I + RGN+PVVI+RPS+IES++ EPFPGW++G RM DPIIL Y KG
Sbjct  297   ENSYTFTKAIGEAVIHSKRGNLPVVIIRPSIIESSYNEPFPGWIQGTRMADPIILAYAKG  356

Query  1339  QLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLA  1515
             Q++ F  DP  ++D++P DMV NA +AAMAKHG  G P   +Y++ SS  VNP+    L 
Sbjct  357   QISDFWADPQSLMDIIPVDMVANAAIAAMAKHG-CGVPEFKVYNLTSSSHVNPMRAGKLI  415

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLST  1695
              L ++H    P  ++    ID+  MK+ SS+E  +S L    I +  +  + +  G LST
Sbjct  416   DLSHQHLCDFPLEET---VIDLEHMKIHSSLEGFTSALSNTIIKQERV--IDNEGGGLST  470

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
             K     ++ +     LA  YEPYTF+  RFDN+N   L++ MS EE+  FGF+++ IDW+
Sbjct  471   K----GKRKLNYFVSLAKTYEPYTFFQARFDNTNTTSLIQEMSMEEKKTFGFDIKGIDWE  526

Query  1876  DYISNVHIPGLRRHVM  1923
              YI NVH+PGL++  +
Sbjct  527   HYIVNVHLPGLKKEFL  542



>ref|XP_011076814.1| PREDICTED: fatty acyl-CoA reductase 2-like [Sesamum indicum]
Length=499

 Score =   457 bits (1175),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 231/492 (47%), Positives = 317/492 (64%), Gaps = 21/492 (4%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI+ F +GK+  ITG T FLGK L+EK+LR+   V KIY+LIKA++K  A +RLK EI
Sbjct  26    GIGILNFFQGKNIFITGATEFLGKALVEKLLRSTA-VGKIYVLIKAEDKAAAFDRLKSEI  84

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I++EL K L++ +G SY+ F+  KL+PV GN+CE +LG+D  TA+ I  EVD+I+ SAAN
Sbjct  85    INSELLKCLREEHGASYEAFIQEKLIPVAGNICEPELGMDVDTADNIMNEVDVIIQSAAN  144

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T+  ERYD   + N  GP RLM+FA +C  L LF+H+STA+VNG+R+G   EKP  +GE+
Sbjct  145   TSMIERYDSLFEANVSGPQRLMRFAKRCKNLILFVHISTAFVNGEREGVNPEKPMTMGEN  204

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQ-KMKELGLERANKFGWQDT  1167
                      N  SS P+L++ +EM +   +    S    A    K+LG +RA  +GW D 
Sbjct  205   ------RRKNISSSFPQLDIANEMSLAFKSITSASTELEATIYSKKLGQQRARFYGWFDA  258

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEM+I+  +G+ PVVIVRP+VIES++KEPFPGW++G R+ DP+I+ YGKG L 
Sbjct  259   YQLTKAMGEMIINECKGDTPVVIVRPAVIESSYKEPFPGWIQGYRVTDPLIISYGKGHLP  318

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FL DP   +D++P DMVVN  +AA AKHG  G PG  +YH AS++VNPL + D+    Y
Sbjct  319   AFLGDPEVKVDIIPVDMVVNTIIAATAKHGIGGMPGLDVYHSASAIVNPLRYYDVFEFSY  378

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLEN  1707
             E+F S P I+S  K  ++  +K F ++E LS +   +   +    AL  +K K       
Sbjct  379   EYFNSNPLIESSSKGSNIKEIKFFDNIEDLSKYTQDEICQRD---ALQQTKWK-------  428

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYIS  1887
                  +  A  L  IYE   FY GRFD SN QKL+  MS+EE+  FG +   IDW+ Y  
Sbjct  429   ---AKILHAIQLCKIYEFSGFYEGRFDISNTQKLLSEMSEEEQRCFGLDARIIDWRKYFC  485

Query  1888  NVHIPGLRRHVM  1923
              +HIPGL++HV+
Sbjct  486   EIHIPGLKKHVL  497



>ref|XP_010427501.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=539

 Score =   457 bits (1177),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/494 (45%), Positives = 328/494 (66%), Gaps = 30/494 (6%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             +G GIVRFL+GKS+L+TGGTGFLGKVLIEK+LR  P++ K+++LI++ ++E A +RL  E
Sbjct  70    EGTGIVRFLKGKSYLVTGGTGFLGKVLIEKLLRASPEIGKVFLLIRSKDQESASKRLCDE  129

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LK+ +G SY+ FM SKL+PV+G++ E +LGI+   A+M+  +VD+I++   
Sbjct  130   IISSDLFKLLKKMHGSSYEAFMKSKLIPVIGDIGEDNLGIEPEIADMVRDDVDVIISCGG  189

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD AL +N  GP RL+ F  +C KL LFLH STAYV G+++G ++E P CIGE
Sbjct  190   RTTFDDRYDSALIVNALGPGRLLSFGKECKKLTLFLHFSTAYVTGKKEGIVLETPLCIGE  249

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+  E+++   A +        +K+KELG ERA  +GW+++
Sbjct  250   NITSD-------------LNIGSELKLASEAVRKFHGSEGIKKLKELGTERAQHYGWENS  296

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKA+GE +I + RG++PVVI+RPS+IES++KEPFPGW++G RM DPI++ Y KGQ++
Sbjct  297   YTFTKAIGETIIHSNRGHLPVVIIRPSIIESSYKEPFPGWIQGIRMADPIVMAYAKGQIS  356

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLARLL  1524
              F  D   +LDV+P DMVVNA +AAMAKHG  G P   +Y++ SS   NPL   +   L 
Sbjct  357   DFWGDSQALLDVIPVDMVVNAAIAAMAKHG-CGVPEFKVYNVTSSSHSNPLRVGEWMDLT  415

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE  1704
             +++    P  ++     D+ RMK  +S+E  +S L         L  +   + K++ +  
Sbjct  416   HQYLCDSPLEET---VTDLVRMKFHTSLEGFTSSL---------LNTITKHERKINNEGG  463

Query  1705  NICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
              +  K   +  Y   LA  YEPYTF+  RFD++N   L++ +S EER  F F++  I+W+
Sbjct  464   GLSMKGYRKLNYFVSLARTYEPYTFFQARFDDTNTTSLIQELSVEERKTFEFDIRGINWE  523

Query  1876  DYISNVHIPGLRRH  1917
              YI+N+H+PGL+RH
Sbjct  524   HYIANIHLPGLKRH  537



>emb|CDX72116.1| BnaC08g27580D [Brassica napus]
Length=544

 Score =   457 bits (1177),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/511 (45%), Positives = 328/511 (64%), Gaps = 20/511 (4%)
 Frame = +1

Query  409   MKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKA  588
             M   V +Y +    G+GI RFL+GKS+LITG TGFL KVLI K++R  P++  I+IL+K 
Sbjct  53    MMSEVETYTKSDSHGVGIFRFLQGKSYLITGATGFLAKVLILKLVRESPEIGNIFILMKT  112

Query  589   DNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEM  768
             +++E A +RL  EIIS++LF+ +KQT+G SY+  M SKL+PVVG++ E +LGI    A  
Sbjct  113   EHQESANKRLYDEIISSDLFRLIKQTHGSSYEALMKSKLIPVVGDIGEDNLGIKSQMAYN  172

Query  769   IAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQR  948
             I+ E+D+I++ A  TTFD RYD AL++N  GP RL+ F   C KLKLFLH+STAYV G +
Sbjct  173   ISDEIDVIISCAGRTTFDYRYDSALNVNALGPGRLLSFGKGCKKLKLFLHISTAYVTGNK  232

Query  949   QGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKEL  1128
             +GKI+E P CIGE+I                LN+E EM++   A +        +K+KEL
Sbjct  233   EGKILETPLCIGENITSH-------------LNIETEMKLASEAVRKFYGREEIKKLKEL  279

Query  1129  GLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMM  1308
             G+ERA  +GW++TY FTKAMGE +I N RG++PVVI+RPS+IES++KEPFPGW++G RM 
Sbjct  280   GMERAQYYGWENTYTFTKAMGESVIQNQRGDLPVVIIRPSIIESSYKEPFPGWLQGIRMS  339

Query  1309  DPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-  1485
              P+IL YGK  +     D     D++P DMV NAT+AAMAKHG  G   T  Y++ SS  
Sbjct  340   APLILAYGKDHIADMWGDYKSSCDIIPVDMVANATIAAMAKHG-CGVSETKAYNVTSSSH  398

Query  1486  VNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTA  1665
              NPL   +     ++H    P I +    +++ R+K ++S+E  +S +      + G  +
Sbjct  399   ANPLRLGESMDFSHQHLCDSPLIKT---VMELERVKFYNSLEDFTSSVSIRIAKQEGEMS  455

Query  1666  LGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQF  1845
              G  +G+  T L    ++ ++    LA  Y+PYTF+  RFD++N + L++ +S EER  F
Sbjct  456   SG--RGESPTMLSMKGKRKLKYLVSLARTYQPYTFFQARFDDTNTRGLIQELSMEERRMF  513

Query  1846  GFEVESIDWKDYISNVHIPGLRRHVMKGRGS  1938
             GF    IDW+ YI NVH+PGL+R + +GR S
Sbjct  514   GFNGRDIDWEHYIVNVHLPGLKRELFRGRFS  544



>emb|CDX72117.1| BnaC08g27570D [Brassica napus]
Length=552

 Score =   453 bits (1166),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 231/514 (45%), Positives = 335/514 (65%), Gaps = 28/514 (5%)
 Frame = +1

Query  403   VGMKELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILI  582
             V + E+  +      DG+GI+ F +GK++L+TG  GFLGKVLIEK+LR  P++ KI++LI
Sbjct  61    VTLFEMPQTETSSVSDGVGILHFSKGKNYLVTGANGFLGKVLIEKLLRASPEIGKIFLLI  120

Query  583   KADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA  762
             K++++E A  RL  EII+++LFK LK+ +G SY+ FM SKL+PV G++ E +L I   TA
Sbjct  121   KSEDQESANRRLYDEIITSDLFKLLKKIHGSSYEAFMKSKLIPVTGDIGEDNLVIKSVTA  180

Query  763   EMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNG  942
               I+ E+D+I++ A  TTFD+RYD AL++N  GP RL++F   C  LKLFLH STAYV G
Sbjct  181   AKISGEIDVIISCAGRTTFDDRYDFALNVNALGPGRLLRFGKGCKNLKLFLHFSTAYVTG  240

Query  943   QRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMK  1122
             +++G ++E P CIGE+I  +             LN+E E+++   A + L      +K+K
Sbjct  241   KKEGTVLETPLCIGENITSD-------------LNIESELKLASEAVRKLHGNEEIKKLK  287

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELG++RA  +GW++TY FTKAMGE +I N RG++PVVI+RPSVIES++KEPFPGW++G R
Sbjct  288   ELGMKRAQHYGWENTYTFTKAMGESVIHNQRGDLPVVIIRPSVIESSYKEPFPGWLQGIR  347

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATL--AAMAKHGAAGKPGTSIYHIA  1476
             M DPIIL YGKGQ++    D   ++D++P DMVVNAT+  AAM KH + G     +Y++ 
Sbjct  348   MSDPIILAYGKGQMSDLWGDYKSLMDIIPVDMVVNATIAGAAMGKH-SRGVSELKVYNVT  406

Query  1477  SSV-VNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDK  1650
             SS   NPL   +L  L  +H    P+ ++    +++ RMK  SS+E  +S ++ R A  +
Sbjct  407   SSSHANPLRLGELMDLSRQHLCDSPFTET---FMELERMKFHSSLEGFTSSIFNRIAKHE  463

Query  1651  SGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE  1830
              G     DS   LS K     ++ +     LA  YEPYTF+  RFD++N ++L++ +S E
Sbjct  464   RG---DADSHTALSMK----GKRRLNYFVSLARTYEPYTFFRARFDDTNTKRLIQELSVE  516

Query  1831  ERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
             E   F F++  IDW  YI NVH+PGL+R   K R
Sbjct  517   EAKMFEFDISGIDWVHYIVNVHLPGLKREHFKER  550



>ref|XP_010039188.1| PREDICTED: fatty acyl-CoA reductase 2-like [Eucalyptus grandis]
Length=456

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 311/479 (65%), Gaps = 41/479 (9%)
 Frame = +1

Query  436   EKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMER  615
              + +DGIGI+ FL  ++FL+TG TGFL KVL EKILR  P+V KI++LIKA +++ AM R
Sbjct  5     RESQDGIGIIDFLERRNFLVTGATGFLAKVLTEKILRVAPNVGKIFLLIKAKDEQAAMNR  64

Query  616   LKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIV  795
              K EII  +LFK L+Q YG+ Y  FML+KLVPV G++ E ++GI D+    I +EVD+I+
Sbjct  65    FKGEIIGCDLFKCLQQKYGEGYTNFMLNKLVPVKGDIREMNMGIGDNLLCQITQEVDVII  124

Query  796   NSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPF  975
             NSAANTT DERYD AL  N   P+RL+ FA +C KL LFLH+ST +VNG+R G ++EK F
Sbjct  125   NSAANTTLDERYDAALVANAIAPSRLLCFAKKCRKLSLFLHLSTTFVNGERPGILMEKAF  184

Query  976   CIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFG  1155
              +GES            S+  KL+V  E+ +V    + L    + QK+KE+GL RA  +G
Sbjct  185   QMGESRI--------DSSTQSKLDVHHEINLVSDLIETLPPNEVPQKLKEVGLARARMYG  236

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             WQ+ Y  TKAMGEMMI+  RG +PVVIVRPSVIEST +EPFPGW++G  ++DP+IL YGK
Sbjct  237   WQNVYQMTKAMGEMMINAGRGRVPVVIVRPSVIESTFREPFPGWIQGYGVLDPLILSYGK  296

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             G+L GFLV+P+ V+DVVPAD+V N  +AAMAKHG A  PG ++YH  SS VNP++  D+ 
Sbjct  297   GRLPGFLVNPDTVMDVVPADLVANVIIAAMAKHGTAASPGINVYHAVSSTVNPMMMCDMF  356

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT-ALG-DSKGKL  1689
                 ++F                                +D  +K+GL+  +G +S  K 
Sbjct  357   NYSRDYFA-------------------------------KDIAEKNGLSNEIGPNSNPKQ  385

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESI  1866
              ++LE  C++  E   +LA +YEPY FY  RFD+ N ++LM+ MS EE  +F  ++ SI
Sbjct  386   RSRLEARCKRMAENLIHLAKLYEPYMFYRARFDSWNTRQLMKQMSTEEGNKFPMDLRSI  444



>ref|XP_009139083.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X3 [Brassica rapa]
Length=539

 Score =   443 bits (1140),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 220/499 (44%), Positives = 316/499 (63%), Gaps = 25/499 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIVRFLRGKS+ +T        VLIEK+LR  P++ KI+IL+K+ + E A +RL  E
Sbjct  64    DGIGIVRFLRGKSYFVT--------VLIEKLLRASPEIGKIFILLKSKDGESANKRLYDE  115

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LKQ +G SY+ FM +KL+PV+G++ E +LGID  TA+ I+ E+D+I+NSA 
Sbjct  116   IISSDLFKLLKQMHGSSYEAFMKNKLIPVIGDIGEENLGIDSETADKISDEIDVIINSAG  175

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD AL +N  GP+RL+ FA +C KLKLFLHVSTA+V G+R+G ++E P CIG+
Sbjct  176   RTTFDDRYDAALSVNALGPDRLLSFAKECKKLKLFLHVSTAFVTGKREGTVLETPLCIGK  235

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  E             L +E+E+++   A +       ++K+KELG ERA  +GW+  
Sbjct  236   NITSE-------------LKIENEVKLASEAARKFHGSEKSKKLKELGYERAQSYGWEKA  282

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEG-NRMMDPIILHYGKGQL  1344
             Y FTKAMGE +I + RG++PVVI+RPS IES++KEPFPGW++G +RM  P+IL  GK Q+
Sbjct  283   YTFTKAMGESIIYSKRGDMPVVIIRPSCIESSYKEPFPGWLQGISRMTAPLILGNGKDQI  342

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDDLARL  1521
                L D     DV+P DMV NA ++ MAKH     P   +Y+I S S  +PL   ++   
Sbjct  343   PDLLGDYQSSCDVIPVDMVANAIISVMAKHSCGNVPEVKVYNITSTSHAHPLRMGEIMDF  402

Query  1522  LYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKL  1701
              Y+H    P  ++  K ++  RMK  SS+E  +S + +    +      G+ + +  T L
Sbjct  403   SYQHLCDSPLTETTTKVLE--RMKFHSSLEEFTSSVSKAIRKQERAMKNGEEEAESHTTL  460

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
                 +K ++    LA  Y+PY F+  RFD +N + L   +S EER  F F+   IDW+ Y
Sbjct  461   SMKGKKKLKYFVSLAKTYQPYMFFQARFDETNTRSLRHELSMEERQMFDFDGSCIDWEHY  520

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
               N+H+PGL+R + + R S
Sbjct  521   FINIHLPGLKRELFRQRSS  539



>ref|XP_010427505.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like [Camelina 
sativa]
Length=520

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/462 (46%), Positives = 308/462 (67%), Gaps = 21/462 (5%)
 Frame = +1

Query  433   VEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAME  612
              + + DGIGIVRFL+GKS+L+TG TGFL KVLIEK+LR  P++ KI++L+++ ++E A +
Sbjct  69    TDPNSDGIGIVRFLKGKSYLVTGATGFLAKVLIEKMLRESPEIGKIFLLMRSKDQESANK  128

Query  613   RLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDII  792
             RL  EIIS++LFK LKQ +G SY+ FM SKL+PV+G++ E +LGI+   A+MI+ E+D+I
Sbjct  129   RLYDEIISSDLFKLLKQMHGSSYEAFMKSKLIPVIGDIGEDNLGIEPDIADMISGEIDVI  188

Query  793   VNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKP  972
             ++    TTFD+RYD AL +N  GPNRL+ F  +C KLKLFLH STAYV G+ +G ++E P
Sbjct  189   ISCGGRTTFDDRYDSALSVNALGPNRLLSFGKECKKLKLFLHFSTAYVTGKNEGLVLETP  248

Query  973   FCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKF  1152
              CIGE+I  +  ++         LN+E E+++   A +       + K+KE G ERA  +
Sbjct  249   LCIGENITSDLNID---------LNIESELKLASEAVRKFHGSEESNKLKEFGFERAQHY  299

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GW ++Y FTKAMGE +I++ RG++PVVI+RPS IES++KEPFPGW++G RM+DPII+ YG
Sbjct  300   GWDNSYTFTKAMGETIINSNRGDLPVVIIRPSTIESSYKEPFPGWIQGIRMVDPIIVGYG  359

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDD  1509
             KGQ++GFL D   +LD+ P DMVVNA + AMAKHG +G P   +Y + S S  NPL   +
Sbjct  360   KGQISGFLADSKSLLDITPVDMVVNAAITAMAKHG-SGVPELKVYTVTSTSHANPLRSGE  418

Query  1510  LARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKL  1689
             L  L Y+H +  P  D   K ID+  MK  SS+E+ +S L      K G       +  +
Sbjct  419   LMDLSYQHLRDSPLED---KEIDLAPMKYHSSLESFTSSLSNKMKRKEG-------ESHI  468

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLME  1815
              + + +  ++ +     +A  Y+PY F+  RFDN N+   ++
Sbjct  469   VSTMSDKGKRRLNYLVSMARTYKPYMFFQARFDNINSDSTIQ  510



>ref|XP_002878102.1| hypothetical protein ARALYDRAFT_324181 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54361.1| hypothetical protein ARALYDRAFT_324181 [Arabidopsis lyrata subsp. 
lyrata]
Length=524

 Score =   439 bits (1129),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/512 (42%), Positives = 321/512 (63%), Gaps = 52/512 (10%)
 Frame = +1

Query  415   ELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADN  594
             E+  +   ++ DG+GI+RFL+ KS+L+TG TGFL K LIEK+LR  P++ KI++L+++ +
Sbjct  61    EMHEADTRRNCDGVGILRFLKAKSYLVTGATGFLAKALIEKLLRASPEIGKIFLLMRSKD  120

Query  595   KEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIA  774
             +E A +R   EIIS++LFK LKQT+G SY+ FM SKL+P +G++ E +LGI+   AEMI+
Sbjct  121   QESANKRPYDEIISSDLFKLLKQTHGSSYEAFMKSKLIPGIGDIGEDNLGIESEIAEMIS  180

Query  775   KEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQG  954
             +E D+I+N    TTFD+RYD A+++N  GP                     AYV G+++G
Sbjct  181   EETDVIINCCGRTTFDDRYDSAINVNALGP---------------------AYVTGKKEG  219

Query  955   KIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGL  1134
              ++E P CIGE+I  +             LN++ E+++   A +        +K+KELG 
Sbjct  220   IVLETPLCIGENITSD-------------LNIDSELKLASEAVRKFRGSEETKKLKELGF  266

Query  1135  ERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDP  1314
             ERA  +GW++TY FTKAMGE +I + RG++PVVI+RPS+IES++ EP PGW++G RM+DP
Sbjct  267   ERAQHYGWENTYTFTKAMGESIIHSKRGDLPVVIIRPSIIESSYNEPSPGWIQGIRMVDP  326

Query  1315  IILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VN  1491
             II+ YGKG ++GF  D   ++D+ P DMV NA +A MAKHG+ G     +Y++ SS   N
Sbjct  327   IIIAYGKGLISGFCADSTSLMDITPVDMVANAAIAVMAKHGSGGVQELKVYNVTSSSHSN  386

Query  1492  PLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALG  1671
             PL F +L  L Y+H ++ P  ++    ID+  MK  SS+E  SS ++ D           
Sbjct  387   PLRFGELMDLSYQHLRNSPLGET---VIDLAPMKFHSSLECFSSSVYNDI----------  433

Query  1672  DSKGKLSTKLENICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ  1842
               K +  + +  + +K   +  Y   LA IY+PY F+  RFD++N   L++ MS EER  
Sbjct  434   -RKQERDSHISTLSKKGNRRLDYFVSLARIYKPYMFFQARFDDTNTTTLIQEMSMEERKM  492

Query  1843  FGFEVESIDWKDYISNVHIPGLRRHVMKGRGS  1938
             F F+   IDW+ YI NVHIPGL+R + +GR S
Sbjct  493   FEFDARGIDWEHYIVNVHIPGLKRQLFQGRSS  524



>ref|XP_004172368.1| PREDICTED: fatty acyl-CoA reductase 2-like [Cucumis sativus]
Length=299

 Score =   429 bits (1103),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/324 (64%), Positives = 243/324 (75%), Gaps = 29/324 (9%)
 Frame = +1

Query  961   IEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLER  1140
             +EKPFC                    +L+VE EM++            M Q MKELGLER
Sbjct  1     MEKPFC-------------------KELDVESEMKLAFEGN------GMGQNMKELGLER  35

Query  1141  ANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPII  1320
             A ++GWQDTYVFTKAMGEM+ID MRG +PV I+RPSVIEST K+PFPGWMEGNRMMDPI+
Sbjct  36    AKRYGWQDTYVFTKAMGEMVIDEMRGEVPVAIIRPSVIESTFKDPFPGWMEGNRMMDPIV  95

Query  1321  LHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLV  1500
             L+YGKGQLTGFLVDPNGV+DVVPADMVVNATLAAMA+HG A +P  +IYH+ASSV NPLV
Sbjct  96    LYYGKGQLTGFLVDPNGVIDVVPADMVVNATLAAMARHGRAPRPSMNIYHVASSVANPLV  155

Query  1501  FDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSK  1680
             F+ LA LL++H+ S P +D  G PI V  MKLF S++  S HLWRDA  +   T      
Sbjct  156   FNRLADLLHQHYNSSPCLDVDGTPIRVSSMKLFDSVDDFSEHLWRDAARRCASTP----D  211

Query  1681  GKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVE  1860
             GKLS KLE IC+K+VEQ KYLA IY+PYTF+ GRFDNSN Q LME MS+EE+ +FGF+VE
Sbjct  212   GKLSKKLEAICKKTVEQLKYLAHIYQPYTFFNGRFDNSNVQGLMEIMSEEEKREFGFDVE  271

Query  1861  SIDWKDYISNVHIPGLRRHVMKGR  1932
             +IDW DYI+NVHIPGLRRHVMKG+
Sbjct  272   NIDWTDYITNVHIPGLRRHVMKGK  295



>emb|CDX67663.1| BnaA07g17030D [Brassica napus]
Length=570

 Score =   437 bits (1125),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/492 (46%), Positives = 320/492 (65%), Gaps = 27/492 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+RFL+GK++LITG TGFL  VLIEK+LR  PD+ KI+ILIK+ ++E A +RL  E
Sbjct  70    DGVGIIRFLKGKTYLITGATGFL--VLIEKLLRASPDIGKIFILIKSKDQESANKRLYDE  127

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LF  LKQT+G+SY+ FM SKL+P++G + E +LGI    +  I+ E+D++++ A 
Sbjct  128   IISSDLFNHLKQTHGRSYEEFMKSKLIPIIGEIGEDNLGIGSEISAKISGEIDVVISCAG  187

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL++N  GP RL+ FA  C KLKLFLH+STAYV G+++G ++E P CIGE
Sbjct  188   RTTFDDRYDLALNVNALGPGRLLSFAKDCKKLKLFLHISTAYVTGKKEGTVLETPLCIGE  247

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERAN-KFGWQD  1164
             +I  +             LN+E E+++   A + L      + +KELG++  +  FG   
Sbjct  248   NITSD-------------LNIEHELKLASEAVRKLHGSGEIKNLKELGIQSVSCNFG--Q  292

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             + +  +  G  +I  MR ++PV I+RPS+IES++KEPFPGW++G RM DPIIL YGKGQ+
Sbjct  293   SLLVKQFHGNPLIQTMREDVPVAIIRPSIIESSYKEPFPGWLQGIRMSDPIILAYGKGQI  352

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
             +G   D     D++P DMVVNAT+AAMAKHG  G     +Y++ SS  NPL   +L  L 
Sbjct  353   SGLWGDSQSFADIIPVDMVVNATIAAMAKHG-CGFSEFKVYNVTSSHANPLRVAELMDLC  411

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS--GLTALGDSKGKLSTK  1698
             Y+H    P        ID+ RMK  SS+E+ +S ++ D I K   G    G    +  T 
Sbjct  412   YQHLYDFPL-----TVIDLARMKFHSSLESFTSSVF-DIIAKQERGTKNEGGEAEESHTT  465

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
             L    R  +     LA  YEPYTF+  RFD++N + L++ MS EER  F F+++SIDW+ 
Sbjct  466   LSFKGRGILNYFVSLARTYEPYTFFKARFDDTNTRSLIQEMSMEERKIFEFDIKSIDWEH  525

Query  1879  YISNVHIPGLRR  1914
             YI NVH+PG+ R
Sbjct  526   YIVNVHLPGIIR  537



>gb|KCW45311.1| hypothetical protein EUGRSUZ_L01016 [Eucalyptus grandis]
Length=474

 Score =   432 bits (1112),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 232/499 (46%), Positives = 313/499 (63%), Gaps = 36/499 (7%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+ FL  ++FLITG TGFL K    K+L+    +  + +L    N + ++     +
Sbjct  9     DGVGIIDFLERRNFLITGATGFLAKGNKNKLLK----MRHVNVLFS--NTKRSLSVFIFQ  62

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II  +LF  L+Q YG+ Y  FMLSKLVPV G++ ES++GI + +   I +EVD+IVNSAA
Sbjct  63    IIGCKLFICLQQKYGEEYTSFMLSKLVPVKGDIQESNMGIGNDSFRQITQEVDVIVNSAA  122

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD AL  NT  P+ L+ FA  C KL LFLH+ST YVNG+R G ++EK F +GE
Sbjct  123   NTTFDERYDAALAANTIAPSWLLSFAKNCKKLSLFLHLSTTYVNGERPGILMEKAFEMGE  182

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             S      VN  Q        VE                 + QK+KE+GL RA  +GWQ+ 
Sbjct  183   SRI--DFVNSKQ--------VE-----------------LPQKLKEIGLARARMYGWQNV  215

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y  TKAMGEMMI+  RG +PVVIVRPSV+EST +EPFPGW++G RM+DP+IL YGKG+L 
Sbjct  216   YEMTKAMGEMMINADRGRVPVVIVRPSVVESTFREPFPGWIQGYRMLDPLILSYGKGRLP  275

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
             GFLVDP+ V+DV+PAD+V N  +AAMAKHG    P   +YH ASS VNP++  D+     
Sbjct  276   GFLVDPDTVIDVIPADLVANVIIAAMAKHGTTASPSIDVYHAASSTVNPIMMCDVFNYSR  335

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGD--SKGKLSTKL  1701
             ++F + P  D +G  I +  M+ FSS+++ SS++ +D  +KSGL+   D  S  K  ++L
Sbjct  336   DYFAASPLTDDQGDEIQITDMEYFSSIDSFSSYIQKDIAEKSGLSKEIDPNSNPKQRSRL  395

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
             E  C++  E   +LA +YEPY FY  RFD+ N +KLME M  EE   F  E E     + 
Sbjct  396   EARCKRMAESIIHLAKLYEPYAFYRARFDSWNTRKLMEQMLTEEAMNFPIEFEKHKIGEE  455

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
             + +  I  L+RHV+K   S
Sbjct  456   LLH-RIAHLKRHVIKKASS  473



>gb|EYU36638.1| hypothetical protein MIMGU_mgv1a004191mg [Erythranthe guttata]
Length=540

 Score =   434 bits (1115),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/492 (45%), Positives = 326/492 (66%), Gaps = 23/492 (5%)
 Frame = +1

Query  466   RFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAEL  645
             +F +GK+  ITG TGFLGK L+EK+LR+   V KIY+L+KAD+KE A++RL KEII ++L
Sbjct  65    KFFQGKNIFITGATGFLGKALVEKLLRST-SVGKIYVLMKADDKENALDRLSKEIIQSDL  123

Query  646   FKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDE  825
             F+ +++ +GKSY+ F+  KL+P+VGN CE +LG+D ++   I  EVD+I+ SAA+T F++
Sbjct  124   FESIREKHGKSYEEFVREKLIPIVGNNCEPNLGMDTYSMHAIMDEVDVIIQSAASTAFND  183

Query  826   RYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGES  1005
             RYD  +D N   P RLM+ A +C  LKL +H+STAYVNG+R+G I E P  +GE      
Sbjct  184   RYDYLIDTNVNAPQRLMRLAKRCKNLKLVVHISTAYVNGKREGLIYENPLVMGE------  237

Query  1006  VVNGNQESSVPKLNVEDEMEM-VLSAKQGLSDGAMAQK-MKELGLERANKFGWQDTYVFT  1179
               NG ++  +  +++ +E+ + V S     +D   + K +K LG+ERA   GW +TY  T
Sbjct  238   --NGRKQDHI--VDIANEINLSVKSCIAATADSNNSSKALKTLGVERAEFLGWNNTYTLT  293

Query  1180  KAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLV  1359
             KAMGEM+++ +R ++P++I+RP++IEST+KEP+PGW++GNRM DP+I+ YGKG L  +L 
Sbjct  294   KAMGEMILNEIREDVPLLIIRPTIIESTYKEPYPGWIQGNRMCDPVIIAYGKGLLPAYLA  353

Query  1360  DPNGVLDVVPADMVVNATLAAMAKHG-AAGKPG--TSIYHIASSVVNPLVFDDLARLLYE  1530
             DPN  LDVVPADMVVN T+AA+AKHG    KP    ++YH+A+   NPL   +L   +YE
Sbjct  354   DPNVHLDVVPADMVVNTTIAAIAKHGIVINKPRGELNVYHVAADYANPLRMSELFEYVYE  413

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGL-TALGDSKGKLSTKLEN  1707
             HF + P   S      + +MK F+  +  S ++ RD +D      A+G S+  L  K+E 
Sbjct  414   HFSANPLTCS----TIIKKMKFFNEFDEFSKYV-RDEMDVVVRNNAVGFSEKTLQ-KIEK  467

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYIS  1887
               +  V  A+ L  IY+   F+  RF + N +KL+E MS+EER  F  +V  I+W+ Y  
Sbjct  468   QYKAKVAYAEELCKIYKFIGFFRARFHSGNTRKLLEEMSEEERDYFEIDVTKIEWRKYFV  527

Query  1888  NVHIPGLRRHVM  1923
              +HIPG+R+H++
Sbjct  528   EIHIPGVRKHLL  539



>ref|XP_010427502.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=525

 Score =   432 bits (1110),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/494 (43%), Positives = 319/494 (65%), Gaps = 44/494 (9%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             +G GIVRFL+GKS+L+TGGTGFLGKVLIEK+LR  P++ K+++LI++ ++E A +RL  E
Sbjct  70    EGTGIVRFLKGKSYLVTGGTGFLGKVLIEKLLRASPEIGKVFLLIRSKDQESASKRLCDE  129

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LK+ +G SY+ FM SKL+PV+G++ E +LGI+   A+M+  +VD+I++   
Sbjct  130   IISSDLFKLLKKMHGSSYEAFMKSKLIPVIGDIGEDNLGIEPEIADMVRDDVDVIISCGG  189

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD              +RL+ F  +C KL LFLH STAYV G+++G ++E P CIGE
Sbjct  190   RTTFD--------------DRLLSFGKECKKLTLFLHFSTAYVTGKKEGIVLETPLCIGE  235

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+  E+++   A +        +K+KELG ERA  +GW+++
Sbjct  236   NITSD-------------LNIGSELKLASEAVRKFHGSEGIKKLKELGTERAQHYGWENS  282

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKA+GE +I + RG++PVVI+RPS+IES++KEPFPGW++G RM DPI++ Y KGQ++
Sbjct  283   YTFTKAIGETIIHSNRGHLPVVIIRPSIIESSYKEPFPGWIQGIRMADPIVMAYAKGQIS  342

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLARLL  1524
              F  D   +LDV+P DMVVNA +AAMAKHG  G P   +Y++ SS   NPL   +   L 
Sbjct  343   DFWGDSQALLDVIPVDMVVNAAIAAMAKHG-CGVPEFKVYNVTSSSHSNPLRVGEWMDLT  401

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE  1704
             +++    P  ++     D+ RMK  +S+E  +S L         L  +   + K++ +  
Sbjct  402   HQYLCDSPLEET---VTDLVRMKFHTSLEGFTSSL---------LNTITKHERKINNEGG  449

Query  1705  NICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
              +  K   +  Y   LA  YEPYTF+  RFD++N   L++ +S EER  F F++  I+W+
Sbjct  450   GLSMKGYRKLNYFVSLARTYEPYTFFQARFDDTNTTSLIQELSVEERKTFEFDIRGINWE  509

Query  1876  DYISNVHIPGLRRH  1917
              YI+N+H+PGL+RH
Sbjct  510   HYIANIHLPGLKRH  523



>ref|XP_011041379.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X2 [Populus 
euphratica]
Length=420

 Score =   425 bits (1093),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/418 (49%), Positives = 290/418 (69%), Gaps = 11/418 (3%)
 Frame = +1

Query  691   MLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNR  870
             M+SKLVPV G+VC ++LGID  T   IAKE+D+I+NSAA TT+D RYDVA++INT GP R
Sbjct  1     MMSKLVPVCGDVCSANLGIDADTTSEIAKEIDVIINSAAKTTWDTRYDVAININTKGPAR  60

Query  871   LMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA-GESVVNGNQESSVPKLN  1047
             +++F  +C KL LFLHVS+AYVNG RQG   EKPFC+ +  A  +++ +  QE SVP L+
Sbjct  61    VLEFGKKCKKLGLFLHVSSAYVNGTRQGVFFEKPFCLEQRTAMRDTITSKAQEISVPFLD  120

Query  1048  VEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIP  1227
             ++ E+++   A + +   A  + M+ELG+ERA   GW  TY  TKAMGEM+ID+MR +IP
Sbjct  121   IDAEIKLASVAVESIDRNA-DRIMRELGMERARIHGWCSTYEMTKAMGEMLIDSMRSSIP  179

Query  1228  VVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVN  1407
              VI+RPS+IEST++EPFPGW++G ++  PI+  YG+ QL GF+ DP+ + D VP DMVVN
Sbjct  180   TVIIRPSLIESTYREPFPGWIQGYKV--PILAAYGQCQLPGFVGDPDTIADTVPMDMVVN  237

Query  1408  ATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPR  1587
             ATL A+AKHG  GKP   +YH+A+SV NP  F D     Y++F S P +DSKGK I +  
Sbjct  238   ATLTALAKHGIDGKPELHVYHVATSVANPHSFKDAFNYAYDYFSSSPLLDSKGKKIAIRP  297

Query  1588  MKLFSSMEALSSHLWRDAIDKSGLTA-----LGDSKGKLSTKLENICRKSVEQAKYLASI  1752
             MK   SM++ +  +  +   +SGL+      + D K  L   L   C  +V +   +A++
Sbjct  298   MKFLVSMDSFTDFIKNEVAQRSGLSPDDNVYMSDPKRYLRMHLA--CFDTVHRFMRIANL  355

Query  1753  YEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMK  1926
             Y+PY FY GRFD  N ++L+E MS EER +F F++ESI+W+ YI +VHIPG+R+H+++
Sbjct  356   YKPYMFYKGRFDVRNTKRLIEDMSSEERKKFNFDIESINWEHYIKSVHIPGVRKHLLR  413



>gb|EMT07818.1| Fatty acyl-CoA reductase 2 [Aegilops tauschii]
Length=510

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 220/439 (50%), Positives = 293/439 (67%), Gaps = 28/439 (6%)
 Frame = +1

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  ELFK L+Q +GK Y  F+  KLV VVGNV E+++GI    A+ IAK+VDII+NSAA
Sbjct  2     IVGTELFKCLEQVHGKDYHHFLARKLVAVVGNVREANMGITPELADDIAKKVDIIINSAA  61

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
             NTTFDERYD+A+D+NT GP RLM FA +  KLKLFLHVSTAYVNG+RQG ++EKPF +G+
Sbjct  62    NTTFDERYDIAMDVNTMGPFRLMSFARRFSKLKLFLHVSTAYVNGRRQGVVLEKPFSLGD  121

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGA-MAQKMKELGLERANKFGWQD  1164
             +I  E   + +       L++E E+++   ++   +D A  +Q+MK+LG+ERA   GWQD
Sbjct  122   TITKELGYSDSSGLRNTVLDIEAEIKLAFCSRHNSNDAASFSQEMKDLGIERARLHGWQD  181

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEM++D+MRG IPVV +RPS+IE T  EP P                  G+L
Sbjct  182   TYVFTKAMGEMVLDSMRGEIPVVTIRPSIIEGTWSEPIP------------------GRL  223

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAA--GKPGTSIYHIASSVVNPLVFDDLAR  1518
             +GF  D +GV+DVVPADMVVNATLAA+AKH  A    P   IYH+ SS   PL++ D+  
Sbjct  224   SGFPADGDGVVDVVPADMVVNATLAAVAKHAQALGAAPEMHIYHVGSSTAKPLIWRDMFT  283

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTK  1698
               ++HF   P+  + G+PI V  M+LF S+E   S++ RD +    L   G++   LS +
Sbjct  284   FFFQHFTRYPFNLASGQPIKVAPMRLFGSIEQFDSNVERDVL----LWGTGET---LSPR  336

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKD  1878
                +  K  E+  +LA +Y+PY FYG RFD +N + L   MS EE+ QF F+V SI+WKD
Sbjct  337   ARMLFSKYAEKITHLARMYQPYGFYGCRFDIANTEALFAEMSVEEKAQFHFDVRSIEWKD  396

Query  1879  YISNVHIPGLRRHVMKGRG  1935
             Y +NVHIPG  +HVMKGRG
Sbjct  397   YFTNVHIPGFLKHVMKGRG  415



>ref|XP_009104016.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X2 [Brassica rapa]
Length=517

 Score =   424 bits (1090),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 210/448 (47%), Positives = 300/448 (67%), Gaps = 23/448 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG+GI+RFL+GK++LITG TGFLGKVLIEK+LR  PD+ KI+ILIK+ ++E A +RL  E
Sbjct  70    DGVGIIRFLKGKTYLITGATGFLGKVLIEKLLRASPDIGKIFILIKSKDQESANKRLYDE  129

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             II+++LF  LKQ +G+SY+ FM SKL+P++G++ E +LGI    A  I+ E+D++++ A 
Sbjct  130   IITSDLFNHLKQMHGRSYEEFMKSKLIPIIGDIGEDNLGIGSEIAANISGEIDVVISCAG  189

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RYD+AL++N  GP RL+ FA  C KLKLFLH+STAYV G+++G ++E P CIG+
Sbjct  190   RTTFDDRYDLALNVNAFGPGRLLSFAKDCKKLKLFLHISTAYVTGKKEGTVLETPLCIGK  249

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I  +             LN+E E+++   A + L      +K+KELG++RA  +GW++T
Sbjct  250   NITSD-------------LNIEHELKLASEAVRKLHGSGEIKKLKELGIQRAQHYGWENT  296

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKAMGE +I  MR ++P+VI+RPS+IES++KEPFPGW++G RM DP+IL YGKGQ++
Sbjct  297   YTFTKAMGETLIQTMREDVPIVIIRPSIIESSYKEPFPGWLQGIRMTDPMILAYGKGQIS  356

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLARLL  1524
             GF  D    LD++P DMVVNAT+AAMAKHG  G     +Y++ SS   +PL   +   L 
Sbjct  357   GFWGDSQSFLDIIPVDMVVNATIAAMAKHG-CGNSDLKVYNVTSSSHAHPLRAGEYMDLC  415

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS--GLTALGDSKGKLSTK  1698
             Y+H    P        ID+ R K  SS++  +S ++ D I K   G    G    +  T 
Sbjct  416   YQHLCDFPL-----TVIDLTRWKFHSSLDGFTSSVF-DIIAKQERGTKNEGGEAEESHTT  469

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGR  1782
             L    ++ ++    LA  YEPYTF+  R
Sbjct  470   LSFKGKRILDYFVSLARTYEPYTFFQAR  497



>ref|XP_009139084.1| PREDICTED: fatty acyl-CoA reductase 6, chloroplastic-like isoform 
X4 [Brassica rapa]
Length=496

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/475 (43%), Positives = 301/475 (63%), Gaps = 17/475 (4%)
 Frame = +1

Query  520   KVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLS  699
             ++LIEK+LR  P++ KI+IL+K+ + E A +RL  EIIS++LFK LKQ +G SY+ FM +
Sbjct  37    RLLIEKLLRASPEIGKIFILLKSKDGESANKRLYDEIISSDLFKLLKQMHGSSYEAFMKN  96

Query  700   KLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMK  879
             KL+PV+G++ E +LGID  TA+ I+ E+D+I+NSA  TTFD+RYD AL +N  GP+RL+ 
Sbjct  97    KLIPVIGDIGEENLGIDSETADKISDEIDVIINSAGRTTFDDRYDAALSVNALGPDRLLS  156

Query  880   FAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDE  1059
             FA +C KLKLFLHVSTA+V G+R+G ++E P CIG++I  E             L +E+E
Sbjct  157   FAKECKKLKLFLHVSTAFVTGKREGTVLETPLCIGKNITSE-------------LKIENE  203

Query  1060  MEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIV  1239
             +++   A +       ++K+KELG ERA  +GW+  Y FTKAMGE +I + RG++PVVI+
Sbjct  204   VKLASEAARKFHGSEKSKKLKELGYERAQSYGWEKAYTFTKAMGESIIYSKRGDMPVVII  263

Query  1240  RPSVIESTHKEPFPGWMEG-NRMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATL  1416
             RPS IES++KEPFPGW++G +RM  P+IL  GK Q+   L D     DV+P DMV NA +
Sbjct  264   RPSCIESSYKEPFPGWLQGISRMTAPLILGNGKDQIPDLLGDYQSSCDVIPVDMVANAII  323

Query  1417  AAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMK  1593
             + MAKH     P   +Y+I S S  +PL   ++    Y+H    P  ++  K ++  RMK
Sbjct  324   SVMAKHSCGNVPEVKVYNITSTSHAHPLRMGEIMDFSYQHLCDSPLTETTTKVLE--RMK  381

Query  1594  LFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFY  1773
               SS+E  +S + +    +      G+ + +  T L    +K ++    LA  Y+PY F+
Sbjct  382   FHSSLEEFTSSVSKAIRKQERAMKNGEEEAESHTTLSMKGKKKLKYFVSLAKTYQPYMFF  441

Query  1774  GGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRGS  1938
               RFD +N + L   +S EER  F F+   IDW+ Y  N+H+PGL+R + + R S
Sbjct  442   QARFDETNTRSLRHELSMEERQMFDFDGSCIDWEHYFINIHLPGLKRELFRQRSS  496



>ref|NP_191229.1| fatty acyl-CoA reductase 6 [Arabidopsis thaliana]
 emb|CAC00733.1| putative protein [Arabidopsis thaliana]
 gb|AAY78776.1| putative male sterility protein [Arabidopsis thaliana]
 gb|ABZ10954.1| fatty acyl CoA reductase short isoform [Arabidopsis thaliana]
 gb|AEE79553.1| fatty acyl-CoA reductase 6 [Arabidopsis thaliana]
Length=527

 Score =   420 bits (1079),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 218/496 (44%), Positives = 317/496 (64%), Gaps = 45/496 (9%)
 Frame = +1

Query  439   KHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERL  618
             ++ DGIGIVRFL GKS+L+TG TGFL KVLIEK+LR   ++ KI++L+++ ++E A +RL
Sbjct  70    RNSDGIGIVRFLEGKSYLVTGATGFLAKVLIEKLLRESLEIGKIFLLMRSKDQESANKRL  129

Query  619   KKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVN  798
               EIIS++LFK LKQ +G SY+ FM  KL+PV+G++ E +LGI    A MI++E+D+I++
Sbjct  130   YDEIISSDLFKLLKQMHGSSYEAFMKRKLIPVIGDIEEDNLGIKSEIANMISEEIDVIIS  189

Query  799   SAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFC  978
                 TTFD+RYD AL +N  GP                     AYV G+R+G ++E P C
Sbjct  190   CGGRTTFDDRYDSALSVNALGP---------------------AYVTGKREGTVLETPLC  228

Query  979   IGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGW  1158
             IGE+I  +             LN++ E+++   A +        +K+KELG ERA  +GW
Sbjct  229   IGENITSD-------------LNIKSELKLASEAVRKFRGREEIKKLKELGFERAQHYGW  275

Query  1159  QDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKG  1338
             +++Y FTKA+GE +I + RGN+PVVI+RPS+IES++ EPFPGW++G RM DPIIL Y KG
Sbjct  276   ENSYTFTKAIGEAVIHSKRGNLPVVIIRPSIIESSYNEPFPGWIQGTRMADPIILAYAKG  335

Query  1339  QLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSV-VNPLVFDDLA  1515
             Q++ F  DP  ++D++P DMV NA +AAMAKHG  G P   +Y++ SS  VNP+    L 
Sbjct  336   QISDFWADPQSLMDIIPVDMVANAAIAAMAKHG-CGVPEFKVYNLTSSSHVNPMRAGKLI  394

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLST  1695
              L ++H    P  ++    ID+  MK+ SS+E  +S L    I +  +  + +  G LST
Sbjct  395   DLSHQHLCDFPLEET---VIDLEHMKIHSSLEGFTSALSNTIIKQERV--IDNEGGGLST  449

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWK  1875
             K     ++ +     LA  YEPYTF+  RFDN+N   L++ MS EE+  FGF+++ IDW+
Sbjct  450   K----GKRKLNYFVSLAKTYEPYTFFQARFDNTNTTSLIQEMSMEEKKTFGFDIKGIDWE  505

Query  1876  DYISNVHIPGLRRHVM  1923
              YI NVH+PGL++  +
Sbjct  506   HYIVNVHLPGLKKEFL  521



>gb|ABR18362.1| unknown [Picea sitchensis]
Length=510

 Score =   414 bits (1063),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/514 (43%), Positives = 326/514 (63%), Gaps = 33/514 (6%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL  K+ L+TG TGFLGK+ +EKILRT P V +I++L+++++ E A  R K E++ A
Sbjct  5     ILGFLNEKNILVTGSTGFLGKIFVEKILRTQPGVKRIFVLLRSEDFESAKIRFKNEVMGA  64

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCES-DLGID-DHTAEMIAKEVDIIVNSAANT  813
             ELFK L+  +G +++ F+  K+VPVVG+V    +LGID + T E +   +D IVN+AA+T
Sbjct  65    ELFKTLRGQHGDNFENFVFQKVVPVVGDVAGGHNLGIDKESTREHLWNILDAIVNNAAST  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FD+RYD++L++NT G   +++FA +C KL++ LHVSTAYV G+  G+I E P  IGES+
Sbjct  125   MFDDRYDISLNVNTRGAENIVEFAKRCRKLQILLHVSTAYVVGRGSGRIKESPLKIGESM  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVL-----------------SAKQGLSDGAMAQKMK  1122
                   N  ++ + P L+++ E E  L                 ++ + + D    + +K
Sbjct  185   TAG---NELEDENGPPLSLDIEAEFGLLENTLAKLHMDSSATGTTSTRSVQDKEAIKHLK  241

Query  1123  ELGLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNR  1302
             ELGLERA +FGW +TY FTKAMGEM+++N R N+PVVI+RP++IEST  EPFPGWMEG R
Sbjct  242   ELGLERARRFGWPNTYSFTKAMGEMVVENRRENLPVVILRPTIIESTLAEPFPGWMEGTR  301

Query  1303  MMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASS  1482
              MD  I+ YGKG+++ FL DP   LD +PADMVVN  + AMA H  A +    IYH+ASS
Sbjct  302   TMDTFIVGYGKGRISFFLGDPELFLD-IPADMVVNQMMVAMATH--AYQNDLFIYHVASS  358

Query  1483  VVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLT  1662
             V NPL +  L+ + Y +F   P + + GK I V  M+   SM +   H+++    K+ L 
Sbjct  359   VGNPLRYSLLSDVAYNYFSKNPCVSNDGKIIRVKEMRFLKSMSSFRLHMFQRY--KAPLL  416

Query  1663  ALGDSKGKLS------TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMS  1824
              LG     +S      T   N   ++     YLA +YEPY  + G FD +N ++L+E +S
Sbjct  417   VLGVVNEVISIFTARFTARYNQMLRNYNFMMYLAELYEPYVLFQGSFDITNTERLLEKVS  476

Query  1825  KEERWQFGFEVESIDWKDYISNVHIPGLRRHVMK  1926
              ++   F F+V+ IDW +Y+SNVHIPG+ ++V+K
Sbjct  477   VQDLEAFNFDVKCIDWVEYLSNVHIPGVVKYVLK  510



>gb|KDP46041.1| hypothetical protein JCGZ_13487 [Jatropha curcas]
Length=378

 Score =   404 bits (1037),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 195/364 (54%), Positives = 268/364 (74%), Gaps = 10/364 (3%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             IGI+ FL+G ++L+TG TGFL KVLIEK+LR VPDV +I+++IK ++K+    RLK E+I
Sbjct  8     IGIIYFLKGNNYLVTGATGFLAKVLIEKMLRMVPDVGRIFLMIKGEDKDEVKRRLKNEVI  67

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANT  813
               ELF+ LK+ +GKSY+ FM SKL PV+GN+C+ +LG+D +TA  IA +V +I+N AANT
Sbjct  68    DEELFRCLKEIHGKSYEAFMRSKLFPVLGNICKDNLGMDAYTAREIANQVHVIINIAANT  127

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
             TFDERYDVA + NT GP+RL+ FA+ C  LKLFLHVSTAY+NG+R G ++EKPF +G S 
Sbjct  128   TFDERYDVAPNTNTKGPSRLLDFANTCKNLKLFLHVSTAYINGERDGIVLEKPFHLGRS-  186

Query  994   AGESVVNGNQES---SVPKLNVEDEMEMVLSAKQGLS-DGAMAQKMKELGLERANKFGWQ  1161
               E  +N    S   S+P L+V  EM++     + L  +    QKMK+LG +RA  +G+ 
Sbjct  187   -AEERMNSTTSSSQVSLPLLDVGAEMKLAFEMMKSLEYNNKRDQKMKDLGTQRAKMYGFY  245

Query  1162  DTYVFTKAMGEMMIDNMRGN--IPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             DTY FTKAMGEM+I++ R +  +P+VIVRPS+IEST++EPFPGW++GN+++DP+ + YGK
Sbjct  246   DTYSFTKAMGEMLINSKRESLTVPIVIVRPSIIESTYREPFPGWIQGNKVIDPLFISYGK  305

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS--IYHIASSVVNPLVFDD  1509
             GQL GF+ +PN +LD+VP DMVVN  L A+AKHG++ K   +  IYHI SSV NP+    
Sbjct  306   GQLPGFVGNPNTILDIVPVDMVVNVILTAIAKHGSSVKTQAAELIYHITSSVSNPISLAT  365

Query  1510  LARL  1521
              + L
Sbjct  366   FSTL  369



>ref|XP_002534572.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF27810.1| Male sterility protein, putative [Ricinus communis]
Length=387

 Score =   403 bits (1035),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/348 (59%), Positives = 254/348 (73%), Gaps = 28/348 (8%)
 Frame = +1

Query  283   DQASKAAALMEAGSLLLA-PNGNAQaaaassasasasaaENVGMKE-------LVSSYVE  438
             DQ   ++ +  A SL+++ PNG  Q                + MK+       L SS + 
Sbjct  59    DQGHSSSVMDTARSLVVSSPNGKGQ--------------PEIAMKDFEPYNDGLTSSSLI  104

Query  439   KHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERL  618
                DGIGIV+FLRG+ F ITG TGFL K   ++      DV KIY+LIKA +KE AM RL
Sbjct  105   DMRDGIGIVKFLRGRGFFITGATGFLAKDSTDR-----TDVGKIYVLIKAKSKEAAMARL  159

Query  619   KKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVN  798
             K EII+AELFK L+QTYGKSYQ FMLSKLVPVVGN+CES+LG+++    +IA +VD+IVN
Sbjct  160   KSEIINAELFKSLQQTYGKSYQAFMLSKLVPVVGNICESNLGLEEDLTNLIANDVDVIVN  219

Query  799   SAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFC  978
             SAANTTFDERYDVA+DINT G   LM FA +C  LKLFL VSTAYVNGQRQG+I+EK FC
Sbjct  220   SAANTTFDERYDVAVDINTRGACHLMNFAKKCQNLKLFLQVSTAYVNGQRQGRIMEKTFC  279

Query  979   IGESIAGESVVNGNQESS-VPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFG  1155
             IG+ IA E+ ++ +   S +P L+VE EM++ L++K GL +  +AQ+MK LGLERA ++G
Sbjct  280   IGDCIAKENFISESTSGSLLPILDVEYEMKLALNSKDGLQESEVAQEMKRLGLERARRYG  339

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGN  1299
             WQDTYVFTKAMGEMMID+MRG IPVVI+RPSVIEST +EPFPGWMEGN
Sbjct  340   WQDTYVFTKAMGEMMIDSMRGEIPVVIIRPSVIESTCREPFPGWMEGN  387



>gb|KDO70812.1| hypothetical protein CISIN_1g0426942mg, partial [Citrus sinensis]
Length=243

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = +1

Query  1216  GNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLVDPNGVLDVVPAD  1395
             G+IPVVI+RPSVIEST KEPF GWMEGNRMMDPIIL+YGKGQLTGFLVDPNG+LDVVPAD
Sbjct  1     GDIPVVIIRPSVIESTCKEPFSGWMEGNRMMDPIILYYGKGQLTGFLVDPNGILDVVPAD  60

Query  1396  MVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQSKPYIDSKGKPI  1575
             MVVNATLAA+A+HG   KP  ++Y IASSVVNPLVF DLARLL+EH+ + P +D+KG+PI
Sbjct  61    MVVNATLAAIAQHGMIQKPDINVYQIASSVVNPLVFQDLARLLHEHYSASPCVDTKGRPI  120

Query  1576  DVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENICRKSVEQAKYLASIY  1755
              VP MKLFSSME  S+HLWRDAI +SGLT+  +  GKL  KLE ICRKSVEQAK+LA IY
Sbjct  121   RVPSMKLFSSMEDFSAHLWRDAIQRSGLTSTANLNGKLPQKLETICRKSVEQAKHLADIY  180

Query  1756  EPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYISNVHIPGLRRHVMKGRG  1935
             EPYTFYGGRFDNSN ++LME MS+EE+ +FGF+V SIDWK+YI+NVHIPGLRRHVMKGRG
Sbjct  181   EPYTFYGGRFDNSNTERLMEKMSEEEKRKFGFDVGSIDWKEYITNVHIPGLRRHVMKGRG  240



>ref|XP_009405296.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   404 bits (1039),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/494 (42%), Positives = 316/494 (64%), Gaps = 14/494 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             ++ FL+GKS L+TG TGFL K+ +EK++R  PDV ++++L++A +   A +R++ EI+  
Sbjct  6     LMEFLKGKSILVTGSTGFLAKIFVEKVMRVQPDVKRLFLLVRAADASSAEKRVQSEILGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANTT  816
             ELFK +K  +G  +  F+ SKL PV G++ + +LGI D +  E + +EVDI+VN AA T+
Sbjct  66    ELFKVVKDKHGDGFHSFVSSKLFPVAGDIVQQNLGIRDSNIREKLWEEVDIVVNVAATTS  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             F ERYDVAL IN  G   +++FA QC KL++ LHVSTAY  G+++G I+EK F +GE++ 
Sbjct  126   FGERYDVALGINVLGAKHVLEFAKQCVKLQVLLHVSTAYAAGEQRGLILEKRFRMGEALK  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G+S ++   E     L + DE    L A Q  +  A AQ MKELG+ RA  FGW +TYV+
Sbjct  186   GDSYLDIEGE-----LRLVDERRRQLGA-QNATKEAEAQAMKELGINRARLFGWPNTYVY  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAM EM++  +RGN+P+VI+RP++I S H++P PGW+EG R +D +I+ Y KG++T F 
Sbjct  240   TKAMAEMLLGELRGNLPLVILRPTIITSIHRDPVPGWIEGTRTIDSLIMGYVKGKITCFF  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              DP  V D++P DMVVNA +A MA H  + +P   IYH++SSV NP+ +  L +  + +F
Sbjct  300   GDPETVADMIPGDMVVNAMIATMAAH--SRQPSEFIYHVSSSVRNPVQYSTLQQCGFRYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALG-DSKGKLSTKLENI  1710
                P +   G+ I   ++ +F +M     ++  R  +   GL  +   S G+ + + + +
Sbjct  358   LENPRVGKDGRVIKTKKLPVFRNMFLFRVYMTLRYKLPLEGLHLVNLLSCGRFARRYDEL  417

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYI  1884
              RK  + A +L  +YEPY F+ G FD+ N ++L   M K+  E   F F+ + IDWKDY 
Sbjct  418   NRK-YKFAMHLVDLYEPYAFFKGCFDDLNLERLRMAMGKDDAEAGMFDFDPKHIDWKDYF  476

Query  1885  SNVHIPGLRRHVMK  1926
              N+HIPG+ ++  K
Sbjct  477   YNIHIPGVLKYACK  490



>ref|XP_007015863.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOY33482.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=491

 Score =   404 bits (1039),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/492 (42%), Positives = 317/492 (64%), Gaps = 11/492 (2%)
 Frame = +1

Query  463   VRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAE  642
             ++FL  KS L+TG TGFL K+ +EKILR  P+V K Y+L++A + + A+ RL  EII  +
Sbjct  7     LQFLDSKSILVTGATGFLAKIFVEKILRVQPNVKKFYLLLRAADHKSAIHRLHNEIIGKD  66

Query  643   LFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANTTF  819
             LFK LK+ YGK++  F+  K+  + G++   DLG++D +  + + +EVD++VN AA T F
Sbjct  67    LFKVLKEKYGKNFSSFISEKITLIPGDISHEDLGVEDSNLVQEMCREVDVVVNLAATTNF  126

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
             DERYDVAL +NT G   ++ FA +C KLK+ +HVSTAYV+G+R G I+E  + +GE++ G
Sbjct  127   DERYDVALGLNTLGAKFVLNFAKKCVKLKVLVHVSTAYVSGERSGLILENSYNMGETLNG  186

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFT  1179
              S ++ N E  V    VE++++ + S  QG S+  + + MK+LG+ERA  +GW + YVFT
Sbjct  187   VSGLDINIEKKV----VEEKLDELRS--QGASEKEITRAMKDLGIERARMYGWPNAYVFT  240

Query  1180  KAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLV  1359
             KAMGEM++  M+GN+P VI+RP++I ST+KEPFPGW EG R +D + + Y KG+LT FL 
Sbjct  241   KAMGEMLVGYMKGNMPTVIIRPTIITSTYKEPFPGWAEGVRTIDSLAVGYAKGKLTFFLG  300

Query  1360  DPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQ  1539
             D   ++DV+PADMVVNA + AM  H A+ +P  +IY + SSV NP+ + +L    + +F 
Sbjct  301   DLESIVDVIPADMVVNAMIVAMVAH-ASCQPSETIYQVGSSVRNPMRYYNLQDYGFRYFS  359

Query  1540  SKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENICR  1716
              KP+I+  GKP+ V ++K+ +SM++   ++  R  +   GL     +  +    + +   
Sbjct  360   KKPWINKDGKPVIVGKVKVMNSMDSFHRYMAIRYLLLLKGLELANTAFCQFFQGVHSDLN  419

Query  1717  KSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECM--SKEERWQFGFEVESIDWKDYISN  1890
             + +     L  IY PY F+   FD+ N +KL      S  E+  F F+ + +DW DY  N
Sbjct  420   RKINFVMRLVDIYRPYLFFKAIFDDINTEKLRMAARSSMAEKDMFYFDPKCLDWDDYFMN  479

Query  1891  VHIPGLRRHVMK  1926
             +HIPG+ +++ K
Sbjct  480   IHIPGVVKYICK  491



>emb|CDX76006.1| BnaA04g02700D [Brassica napus]
Length=511

 Score =   405 bits (1040),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/511 (41%), Positives = 304/511 (59%), Gaps = 63/511 (12%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DGIGIVRFLRGKS+ +TG TGFLGKVL+EK+LR  P++ KI+IL+K+ ++E A +RL  E
Sbjct  42    DGIGIVRFLRGKSYFVTGATGFLGKVLVEKLLRESPEIGKIFILMKSKDQESANKRLYDE  101

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LKQ +G SY+ FM SKL+PV G++ E +LG+D  TA+ I++E+D+I+N+A 
Sbjct  102   IISSDLFKLLKQMHGSSYEAFMKSKLIPVTGDIGEENLGMDSETADKISEEIDVIINTAG  161

Query  808   NTTFDE-RYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIG  984
              TTFD+ RYD AL +N  GP+RL+ F  +C KLKLFLHVSTA+V G+ +G ++E P C G
Sbjct  162   RTTFDDSRYDAALSVNALGPDRLLSFGEECKKLKLFLHVSTAFVTGKLEGTVLETPLCFG  221

Query  985   ESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKEL------------  1128
             E+I  +             LN+E E+++   A +       ++K+KEL            
Sbjct  222   ENITSD-------------LNIETEVKLASEAARKFHGSEKSKKLKELEIITLCIYLIWS  268

Query  1129  ---GLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGN  1299
                G  RA  +GW+  Y FTKAMGE ++ + RG++ VVI+RPSVIES++KEPFPGW++G 
Sbjct  269   WNFGKIRAQSYGWEKAYTFTKAMGESLLHSNRGDLSVVIIRPSVIESSYKEPFPGWLQGI  328

Query  1300  RMMDPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGK-PGTSIYHIA  1476
             RM  P+IL  GK Q+     D     DV+P DMV NA +AAMAKHG         +Y++ 
Sbjct  329   RMSAPLILGNGKDQIPDLFGDYQSSCDVIPVDMVANAIIAAMAKHGCGNVLTDVKVYNVT  388

Query  1477  S-SVVNPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKS  1653
             S S  NPL   +L    ++H  +    + + K                            
Sbjct  389   STSHANPLRLGELMDFSHQHLCAIAKQEREMKN---------------------------  421

Query  1654  GLTALGDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE  1833
                  G+ + +  T L    ++ ++    LA  Y+PY F+  RFD++N + L+  +S EE
Sbjct  422   -----GEGEAESHTTLSMKGKRKLKYFVSLAKTYQPYMFFQARFDDTNTRSLLNELSVEE  476

Query  1834  RWQFGFEVESIDWKDYISNVHIPGLRRHVMK  1926
             R  F F+   IDW+ Y  N+H+PGL+  + +
Sbjct  477   RKMFEFDGSCIDWEHYFINIHLPGLKMELFR  507



>emb|CDY28321.1| BnaC03g66380D [Brassica napus]
Length=492

 Score =   402 bits (1034),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 207/494 (42%), Positives = 308/494 (62%), Gaps = 11/494 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             + + ++++L  KS L+ G  GFL  + +EKILR  P+V K+Y+L++A N++ A +R K E
Sbjct  6     EAVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATQRFKDE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  +L+K +K+ YG +       K+  V G++C +DLGI D  A  +  +VD I+N AA
Sbjct  66    ILGKDLYKVVKEKYGPNLTQLTSEKVTVVNGDICLADLGIQDSLAHEMIHQVDAIINLAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T FDERYDVAL  NT GP  ++ FA +C   K+F+HVSTAYV+G++ G I+E P+ +GE
Sbjct  126   TTKFDERYDVALGNNTLGPLNVLDFAKKCENAKIFVHVSTAYVSGEKSGLIMETPYRMGE  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++ G + ++ N E  +    V+++++ +L  K       + Q MK++GL RA  +GW +T
Sbjct  186   TLNGTTGLDINHERKL----VQEKLDQLLVIKA--PPETITQAMKDMGLTRAKMYGWPNT  239

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEMM+   R NI +V++RPS+I ST KEPFPGW EG R +D + + YGKG+LT
Sbjct  240   YVFTKAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGRLT  299

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FL D N + DV+PADMVVN+ L +MA    AGK    IYH+ SS  NPL  + L  + Y
Sbjct  300   CFLGDLNAISDVMPADMVVNSILVSMA--AQAGKQKEIIYHLGSSQKNPLKNEKLPEVAY  357

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLE  1704
             ++F +KP+ +  GKP+ V ++++ SSM +   ++    +I   GL  L     KL  K  
Sbjct  358   QYFTTKPWTNKDGKPVRVRKIEILSSMPSFHRYMAIHYSIPLKGLAVLNMVLCKLLDKSV  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
                 + +  A  L  +Y+PY F+ G FD+SN +KL   + K   E   F F+ + I+W D
Sbjct  418   TDFHRKINLALRLVDLYQPYLFFYGVFDDSNTEKLQRMVLKTGVETEMFYFDPKIINWDD  477

Query  1879  YISNVHIPGLRRHV  1920
             Y  N HIPGL ++V
Sbjct  478   YFVNTHIPGLVKYV  491



>ref|XP_006851509.1| hypothetical protein AMTR_s00040p00158690 [Amborella trichopoda]
 gb|ERN13090.1| hypothetical protein AMTR_s00040p00158690 [Amborella trichopoda]
Length=487

 Score =   402 bits (1033),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 218/494 (44%), Positives = 309/494 (63%), Gaps = 17/494 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+R L+ KS LITG TGFL K+L+EK+LRT P+V K+++LI+A +   A  RL  EI+  
Sbjct  6     IIRSLQHKSILITGSTGFLAKILVEKVLRTQPEVKKLFLLIRASDLNSARYRLHNEILKK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANTT  816
             ELFK L++ +G  +  F+  K+ PVVG+V    LGI D    + + +E DII+N AA T+
Sbjct  66    ELFKVLREKHGSGFDSFVREKIFPVVGDVGHESLGIADLELRKTLWREADIIINVAATTS  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCH-KLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
             FDERYDVAL++NT G   +++FA QC  +L++ LHVSTAYV+G + G I+EKP  +GE++
Sbjct  126   FDERYDVALEVNTLGAKHVLEFAKQCGGRLEVLLHVSTAYVSGNKSGLIMEKPIKLGETL  185

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
                S ++ + E  +    VE E+E   +  +G  +      MK+LGL+RA  +GW +TY 
Sbjct  186   IPYSHLDIDFELKL----VEIELEK--ARNEGADEKTQRLAMKKLGLKRARLYGWPNTYT  239

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEMM+ ++RG++PVVI+RPS+IEST  +PFPGWMEG R +D +I+++GKG+L  F
Sbjct  240   FTKAMGEMMMGHLRGDLPVVIMRPSIIESTFSDPFPGWMEGARTIDSLIVNFGKGKLKCF  299

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             L DPN VLDV+PADMVVNA + AMA H +  +    IYH+ SSV NP  +  LA   + +
Sbjct  300   LADPNLVLDVIPADMVVNAMIVAMATHRS--ESSLHIYHVTSSVRNPCNYHTLADTSHRY  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE---  1704
             F   P  D  G+ I V R+ +F++M     ++      K  L  L      L  K     
Sbjct  358   FSKNPCYDKDGRLIVVKRVVMFTTMAQFRRYM--TLFYKLPLQILKLVNKVLLQKFRLQY  415

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDYI  1884
             N    +     +LA +YEPY  + G FD+ NA KL   +S   R    F+ + IDW DY 
Sbjct  416   NKLNTNYNYVMHLAELYEPYVCFKGWFDDLNAGKLRSMVS--PRSNLAFDTQIIDWDDYF  473

Query  1885  SNVHIPGLRRHVMK  1926
               +HIPGL ++V+K
Sbjct  474   MTIHIPGLVKYVLK  487



>gb|EMT08796.1| Fatty acyl-CoA reductase 1 [Aegilops tauschii]
Length=489

 Score =   402 bits (1033),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 206/497 (41%), Positives = 309/497 (62%), Gaps = 16/497 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   +  F RGK+ LITG TGFLGKVL+EKILR  P+V K+++L++A + E A  R++ E
Sbjct  2     DAAQVAAFFRGKNILITGATGFLGKVLLEKILRIQPEVTKLFLLVRATDDESARRRVQTE  61

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +   E+F+ L++ +GK ++ F+  K+ P+ G+V   D G+D    + ++K+VDIIVN AA
Sbjct  62    VTGREIFQVLREKHGKGFEDFIEEKVYPLAGDVMYEDFGLDTAKLKEVSKDVDIIVNGAA  121

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDV+ D N  G  ++  FA++C KLK+ LHVSTAYV G+++G I+EKPF +G+
Sbjct  122   TTNFYERYDVSFDTNVLGAKQICAFANKCTKLKMLLHVSTAYVCGEQEGLILEKPFMMGD  181

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++       G       +LN+    +M L A    +D A  + MKELGL+RA +FGW +T
Sbjct  182   TLR-----EGTHLDIESELNLIKHTQMELKANCA-TDKAQRKTMKELGLKRARRFGWPNT  235

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ ++RG++PVVI+RPS+I S  KEP PGWMEG R +D + L Y K  L 
Sbjct  236   YVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGVRTIDSVFLGYAKQALK  295

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FLVDPN ++DV+P DMVVN+ + AM  H  +G+   +IYH+ SS+ NP  +  L    +
Sbjct  296   FFLVDPNTIMDVIPGDMVVNSMMVAMLAH--SGEQAQTIYHVTSSMSNPASYMTLRESAH  353

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLSTK  1698
              +F   P     G+PI + +M+ FS++  L  ++   ++  ++   L  +G   G  S +
Sbjct  354   RYFVDNPPRGENGEPIRLNKMRFFSTVARLRMYMVIKYKLPLEILHLVNIGLC-GVFSGR  412

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE---RWQFGFEVESID  1869
                +  K    A +L  +Y PYT + GRFD+ N +KL + M +      + F F+ + ID
Sbjct  413   YNELSGK-YRLAMHLIELYAPYTLFKGRFDDMNLEKLRKAMEQNSDGGEYYFDFDPKKID  471

Query  1870  WKDYISNVHIPGLRRHV  1920
             W DY   VH PG+ +++
Sbjct  472   WDDYFYMVHFPGVLKYL  488



>ref|XP_009108773.1| PREDICTED: fatty acyl-CoA reductase 3-like [Brassica rapa]
Length=492

 Score =   402 bits (1033),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 206/494 (42%), Positives = 307/494 (62%), Gaps = 11/494 (2%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             + + ++++L  KS L+ G  GFL  + +EKILR  P+V K+Y+L++A N++ A +R K E
Sbjct  6     EAVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATQRFKDE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  +L+K +K+ YG +       K+  V G++C +DLGI D  A  +  +VD I+N AA
Sbjct  66    ILGKDLYKVVKEKYGPNLTQLTSEKVTVVNGDICLADLGIQDSLAHEMIHQVDAIINLAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T FDERYDVAL INT GP  ++ FA +C   K+F+HVSTAYV+G++ G I+E P+ +GE
Sbjct  126   TTKFDERYDVALGINTLGPLNVLDFAKKCENAKIFVHVSTAYVSGEKSGLIMETPYRMGE  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++ G + ++ N E  +    V+++++ +L  K       + Q MK++GL RA  +GW +T
Sbjct  186   TLNGTTGLDINHERKL----VQEKLDQLLVIKT--PPETITQAMKDMGLTRAKMYGWPNT  239

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEMM+   R NI +V++RPS+I ST KEPFPGW EG R +D + + YGKG+LT
Sbjct  240   YVFTKAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGRLT  299

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FL D N + DV+PADMVVN+ L +MA    AGK    IYH+ SS  NPL  +    + Y
Sbjct  300   CFLGDLNAISDVMPADMVVNSILVSMA--AQAGKQKEIIYHLGSSQKNPLKNEKFPEVAY  357

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLE  1704
             ++F +KP+ +  GKP+ V ++++ SSM +   ++    +I   GL  L     KL  K  
Sbjct  358   QYFTTKPWTNKDGKPVHVRKIEILSSMPSFHRYMAIHYSIPLKGLAVLNMVLCKLLDKSV  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
                 + +  A  L  +Y+PY F+ G FD+SN +KL   + K   E   F F+ + I+W D
Sbjct  418   TDFHRKINLALRLVDLYQPYLFFYGVFDDSNTEKLQRMVLKTGVETEMFYFDPKIINWDD  477

Query  1879  YISNVHIPGLRRHV  1920
             Y    HIPGL ++V
Sbjct  478   YFVKTHIPGLVKYV  491



>ref|XP_007150087.1| hypothetical protein PHAVU_005G125400g [Phaseolus vulgaris]
 gb|ESW22081.1| hypothetical protein PHAVU_005G125400g [Phaseolus vulgaris]
Length=524

 Score =   402 bits (1033),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/495 (42%), Positives = 311/495 (63%), Gaps = 16/495 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             ++ FL+ K+ LI GGTGFL K+L+EKILR  P+V KI++L++A +   A  RL  EII  
Sbjct  40    VLHFLQNKTILIAGGTGFLAKILLEKILRVQPNVKKIFLLLRASDANSATYRLHNEIIGK  99

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF  LK+  G +++ F+  K+  V G++    LG+ D T  E I  + D+IVN AA T 
Sbjct  100   DLFIVLKEKLGSNFKSFIAEKVTLVPGDITYEGLGLKDSTLREEICNQTDVIVNLAATTN  159

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+ALD+NT G   +M FA QC KLK+ LHVSTAYV G+R G I+E P+  GE++ 
Sbjct  160   FDERYDIALDLNTFGVKYVMNFAKQCTKLKVLLHVSTAYVCGERGGLILEDPYHFGETLN  219

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++ + E ++   N  DE+      +QG ++  +   MK LG+ RA  +GW +TYVF
Sbjct  220   GVSGLDIDAEKTIV-CNKLDELR-----EQGATERDVKIAMKNLGISRAKVYGWPNTYVF  273

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKA+GEM+++ ++GN+ VVI+RP+++ ST KEPFPGW+EG R +D + + YGKG+LT FL
Sbjct  274   TKAVGEMLVEKLKGNLSVVIIRPTIVTSTMKEPFPGWVEGIRTIDSLAVTYGKGKLTCFL  333

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D NGV+DVVPADMVVNA L AM  H  A +P   IYH+ SS+ NPL + +L     ++F
Sbjct  334   GDINGVVDVVPADMVVNAMLVAMVAH--AKQPSDIIYHVGSSLRNPLTYLNLQDFGLKYF  391

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKL--STKLEN  1707
              +KP+I   G P+ V R+ + +SM++   +++ R  +   GL     +  +    T LE 
Sbjct  392   TAKPWIKKDGTPVKVGRVTVLTSMDSFQRYMFIRYLLPLKGLELANTALCQYFQGTYLE-  450

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC--MSKEERWQFGFEVESIDWKDY  1881
                + ++    +  +Y PY F+ G FD+ N +KL      S  E   F F+ + I+W+DY
Sbjct  451   -LNRKIQVVMRMVELYRPYMFFSGLFDDMNTEKLRMAAEQSGTEIDMFYFDTKEINWEDY  509

Query  1882  ISNVHIPGLRRHVMK  1926
                 H+PG+ +++ K
Sbjct  510   FMKTHLPGVVKYIFK  524



>ref|XP_003540237.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
Length=490

 Score =   400 bits (1029),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/493 (42%), Positives = 308/493 (62%), Gaps = 12/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL+ K+ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + E A +RL  EII  
Sbjct  6     IMHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRARDTESATQRLHTEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G  +  F+  KL  V G++ + DL ++D    E I  + D+IVN AA T 
Sbjct  66    DLFRLLKEKLGTRFNSFVSEKLAVVPGDISQEDLNLEDPILGEEIFNQTDVIVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+AL INT G   ++ FA +C KLK+ +HVSTAYV G+R+G I+E P   G S+ 
Sbjct  126   FDERYDIALSINTLGVLHVLSFAKKCVKLKVLIHVSTAYVCGEREGLILEAPHHFGVSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G   V G  +  + K  VED++  +   ++G  +  +   MK+LG +RA  +GW +TYVF
Sbjct  186   G---VPG-PDIDMEKKKVEDKLNQL--REEGAIEHDIELAMKDLGTQRATMYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++   +GN+ VVIVRP+++ ST+KEPFPGW+EG R +D I++ YGKG+L  FL
Sbjct  240   TKAMGEMLVGTTKGNMNVVIVRPTMVTSTYKEPFPGWIEGLRTIDSIVVAYGKGKLVCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              +   V DV+PADMVVNA L AM  H  A +P   IYH+ SSVVNP+++ +L      +F
Sbjct  300   ANLEAVFDVIPADMVVNAMLVAMVAH--ANQPSDIIYHVGSSVVNPVMYLNLRDYSVRYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENIC  1713
               KP+I+  GKP+ V +  +  +M++   +++ R  +   GL  +  +  +   K+    
Sbjct  358   TEKPWINRDGKPVKVGKFTILRNMDSFRKYMYIRYLLPLKGLELVNAASCQYFQKMYLDF  417

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK--EERWQFGFEVESIDWKDYIS  1887
              + +     L  +Y+PY F+ G FDN+N +KL+    +   E   F F+ + IDW+DY  
Sbjct  418   NRKIRTVLRLVELYKPYLFFNGVFDNTNTEKLLSSARQGGVETELFYFDTKMIDWEDYFI  477

Query  1888  NVHIPGLRRHVMK  1926
             N+H PG+ ++  K
Sbjct  478   NIHFPGIIKYAFK  490



>ref|XP_004506277.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   400 bits (1029),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 209/494 (42%), Positives = 308/494 (62%), Gaps = 13/494 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             ++ FL  K+ LITGGTGFL K+L+EKILR  P++ KIYIL++A + + A  R   EII  
Sbjct  6     VLEFLEEKTILITGGTGFLAKLLLEKILRVQPNIKKIYILLRAVDVKSAGHRFDTEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             ELF+ LK+  GK++  F+  KL  + G+V   DLG+ D    E I    D+IVN AANT 
Sbjct  66    ELFRLLKEKMGKNFTTFLSEKLTLIPGDVSLEDLGLKDSIIKEEIYNHTDVIVNLAANTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD++L +NT G   ++ FA +C+KLK+ +HVSTAYV G+ +G I+EKP+ +G S+ 
Sbjct  126   FDERYDISLGLNTFGTKYIINFAKKCNKLKVLVHVSTAYVCGEGEGLILEKPYQLGHSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQ-GLSDGAMAQKMKELGLERANKFGWQDTYV  1173
             G   +N ++E  V +       E +   +Q G ++  +   MK LGL RA  +GW +TYV
Sbjct  186   GVHGLNIDEEEKVVQ-------EKLFELQQLGATEDEIKVVMKNLGLSRAKLYGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM+++ ++ N+ VVIVRP+++ ST KEPFPGW EG R +D + L YGKG+LT F
Sbjct  239   FTKAMGEMLVEQLKENLSVVIVRPAIVTSTFKEPFPGWGEGVRTIDSLALAYGKGKLTCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             L D   ++D +PADMVVNA L A+  H A      SIYH+ SS+  PL+++DL    + H
Sbjct  299   LGDVKAIVDAIPADMVVNAMLVAIVAH-ANNPSDDSIYHVGSSLRRPLIYNDLQEFGFRH  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENI  1710
             F +KP+++S GKPI V R+++F  M++    ++ R  +   GL     +  K      + 
Sbjct  358   FSAKPWLNSDGKPIKVGRVQVFGDMDSFRRFMFIRYFLLLKGLELANTAFCKYFQGTYDD  417

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYI  1884
              ++ +     L  +Y+PY F+ G FD+ N +KL    S+   E   F F+ + I+W DY 
Sbjct  418   FKRKIHSVMRLVDLYKPYLFFKGVFDDINTEKLRMAASQGGVETDLFYFDPKVINWDDYF  477

Query  1885  SNVHIPGLRRHVMK  1926
              N+H+PG+ ++  K
Sbjct  478   LNIHLPGVVKYTRK  491



>ref|XP_006412311.1| hypothetical protein EUTSA_v10025005mg [Eutrema salsugineum]
 gb|ESQ53764.1| hypothetical protein EUTSA_v10025005mg [Eutrema salsugineum]
Length=494

 Score =   400 bits (1029),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 310/495 (63%), Gaps = 12/495 (2%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             + ++++L  KS L+ G  GFL K+ +EKILR  P+V K+Y+L++A N++ A +R   EI+
Sbjct  8     VSVLQYLDNKSILVIGAAGFLAKIFLEKILRVAPNVKKLYLLLRATNEKSATQRFNDEIL  67

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAAN  810
               +L++ +K+ YG +       K+  V G++C  DLG+ D   A  +  EVD IVN AA 
Sbjct  68    GKDLYRVVKEKYGANLYQLTSEKVTVVNGDICRDDLGLQDSDLAHEMIHEVDAIVNLAAT  127

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T FDERYDVAL INT G   ++ FA +C K+K+F+HVSTAYV G++ G I+E P+ +GE+
Sbjct  128   TKFDERYDVALGINTSGALSVLNFAKRCAKVKIFVHVSTAYVCGEKSGVIMETPYRMGET  187

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G + +N N E  +    V+++++ + +   G S   + Q MK+LGL RA  +GW +TY
Sbjct  188   LNGTTGLNINHEKKL----VQEKLDQLRAT--GASPETITQAMKDLGLTRAKMYGWPNTY  241

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM++   RGNI +V++RPS+I ST KEPFPGW EG R +D + + YGKG+LT 
Sbjct  242   VFTKAMGEMLVGTKRGNISLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTC  301

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             FL D N + DV+PADMVVN+ L +MA    AGK    IYH+ SS+ NPL  +    + Y 
Sbjct  302   FLADLNAISDVMPADMVVNSILVSMA--AQAGKEKEIIYHVGSSLRNPLKNEKFPEVAYR  359

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F++ P+I+ +G P+ V ++++ SSM +   ++     I   GL  +     KL  K   
Sbjct  360   YFKTNPWINKEGNPVRVKKIEMLSSMSSFHKYMTIHYLISLKGLELVNMILCKLLEKKFR  419

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDY  1881
                + +     L  +Y+PY F+ G FD++N +KL + + K   E   F F+ + I+W DY
Sbjct  420   DFHRKIYFVFRLVDLYQPYLFFHGVFDDTNTEKLQKMVPKTELENEMFYFDPKIINWDDY  479

Query  1882  ISNVHIPGLRRHVMK  1926
               ++HIPGL ++V K
Sbjct  480   FVDIHIPGLVKYVFK  494



>ref|XP_006402959.1| hypothetical protein EUTSA_v10005887mg [Eutrema salsugineum]
 gb|ESQ44412.1| hypothetical protein EUTSA_v10005887mg [Eutrema salsugineum]
Length=531

 Score =   402 bits (1032),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 214/499 (43%), Positives = 306/499 (61%), Gaps = 38/499 (8%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             +GIGIVRFL GKS+L+TG TGFL KVLIEK+LR  P++ KI++L+K+ ++E A +RL  E
Sbjct  69    EGIGIVRFLTGKSYLVTGATGFLAKVLIEKLLRASPEIGKIFVLMKSKDQESANKRLYDE  128

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             IIS++LFK LKQ +G SY+ FM SKLVPV+G++ E +LG +   A+ I +E+D+I++ A 
Sbjct  129   IISSDLFKVLKQMHGTSYEAFMKSKLVPVIGDIREDNLGTESEIADKINEEIDVIISCAG  188

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              TTFD+RY  AL +N  GP                     AYV G+++G I+E P CIGE
Sbjct  189   RTTFDDRYYSALSVNALGP---------------------AYVTGKKEGTILETPLCIGE  227

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             +I                LN++ EM++   A +        +K+KELG+ERA  FGW++ 
Sbjct  228   NITS-------------NLNIKTEMKLASEAVKKFHGSEQIKKLKELGIERAQYFGWENV  274

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             Y FTKA+GE +I++ RG  PVVI+RPS+IES++KEPFPGW++G RM  P+IL YGK Q++
Sbjct  275   YTFTKALGETIINSKRGKFPVVIIRPSIIESSYKEPFPGWLQGRRMSVPLILGYGKEQIS  334

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIAS-SVVNPLVFDDLARLL  1524
                 D     D++P DMV NA +AA+AKHG    P   +Y++ S S  NPL   +LA   
Sbjct  335   DMWGDYQSFCDIIPVDMVANAAIAAIAKHGFGDVPELKVYNVTSTSHANPLRLGELADFS  394

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLS-TKL  1701
             ++H    P  ++  K  D+ RMK  SS+E  +S +      +      G+ KG  S T L
Sbjct  395   HQHLCDSPLTETITK--DLERMKFHSSLEGFTSSVSNTLAKQEIEMNTGEGKGGESHTTL  452

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFGFEVESIDWKDY  1881
                 ++ +     LA  Y+PY+F+   FD++N + L++ MS EER  F F+   IDW+ Y
Sbjct  453   SIKGKRKLNYFVSLARTYQPYSFFQACFDDTNTRSLIQEMSLEERKVFEFDGRCIDWEHY  512

Query  1882  ISNVHIPGLRRHVMKGRGS  1938
             I NVH+PGL+R +   R S
Sbjct  513   IVNVHLPGLKRQLFSERSS  531



>ref|XP_003573673.1| PREDICTED: fatty acyl-CoA reductase 1-like [Brachypodium distachyon]
Length=496

 Score =   400 bits (1028),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 210/504 (42%), Positives = 317/504 (63%), Gaps = 28/504 (6%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             DG  +  + RGK+ LITG TGFLGKVL+EKILR  PDV K+++L++A + E A  R++ E
Sbjct  6     DGSMVAGYFRGKTILITGSTGFLGKVLVEKILRVQPDVKKLFLLVRASDVESAKLRIQTE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +   E+F+ LK+ +G  +  F+  K+ PV G++   + G+D  +   + K+VDIIVN AA
Sbjct  66    VTGREIFQVLKEKHGMGFDNFIEEKICPVAGDIVYENFGLDAASLRELVKDVDIIVNGAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDVA D N  G   +  FA +C KLK+ LHVSTAYV G+++G I+EKPF +GE
Sbjct  126   TTNFSERYDVAFDSNVLGAKHVCAFAKKCTKLKMLLHVSTAYVAGEKEGLILEKPFLMGE  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-----SDGAMAQKMKELGLERANKF  1152
             ++         +E +   L++E E++++   +  L     S+ A  + MKELGL+RA +F
Sbjct  186   TL---------REGT--HLDIESELDLIKETRSELKANCSSEKAERRTMKELGLKRARQF  234

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GW +TYVFTKAMGEM++ ++RG++PVVI+RPS+I ST KEP PGWMEG R +D +++ Y 
Sbjct  235   GWPNTYVFTKAMGEMLLGHLRGDLPVVILRPSIITSTLKEPLPGWMEGIRTIDSVVIGYA  294

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDL  1512
             K  L+ FLVD + ++DV+P DMVVNA + AMA H  + +   +IYH+ SS+ NP  +  L
Sbjct  295   KQTLSFFLVDLDLIMDVIPGDMVVNAMMVAMAAH--SEEQAQTIYHVTSSLRNPAPYAIL  352

Query  1513  ARLLYEHFQSKPYIDSK-GKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSK  1680
             A   + +F   P    K G+P  + +M+ FS++  LS ++   +R  ++   L  +    
Sbjct  353   ADTGHRYFFDNPPCTGKNGEPARLKKMRFFSTVARLSLYMTIKYRLPLEMLRLVNISLC-  411

Query  1681  GKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE----RWQFG  1848
             G  S +   + RK      +L  +Y PY+ + G FD+ N+++L   M KE+     + F 
Sbjct  412   GVFSQRYNELSRK-YRFVMHLIELYAPYSLFKGCFDDMNSERLRLAMKKEQDDNGEYCFD  470

Query  1849  FEVESIDWKDYISNVHIPGLRRHV  1920
             F+ +SIDW DY  NVHIPG+ +++
Sbjct  471   FDPKSIDWDDYFYNVHIPGVLKYM  494



>ref|XP_011088871.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Sesamum indicum]
Length=493

 Score =   399 bits (1025),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 206/500 (41%), Positives = 317/500 (63%), Gaps = 15/500 (3%)
 Frame = +1

Query  448   DGIG-IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKK  624
             D +G I+ FL   S L+TG TGFL K+ IEKILR  PDV K+Y+L++A +   AM R   
Sbjct  2     DQLGSILEFLENSSILVTGATGFLAKIFIEKILRVQPDVKKLYLLLRAADDNSAMLRFNT  61

Query  625   EIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNS  801
             E+I+ +LF+ LK+ +G +    +  K+  V G++   +LG+ D    + + K+VD++++ 
Sbjct  62    EVIAKDLFRVLKEKHGGNLSCLLSEKVRAVAGDITSENLGVKDPDLLQEMWKQVDVVLHL  121

Query  802   AANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCI  981
             AA T FDERYDVAL INT G   ++ F+ +C KLK+F+HVSTAYV+G+++G I+E P+ +
Sbjct  122   AATTKFDERYDVALAINTLGARHVLNFSKKCDKLKVFVHVSTAYVSGEKEGLILETPYKL  181

Query  982   GESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQ  1161
             GE++ G S ++ + E  +      DE    LSAK   S+ ++   MK+LG++RA K+GW 
Sbjct  182   GETLNGTSELDIDAEKKLV-----DETLKQLSAKN-YSEDSIKSAMKDLGIQRARKYGWP  235

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             +TYVF+KAMGEM++ +++ NIP+VI+RP+++ ST K+PFPGW+EG R +D + + YGKG+
Sbjct  236   NTYVFSKAMGEMLLGHLKQNIPLVIIRPTIVTSTFKDPFPGWVEGVRTIDSLAVGYGKGK  295

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLAR  1518
             +T FL +P  ++DV+PADMVVNA + AM  H  A +P    IYHI SSV +P+ F  L  
Sbjct  296   ITCFLGNPQSIIDVIPADMVVNAIIVAMVAH--ANQPNEDIIYHIGSSVSSPVEFTWLQD  353

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAI-DKSGLTALGDSKGKLST  1695
               + +F + PYID  GKP+ V ++ + S+ME+   ++    I    GL  L  +  +   
Sbjct  354   YAFRYFTNHPYIDKHGKPVIVGKVTVLSTMESFQRYMTIHYILPLKGLEILNTTCCQYFQ  413

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE---ERWQFGFEVESI  1866
             +L     + V+    L  +Y PY F+ G +D+ N +KL     +    E   F F+ +SI
Sbjct  414   RLYLDLSRKVKLVMRLIDLYGPYLFFNGYYDDMNTEKLRRAAKESGSVEDDMFNFDPKSI  473

Query  1867  DWKDYISNVHIPGLRRHVMK  1926
             +W+DY  N HIPG+ ++V K
Sbjct  474   NWEDYFMNTHIPGIVKYVFK  493



>gb|AIZ97193.1| fatty acyl-coenzyme A reductase [Triticum aestivum]
Length=494

 Score =   398 bits (1023),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/497 (41%), Positives = 306/497 (62%), Gaps = 16/497 (3%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   +  F RGK+ LITG TGFLGKVL+EKILR  P+V K+++L++A + E A  R++ E
Sbjct  7     DAAQVAAFFRGKNILITGATGFLGKVLLEKILRIQPEVTKLFLLVRATDDESARRRVQTE  66

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +   E+F+ L++ +GK ++ F+  K+ P+ G+V   D G+D    + ++K+VDIIVN AA
Sbjct  67    VTGREIFQVLREKHGKGFEDFIEEKVYPLAGDVMYEDFGLDTAKLKEVSKDVDIIVNGAA  126

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDV+ D N  G  ++  FA++C KLK+ LHVSTAYV G+++G I+EKPF +G+
Sbjct  127   TTNFYERYDVSFDTNVLGAKQICAFANKCTKLKMLLHVSTAYVCGEQEGLILEKPFMMGD  186

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++       G       +LN+    +M L A    +D A  + MKELGL+RA +FGW +T
Sbjct  187   TLR-----EGTHLDIESELNLIKHTQMELKANCA-TDKAQRKTMKELGLKRARRFGWPNT  240

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ ++RG++PVVI+RPS+I S  KEP PGWMEG R +D + L Y K  L 
Sbjct  241   YVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGVRTIDSVFLGYAKQALK  300

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FLVDPN ++D +P DMVVN  + AM  H  +G+   +IYH+ S + NP  +  L    +
Sbjct  301   FFLVDPNTIMDAIPGDMVVNTMMVAMLAH--SGEQAQTIYHVTSCMSNPASYMTLRESAH  358

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLSTK  1698
              +F   P     G+PI + +M+ FS++  L  ++   ++  ++   L  +G   G  S +
Sbjct  359   RYFVDNPPRGENGEPIRLNKMRFFSTVARLRMYMVIKYKLPLEILHLVNIGLC-GVFSGR  417

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE---RWQFGFEVESID  1869
                +  K    A +L  +Y PYT + GRFD+ N +KL + M +      + F F+ + ID
Sbjct  418   YNELSGK-YRLAMHLIELYAPYTLFKGRFDDMNLEKLRKAMEQNSDGGEYYFDFDPKKID  476

Query  1870  WKDYISNVHIPGLRRHV  1920
             W DY   VH PG+ +++
Sbjct  477   WDDYFYMVHFPGVLKYL  493



>ref|XP_007015865.1| Jojoba acyl CoA reductase-related male sterility protein, putative 
[Theobroma cacao]
 gb|EOY33484.1| Jojoba acyl CoA reductase-related male sterility protein, putative 
[Theobroma cacao]
Length=534

 Score =   399 bits (1026),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 203/494 (41%), Positives = 311/494 (63%), Gaps = 13/494 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +++FL  KS  + G TGFL K+ +EKILR  P+V K+Y+L++A++ + A +R   EII  
Sbjct  48    VLQFLDNKSIFVIGATGFLAKIFVEKILRVQPNVKKLYLLLRAEDSKSATQRFHNEIIGK  107

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEM-IAKEVDIIVNSAANTT  816
             ELFK LK+ +G ++  F+  K+  V G++   DLG+ +   E  + +EVD++VNSAA T 
Sbjct  108   ELFKVLKEKWGNNFNSFISEKIAVVPGDISHEDLGLKNSKLEKELRREVDVVVNSAATTN  167

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL +N  G   ++ FA +C KLK+F+HVSTAYV G++ G I+E  F +G+++ 
Sbjct  168   FDERYDVALGLNVLGAKHVLDFAKKCAKLKVFVHVSTAYVAGEKSGLILESSFSMGKTLN  227

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++ N E  V     E+E++ + +  QG S+  +   MK+LG ERA  FGW +TYVF
Sbjct  228   GVSGLDINVEMKV----AEEELKQLQA--QGASEKEITLVMKDLGAERARLFGWPNTYVF  281

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++ N +G++P+VIVRP+++ ST KEPFPGW+EG R +D +I+  GKG++T FL
Sbjct  282   TKAMGEMLVGNFKGDLPLVIVRPTIVTSTFKEPFPGWIEGLRTIDSVIVGLGKGKMTCFL  341

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              +P   +D++PADMV+NA +  M  H A      +IYH+ SS+ NP+   ++    Y +F
Sbjct  342   GNPKVTIDLIPADMVINAMIVTMMAH-ANQSCDDAIYHVGSSLRNPMNSLNVHNFSYHYF  400

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENIC  1713
                P ID  GKP    ++ + S+M     ++  R ++   GL  L     +  TK+ NI 
Sbjct  401   TKNPLIDRNGKPTKTRKLLILSTMSRFRLYMKIRYSLPLKGLYLLSKLCPRYFTKVYNIN  460

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ---FGFEVESIDWKDYI  1884
                ++    LA +Y PY F+ G FD+ N ++L   ++KE       F F+   I+W++Y 
Sbjct  461   DHKIKSVMRLAELYRPYVFFKGIFDDINLERL-RMVAKESGMDLEVFNFDPRFIEWEEYF  519

Query  1885  SNVHIPGLRRHVMK  1926
             + +HIPGL RHV++
Sbjct  520   TKIHIPGLTRHVIR  533



>ref|XP_003543435.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
Length=490

 Score =   398 bits (1022),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 205/493 (42%), Positives = 305/493 (62%), Gaps = 12/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL+ K+ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + E A +RL  EII  
Sbjct  6     IIHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRARDTESATQRLHAEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G  +  ++  KL  V G++ + DL + D    E I  + D+IVN AA T 
Sbjct  66    DLFRLLKEKLGTRFNSYVSEKLTVVPGDISQEDLNLKDPILGEEIFNQTDVIVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL INT G   ++ FA +C KLK+ +HVSTAYV G+++G I+E P   G S+ 
Sbjct  126   FDERYDVALGINTLGVMHVLSFAKKCVKLKVLIHVSTAYVCGEKEGLILEDPHHFGVSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G   ++ + E    K NVE ++  +   ++G ++  +   MK+LG ERA  +GW +TYVF
Sbjct  186   GVPGLDIDME----KKNVEQKL--IQLREEGATEHDIELAMKDLGSERAKMYGWANTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++   +GN+ VVIVRP+++ STH EPFPGW+EG R +D I++ YGKG+L  FL
Sbjct  240   TKAMGEMLVGTTKGNMNVVIVRPTMVTSTHTEPFPGWIEGLRTIDSIVVAYGKGKLACFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              +   V DV+PADMVVN  L AM  H  A +P   IYH+ SSVVNP+ + +L      +F
Sbjct  300   ANLKAVFDVIPADMVVNTMLVAMVAH--ANQPSDIIYHLGSSVVNPVKYLNLRDYSVRYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENIC  1713
                P+I+  GKP+ V ++ + S+M++   +++ R  +   GL  +     +   K+    
Sbjct  358   MENPWINKDGKPVKVGKVTILSNMDSFRKYMYIRYLLPLKGLELVNAVSCQYFQKMYLDF  417

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK--EERWQFGFEVESIDWKDYIS  1887
              + +     L  +Y+PY F+ G FDN N +KL+    +   E   F F+ + IDW+DY  
Sbjct  418   NRKIRTVMRLVELYKPYLFFNGVFDNMNTEKLLSSARQGGVETEFFYFDPKMIDWEDYFI  477

Query  1888  NVHIPGLRRHVMK  1926
             N+H PG+ +H +K
Sbjct  478   NIHFPGIIKHALK  490



>gb|KEH29873.1| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=491

 Score =   398 bits (1022),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 203/494 (41%), Positives = 315/494 (64%), Gaps = 13/494 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             ++ FL+ K+ LITG TGFL K+L+EKILR  P+V K+Y+L++A + + A  R   EII  
Sbjct  6     VLHFLQDKTILITGATGFLAKILLEKILRVQPNVKKLYLLLRASDAKSASHRFHNEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             +LFK LK+  G ++  F+  KL  V G++   DLG++D    E I  ++D+IVN AANT 
Sbjct  66    DLFKCLKEKLGANFTTFLSEKLTLVPGDISLEDLGLEDSILKEEIHNQIDVIVNLAANTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD++L +NT G   ++ FA +C+KLK+ +HVSTAYV G+ +G I+EKP+ +G S+ 
Sbjct  126   FDERYDISLGLNTFGIKYIINFAKKCNKLKVLVHVSTAYVCGEGEGLILEKPYHLGHSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G + ++ + E  V    V D++  +   + G ++  +   MK LG+ RA  +GW +TYVF
Sbjct  186   GVNGLDVDIEEKV----VRDKLCEL--QQLGATEDEIKMAMKNLGISRAKLYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++  ++GN+ VVI+RP+++ ST KEPFPGW EG R +D + + YGKG+LT FL
Sbjct  240   TKAMGEMLVGQLKGNLSVVIIRPAIVTSTFKEPFPGWSEGVRTIDSLAVAYGKGKLTCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFDDLARLLYEH  1533
              D N ++DV+PADMVVN+ L A+  H  A  P   +IYH+ SS+  PL++ DL    + H
Sbjct  300   GDLNAIVDVIPADMVVNSILVAIVAH--ANHPNNDAIYHVGSSIRRPLMYSDLQEFGFRH  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENI  1710
             F++KPYI+  GKP+ V ++ +FS+M++ S  ++ R  +   GL     +  +        
Sbjct  358   FKAKPYINKDGKPVKVGKVTVFSNMDSFSRFMFIRYLLMLKGLEIANTALCQYFKGTYLD  417

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYI  1884
              ++ ++    L  +Y+PY F+ G FD+ N +KL     +   E   F F+ + I W DY 
Sbjct  418   LKRKIQIVMRLVDLYKPYLFFKGVFDDMNTEKLRMAARQGGVETDLFYFDPKVIKWDDYF  477

Query  1885  SNVHIPGLRRHVMK  1926
              N+H+PG+ ++++K
Sbjct  478   LNIHLPGVVKYILK  491



>ref|XP_010325917.1| PREDICTED: fatty acyl-CoA reductase 2-like isoform X2 [Solanum 
lycopersicum]
Length=527

 Score =   399 bits (1024),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 205/508 (40%), Positives = 309/508 (61%), Gaps = 61/508 (12%)
 Frame = +1

Query  412   KELVSSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKAD  591
             KE++S   +   +GIGIV F  GK+ L+TGGTGFL K LIEK+LRT P ++KIYILI+A 
Sbjct  76    KEIIS---QNANNGIGIVEFFEGKNILVTGGTGFLAKALIEKMLRTTPKINKIYILIRAK  132

Query  592   NKEVAMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMI  771
             +KE A  RLK EII +ELFK L++ +G+ Y+ F+L+KL+P+VGN+ E +LG+D  T++ I
Sbjct  133   DKEAAFNRLKSEIIESELFKCLEEIHGEYYKPFILNKLIPIVGNIYEPNLGMDIITSQQI  192

Query  772   AKEVDIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQ  951
             A+++D+I++SAANTTFDERYD+ALD N  GP +LM FA +C  LKL +H STAY NG+R+
Sbjct  193   AQQIDLIIDSAANTTFDERYDLALDANVNGPYQLMMFAKKCKNLKLLMHYSTAYANGERE  252

Query  952   GKIIEKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDG-AMAQKMKEL  1128
             G I+EKPF +GESI  E + + +  ++ P L+V++E++++   K  +++   + Q MK L
Sbjct  253   GLILEKPFSMGESITKEKINSISPFTNFPSLHVDNEIDLISKLKNNITNNIGLEQIMKNL  312

Query  1129  GLERANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMM  1308
             G+ER                               ++ PS                    
Sbjct  313   GVER-------------------------------VIDPS--------------------  321

Query  1309  DPIILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVV  1488
                I  YGKG+L     D +  +D++P D+VVNAT+AA+AKHG    P  ++YH+A+++V
Sbjct  322   ---IFLYGKGELPAIYCDQDTDVDLIPVDVVVNATMAAIAKHGYLQSPQLNVYHLATTLV  378

Query  1489  NPLVFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTAL  1668
             NP+    L    YE+F   P+++SKG  I+V  MK F  +   S+++W     +  +  L
Sbjct  379   NPVAIHQLFDYCYEYFTLFPFVNSKGDKIEVKEMKYFDKISDFSNYIWEVLSKQHKVQDL  438

Query  1669  GDSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQFG  1848
              +   K   K+    ++ VE     + +YEPY FY GRF   N + LME MS+EER  F 
Sbjct  439   SE---KELLKIHMRFKRKVEFLNNFSKLYEPYGFYRGRFHTGNMRILMEEMSEEERKNFE  495

Query  1849  FEVESIDWKDYISNVHIPGLRRHVMKGR  1932
              +  +I+WKDY++ +HI G+++HV +G+
Sbjct  496   IDASNINWKDYLTRIHISGVKKHVFEGK  523



>dbj|BAH01371.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68433.1| hypothetical protein OsJ_26806 [Oryza sativa Japonica Group]
Length=496

 Score =   397 bits (1019),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 207/499 (41%), Positives = 310/499 (62%), Gaps = 18/499 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   +V F RG+S LITG TGFLGKVL+EKILR  PDV K+Y+L++A++ E A  R++ E
Sbjct  6     DSGNVVAFFRGRSILITGSTGFLGKVLVEKILRVQPDVKKLYLLVRANDVESATRRVQDE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +   E+F+ LK+ +G  ++ F+  K+  + G++   +LG+D      ++ E+DIIVN AA
Sbjct  66    VTGKEIFQVLKEKHGDGFESFVEEKVCTLAGDIIYENLGLDSAKLTELSNEIDIIVNGAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G I+EKPF +G+
Sbjct  126   TTNFYERYDVAFDSNVLGAKNICEFAKKCTKLKMLLHVSTAYVAGEQEGLILEKPFLMGQ  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++       G       +LN+  E    + A    S+    + MKELGL+RA  FGW +T
Sbjct  186   ALR-----EGRHLDITSELNLIKETRREMKASNRCSEKTEKRTMKELGLKRAKHFGWPNT  240

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ ++RG++PVVI+RPS+I S  KEP PGWMEG R +D +I+ Y K  L+
Sbjct  241   YVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGIRTIDSVIIGYAKQTLS  300

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FLVD N ++DV+P DMVVNA + AMA H  +G+   +IYH+ SS+ NP  +  L+   +
Sbjct  301   FFLVDLNLIMDVIPGDMVVNAMMVAMAAH--SGEQAQTIYHVTSSLSNPAPYAVLSDAGH  358

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLSTK  1698
              +F + P     GK   + RM+ FS++ +  +H+   ++  ++   L  +    G  S +
Sbjct  359   RYFFANP-PPRAGKNGRLRRMRFFSTVASFRAHMAINYKLPLEILRLVNIALC-GMFSRR  416

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEER-----WQFGFEVES  1863
              + + RK  +   +L  +Y PYT + G FD+ N +KL   M K+E      + F F+ +S
Sbjct  417   YDELSRK-YKFVMHLVELYAPYTLFKGCFDDINTEKLRITMRKQEDKNDGGYCFDFDPKS  475

Query  1864  IDWKDYISNVHIPGLRRHV  1920
             IDW +Y   VHIPG+ +++
Sbjct  476   IDWDEYFYKVHIPGVVKYL  494



>gb|KHN21439.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/493 (42%), Positives = 305/493 (62%), Gaps = 12/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL+ K+ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + E A +RL  EII  
Sbjct  6     IIHFLQDKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRARDTESATQRLHAEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G  +  ++  KL  V G++ + DL + D    E I  E D+IVN AA T 
Sbjct  66    DLFRLLKEKLGTRFNSYVSEKLTVVPGDISQEDLNLKDPILGEEIFNETDVIVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL INT G   ++ FA +C KLK+ +HVSTAYV G+++G I+E P   G S+ 
Sbjct  126   FDERYDVALGINTLGVMHVLSFAKKCVKLKVLIHVSTAYVCGEKEGLILEDPHHFGVSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G   ++ + E    K NVE ++  +   ++G ++  +   MK+LG ERA  +GW +TYVF
Sbjct  186   GVPGLDIDME----KKNVEQKL--IQLREEGATEHDIELAMKDLGSERAKMYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++   +GN+ VVIVRP+++ ST+ EPFPGW+EG R +D I++ YGKG+L  FL
Sbjct  240   TKAMGEMLVGTTKGNMNVVIVRPTMVTSTYTEPFPGWIEGLRTIDSIVVAYGKGKLACFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              +   V DV+PADMVVN  L AM  H  A +P   IYH+ SSVVNP+ + +L      +F
Sbjct  300   ANLKAVFDVIPADMVVNTMLVAMVAH--ANQPSDIIYHLGSSVVNPVKYLNLRDYSVRYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENIC  1713
                P+I+  GKP+ V ++ + S+M++   +++ R  +   GL  +     +   K+    
Sbjct  358   MENPWINKDGKPVKVGKVTILSNMDSFRKYIYIRYLLPLKGLELVNAVSCQYFQKMYLDF  417

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK--EERWQFGFEVESIDWKDYIS  1887
              + +     L  +Y+PY F+ G FDN N +KL+    +   E   F F+ + IDW+DY  
Sbjct  418   NRKIRTVMRLVELYKPYLFFNGVFDNMNTEKLLSSARQGGVETEFFYFDPKMIDWEDYFI  477

Query  1888  NVHIPGLRRHVMK  1926
             N+H PG+ +H +K
Sbjct  478   NIHFPGIIKHALK  490



>gb|EEC83314.1| hypothetical protein OsI_28691 [Oryza sativa Indica Group]
 dbj|BAI39721.1| putative fatty acyl coA reductase [Oryza sativa Indica Group]
Length=496

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/499 (41%), Positives = 310/499 (62%), Gaps = 18/499 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   +V F RG+S LITG TGFLGKVL+EKILR  PDV K+Y+L++A++ E A  R++ E
Sbjct  6     DSGNVVAFFRGRSILITGSTGFLGKVLVEKILRVQPDVKKLYLLVRANDVESATRRVQDE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +   E+F+ LK+ +G  ++ F+  K+  + G++   +LG+D      ++ E+DIIVN AA
Sbjct  66    VTGKEIFQVLKEKHGDGFESFVEEKVCTLAGDIIYENLGLDSAKLTELSNEIDIIVNGAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G I+EKPF +G+
Sbjct  126   TTNFYERYDVAFDSNVLGAKNICEFAKKCTKLKMLLHVSTAYVAGEQEGLILEKPFLMGQ  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++       G       +LN+  E    + A    S+    + MKELGL+RA  FGW +T
Sbjct  186   ALR-----EGRHLDITSELNLIKETRREMKASNRCSEKTEKRTMKELGLKRAKHFGWPNT  240

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ ++RG++PVVI+RPS+I S  KEP PGWMEG R +D +I+ Y K  L+
Sbjct  241   YVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGIRTIDSVIIGYAKQTLS  300

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FLVD N ++DV+P DMVVNA + AMA H  +G+   +IYH+ SS+ NP  +  L+   +
Sbjct  301   FFLVDLNLIMDVIPGDMVVNAMMVAMAAH--SGEQAQTIYHVTSSLRNPAPYAVLSDAGH  358

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLSTK  1698
              +F + P     GK   + RM+ FS++ +  +H+   ++  ++   L  +    G  S +
Sbjct  359   RYFFANP-PPRAGKNGRLRRMRFFSTVASFRAHMAINYKLPLEILRLVNIALC-GMFSRR  416

Query  1699  LENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEER-----WQFGFEVES  1863
              + + RK  +   +L  +Y PYT + G FD+ N +KL   M K+E      + F F+ +S
Sbjct  417   YDELSRK-YKFVMHLVELYAPYTLFKGCFDDINTEKLRITMRKQEDKNDGGYCFDFDPKS  475

Query  1864  IDWKDYISNVHIPGLRRHV  1920
             IDW +Y   VHIPG+ +++
Sbjct  476   IDWDEYFYKVHIPGVVKYL  494



>ref|XP_007020558.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12083.1| Fatty acid reductase 4 [Theobroma cacao]
Length=492

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/493 (41%), Positives = 315/493 (64%), Gaps = 13/493 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +V+FL+GK+ L+TG TGFL K+ +EKILR  P+V+K+Y+L+KA + + A +RL  EII  
Sbjct  8     VVKFLQGKTILVTGATGFLAKIFVEKILRIQPNVNKLYLLLKAADAKSATKRLHSEIIDT  67

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             ELF  L+  +G  +  F+L+K++ V G++   +LG+++    E + KE++I+V+ AA T 
Sbjct  68    ELFTILRDNWGSEFDSFILTKVIAVPGDISSENLGVNESKLREQMLKEIEIVVHVAATTG  127

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             F+E YDVAL INT G   ++ FA +C K+KLFLH STAYV G+  G I+EKPF + +++ 
Sbjct  128   FNESYDVALAINTFGALNVLSFAKKCDKIKLFLHTSTAYVCGEEAGIILEKPFSVDDTLL  187

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
                 ++  +E  +    VE++++ +    Q   +  +  +MKE GL+RA  +GW +TYVF
Sbjct  188   KTCKLDIIEEKRI----VEEKLDEL--RFQHAPNEVIKSEMKEFGLKRAKLYGWPNTYVF  241

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++ N +G++P+VI+RP++I ST+KEPFPGW+EG R +D +I+ YGKG+LT F 
Sbjct  242   TKAMGEMLLGNFKGDLPLVIIRPTMIASTYKEPFPGWIEGVRTIDSVIVSYGKGKLTCFP  301

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
               PN  LDV+PADMVVNA + AM+ H  + +   +IYH++SS+ NPL   D  + ++ +F
Sbjct  302   GYPNSALDVIPADMVVNAMVVAMSVH-TSNQSCQTIYHVSSSLKNPLKLGDFCKFIHCYF  360

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGD--SKGKLSTKLENI  1710
                P+ +  G+ + V ++ + S++     ++W   +    +  L +  S         ++
Sbjct  361   TENPWSNRNGQRVKVRKLTVLSTINGYFLYMWTKYVFPLKVLYLVNILSCQYFRQVYMDL  420

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYI  1884
              RK ++ A  LA  Y+PY F+ G F ++N  KL         +   F F+ +SIDWKDY+
Sbjct  421   NRK-IKFAMRLAEFYKPYAFFKGNFSDTNLDKLRMVAQGRGIDMGVFDFDSKSIDWKDYM  479

Query  1885  SNVHIPGLRRHVM  1923
              N+HIPGL RH +
Sbjct  480   MNIHIPGLLRHAI  492



>gb|ADK66305.1| gland-specific fatty acyl-CoA reductase 1 [Artemisia annua]
Length=493

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/501 (41%), Positives = 312/501 (62%), Gaps = 26/501 (5%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             IV FL  K  LITG TGFL K+ +EKILR  P+V K+Y+L++A +   A++R   E ++ 
Sbjct  7     IVDFLENKVILITGATGFLAKIFVEKILRVQPNVKKLYLLVRAPDATAALQRFNTEAVAK  66

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEM-IAKEVDIIVNSAANTT  816
             +LFK LK+ +G + Q F+  K+ PV G++   DLG+ D + ++ + +++D++VN AA T 
Sbjct  67    DLFKVLKEKHGTNLQKFLSEKVTPVAGDITFEDLGLQDPSLKVEMLRDIDVVVNIAATTN  126

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL +NT G   ++ FA +C  +KL LHVSTAYV+G++ G I+E P  +GES+ 
Sbjct  127   FDERYDVALALNTYGAKYVLNFAKKCANIKLLLHVSTAYVSGEKPGLILETPHYLGESLN  186

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++ ++E  +    V+++++ V S  Q  +D ++   MK+LG+ER+N +GW +TYVF
Sbjct  187   GTSGLDIDEERKI----VQEKLKEVKS-DQNANDNSIKIAMKKLGMERSNHYGWPNTYVF  241

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKA+GEM+I +++G++PVVI+RP+++ ST+KEPFPGW+EG R +D ++L YGKG+LT FL
Sbjct  242   TKALGEMIIGHLKGDMPVVIIRPTIVTSTYKEPFPGWVEGIRTIDSLVLGYGKGKLTCFL  301

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              DP  V DVVPADMVVN  +A++A H A      +IYH+ SSV NP  F  + R  Y +F
Sbjct  302   GDPEAVYDVVPADMVVNTMIASIAAH-ANQTSCETIYHVGSSVSNPFQFTTIQRCGYLYF  360

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW---------RDAIDKSGLTALGDSKGKL  1689
                P+I+  GK + V  +K+ +SM +   ++             ++     A   +   L
Sbjct  361   TEHPWIEKDGKAVIVGEVKVLNSMVSFHRYIALRYLLPLQVLQFVNFISCQAFAGTYKNL  420

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK--EERWQFGFEVES  1863
               K+  + R        L  +Y+PY F    +D+ N +KL   + K  +E   F F+   
Sbjct  421   KRKITFVLR--------LVDLYKPYLFTKCFYDDMNTEKLRIAVRKMGDEENIFYFDPRI  472

Query  1864  IDWKDYISNVHIPGLRRHVMK  1926
             ++W DY   +HIPGLR    K
Sbjct  473   LNWADYFQKIHIPGLRHREFK  493



>gb|AFW65447.1| male sterility protein 2 [Zea mays]
Length=499

 Score =   395 bits (1016),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 209/500 (42%), Positives = 314/500 (63%), Gaps = 27/500 (5%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +VR+ RGKS LITG TGFLGKVL+EKILR  PDV K+++L++A + E A +R++ E+   
Sbjct  11    VVRYFRGKSILITGSTGFLGKVLVEKILRVQPDVKKLFLLVRAADDESAKQRVETEVTGK  70

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             E+F+ LK+ +G  ++ F+  K+ P+ G+V   +LG+       + KE+DI+VN AA T F
Sbjct  71    EIFQVLKEKHGNGFEGFVQEKICPLPGDVMHENLGLGAAKLRQVCKEIDIVVNGAATTNF  130

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
              ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G ++EKPF +GE++  
Sbjct  131   YERYDVAFDTNVMGAKHICEFAKRCSKLKMLLHVSTAYVAGEQEGVVLEKPFRLGETL--  188

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-----SDGAMAQKMKELGLERANKFGWQD  1164
                    +E +   L++E E+ ++   ++ L     S+ A  + MKELGL+RA +FGW +
Sbjct  189   -------REGT--HLDIESELNLIKETRRELKASRCSEKAERRSMKELGLKRAREFGWPN  239

Query  1165  TYVFTKAMGEMMID-NMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             TYVFTKAMGEM++  ++RG++PVVIVRPS+I S  KEP PGWMEG R +D  I+ Y K  
Sbjct  240   TYVFTKAMGEMLLGAHLRGDVPVVIVRPSIITSILKEPLPGWMEGIRTIDSFIIGYAKQA  299

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
             L+ FLVD + ++DV+P DMVVNA + AMA H       TSIYH+ SSV +P  +  LA  
Sbjct  300   LSIFLVDLDLIMDVIPGDMVVNAMMVAMAAHSEERGQQTSIYHLTSSVRHPAPYAVLAEC  359

Query  1522  LYEHFQSKPYIDSKGK---PIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKG  1683
                +F   P + S GK   P+   RM+ F ++    +++   +R  ++   L  +    G
Sbjct  360   GRRYFLHNP-LRSGGKNSEPVRPSRMRFFRTLPGFRAYMAIKFRLPLEILRLLNIVLC-G  417

Query  1684  KLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMS-KEERWQFGFEVE  1860
              LS + + + RK      ++A +Y PY+ + G FD+SN ++L   M+ +   + FGF+  
Sbjct  418   ALSRRHDELSRK-YRYVMHIAELYAPYSLFKGCFDDSNTERLRAAMANRSSGYDFGFDPL  476

Query  1861  SIDWKDYISNVHIPGLRRHV  1920
              +DW DY   VHIPG+ +++
Sbjct  477   CVDWDDYFYRVHIPGVVKYL  496



>ref|XP_008462137.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Cucumis 
melo]
Length=492

 Score =   395 bits (1015),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 205/505 (41%), Positives = 318/505 (63%), Gaps = 32/505 (6%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              +++FL+ KS  +TG TGFL KV++EKILR  P+V KIY+LI+A +++ A +RL  ++I 
Sbjct  5     SVLQFLQNKSIFVTGATGFLAKVMVEKILRVQPNVKKIYLLIRAADEKAATQRLNTDVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA--EMIAKEVDIIVNSAAN  810
              ELF+ LK+ +G++++  +  KLV V G++ +  L + +++   E +  ++D+IV+ AA 
Sbjct  65    KELFRILKEKWGENFRTMISEKLVAVAGDISDELLVLKEYSQLREELYDQIDVIVHLAAT  124

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T FDERYD+AL +NT G   ++ FA  C KLK FLHVSTAYV G ++G I+E  + +G++
Sbjct  125   TNFDERYDIALHVNTLGAKHVINFAKNCVKLKAFLHVSTAYVCGVKEGLILESQYNMGDT  184

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMV------LSAKQGLSDGAMAQKMKELGLERANKF  1152
             + G+             L +EDE+ +V      L AK G +  ++   MKE+GLER+  +
Sbjct  185   LNGKC-----------GLQIEDELNLVDYKISDLRAK-GATQQSITLTMKEMGLERSQNY  232

Query  1153  GWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYG  1332
             GW +TYVFTKAMGEM+I  ++ NIPVVI+RP+++ ST+KEPFPGW+EG R +D + + YG
Sbjct  233   GWTNTYVFTKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYG  292

Query  1333  KGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFDD  1509
             KG++T FL D N ++DV+PADMVVNA L AM  H  A +P + +IYH++SS+ NP+++  
Sbjct  293   KGKITCFLGDVNALVDVIPADMVVNAMLVAMVAH--ASQPSSYAIYHVSSSMRNPVMYGK  350

Query  1510  LARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGK  1686
             L    + +F + P+I+  G+P+ V ++ +   M +   ++  R  +   GL  L  +   
Sbjct  351   LQEYGFHYFSANPWINKDGQPVRVGKVTILKDMASFHRYMTIRYLVFLKGLEVLNIA---  407

Query  1687  LSTKLENICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGF  1851
             L    + I      + KY   L  +Y PY F+ G FD+ N +KL         E   F F
Sbjct  408   LCHYFDGILFNFNRKIKYVLRLVDLYGPYLFFKGVFDDINTEKLRTAAKDNGIETDLFYF  467

Query  1852  EVESIDWKDYISNVHIPGLRRHVMK  1926
             + +SI+W DY  N+HIPG+ R+V +
Sbjct  468   DPKSINWDDYFMNIHIPGVVRYVFR  492



>ref|XP_006664917.1| PREDICTED: fatty acyl-CoA reductase 1-like [Oryza brachyantha]
Length=493

 Score =   395 bits (1015),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 211/500 (42%), Positives = 311/500 (62%), Gaps = 19/500 (4%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   IV F RG+S LITG TGFLGKVLIEKILR  PDV ++Y++++A +   A  R++ E
Sbjct  2     DSESIVNFFRGRSILITGSTGFLGKVLIEKILRVQPDVKRLYLVVRATDIGSATRRVENE  61

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +I  ++F+ LK+ +G  ++ F+  K+ P+ G++   +LG+D      ++KE+DI+VNSAA
Sbjct  62    VIGTDIFQILKEQHGSGFKSFVEEKVCPLAGDIIYENLGLDADKLTELSKEIDIVVNSAA  121

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G I+EKPF + E
Sbjct  122   TTNFYERYDVAFDSNVMGAKNICEFAKKCTKLKMLLHVSTAYVAGEQEGLILEKPFLMNE  181

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++      NG       +LN+  E ++ + AK   S     + MK LGLERA  FGW +T
Sbjct  182   ALR-----NGPHLDITSELNLIKETKIDMRAK-CCSMKTEKRTMKNLGLERARHFGWPNT  235

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ ++ G++PVVI+RPS+I S  KEP PGW EG R +D +I+ Y K  L 
Sbjct  236   YVFTKAMGEMLLGHLCGDLPVVIIRPSIITSILKEPLPGWTEGIRTIDSVIIGYAKQALP  295

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FLVD + ++DV+P DMVVNA + AMA H  +G+P  +IYH+ SS+ NP  +  L+   +
Sbjct  296   FFLVDLDLIMDVIPGDMVVNAMMVAMAVH--SGQPAQTIYHVTSSLRNPAPYAVLSDTGH  353

Query  1528  EHFQSKPYIDSK-GKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLST  1695
              +F + P    K G+   + RM+ FS++ +  +H+   +R  ++      +    G LS 
Sbjct  354   RYFLANPPCMGKNGEHARLRRMRFFSTVASFRAHMVINYRLPLEILRWVNIALC-GMLSR  412

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEER-----WQFGFEVE  1860
             + E + RK      +L  +Y PYT + G FD+ N QKL   M K E      + F F+ +
Sbjct  413   RYEEMSRK-YRFIMHLVELYAPYTLFKGCFDDINTQKLRVAMKKHEEKTDGGYYFDFDPK  471

Query  1861  SIDWKDYISNVHIPGLRRHV  1920
             SIDW++Y   VHIPG+ +++
Sbjct  472   SIDWEEYFYKVHIPGVVKYL  491



>gb|EYU21147.1| hypothetical protein MIMGU_mgv1a019387mg, partial [Erythranthe 
guttata]
Length=481

 Score =   394 bits (1013),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 298/452 (66%), Gaps = 22/452 (5%)
 Frame = +1

Query  424   SSYVEKHEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEV  603
             +SY  + + G+GI+ F +GK+  ITGGTG LGK L+EK+LR  P V KIYIL+KAD+ E 
Sbjct  38    TSYDLQGKGGVGIINFFQGKNIFITGGTGLLGKALVEKLLRLTP-VGKIYILVKADDHET  96

Query  604   AMERLKKEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEV  783
             A++R+ KE+I++ELFK L++ +GK YQ FM   LVPV+GN+ E +LG+D  +A  I K+V
Sbjct  97    AIDRITKELINSELFKCLQEKHGKYYQEFMAKNLVPVIGNITEPNLGMDPDSAHAIMKDV  156

Query  784   DIIVNSAANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKII  963
             ++I+ SAANT  +ERYDV+L  N  GP R+M FA  C  L+L +++STAYVNG+R+G  +
Sbjct  157   NVIIESAANTNINERYDVSLKTNVNGPQRIMSFAKACKSLELLVYISTAYVNGEREGIFL  216

Query  964   EKPFCIGESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAM--AQKMKELGLE  1137
             E P  +GE+            S  P+++V DE+   L+++ G +       + M++LG+E
Sbjct  217   ENPLTMGEN-------RRKDPSPFPRVDVSDEVN--LASRSGTTSTGFDGNKYMRKLGME  267

Query  1138  RANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPI  1317
             RAN +GW +TY  TKAMGEM+I+  RG++PVVI+RP++IES +K P PGW++GNR+ DP+
Sbjct  268   RANFYGWHNTYQITKAMGEMVINKTRGDMPVVIIRPTIIESCYKGPVPGWIQGNRVFDPL  327

Query  1318  ILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPL  1497
             I  +GKGQL  FL  P+  +D++P DMVVNAT+AAMAKHG    P  +IY IA+SV+NP+
Sbjct  328   ICSFGKGQLPAFLCKPDTPIDIIPLDMVVNATIAAMAKHGYKHMPELNIYQIATSVLNPV  387

Query  1498  VFDDLARLLYEHFQSKPYIDSKGKPI-----DVPRMKLFSSMEALSSHLWRDAIDKSGLT  1662
                D+     E+F+S+P I+S+         ++  +K F + + LS +  RD I +    
Sbjct  388   RISDMFDYTCEYFRSRPLIESESSSRISYYDNLAPVKYFDNFDDLSKYT-RDEIYRR---  443

Query  1663  ALGDSKGKLSTKLENICRKSVEQAKYLASIYE  1758
               G  +   + KL+  C+  +  A+ L  IYE
Sbjct  444   -FGSMRNVEAHKLQKQCKAKIMYAENLCKIYE  474



>ref|XP_009789793.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana sylvestris]
Length=490

 Score =   394 bits (1011),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/495 (41%), Positives = 315/495 (64%), Gaps = 17/495 (3%)
 Frame = +1

Query  463   VRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAE  642
             V+FL  ++ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + + A++R   E ++ +
Sbjct  6     VKFLENRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDNKAALQRFNTEAVAKD  65

Query  643   LFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANTTF  819
             LFK L++ YG +   F+  K   + G++    LG+ D +  E + +EVD+IVN AA T F
Sbjct  66    LFKLLREKYGANLNTFISEKATIIAGDITCEKLGVKDPNLVEEMWREVDVIVNIAATTNF  125

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
             DERYDVALD+NT G   ++ FA +C KLK+ LHVSTA+V+G++ G I+E P+ +GE++ G
Sbjct  126   DERYDVALDLNTFGAIFVLDFAKKCSKLKVLLHVSTAFVSGEKAGLILETPYNLGETLNG  185

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVFT  1179
              S ++ + E+ V    +E+ ++ + +  +G S+ ++   MKELGLERA K+GW +TYVFT
Sbjct  186   TSGLDIDTENKV----MEETLKQLKA--EGSSEQSITSAMKELGLERARKYGWPNTYVFT  239

Query  1180  KAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFLV  1359
             KAMGEM++ N++ +IP+VI+RP++I ST +EPFPGW+EG R +D + + YGKG+LT FL 
Sbjct  240   KAMGEMLLGNLKEDIPLVILRPTIITSTFQEPFPGWVEGIRTIDSLAVGYGKGRLTCFLG  299

Query  1360  DPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHFQ  1539
             DP  V+DV+PADMVVNA + +M  H A  +    IY + SSV NP+ F  L      +F+
Sbjct  300   DPKAVIDVIPADMVVNAMIVSMMAH-ANERGSQIIYQVGSSVSNPIDFISLQDYGLRYFR  358

Query  1540  SKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENIC--  1713
             + P+I+  GKP+ V ++ + S+M++   ++    +    L  L      L    +  C  
Sbjct  359   ANPWINKDGKPVIVGKVTVLSTMDSFHRYMALHYL--LPLKVLEIVNTTLCQYFQGKCLE  416

Query  1714  -RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE---ERWQFGFEVESIDWKDY  1881
               + +     L  +Y PY F+ G FD+ N +KL    +KE   E     F+ +SI+W+DY
Sbjct  417   LHRKINFVMRLIDLYGPYLFFKGIFDDMNTEKLRR-EAKEAGIEMDVINFDPKSINWEDY  475

Query  1882  ISNVHIPGLRRHVMK  1926
               N H+PG+ ++V K
Sbjct  476   FMNTHVPGVVKYVFK  490



>ref|XP_004139568.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 3-like 
[Cucumis sativus]
Length=492

 Score =   394 bits (1011),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 201/503 (40%), Positives = 318/503 (63%), Gaps = 28/503 (6%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              +++FL  KS  +TG TGFL KV++EKILR  P+V K+Y+LI+A +++ A +RL  ++I 
Sbjct  5     SVLQFLHNKSIFVTGATGFLAKVMVEKILRVQPNVKKLYLLIRAADEKAATQRLNTDVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA--EMIAKEVDIIVNSAAN  810
              ELF+ LK+ +G++++  +  KLV V G++ +  L + +++   E +  ++D+IVN AA 
Sbjct  65    KELFRILKEKWGENFRSMISEKLVAVAGDISDELLVLKEYSKLREELYDQIDVIVNLAAT  124

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T FDERYDVAL +NT G   ++ FA  C K K F+HVSTAYV+G ++G I+E P+ +G++
Sbjct  125   TNFDERYDVALHVNTLGAKHVINFAKNCVKXKAFVHVSTAYVSGVKEGLILESPYVMGDT  184

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMV---LS--AKQGLSDGAMAQKMKELGLERANKFG  1155
             + G+             L +EDE+++V   LS    +G +  ++   MK+LG++R+  +G
Sbjct  185   LNGKC-----------GLQIEDELKLVDHKLSDLRAEGATQQSITLTMKDLGIQRSQNYG  233

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             W +TYVFTKAMGEM+I  ++ NIPVVI+RP+++ ST+KEPFPGW+EG R +D + + YGK
Sbjct  234   WTNTYVFTKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGK  293

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLA  1515
             G++T FL D N ++DV+PADMVVNA L AM  H A+     +IYH++SS+ NP+++  L 
Sbjct  294   GKITCFLGDVNALVDVIPADMVVNAMLVAMVAH-ASQLSSYTIYHVSSSMRNPIMYRKLQ  352

Query  1516  RLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLS  1692
                + +F + P+I+  G+P+ V ++ + + M +   ++  R  +   GL  L  +   L 
Sbjct  353   EYGFHYFSANPWINKDGQPVKVGKVTILNDMASFHRYMTIRYLVFLKGLEVLNIA---LC  409

Query  1693  TKLENICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEV  1857
                + I      + KY   L  +Y PY F+ G FD+ N +KL         E   F F+ 
Sbjct  410   HYFDGILFNFNRKIKYVLRLVDLYGPYLFFKGVFDDINTEKLRIAAKANGIETDLFYFDP  469

Query  1858  ESIDWKDYISNVHIPGLRRHVMK  1926
             +SI+W DY  N+HIPG+ R+V +
Sbjct  470   KSINWDDYFMNIHIPGVVRYVFR  492



>ref|NP_001151388.1| male sterility protein 2 [Zea mays]
 gb|ACG42654.1| male sterility protein 2 [Zea mays]
Length=499

 Score =   393 bits (1010),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 208/500 (42%), Positives = 313/500 (63%), Gaps = 27/500 (5%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +VR+ RGKS LITG TGFLGKVL+EKILR  PDV K+++L++A + E A +R++ E+   
Sbjct  11    VVRYFRGKSILITGSTGFLGKVLVEKILRVQPDVKKLFLLVRAADDESAKQRVETEVTGK  70

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             E+F+ LK+ +G  ++ F+  K+ P+ G+V   +LG+       + KE+DI+VN AA T F
Sbjct  71    EIFQVLKEKHGNGFEGFVQEKICPLPGDVMHENLGLGPAKLRQVCKEIDIVVNGAATTNF  130

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
              ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G ++EKPF +GE++  
Sbjct  131   YERYDVAFDTNVMGAKHICEFAKRCSKLKMLLHVSTAYVAGEQEGVVLEKPFRLGETL--  188

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-----SDGAMAQKMKELGLERANKFGWQD  1164
                    +E +   L++E E+ ++   ++ L     S+ A  + MKELGL+RA +FGW +
Sbjct  189   -------REGT--HLDIESELNLIKETRRELKASRCSEKAERRSMKELGLKRAREFGWPN  239

Query  1165  TYVFTKAMGEMMID-NMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             TYVFTKAMGEM++  ++RG++PVVIVRPS+I S  KEP PGWMEG R +D  I+ Y K  
Sbjct  240   TYVFTKAMGEMLLGAHLRGDVPVVIVRPSIITSILKEPLPGWMEGIRTIDSFIIGYAKQA  299

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
             L+ FLVD + ++DV+P DMVVNA + AMA H       TSIYH+ SSV +P  +  LA  
Sbjct  300   LSIFLVDLDLIMDVIPGDMVVNAMMVAMAAHSEERGQQTSIYHLTSSVRHPAPYAVLAEC  359

Query  1522  LYEHFQSKPYIDSKGK---PIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKG  1683
                +F   P + S GK   P+   RM+ F ++    +++   +R  ++   L  +    G
Sbjct  360   GRRYFLHNP-LRSGGKNSEPVRPSRMRFFRTLPGFRAYMAIKFRLPLEILRLLNIVLC-G  417

Query  1684  KLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMS-KEERWQFGFEVE  1860
              LS + + + RK      ++A +Y PY+ + G FD+SN ++L   M+ +   +  GF+  
Sbjct  418   ALSRRHDELSRK-YRYVMHIAELYAPYSLFKGCFDDSNTERLRAAMANRSSGYDLGFDPM  476

Query  1861  SIDWKDYISNVHIPGLRRHV  1920
              +DW DY   VHIPG+ +++
Sbjct  477   CVDWDDYFYRVHIPGVVKYL  496



>ref|XP_002529056.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF33300.1| Male sterility protein, putative [Ricinus communis]
Length=493

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 203/501 (41%), Positives = 312/501 (62%), Gaps = 24/501 (5%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              ++ FL  K+ L+TG TG+L KV +EK+LR  P+V K+Y+L++A +   AMERL KE+I 
Sbjct  5     SVIEFLDNKTILVTGATGYLAKVFVEKVLRVQPNVKKLYLLLRAADANSAMERLNKEVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA--EMIAKEVDIIVNSAAN  810
              +LFK L++ YG S   F+  K+ P+ G++   DLGI D     EM+ K++D+++N AA 
Sbjct  65    KDLFKVLRERYGASLNSFVSEKMTPIPGDISREDLGIKDSNLRNEML-KDIDVVINFAAT  123

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T FDERYDVAL INT G   ++ FA +C K+++ +HVSTAYV G+  G I+EKPF +GE 
Sbjct  124   TNFDERYDVALGINTLGALHVLNFAKKCLKIRMLVHVSTAYVCGEDTGLILEKPFPMGEG  183

Query  991   IAGESVVNGNQESSV--PKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
               G S ++  +E  +   KLN   E+E      +  S+  +   MK+ G+ERA   GW +
Sbjct  184   KKGNSKIDIEEEKKLVQEKLN---ELE-----SENASEKEITAIMKDFGIERARALGWPN  235

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAM EM++ +M+ N+P++I+RP++I ST+K+PFPGW+EG R +D +I+ YGK ++
Sbjct  236   TYVFTKAMAEMLLVHMKENLPLLIIRPTMITSTYKQPFPGWIEGVRTIDSVIVGYGKRKI  295

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
             T F+  P  +LDV+PADMVVN  + AMA      +    IY I SS+ NPL F ++    
Sbjct  296   TCFVSSPRSILDVIPADMVVNGIIVAMATR-YQKQSSEIIYQIGSSLRNPLKFSNIHDFA  354

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLE  1704
             Y +F + P+ID +G P+ + +  + SSM   S H++     +  L A   +   +  + +
Sbjct  355   YRYFSANPWIDKEGSPVKIGKGIVLSSMT--SFHMYMAVCFQLPLKAFELATTLVLKEYQ  412

Query  1705  NICR---KSVEQAKYLASIYEPYTFYGGRFDNSNAQKL-----MECMSKEERWQFGFEVE  1860
             +  R   + V+  + L  +Y+ Y F+ G FD++N +KL     +  +  EE  +F F+  
Sbjct  413   DKYRLLDRKVKLVQRLVDLYKSYLFFEGIFDDTNLEKLRTEARLRSLEVEEMDEFNFDPT  472

Query  1861  SIDWKDYISNVHIPGLRRHVM  1923
             +IDW+DY+  VHIPGL ++ M
Sbjct  473   NIDWEDYMMGVHIPGLVKYTM  493



>ref|XP_003596783.1| Fatty acyl-CoA reductase [Medicago truncatula]
 gb|AES67034.1| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   393 bits (1009),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 200/495 (40%), Positives = 313/495 (63%), Gaps = 16/495 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL GK+ L+ G TGFL K+ +EK+LR  P+V K+++L++A + + A  RL+ EI++ 
Sbjct  8     ILNFLEGKTILVIGATGFLAKIFLEKVLRVQPNVKKLFLLLRASDDKSAASRLQNEILAK  67

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF  L +  G +++ F+  KL  V G++   DLG+ D    E I+ + D+I+N AA T 
Sbjct  68    DLFNLLNEKMGTNFKSFISEKLTVVPGDITFEDLGLKDSILREDISSQTDVIINLAATTN  127

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+ALD+NT G   +M FA QC +LK+ +HVSTAYV G++ G I+E P+ +G+S+ 
Sbjct  128   FDERYDIALDLNTFGVKHIMSFAKQCIRLKVLVHVSTAYVCGEKSGLILESPYLLGDSLN  187

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G + ++ N E    KL  E   E+    ++G ++  +   MK+LG+ RAN +GW +TYVF
Sbjct  188   GVAGLDINAEK---KLVTEKLGEL---QEKGATEHEIKVAMKDLGITRANVYGWPNTYVF  241

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKA+GEM+++ ++GN+ VVI+RP+++ ST +EPFPGW+EG R +D + + YGKG+LT FL
Sbjct  242   TKALGEMLVEKLKGNLSVVILRPAIVTSTLREPFPGWVEGLRTIDSLAVVYGKGKLTCFL  301

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D NGV+D +PADMVVNA L AM  H  A +P   +YH+ SSV NPL +        ++F
Sbjct  302   GDINGVVDAIPADMVVNAMLVAMVAH--ANQPRDGVYHVGSSVRNPLRYQSFHDYGLKYF  359

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKL--STKLEN  1707
             ++KP+I+  G  + V +M + ++M +   +++ R  +   GL  +  +  +    T LE 
Sbjct  360   KAKPWINKDGTVVKVGKMTILTNMASFQRYIFIRYLLPLKGLKLVNTALCQYFQGTYLE-  418

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC--MSKEERWQFGFEVESIDWKDY  1881
                + ++    L  +Y PY F+ G FD+ N +KL      S  E   F F+ + +DW+DY
Sbjct  419   -LNRKIQVVMRLVELYRPYLFFKGIFDDLNTEKLRMSARQSGTEIDLFYFDPKEMDWEDY  477

Query  1882  ISNVHIPGLRRHVMK  1926
               N H+PGL +++ K
Sbjct  478   FMNTHLPGLVKYIFK  492



>ref|XP_009631058.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=491

 Score =   392 bits (1007),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 203/502 (40%), Positives = 320/502 (64%), Gaps = 29/502 (6%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +++FL  ++ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + + A++R   E ++ 
Sbjct  6     VLKFLENRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDNKAALQRFNTEAVAK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANTT  816
             +LFK L++ YG +   F+  K   + G++   +LG+ D +  + + +EVD+IVN AA T 
Sbjct  66    DLFKLLREKYGANLNTFISEKATIIPGDITCENLGVKDPNLVQQMWREVDVIVNIAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVALD+NT G   ++ FA +C KLK+ LHVSTA+V+G++ G I+E P+ +GE++ 
Sbjct  126   FDERYDVALDLNTFGAIFVVDFAKKCSKLKVLLHVSTAFVSGEKAGLILETPYNMGETLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++ ++E  V    +E+ ++ + +  +G S+ ++   MKELG+ERA K+GW +TYVF
Sbjct  186   GTSGLDIDKEKKV----MEETLKQLKA--EGSSENSITSAMKELGIERARKYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++ N++ +IP+VI+RP++I ST +EPFPGW+EG R +D + + YGKG+LT FL
Sbjct  240   TKAMGEMLLGNLKEDIPLVILRPTIITSTFQEPFPGWVEGIRTIDSLAVGYGKGKLTCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              DP  V+DV+PADMVVNA + +M  H A  +    IY + SSV NP+ F  L      +F
Sbjct  300   GDPKAVIDVIPADMVVNAMIVSMMAH-ADERGSQIIYQVGSSVSNPIDFTSLQDYGLRYF  358

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSME------ALSSHLWRDAIDKSGLTALGDSKGK---L  1689
             +  P+I+  GKP+ V ++ + S+M+      AL   L    ++    T     +GK   L
Sbjct  359   RENPWINKDGKPVIVGKVTVLSTMDSFHRYMALHYLLPLKVLEIVNTTLCQYFQGKYLEL  418

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ---FGFEVE  1860
               K+  + R        L  +Y PY F+ G FD+ N +KL    +KE   +   F F+ +
Sbjct  419   HRKINFVMR--------LIDLYGPYLFFKGIFDDMNTEKLRRA-AKEAGIEIDVFNFDPK  469

Query  1861  SIDWKDYISNVHIPGLRRHVMK  1926
             SI+W+DY  + H+PG+ ++V K
Sbjct  470   SINWEDYFMDTHVPGVVKYVFK  491



>dbj|BAK04658.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   392 bits (1007),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 207/502 (41%), Positives = 314/502 (63%), Gaps = 30/502 (6%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +V + RGKS LITG TGFLGKVL+EKILR  PDV K+++L++A + E A  R++ E+I  
Sbjct  6     VVGYFRGKSILITGSTGFLGKVLVEKILRVQPDVKKLFLLVRARHVESAKLRVQTEVIGR  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             E+F  LK+ +   +   M  K+ P+ G++   + G+D      + K++DIIVN AA T F
Sbjct  66    EIFLVLKEKHSMGFDDLMEEKICPLAGDIMYENFGLDTANLRELYKDIDIIVNIAATTNF  125

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
              ERYDVA D N  G   +  FA +C KLK+ LHVSTAYV G+++G I+EKPF +GE++  
Sbjct  126   SERYDVAFDANVLGAKHVCAFAKKCTKLKMLLHVSTAYVAGEQEGLILEKPFLMGETL--  183

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGL-----SDGAMAQKMKELGLERANKFGWQD  1164
                    +E +   L++E E+ ++   ++ L     S+ A  + MKELGL+RA +FGW +
Sbjct  184   -------REGT--HLDIESELNLIRETRRELKANCSSEKAERRTMKELGLKRAREFGWPN  234

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEM++ ++RG +PVVIVRPS+I S  KEP PGWMEG R +D +++ Y K  L
Sbjct  235   TYVFTKAMGEMLLGHLRGELPVVIVRPSIITSILKEPLPGWMEGIRTIDAVVIGYAKQTL  294

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
               FLVD + ++DV+P DMVVNA + AMA H  + +P  +IYH+ SS+ NP  +  LA   
Sbjct  295   PFFLVDLSLIMDVIPGDMVVNAMMVAMAAH--SEEPAQTIYHVTSSLRNPAPYAILAETG  352

Query  1525  YEHF-QSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLS  1692
             + +F  + P I  KG+P+ + +M+ FS++  LS ++   +R  ++   L  +    G  S
Sbjct  353   HRYFYDNPPRIGRKGEPVRLNKMRFFSTVARLSLYMAVRYRLPLEMLRLVNIALC-GVFS  411

Query  1693  TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE------ERWQFGFE  1854
              + +++ RK     + L  +Y PY+ + G FD+ N ++L   + K+      E + F F+
Sbjct  412   RRYDDLSRKYRFIVQ-LIELYAPYSLFKGCFDDMNTERLRMAIKKKKDDNGAEEYYFDFD  470

Query  1855  VESIDWKDYISNVHIPGLRRHV  1920
              +SIDW +Y   VHIPG+ +++
Sbjct  471   PKSIDWDNYFYGVHIPGVLKYM  492



>dbj|BAD31814.1| putative fatty acyl coA reductase [Oryza sativa Japonica Group]
 dbj|BAD31294.1| putative fatty acyl coA reductase [Oryza sativa Japonica Group]
Length=516

 Score =   392 bits (1008),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 209/518 (40%), Positives = 312/518 (60%), Gaps = 36/518 (7%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   +V F RG+S LITG TGFLGKVL+EKILR  PDV K+Y+L++A++ E A  R++ E
Sbjct  6     DSGNVVAFFRGRSILITGSTGFLGKVLVEKILRVQPDVKKLYLLVRANDVESATRRVQDE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +   E+F+ LK+ +G  ++ F+  K+  + G++   +LG+D      ++ E+DIIVN AA
Sbjct  66    VTGKEIFQVLKEKHGDGFESFVEEKVCTLAGDIIYENLGLDSAKLTELSNEIDIIVNGAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G I+EKPF +G+
Sbjct  126   TTNFYERYDVAFDSNVLGAKNICEFAKKCTKLKMLLHVSTAYVAGEQEGLILEKPFLMGQ  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
             ++       G       +LN+  E    + A    S+    + MKELGL+RA  FGW +T
Sbjct  186   ALR-----EGRHLDITSELNLIKETRREMKASNRCSEKTEKRTMKELGLKRAKHFGWPNT  240

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ ++RG++PVVI+RPS+I S  KEP PGWMEG R +D +I+ Y K  L+
Sbjct  241   YVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGIRTIDSVIIGYAKQTLS  300

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FLVD N ++DV+P DMVVNA + AMA H  +G+   +IYH+ SS+ NP  +  L+   +
Sbjct  301   FFLVDLNLIMDVIPGDMVVNAMMVAMAAH--SGEQAQTIYHVTSSLSNPAPYAVLSDAGH  358

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-----------------WRDA-IDKS  1653
              +F + P     GK   + RM+ FS++ +  +H+                 + D+ + + 
Sbjct  359   RYFFANP-PPRAGKNGRLRRMRFFSTVASFRAHMAINYKLPLEDYQIKQVAYTDSFVKRD  417

Query  1654  GLTALGDSK----GKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECM  1821
             G+  L        G  S + + + RK  +   +L  +Y PYT + G FD+ N +KL   M
Sbjct  418   GVQILRLVNIALCGMFSRRYDELSRK-YKFVMHLVELYAPYTLFKGCFDDINTEKLRITM  476

Query  1822  SKEER-----WQFGFEVESIDWKDYISNVHIPGLRRHV  1920
              K+E      + F F+ +SIDW +Y   VHIPG+ +++
Sbjct  477   RKQEDKNDGGYCFDFDPKSIDWDEYFYKVHIPGVVKYL  514



>ref|XP_008462145.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Cucumis 
melo]
Length=488

 Score =   392 bits (1006),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 204/500 (41%), Positives = 315/500 (63%), Gaps = 32/500 (6%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +++FL+ KS  +TG TGFL KV++EKILR  P+V KIY+LI+A +++ A +RL  ++I  
Sbjct  6     VLQFLQNKSIFVTGATGFLAKVMVEKILRVQPNVKKIYLLIRAADEKAATQRLNTDVIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA--EMIAKEVDIIVNSAANT  813
             ELF+ LK+ +G++++  +  KLV V G++ +  L + +++   E +  ++D+IV+ AA T
Sbjct  66    ELFRILKEKWGENFRTMISEKLVAVAGDISDELLVLKEYSQLREELYDQIDVIVHLAATT  125

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYD+AL +NT G   ++ FA  C KLK FLHVSTAYV G ++G I+E  + +G+++
Sbjct  126   NFDERYDIALHVNTLGAKHVINFAKNCVKLKAFLHVSTAYVCGVKEGLILESQYNMGDTL  185

Query  994   AGESVVNGNQESSVPKLNVEDEMEMV------LSAKQGLSDGAMAQKMKELGLERANKFG  1155
              G+             L +EDE+ +V      L AK G +  ++   MKE+GLER+  +G
Sbjct  186   NGKC-----------GLQIEDELNLVDYKISDLRAK-GATQQSITLTMKEMGLERSQNYG  233

Query  1156  WQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGK  1335
             W +TYVFTKAMGEM+I  ++ NIPVVI+RP+++ ST+KEPFPGW+EG R +D + + YGK
Sbjct  234   WTNTYVFTKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGK  293

Query  1336  GQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFDDL  1512
             G++T FL D N ++DV+PADMVVNA L AM  H  A +P + +IYH++SS+ NP+++  L
Sbjct  294   GKITCFLGDVNALVDVIPADMVVNAMLVAMVAH--ASQPSSYAIYHVSSSMRNPVMYGKL  351

Query  1513  ARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKL  1689
                 + +F + P+I+  G+P+ V ++ +   M +   ++  R  +   GL  L  +   L
Sbjct  352   QEYGFHYFSANPWINKDGQPVRVGKVTILKDMASFHRYMTIRYLVFLKGLEVLNIA---L  408

Query  1690  STKLENICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFE  1854
                 + I      + KY   L  +Y PY F+ G FD+ N +KL         E   F F+
Sbjct  409   CHYFDGILFNFNRKIKYVLRLVDLYGPYLFFKGVFDDINTEKLRTAAKDNGIETDLFYFD  468

Query  1855  VESIDWKDYISNVHIPGLRR  1914
              +SI+W DY  N+HIPG+ R
Sbjct  469   PKSINWDDYFMNIHIPGVVR  488



>ref|XP_003538130.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Glycine 
max]
Length=492

 Score =   392 bits (1006),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/499 (40%), Positives = 310/499 (62%), Gaps = 20/499 (4%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I  FL+ K+ L+ G TGFL K+ +EK+LR  P+V K+Y+L++A + E A +RL  EI+ 
Sbjct  5     SITDFLQNKNILVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESASQRLHNEIMR  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANT  813
              +LF+ LK+  G  +  F+  KL  V G++ + DL + D    E I  ++  IVN AA T
Sbjct  65    KDLFRLLKENVGAKFNAFVSEKLTLVPGDISQEDLNLKDPILREEIYNQIHCIVNFAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA  C KLK+ +HVSTAYV G+R G I+E P  +G S+
Sbjct  125   NFDERYDVALGINTFGVKHVLNFAKSCIKLKVLVHVSTAYVCGERGGLIVEDPCQLGVSL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G   ++   E  V    VED+M  +   ++G ++  +   MK+LG++RA  +GW +TYV
Sbjct  185   NGVPGLDIGMEKRV----VEDKMNQL--HEEGATEEDVKMAMKDLGMKRATLYGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM+++ ++ N+ V+IVRP++I ST+KEPFPGW+EG R +D +I+ YGKG+L  F
Sbjct  239   FTKAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGKLPCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLYE  1530
             L+D N + DV+PADMVVNA +  +  H  A +P  + IY + SS+ NP+ + +L   +Y 
Sbjct  299   LLDINAIFDVIPADMVVNAIITTLVAH--ANQPCDNIIYQVGSSIANPIRYHNLKDYIYR  356

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F++KP+++ +G P+ V ++ +  +M +   +++ R  +   GL     +        + 
Sbjct  357   YFKAKPWVNKEGNPVMVGKVTVLDTMTSFQRYMFIRYLLPLKGLEL---ANVAFCQYFQG  413

Query  1708  IC---RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK---EERWQFGFEVESID  1869
             +C   R+ +     L  +Y+PY F+ G FDN N +KL   + +   E  + F F+ + ID
Sbjct  414   MCLDIRRKIHIVMQLVDLYKPYVFFKGVFDNMNTEKLQTAVRQGEVEMEYSFYFDPKMID  473

Query  1870  WKDYISNVHIPGLRRHVMK  1926
             W+DY  N+HIPG+ ++V K
Sbjct  474   WEDYFMNIHIPGIVKYVFK  492



>ref|XP_004506152.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=490

 Score =   391 bits (1005),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 206/493 (42%), Positives = 305/493 (62%), Gaps = 12/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I  FLR K+ L+ G TGFL K+ IEKILR  P+V K+Y+L++A + E A +RL  EI+  
Sbjct  6     ITDFLRDKNILVLGATGFLAKIFIEKILRVQPNVKKLYLLMRATDTESATKRLNNEILRK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANTT  816
             +LFK LK+  G  +  F+L KL  V G++ + D  + D +  + I  + D+IVN AA T 
Sbjct  66    DLFKLLKENLGAKFNSFVLEKLSVVPGDISQEDFNLKDSNLLKEICDQTDVIVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL +NT G   ++ FA +C  L++ +HVSTAYV G+R G IIE P  +G S+ 
Sbjct  126   FDERYDVALGLNTFGVKHVINFAKKCINLRVLVHVSTAYVCGERGGLIIEDPIQLGASLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G   ++ ++E  V    VE++M  +   ++G ++  +   MK+LG+ERAN +GW +TYVF
Sbjct  186   GVKGLDIDEEKKV----VEEKMNKL--RQEGATEEDIKIAMKDLGIERANLYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM+I+ M+  + + IVRP++I ST+KEPFPGW+EG R +D II+ YGKG+LT FL
Sbjct  240   TKAMGEMLIETMKETLSIFIVRPTMITSTYKEPFPGWVEGIRTIDSIIVAYGKGKLTCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              +   V DV+PAD VVNA +  M  H  A +P  SIY + SS+ NP+ + +L    + +F
Sbjct  300   ANVKAVFDVIPADFVVNAMVVGMVSH--ANQPRDSIYQLGSSIANPITYQNLHEYGFRYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENIC  1713
              +KP ID +G PI V  + +  +M A   +++ R  +   GL  +  +  +    +    
Sbjct  358   TAKPCIDKEGNPIKVGNVTVLDNMAAFQRYMFIRYILPLKGLKLVNAAFCQYFHGIYFDI  417

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKL-MECM-SKEERWQFGFEVESIDWKDYIS  1887
              + +     L  +Y PY F+ G FDN NA+KL +E + S  E   F F+ + I+W+DY  
Sbjct  418   NRKINIILRLVELYRPYLFFDGIFDNMNAEKLQIEAIKSGVEMNLFYFDPKMINWEDYFM  477

Query  1888  NVHIPGLRRHVMK  1926
             NVH PG+ ++  K
Sbjct  478   NVHFPGIVKYCFK  490



>ref|XP_004973114.1| PREDICTED: fatty acyl-CoA reductase 1-like [Setaria italica]
Length=497

 Score =   390 bits (1003),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 204/503 (41%), Positives = 310/503 (62%), Gaps = 29/503 (6%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              +V + RGKS LITG TGFLGKVL+EKILR  PDV K+++LI+A + E A +R++ E+  
Sbjct  9     AVVGYFRGKSILITGSTGFLGKVLVEKILRVQPDVKKLFLLIRAADVESAKQRVETEVTG  68

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTT  816
              E+F  L++ +G  ++ F+  K+ P+ G+V   +LG+D+     ++KE+DIIVN AA T 
Sbjct  69    KEIFHVLREKHGNRFEDFIQEKVCPLAGDVVYKNLGLDNAKLTELSKEIDIIVNGAATTN  128

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             F ERYDVA D N  G   + KFA +C+KLK+ LHVSTAYV G+++G + EKPF +GE++ 
Sbjct  129   FYERYDVAFDTNVMGAKHICKFAKRCNKLKMLLHVSTAYVAGEQEGILPEKPFLVGETL-  187

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK-----MKELGLERANKFGWQ  1161
                     +E     L++E E+ ++   +  +      +K     MKELGL+RA +FGW 
Sbjct  188   --------REGG--DLDIESELNLIKEIRIDMETNCSPEKVEKRTMKELGLKRAREFGWP  237

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             +TYVFTKAMGEM++ ++RG++PVVI+RPS+I S   EP PGWMEG R +D  I+ Y K  
Sbjct  238   NTYVFTKAMGEMILGHLRGDLPVVIIRPSIITSILNEPLPGWMEGIRTIDSFIIGYAKQA  297

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARL  1521
             L+ FLV+ + ++DVVP DMVVNA + AMA H  + +    I+H+ SS+ NP  +  LA  
Sbjct  298   LSIFLVNLDLIMDVVPGDMVVNAMMVAMAAH--SEEQAQRIFHLTSSLRNPAPYAVLAES  355

Query  1522  LYEHFQSKPYIDSK-GKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKL  1689
              + +F   P    K G+P+ + RM+ F ++    +++   +R  ++   L  +    G  
Sbjct  356   GHRYFLHNPPRSGKNGEPVRLSRMRFFRTLPGFRAYMAVKFRLPLEILRLLNIAGC-GAF  414

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECM-----SKEERWQFGFE  1854
             S +   + RK      ++A +Y PY  + G FD++N ++L   M      K   + FGF+
Sbjct  415   SRRYHELSRK-YRYVMHIAELYAPYALFKGCFDDTNTERLRAVMVNNQQDKSRGYDFGFD  473

Query  1855  VESIDWKDYISNVHIPGLRRHVM  1923
              +SIDW DY   VHIPG+ ++++
Sbjct  474   PKSIDWDDYFYRVHIPGVVKYLL  496



>gb|AFK33782.1| unknown [Medicago truncatula]
Length=492

 Score =   390 bits (1002),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 199/495 (40%), Positives = 312/495 (63%), Gaps = 16/495 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL GK+ L+ G TGFL K+ +EK+LR  P+V K+++L++A + + A  RL+ EI++ 
Sbjct  8     ILNFLEGKTILVIGATGFLAKIFLEKVLRVQPNVKKLFLLLRASDDKSAASRLQNEILAK  67

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF  L +  G +++ F+  KL  V G++   DLG+ D    E I+ + D+I+N AA T 
Sbjct  68    DLFNLLNEKMGTNFKSFISEKLTVVPGDITFEDLGLKDSILREDISSQTDVIINLAATTN  127

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+ALD+NT G   +M FA QC +LK+ +HVSTAYV G++ G I+E P+ +G+S+ 
Sbjct  128   FDERYDIALDLNTFGVKHIMSFAKQCIRLKVLVHVSTAYVCGEKSGLILESPYLLGDSLN  187

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G + ++ N E    KL  E   E+    ++G ++  +   MK+LG+ RAN +GW +TYVF
Sbjct  188   GVAGLDINAEK---KLVTEKLGEL---QEKGATEHEIKVAMKDLGITRANVYGWPNTYVF  241

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKA+GEM+++ ++GN+ VVI+RP+++  T +EPFPGW+EG R +D + + YGKG+LT FL
Sbjct  242   TKALGEMLVEKLKGNLSVVILRPAIVTGTLREPFPGWVEGLRTIDCLAVVYGKGKLTCFL  301

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D NGV+D +PADMVVNA L AM  H  A +P   +YH+ SSV NPL +        ++F
Sbjct  302   GDINGVVDAIPADMVVNAMLVAMVAH--ANQPRDGVYHVGSSVRNPLRYQSFHDYGLKYF  359

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKL--STKLEN  1707
             ++KP+I+  G  + V +M + ++M +   +++ R  +   GL  +  +  +    T LE 
Sbjct  360   KAKPWINKDGTVVKVGKMTILTNMASFQRYIFIRYLLPLKGLKLVNTALCQYFQGTYLE-  418

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC--MSKEERWQFGFEVESIDWKDY  1881
                + ++    L  +Y PY F+ G FD+ N +KL      S  E   F F+ + +DW+DY
Sbjct  419   -LNRKIQVVMRLVELYRPYLFFKGIFDDLNTEKLRMSARQSGTEIDLFYFDPKEMDWEDY  477

Query  1882  ISNVHIPGLRRHVMK  1926
               N H+PGL +++ K
Sbjct  478   FMNTHLPGLVKYIFK  492



>gb|KHN38645.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   390 bits (1001),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 311/496 (63%), Gaps = 15/496 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL+ KS LITG TGFL KVL+EKILR  P+V K+Y+L++A++ + A  RL  EII  
Sbjct  6     ILHFLQDKSILITGATGFLAKVLLEKILRVQPNVKKLYLLLRAEDAKSATHRLHNEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G ++  F+  KL  V G++   DLG++D    E I  + D+I+N AA T 
Sbjct  66    DLFRVLKEKLGANFNSFVSKKLTLVPGDISREDLGLEDSILREEIYDQTDVIINLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQ--RQGKIIEKPFCIGES  990
             FDERYD++L +NT G   ++ FA +C KLK+ +HVSTAYV G+  R+G I+EKP+ +G+S
Sbjct  126   FDERYDISLGLNTFGVKYVINFAKKCTKLKVLVHVSTAYVCGEGGREGLILEKPYHLGDS  185

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G S ++ N E  V    V D++  +   + G ++  + + MK+LG+ RA  +GW +TY
Sbjct  186   LNGVSGLDINAEEKV----VRDKLSEL--QQLGATEKEIKEVMKDLGISRAKLYGWPNTY  239

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM+++ ++GN+ VVI+RPS++ ST KEPFPGW EG R +D + + YGKG+LT 
Sbjct  240   VFTKAMGEMLVEQLKGNLSVVIIRPSIVTSTLKEPFPGWAEGVRTIDSLAVAYGKGKLTC  299

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLY  1527
             FL D   ++D +PADMVVNA L AM  H  A +P    IYHI SSV  PL +  L    +
Sbjct  300   FLGDLKAIVDAIPADMVVNAILVAMVAH--ANRPSDDVIYHIGSSVRRPLRYGKLQEYGF  357

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLE  1704
              +F +KP I   G+P+ V ++ + S+M++   +++ R  +   GL     +  +      
Sbjct  358   RYFTAKPCISKDGRPVKVGKVTVLSNMDSFRRYMFIRYLLVLKGLELANTAFCQYFQGTY  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
                 + ++    L  +Y+PY F+   FD+ N +KL     +   E   F F+ E IDW+D
Sbjct  418   LDLNRKIQIVMRLVDLYKPYLFFKAAFDDMNTEKLRMAGRQGGVETDLFYFDPELIDWED  477

Query  1879  YISNVHIPGLRRHVMK  1926
             Y  N+H+PG+ ++++K
Sbjct  478   YFLNIHLPGMVKYILK  493



>ref|XP_011090359.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Sesamum indicum]
Length=491

 Score =   389 bits (1000),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 197/493 (40%), Positives = 312/493 (63%), Gaps = 12/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I++FL  +S L+TG TGFL K+ IEKILR  P+V K+Y+L++A + + AM R   E+++ 
Sbjct  7     ILQFLENRSILVTGATGFLAKIFIEKILRVQPNVRKLYLLLRAPDAKTAMLRFNTEVMAK  66

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF+ +K+ YG      +  K+  V G++   +LG+ D    E + KEVD++VN AANT 
Sbjct  67    DLFRVVKEKYGGGLSSLISEKVKVVAGDITCENLGVKDTVLLEEMWKEVDVVVNLAANTN  126

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDV+L INT G   ++ F+ +C KLK+ +HVSTAYV+G+++G I+E P+ +GE++ 
Sbjct  127   FDERYDVSLAINTLGAKHVLNFSKRCDKLKVHVHVSTAYVSGEKEGLILETPYKMGETLN  186

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S +  + E  +    V+D ++ + +  +  S+  +   MK+LG++RA KFGW +TYVF
Sbjct  187   GTSGLAIDAEKKL----VDDTLKQLKA--ENCSEEFIKSAMKDLGIQRARKFGWPNTYVF  240

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             +KAMGEM++ +++ NIP+VIVRP+++ ST+KEPFPGW EG R +D + + YGKG++T FL
Sbjct  241   SKAMGEMLLGHLKENIPLVIVRPTIVTSTYKEPFPGWAEGVRTIDSLAVGYGKGRITCFL  300

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              +P  V+D +PADMVVNA + AMA H  A +P  +IYH+ SSV NPL    +      +F
Sbjct  301   GNPKTVIDAIPADMVVNAMIVAMAAH--ANQPNETIYHVGSSVSNPLELGSVRDYGQRYF  358

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENIC  1713
                P+I+ +G+P+ V  +K+ +SM++   +L     +   GL  +  +  +    L    
Sbjct  359   TKHPWINKEGRPVIVGEVKMLNSMDSFKRYLAIHYLLPLKGLEIVNTACCQYFESLYVDL  418

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYIS  1887
             R+ ++    L  +Y PY F+ G +D+ N + L     +   E   F F+ + I+W DY  
Sbjct  419   RRKIKFVMRLVELYGPYLFFKGYYDDMNTEILRRAAEESGVETDMFYFDPKVINWADYFM  478

Query  1888  NVHIPGLRRHVMK  1926
             N+H+PG  ++V K
Sbjct  479   NIHLPGAVKYVFK  491



>ref|XP_004487512.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=492

 Score =   389 bits (1000),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 202/493 (41%), Positives = 302/493 (61%), Gaps = 10/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I++FL G++ L+TG TGFL K+ +EKILR  P V K+Y+L++A + E A +RL+ EII  
Sbjct  6     IMQFLEGRTILVTGATGFLAKIFVEKILRVQPKVKKLYLLLRAKDSESATQRLRTEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             +LFK LK+  G  +  F+  KL  V G++ +  L + +    E I  + D+I+N AA T 
Sbjct  66    DLFKLLKENLGTKFDSFVSEKLTVVPGDISQEGLNLKESILEENICNQTDVIINLAATTK  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL INT G   ++ FA +C KLK+ +HVSTAYV G+R G I+E P   G S+ 
Sbjct  126   FDERYDVALGINTLGAKHVLSFAKKCVKLKVLVHVSTAYVCGERGGLILEDPHPFGVSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G   V+G       KL VE +++ + +  +G ++  +   MK+LG+ERAN++GW +TYVF
Sbjct  186   G---VHGLDICMEKKL-VERKLKQLQA--EGATEHDIEVAMKDLGMERANEYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM+++  + N+ VVI+RP+++ ST++EPFPGW+EG R +D II+ YGKG+LT F+
Sbjct  240   TKAMGEMLVEASKENMSVVILRPTIVTSTYREPFPGWVEGLRTIDSIIVAYGKGKLTSFM  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D + V DV+PADMVVNA + AM  H         IYH+ SSV NP+ +  L    + +F
Sbjct  300   ADLDAVFDVIPADMVVNAIIVAMMAHANQASDNHIIYHVGSSVRNPIKYRSLKDYNFRYF  359

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENIC  1713
               KP+I+  GKP+ V ++ +F++M     +++ R  +   GL        +    +    
Sbjct  360   TEKPWINKDGKPVKVGKVTVFNNMANFRRYMFIRYVLPLKGLEMANSILCQYFKGISLDL  419

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYIS  1887
              + +     L  +Y PY F+ G FD+ N QKL+    +   E   F F+ + IDW +Y  
Sbjct  420   NRKINTVMRLTDLYLPYLFFNGVFDDMNTQKLLLAAKQGGVEMNLFYFDPKIIDWDNYFM  479

Query  1888  NVHIPGLRRHVMK  1926
             N+HIPG+  +  K
Sbjct  480   NIHIPGIFTYAFK  492



>gb|KHN38647.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=492

 Score =   389 bits (999),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 198/499 (40%), Positives = 309/499 (62%), Gaps = 20/499 (4%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I  FL+ K+ L+ G TGFL K+ +EK+LR  P+V K+Y+L++A + E A +RL  EI+ 
Sbjct  5     SITDFLQNKNILVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESASQRLHNEIMR  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANT  813
              +LF+ LK+  G  +  F+  KL  V G++ + DL + D    E I  ++  IVN AA T
Sbjct  65    KDLFRLLKENVGAKFNAFVSEKLTLVPGDISQEDLNLKDPILREEIYNQIHCIVNFAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA  C KLK+ +HVSTAYV G+R G I+E P  +G S+
Sbjct  125   NFDERYDVALGINTFGVKHVLNFAKSCIKLKVLVHVSTAYVCGERGGLIVEDPCQLGVSL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G   ++   E  V    VED+M  +   ++G ++  +   MK+LG++RA  +GW +TYV
Sbjct  185   NGVPGLDIGMEKRV----VEDKMNQL--HEEGATEEDVKMAMKDLGMKRATLYGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM+++ ++ N+ V+IVRP++I ST+KEPFPGW+EG R +D +I+ YGKG+L  F
Sbjct  239   FTKAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGKLPCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLYE  1530
             L+D N + DV+PADMVVNA +  +  H  A +P  + IY + SS+ NP+ + +L   +Y 
Sbjct  299   LLDINAIFDVIPADMVVNAIITTLVAH--ANQPCDNIIYQVGSSIANPIRYHNLKDYIYR  356

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F++KP+++ +G P+ V ++ +  +M +   +++ R  +   GL     +        + 
Sbjct  357   YFKAKPWVNKEGNPVMVGKVTVLDTMTSFQRYMFIRYLLPLKGLEL---ANVAFCQYFQG  413

Query  1708  IC---RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSK---EERWQFGFEVESID  1869
             +C   R+ +     L  +Y+PY F+ G FDN N +KL   + +   E  +   F+ + ID
Sbjct  414   MCLDIRRKIHIVMQLVDLYKPYVFFKGVFDNMNTEKLQTAVRQGEVEMEYSVYFDPKMID  473

Query  1870  WKDYISNVHIPGLRRHVMK  1926
             W+DY  N+HIPG+ ++V K
Sbjct  474   WEDYFMNIHIPGIVKYVFK  492



>ref|XP_007132412.1| hypothetical protein PHAVU_011G092500g [Phaseolus vulgaris]
 gb|ESW04406.1| hypothetical protein PHAVU_011G092500g [Phaseolus vulgaris]
Length=492

 Score =   389 bits (999),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 315/496 (64%), Gaps = 16/496 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             ++ FL+ K+ LITG TGFL KVL+EKILR  P+V K+Y+L++A + + A  RL  EII+ 
Sbjct  6     VLHFLQDKTILITGATGFLAKVLLEKILRVQPNVKKLYLLLRAADAKSATHRLHNEIIAK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G ++   +L KL  V G++   DLG++D    E I  + D+I+N AA T 
Sbjct  66    DLFRVLKEKMGANFNSLILEKLTLVPGDISREDLGLEDTILREEIYDQTDVIINLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQ--RQGKIIEKPFCIGES  990
             FDERYD++L +NT G   ++ FA +C KL++ +HVSTAYV+G+   +G I+EKP+ +G+S
Sbjct  126   FDERYDISLGLNTFGVKYVINFAKKCTKLEVLVHVSTAYVSGEGGEEGLILEKPYHLGDS  185

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G S ++ N E  + +  + +  ++      G ++  + + MK+LGL RA  +GW +TY
Sbjct  186   LNGVSGLDINAEDKLVREKLTELQQL------GATEKEIKEVMKDLGLSRAKLYGWPNTY  239

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM+++ ++GN+ VVI+RP+++ ST KEPFPGW EG R +D + + YGKG+LT 
Sbjct  240   VFTKAMGEMLVEQLKGNLSVVIIRPTIVTSTFKEPFPGWAEGVRTIDSLAVAYGKGKLTC  299

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLY  1527
             FL D   ++D +PADMVVNA L AMA H  A +P    IYH+ SSV  PL +++L    +
Sbjct  300   FLGDLKAIVDAIPADMVVNAILVAMAAH--ANRPTDDVIYHVGSSVRKPLRYNNLQDYGF  357

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGK-LSTKLE  1704
              +F +KP+I+  G P+ V ++ + ++M++   +++R  +   GL     +  +       
Sbjct  358   RYFTAKPWINKDGSPVKVDKVTVLNNMDSFRRYMFRYLLVLKGLEIANTAFCQYFQGTYL  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
             N+ RK V+    L  +Y+PY F+   FD+ N +KL     +   E   F F+ + I+W D
Sbjct  418   NLNRK-VQIVMRLVDLYKPYLFFRAAFDDMNTEKLRMAARQGGVETDLFYFDPQHIEWDD  476

Query  1879  YISNVHIPGLRRHVMK  1926
             Y  N+H+PG+ +++ K
Sbjct  477   YFLNIHLPGVVKYIFK  492



>gb|AFK47309.1| unknown [Lotus japonicus]
Length=491

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 308/494 (62%), Gaps = 11/494 (2%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I  FL+ K+ L+ G TGFL K+ +EK+LR  P+V K+Y+L++A + E A  RL  EI+ 
Sbjct  5     SITHFLQDKNVLVIGATGFLAKIFVEKVLRVQPNVKKLYLLLRATDAESATRRLHNEIMR  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANT  813
              +LF+ LK+  G  +  F+  K+  V G++ + DL + D    + I  ++D+IVN AA T
Sbjct  65    KDLFRLLKENLGLKFNNFVSEKVTVVPGDISKEDLNLKDSVLRQEICNQIDVIVNLAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA  C  LK+ +HVSTAYV G+R G I+E P  +G S+
Sbjct  125   NFDERYDVALGINTFGAKHILSFAKNCINLKVLVHVSTAYVCGERGGLILEDPCQLGVSL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G   ++ + E  V    V+++++M+   ++G S+  +   MK+LG++RA+ +GW +TYV
Sbjct  185   NGVPGLDVDVEKKV----VDEKLKML--KEEGASEDEIKMAMKDLGMKRASVYGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM++  ++ N+PVVI+RP+++ ST++EPFPGW+EG R +D +I+ YGKG+LT F
Sbjct  239   FTKAMGEMLVGTLKENMPVVILRPTIVTSTYREPFPGWVEGVRTIDSLIVAYGKGKLTCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             L D   V DV+PADMVVNA L AM  + A  +P   IYH+ SSV NP+ + +L    + +
Sbjct  299   LADIKAVFDVIPADMVVNAILVAMVGN-ADQRPCDMIYHVGSSVANPVRYLNLEDYNFRY  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENI  1710
             F +KP  D +GK + V R+ +  +M +   +++ R  +   GL  +  +  +    +   
Sbjct  358   FSAKPCKDKEGKLVKVSRVTILDNMSSFRRYMFIRYLLPLKGLELVNTAFCQYFQGMYLD  417

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ--FGFEVESIDWKDYI  1884
               + +     L  +Y+PY F+ G FDN N +KL     + E     F F+ + IDW+DY 
Sbjct  418   IHRKIHIVMRLVDLYKPYLFFNGVFDNMNTEKLQIAAKQGEAEMDVFYFDPKMIDWEDYF  477

Query  1885  SNVHIPGLRRHVMK  1926
              N+HIPG+ ++V+K
Sbjct  478   MNIHIPGIVKYVVK  491



>ref|XP_002867157.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43416.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=493

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/494 (41%), Positives = 303/494 (61%), Gaps = 12/494 (2%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             + ++++L  KS L+ G  GFL  + +EKILR  P+V K+Y+L++A N + A +R   EI+
Sbjct  8     VSVLKYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNGKSATQRFNDEIL  67

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAAN  810
               +LFK +K+ YG +    +  K+  + G++C  DLG+ D   A  +  +VD IVN AA 
Sbjct  68    RKDLFKVVKEKYGPNLNQLISEKVTIIDGDICLEDLGLHDFDLAHEMIHQVDAIVNLAAT  127

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
             T FDERYDVAL INT G   ++ FA +C K+K+ +HVSTAYV G++ G I+E P+ +GE+
Sbjct  128   TKFDERYDVALGINTLGALNVLNFAKRCAKVKILVHVSTAYVCGEKSGLIMETPYRMGET  187

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G + ++ N E       V+++++ + ++  G S   + Q MK+LGL RA  +GW +TY
Sbjct  188   LNGTTGLDINHEKKF----VQEKLDQLRAS--GASPETVTQAMKDLGLRRAKVYGWPNTY  241

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEMM+   R N+ +V++RPS+I ST KEPFPGW EG R +D + + YGKG+LT 
Sbjct  242   VFTKAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTC  301

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             FL D N + DV+PADMVVN+ L +MA    AGK    IYH+ SS+ NP+       L Y 
Sbjct  302   FLCDLNAISDVLPADMVVNSILVSMA--AQAGKQEEIIYHVGSSLRNPMKNAKFPELAYR  359

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F + P+I+ +GK + V  +++ SSM +   ++  R  I   GL  +     KL  K   
Sbjct  360   YFSTNPWINKEGKVVRVGNIEILSSMRSFHRYMTIRYLISLKGLELVNMVLCKLLEKEFK  419

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDY  1881
                + +     L  +Y+PY F+ G FD++N +KL + +SK   E   F F+ E IDW DY
Sbjct  420   YFHRKINFIYRLVDLYQPYLFFYGIFDDTNTEKLQKMVSKTGVESEMFYFDPEVIDWDDY  479

Query  1882  ISNVHIPGLRRHVM  1923
               N H+ GL ++V 
Sbjct  480   FLNTHVIGLLKYVF  493



>ref|XP_006591085.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Glycine 
max]
Length=493

 Score =   388 bits (996),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 310/496 (63%), Gaps = 15/496 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL+ KS LITG TGFL KVL+EKILR  P+V K+Y+L++ ++ + A  RL  EII  
Sbjct  6     ILHFLQDKSILITGATGFLAKVLLEKILRVQPNVKKLYLLLRTEDAKSATHRLHNEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G ++  F+  KL  V G++   DLG++D    E I  + D+I+N AA T 
Sbjct  66    DLFRVLKEKLGANFNSFVSKKLTLVPGDISREDLGLEDSILREEIYDQTDVIINLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQ--RQGKIIEKPFCIGES  990
             FDERYD++L +NT G   ++ FA +C KLK+ +HVSTAYV G+  R+G I+EKP+ +G+S
Sbjct  126   FDERYDISLGLNTFGVKYVINFAKKCTKLKVLVHVSTAYVCGEGGREGLILEKPYHLGDS  185

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G S ++ N E  V    V D++  +   + G ++  + + MK+LG+ RA  +GW +TY
Sbjct  186   LNGVSGLDINAEEKV----VRDKLSEL--QQLGATEKEIKEVMKDLGISRAKLYGWPNTY  239

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM+++ ++GN+ VVI+RPS++ ST KEPFPGW EG R +D + + YGKG+LT 
Sbjct  240   VFTKAMGEMLVEQLKGNLSVVIIRPSIVTSTLKEPFPGWAEGVRTIDSLAVAYGKGKLTC  299

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLY  1527
             FL D   ++D +PADMVVNA L AM  H  A +P    IYHI SSV  PL +  L    +
Sbjct  300   FLGDLKAIVDAIPADMVVNAILVAMVAH--ANRPSDDVIYHIGSSVRRPLRYGKLQEYGF  357

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLE  1704
              +F +KP I   G+P+ V ++ + S+M++   +++ R  +   GL     +  +      
Sbjct  358   RYFTAKPCISKDGRPVKVGKVTVLSNMDSFRRYMFIRYLLVLKGLELANTAFCQYFQGTY  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
                 + ++    L  +Y+PY F+   FD+ N +KL     +   E   F F+ E IDW+D
Sbjct  418   LDLNRKIQIVMRLVDLYKPYLFFKAAFDDMNTEKLRMAGRQGGVETDLFYFDPELIDWED  477

Query  1879  YISNVHIPGLRRHVMK  1926
             Y  N+H+PG+ ++++K
Sbjct  478   YFLNIHLPGMVKYILK  493



>ref|XP_008801227.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Phoenix dactylifera]
Length=490

 Score =   388 bits (996),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 313/496 (63%), Gaps = 16/496 (3%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
             GI   L+ K+ L+TG TGFL K+ +EK+LR  P+V K+++L++A +   AM R++ E+I 
Sbjct  5     GIPECLKDKNILVTGSTGFLAKIFVEKVLRVQPNVKKLFLLVRAVDNTSAMRRVQTEVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
              ELFK LK+++G  +  F+  KL P+ G++   +LGI D    E + K++DI+VN AA T
Sbjct  65    KELFKILKESHGNGFHSFIAEKLFPIAGDIIHENLGIRDSDLIEELWKKIDIVVNVAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVALD+N  G   +++FA +C KL++ LHVS+A+V+G ++G I+EKPF +G+++
Sbjct  125   NFDERYDVALDVNVFGAKHVLEFAKKCVKLEMLLHVSSAFVSGMKEGLILEKPFHMGQTL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
                S ++   E     L + +E +  L A + + D A    +KE+G++RA  FGW +TYV
Sbjct  185   KENSYLDIEAE-----LQLVEEKKRKLHANKSMED-AEDTALKEMGMKRAEFFGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             +TKAMGEM++ ++RG++P+VI+RP++I S +KEP PGW+EG R +D +I+ Y KG+L+ F
Sbjct  239   YTKAMGEMLLGHLRGDLPLVILRPTMITSIYKEPLPGWIEGTRTIDSLIIGYAKGKLSCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
               +P  V+DVVP DMVVNA +  MA H    +    IYH++S V NP+ +  L +  + +
Sbjct  299   FGEPELVMDVVPGDMVVNAMIVTMASH--LNQRSKFIYHMSSGVRNPVTYAILEQCGFRY  356

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTALGDSKGKLSTKLE  1704
             F   P +   GK I   RM +F +M A  +++   +R  ++   L  L   +     + +
Sbjct  357   FLENPRVGKDGKTIKTNRMSVFRTMSAFHAYVTLRYRLPLEVLHLVNLIFCR-LFDRRYK  415

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
              + RK  +   +L  +Y PY F+ G FD+ N ++L   M K+  +   F F+ +SIDWKD
Sbjct  416   ELSRK-FKFMMHLVYLYSPYAFFKGCFDDINLERLRMTMMKDNVDATLFNFDPKSIDWKD  474

Query  1879  YISNVHIPGLRRHVMK  1926
             Y   VHIPG+ ++V K
Sbjct  475   YFYRVHIPGVLKYVCK  490



>ref|XP_004515386.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   388 bits (996),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 200/496 (40%), Positives = 312/496 (63%), Gaps = 17/496 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +++FL  K+ LITGGTGFL K+L+EKILR  P++ KIY+ ++A + + AM RL  EII  
Sbjct  6     VLQFLEDKTILITGGTGFLAKILLEKILRVQPNIRKIYVHLRAVDDKSAMHRLNTEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             ELF+ LK+  G ++  F+  KL  + G++   DLG++D    E I  + D+IVN AANT 
Sbjct  66    ELFRLLKEKMGANFTTFLSEKLTLIRGDISVEDLGLEDSILREEIYNQTDVIVNLAANTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD++L +NT G   L+ FA +C KLK+ +HVSTAYV G+ +G I+EKP+ +G S+ 
Sbjct  126   FDERYDISLGLNTFGVKHLINFAKKCSKLKVLVHVSTAYVCGEGEGLILEKPYQLGHSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G + +N ++E  V    V+D++  +   + G ++  +   MK LG+ RA  +GW +TYVF
Sbjct  186   GVNGLNIDEEEKV----VQDKLGEL--QQLGATEDEIKMVMKNLGISRAKLYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM+++ ++ N+ VV+VRP+++ ST KEPFPGW EG R +D + L YGKG+LT F+
Sbjct  240   TKAMGEMLLEQLKENLSVVVVRPAIVTSTFKEPFPGWAEGVRTIDSLALAYGKGKLTCFI  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLYEH  1533
              D   ++D +PADMVVNA L A+  H  A  P  + IYH+ SS+  PL++ DL    + +
Sbjct  300   GDIKAIVDAIPADMVVNAILVAIVAH--ANNPSDNFIYHVGSSLRRPLIYSDLQEFGFRY  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDS---KGKLSTKLE  1704
             F +KP+I++ GK + V ++++F  M++    ++           L ++   K    T ++
Sbjct  358   FSAKPWINNYGKAVKVGKVQVFGDMDSFRRFMFIRYFLLLKGLELLNTIFCKYFQGTYVD  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
                ++ ++    L  +Y+PY F+ G FD+ N +KL     +   E   F F+ + I+W D
Sbjct  418   --LKRKIKSVMRLVDLYKPYLFFKGVFDDINTEKLRMAAKQGGVETDLFYFDPKVINWDD  475

Query  1879  YISNVHIPGLRRHVMK  1926
             Y  N+H+PGL ++  K
Sbjct  476   YFLNIHLPGLMKYTWK  491



>ref|XP_007020559.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12084.1| Fatty acid reductase 4 [Theobroma cacao]
Length=492

 Score =   387 bits (995),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 197/492 (40%), Positives = 311/492 (63%), Gaps = 11/492 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +V+FL+GK+ L+T  TGFL K+ +EKILR  P+V+K+Y+L++A + + A +RL  EII  
Sbjct  8     VVKFLQGKTILVTDATGFLAKIFVEKILRIQPNVNKLYLLLRAADAKSATKRLHSEIIDT  67

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             ELF  L+  +G  +  F+ +K++ V G++   +LG+++    E + KE++I+V+ AA T 
Sbjct  68    ELFTILRDNWGSEFDSFISTKVIAVPGDISSENLGVNESKLREQMLKEIEIVVHVAATTG  127

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             F+ERYDVAL INT G    + FA +C  +KLFLH STAYV G++ G I+EKPF + +++ 
Sbjct  128   FNERYDVALAINTFGAFNALNFAKKCDAIKLFLHTSTAYVCGEQVGIILEKPFSMDDTLL  187

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
                 ++  +E  +    VE++++ +        +  +  +M E GL+RA  +GW +TYVF
Sbjct  188   KTCKLDITEEKRI----VEEKLDEL--RFHHAPNEVIKSEMMEFGLKRAKLYGWPNTYVF  241

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++ N +G++P+VI+RP++I S +KEPFPGW+EG R +D +I+ YGKG+LT F 
Sbjct  242   TKAMGEMLLGNFKGDLPLVIIRPTMIASPYKEPFPGWIEGVRTIDRVIVSYGKGKLTCFP  301

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
               P+  LDV+PADMVVNA   AM  H    +   +IYH++SS  NP+ F DL + +Y +F
Sbjct  302   GYPSYALDVIPADMVVNAMAVAMVVH-TNYQSCPAIYHVSSSFKNPIKFGDLHKFVYHYF  360

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDS-KGKLSTKLENIC  1713
               KP+I+  G+ + V +  + S++     ++W   +    +  L ++  G+   ++    
Sbjct  361   TKKPWINRDGQRVKVRKGTVLSTVNGFFLYMWIKYVFPLKVLYLVNALSGQYFRQVYMDL  420

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYIS  1887
              + V+ A  LA  Y+PYTF+ G F ++N  KL         +   F F+ +SIDW+DY+ 
Sbjct  421   NRKVKLAMRLAEFYKPYTFFKGIFSDTNLDKLRMVAQGRGIDMGVFDFDSKSIDWEDYMM  480

Query  1888  NVHIPGLRRHVM  1923
             N+HIPGL RH M
Sbjct  481   NIHIPGLLRHAM  492



>ref|XP_002523777.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF38503.1| Male sterility protein, putative [Ricinus communis]
Length=493

 Score =   387 bits (995),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/500 (40%), Positives = 313/500 (63%), Gaps = 22/500 (4%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I+ FL  K+ L TG TG+L K+ +EK+LR  P+V K+Y+L++A + + AMERL +E+I 
Sbjct  5     SILEFLENKTILATGATGYLAKIFVEKVLRVQPNVKKLYLLLRAADADSAMERLNREVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANT  813
              +LFK +++ YG S   F+  K+ P+ G++   DLGI+D +  + I K++D+++N AA T
Sbjct  65    KDLFKGVREKYGSSLNSFVSEKMTPIPGDISREDLGIEDFNLRDEILKDIDVVINFAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL +NT G   ++ FA +C K+++ +HVSTAYV G+  G I+EKPF +GE+ 
Sbjct  125   NFDERYDVALGVNTLGALNVLNFAKKCLKIRMLVHVSTAYVCGEDTGLILEKPFPMGEAK  184

Query  994   AGESVVNGNQESSV--PKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
              G   ++  +E  +   KLN   E+E      +  S+  +   MK+ G+ERA  FGW +T
Sbjct  185   KGNRKIDIEEEKKLVQEKLN---ELE-----SENASEKEITAIMKDFGIERARMFGWPNT  236

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ +M+ ++ ++I+RP++I ST++EPFPGW+EG R +D +I+ YGKG++ 
Sbjct  237   YVFTKAMGEMILMHMKEDLSLLIIRPTMITSTYREPFPGWIEGARTVDSVIVGYGKGKVG  296

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              F+  P  VLDV+PADMVVN  + AMA   A  +    IY I SS+ NPL    +    Y
Sbjct  297   CFVSRPESVLDVIPADMVVNGIIVAMATR-AQKQASEIIYQIGSSLRNPLKLSSVNDFSY  355

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLEN  1707
              +F + P+I+ +G P+   +  + SSM     +++     +  L AL  +   +    ++
Sbjct  356   RYFSANPWINKEGVPVKTSKAIILSSMTKF--YIYMAFRFQLPLKALQVATILVLKNYQD  413

Query  1708  ICR---KSVEQAKYLASIYEPYTFYGGRFDNSNAQKLM-----ECMSKEERWQFGFEVES  1863
             +C    + V+    L  +Y+PY F+ G FD+SN++KL        +  +E  +F F+   
Sbjct  414   MCTVLDRKVKLVMRLVQLYKPYVFFEGSFDDSNSEKLRIEARERSLELKEMDEFNFDPTE  473

Query  1864  IDWKDYISNVHIPGLRRHVM  1923
             IDW++Y+ +VHIPGL ++VM
Sbjct  474   IDWENYMMSVHIPGLVKYVM  493



>ref|XP_006659273.1| PREDICTED: fatty acyl-CoA reductase 1-like [Oryza brachyantha]
Length=497

 Score =   387 bits (994),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 209/503 (42%), Positives = 310/503 (62%), Gaps = 33/503 (7%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +V F RG+S LITG TGFLGKVL+EKILR  P V K+Y+L++A+  E A  R++ E+   
Sbjct  10    VVGFFRGRSILITGSTGFLGKVLVEKILRVQPHVKKLYLLVRANGVESATRRVQNEVTGK  69

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             E+F+ LK+ Y   ++ F+  K+ P+ G++   DLG++      ++KEVDIIVN AA T F
Sbjct  70    EIFQVLKEKYAGGFEDFIQEKVCPLAGDIIYEDLGLESAKLTELSKEVDIIVNGAATTNF  129

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
              ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV+G+++G I+EKPF +G++++ 
Sbjct  130   YERYDVAFDSNVMGAKNICEFAKKCTKLKMLLHVSTAYVSGEQEGLILEKPFLMGQALS-  188

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK-----MKELGLERANKFGWQD  1164
                  G Q      L++  E+ ++   ++ L      +K     MKELGL+RA  FGW +
Sbjct  189   ----EGTQ------LDITSELNLIKETRRDLKANCCPEKTEKRTMKELGLKRARHFGWPN  238

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEM++ ++RG++PVVI+RPS+I S  KEP PGW EG R +D +I+ Y K  L
Sbjct  239   TYVFTKAMGEMLLGHLRGHLPVVIIRPSIITSILKEPLPGWTEGIRTIDSVIIGYAKQAL  298

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
               FLV+ + ++DV+P DMVVNA + A A H  + +P  ++YH+ SS+ NP  +  LA   
Sbjct  299   PFFLVNLDLIMDVIPGDMVVNAMMVATAAH--SEQPTQTVYHMTSSLRNPAPYAVLADTG  356

Query  1525  YEH-FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAID-KSGLTALGDSK----GK  1686
             + + F + P +  KG+   + RM+ F ++    +H+   AI+ K  L  L        G 
Sbjct  357   HRYFFANPPRMGKKGERARLRRMRFFGTVARFRTHM---AINYKLPLEILRWVNIALCGM  413

Query  1687  LSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE-----RWQFGF  1851
             LS + E + RK      +L  +Y PYT + G FD+ N +KL   M  +E     R  F F
Sbjct  414   LSRRYEEMSRK-YRFIMHLVELYAPYTLFKGCFDDINTEKLRIAMKMQEEKHDGRHYFDF  472

Query  1852  EVESIDWKDYISNVHIPGLRRHV  1920
             + +SIDW++Y   VHIPG+ +++
Sbjct  473   DPKSIDWEEYFYRVHIPGVVKYL  495



>gb|EYU34267.1| hypothetical protein MIMGU_mgv1a018187mg [Erythranthe guttata]
Length=458

 Score =   385 bits (990),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 287/443 (65%), Gaps = 21/443 (5%)
 Frame = +1

Query  451   GIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEI  630
             GIGI++F  GK+  +TGGTG LGKVL+EKILR+ P + KIY+L+KAD+++ A++R+ KE+
Sbjct  12    GIGILKFFEGKNIFVTGGTGLLGKVLVEKILRSTP-IGKIYVLVKADDQDSAVDRITKEL  70

Query  631   ISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAAN  810
             I+++LF+ LK+ +G+ YQ ++   L+P+VGN+CE +LG+D  +   I ++V++I+ SAA 
Sbjct  71    INSDLFRCLKEKHGQYYQAYIRDTLIPIVGNICEPNLGMDSDSTHAIMEDVNVIIESAAI  130

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVN-GQRQGKIIEKPFCIGE  987
             TT +ERYDV L  N   P  LM+FA  C  L+L       Y N G+R+G I+EKP  +GE
Sbjct  131   TTLNERYDVMLGANVNSPQELMRFAKTCKNLEL-----CPYFNRGEREGIILEKPLIMGE  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDG-AMAQKMKELGLERANKFGWQD  1164
             +   +   N    S  P L++ DE+ +  S KQ  S    + + MK LG+ERAN +GW +
Sbjct  186   NRRKDDTCN---TSRFPLLDITDEVNLSASRKQKASSNYDLTRDMKMLGMERANFYGWYN  242

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TY  TKAM EM+I+  RG+IPVVI+RP+VIES  KEP PGW++GNRM DPII+ YG GQL
Sbjct  243   TYQLTKAMAEMVINETRGDIPVVIIRPTVIESCCKEPIPGWIQGNRMFDPIIVSYGNGQL  302

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
               FL  P+  +DV+P D+VVN T+AA+AKHG   K   ++Y IASSV NPL + +    L
Sbjct  303   PAFLGKPDSPMDVIPLDIVVNGTIAAIAKHGYMQKAELNVYQIASSVTNPLHYSEFFEYL  362

Query  1525  YEHFQSKPYIDSK-----GKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKL  1689
             YE+F+S+P ++S+         D+ ++K F +    S +  R+ I +     +G      
Sbjct  363   YEYFRSEPLVESENLIRVNNYDDIEKIKYFDNFNDFSKYT-REEISRR----VGGGNAVA  417

Query  1690  STKLENICRKSVEQAKYLASIYE  1758
             + K +  CR  +  A++L  +YE
Sbjct  418   TKKAQTQCRAKIMYAEHLCKMYE  440



>ref|XP_004487511.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   387 bits (993),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 192/493 (39%), Positives = 309/493 (63%), Gaps = 12/493 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ F++ K+ LI G TGFL K+ +EK+LR  P+V K+++L++A + + A  RL+ EI++ 
Sbjct  7     ILHFIQDKTILIVGATGFLAKIFLEKVLRVQPNVKKLFLLLRASDDKSAACRLQNEILAK  66

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF  LK   G +++ F+  KL  V G++   DLG+ +    + I  + D+I+N AA T 
Sbjct  67    DLFNLLKDKMGANFESFISEKLTLVPGDISCEDLGLKNSILRDDILCQTDVIINLAATTN  126

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+AL +NT G   ++ FA QC+KLK+ +H+STAYV G++ G I+E P+  GE++ 
Sbjct  127   FDERYDIALGLNTFGVKHIINFAKQCNKLKVLVHISTAYVCGEKSGLILESPYLFGETLN  186

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++ N E  +    +++  EM      G ++  +   MK+LG++RAN +GW +TYVF
Sbjct  187   GVSGLDINAEKKLVTEKLDELQEM------GATEREIKLAMKDLGIKRANVYGWPNTYVF  240

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKA+GEM+++ +RGN+ VVI+RP+++ ST KEPFPGW EG R +D + + YGKG+L+ FL
Sbjct  241   TKAVGEMLVEQLRGNLSVVILRPTIVTSTFKEPFPGWSEGIRTIDSLAVAYGKGKLSCFL  300

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D   V+D++PADMVVNA L AM  H  A +P   +YH+ SSV+NP+ + +L    + +F
Sbjct  301   GDVECVVDIIPADMVVNAILVAMVAH--ANQPSDILYHVGSSVLNPIRYLNLQEYGFRYF  358

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENIC  1713
             ++KP+I+  G  + V  + +   M +   +++ R  +   GL        +   K     
Sbjct  359   KAKPWINKDGSIVKVGSVTMLPDMASFKRYMFIRYLLPLQGLKLANVVFCQYFQKTYLEL  418

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECM--SKEERWQFGFEVESIDWKDYIS  1887
              ++++    L  +Y PY F+ G FD+ N +KL   +  S  ER  F F+ + IDW+DY  
Sbjct  419   NRNIQIVMRLVELYRPYVFFKGIFDDMNTEKLRRAVRESGTERDLFYFDPKVIDWEDYFL  478

Query  1888  NVHIPGLRRHVMK  1926
             N+H+PG+ +++ K
Sbjct  479   NIHVPGIVKYIFK  491



>ref|XP_011090362.1| PREDICTED: fatty acyl-CoA reductase 3-like [Sesamum indicum]
Length=495

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/495 (39%), Positives = 307/495 (62%), Gaps = 15/495 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I  +  GK+  ITG TGFL K+  EKILR  P++ K+++LI+   K  + +RL++E++  
Sbjct  6     IFEYFEGKTIFITGATGFLAKIFAEKILRVQPNIKKLFLLIRETTKTTSKQRLQEEVVDT  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANTT  816
             ELF+ L++ YG ++   +LSK+VPV G+V   +LGI D    E + +E+DIIVNSAA T 
Sbjct  66    ELFRVLREEYGVNFNTALLSKIVPVSGDVSLENLGIVDPEVRENMWEEIDIIVNSAATTK  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+AL IN  G + +  FA +C KL++ +HVSTA+V+G R G I EKPF +GE++ 
Sbjct  126   FDERYDIALRINALGASHVRNFASKCSKLEMLVHVSTAFVHGTRIGLIPEKPFSMGETLD  185

Query  997   GE--SVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             G   S ++ N+E  +    +E+++  + + K   ++  + + M++LG+ERA   GW +TY
Sbjct  186   GSKISYLDINKEKKI----IEEKLSRLQTQKA--TEKEITRAMRDLGIERATLHGWPNTY  239

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKA+GEM ++N +    V+I+RP++I ST++EPFPGW+EG R +D I + YG+G+L  
Sbjct  240   VFTKAIGEMFLENFKEKATVIIIRPTIITSTYREPFPGWIEGVRTLDSIFVGYGQGKLKF  299

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             F+ DP+  LD++P DMVVN  LAA+A H    +   S+YHI SS  NP+ F++L  L++ 
Sbjct  300   FVGDPDSTLDMIPGDMVVNCMLAAIASHSNDFQHSLSVYHIGSSRRNPVKFEELKWLMHR  359

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLENI  1710
             +    P  D++GKPI V +    S+M +  +++    +    L  L           E++
Sbjct  360   YLTENPMFDTRGKPIRVGQPTTLSTMASFHNYIATHYL--PLLKILKVINMMFCNHFESL  417

Query  1711  ---CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEER-WQFGFEVESIDWKD  1878
                 R+ +  A  LA +Y+PY F+ G FD+ N + L   + +  +     F+ + I W++
Sbjct  418   YTNMRRRINNAMRLAELYKPYVFFQGIFDDVNTENLRRTIRESNKNVVLNFDPKCIQWEE  477

Query  1879  YISNVHIPGLRRHVM  1923
             Y  N+H  GL ++V+
Sbjct  478   YFENIHFQGLTKYVL  492



>ref|XP_002305562.1| hypothetical protein POPTR_0004s19600g [Populus trichocarpa]
 gb|EEE86073.1| hypothetical protein POPTR_0004s19600g [Populus trichocarpa]
Length=490

 Score =   386 bits (991),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/496 (40%), Positives = 316/496 (64%), Gaps = 16/496 (3%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              +++FL  K+ L+TG TG+L K+ +EKILR  P+V K+Y+L++A + + A ERL  E+I 
Sbjct  5     SVLQFLENKTILVTGATGYLAKIFVEKILRVQPNVKKLYLLLRAVDAKSARERLHHEVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANT  813
              ELFK +++ +G S   F+  K+ PV G++   +LG+ D +  + + +E+D+++N AA T
Sbjct  65    KELFKVIREKHGASLHSFISEKVTPVPGDISYEELGVKDCSLKDEMWREIDVVLNFAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA +C  +K+ +HVSTAYV G+  G I+E+P+ +G + 
Sbjct  125   NFDERYDVALGINTLGALHVLNFAKKCVNVKMLVHVSTAYVCGEDAGLIMEQPYHMGMAK  184

Query  994   AGESVVNGNQESSVPKLNVEDEM-EMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
              G+  V+ N E  +    V+D++ ++VL   + + +  +   MK+LG+ERA +FGW +TY
Sbjct  185   RGDDKVDINFEKKM----VQDKLNQLVL---EDVPEKEITSAMKDLGIERARRFGWPNTY  237

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM++ N + ++PV+I+RP+++ ST+KEPFPGW+EG R +D II+ YG G+++ 
Sbjct  238   VFTKAMGEMLVVNFKDDLPVLIIRPTMVASTYKEPFPGWIEGLRTIDSIIVGYGIGKVSC  297

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             F+  P   LDV+PADMVVNA   AM    +A +   ++YH+ SS+ NP+ F +L    + 
Sbjct  298   FISGPQATLDVIPADMVVNAITVAMV--ASAKQHPENVYHLGSSLRNPVKFSNLHDFSFR  355

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F   P+I+ +G+ + + R  +FSSM    +++  R  +    L        K    +  
Sbjct  356   YFSENPWINKEGEVVKIGRGTVFSSMSKFYTYMTIRYLLPLKALQLFNTLLFKRYQDVYT  415

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE---ERWQFGFEVESIDWKD  1878
             +  +  +    L  +Y+PY F+ G FD+ NA+KL    S+E   E   F F+  SIDW+D
Sbjct  416   VLDRKAKLVMRLVDLYKPYVFFEGIFDDMNAEKL-RIASRETCPEANDFDFDPISIDWED  474

Query  1879  YISNVHIPGLRRHVMK  1926
             Y+ NVHIPGL ++V+K
Sbjct  475   YMMNVHIPGLVKYVIK  490



>ref|XP_010089855.1| Fatty acyl-CoA reductase 3 [Morus notabilis]
 gb|EXB38471.1| Fatty acyl-CoA reductase 3 [Morus notabilis]
Length=492

 Score =   386 bits (991),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/494 (40%), Positives = 313/494 (63%), Gaps = 12/494 (2%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +++FL  KS LITG TGFL K+  EK+LR  P V K+Y+L++A++++ A +RL  EII  
Sbjct  6     VLKFLENKSILITGATGFLAKIFAEKVLRAQPKVKKLYLLLRANDEKSATQRLNNEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANTT  816
             +LFK LK+  G S+  F+  KL  + G++   DLG+ D    E +  ++D+IVN AA T 
Sbjct  66    DLFKVLKERLGASFGTFVREKLSVMAGDITREDLGLKDLKLKEEMLNQLDVIVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD++L +NT G    + FA QC KLK+ +HVSTAYV+G++ G I+E P+ +G+++ 
Sbjct  126   FDERYDISLFLNTVGVKHCLNFAKQCQKLKILVHVSTAYVSGEKGGLILENPYHMGDTLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G + ++ + E  +    VE +++  L A++  S+  +   MK+ G++RANK+GW +TYVF
Sbjct  186   GATGLDIDNEVRL----VEAKLKQ-LQAEEA-SEAEITLAMKDFGIQRANKYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++ +++ N+ VVI+RP++I ST+KEPFPGW+EG R +D + + YGKG+LT FL
Sbjct  240   TKAMGEMVLGHLKENVNVVIIRPTIITSTYKEPFPGWVEGLRTIDSLAVGYGKGKLTCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D   V+DV+PAD+VVNAT+ A+A H         IY + SSV NP+ + +L    + +F
Sbjct  300   GDLEAVVDVIPADLVVNATIVAIAAHANQPSSENVIYQVGSSVRNPVRYSNLQDYGFRYF  359

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENIC  1713
               KP+I+  GKPI V ++ +   M +   ++  R  +   GL  +  +  +    +    
Sbjct  360   SKKPWINKDGKPIKVRKVLVLGDMASFRRYMSVRYLLFLKGLELVNTAFCQYFQGMYLDL  419

Query  1714  RKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE---ERWQFGFEVESIDWKDYI  1884
              + ++    L  +Y PY F+ G FD+ N ++L    +KE   E   F F+ +SI+W +Y 
Sbjct  420   NRKIQFVMRLVELYRPYLFFKGVFDDMNTERL-RLAAKESGIETDIFYFDPKSINWDEYF  478

Query  1885  SNVHIPGLRRHVMK  1926
              ++HIPG+ ++V K
Sbjct  479   MSIHIPGVVKYVSK  492



>ref|XP_011046268.1| PREDICTED: fatty acyl-CoA reductase 3-like [Populus euphratica]
Length=492

 Score =   386 bits (991),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 208/498 (42%), Positives = 314/498 (63%), Gaps = 20/498 (4%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +V+FL  K+ LITG TGFL K+L+EKILR  P+V KIY+L++A + + A +RL+ EI+  
Sbjct  6     VVQFLEDKTILITGATGFLAKILLEKILRVQPNVKKIYLLLRAADAKSASQRLQNEILGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVC-ESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
             +LF  LK+ +G     F+  K+V V G++  + DLG+ D +  E I  ++D++VN AA T
Sbjct  66    DLFTLLKEKWGADLNSFISKKIVLVPGDISYDDDLGVKDSNLREEIWSQLDVVVNLAATT  125

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA +C KL + +HVSTAYV+G+R G I E  +  G+++
Sbjct  126   NFDERYDVALGINTMGAMHVLCFAKKCVKLTVLVHVSTAYVSGERAGLIPETSYGWGDTL  185

Query  994   AGESVVNGNQESSV--PKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
              G S ++ N+E  +   KLN   E++      +G +  A+ + MK++G+ERA  +GW +T
Sbjct  186   NGVSGLDINEEKKLVDQKLN---ELQ-----AEGATAEAIKEAMKDMGIERAKVYGWPNT  237

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ +++ N+ VVI+RP+++ ST KEPFPGW+EG R +D + + YGKG+LT
Sbjct  238   YVFTKAMGEMLVGDLKENLSVVIIRPTIVTSTLKEPFPGWIEGIRTIDSLAVGYGKGRLT  297

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
              FL D  G++DV+PADMVVNA + AM  H A  +   +IY + SSV NP+ + +L    +
Sbjct  298   CFLGDITGIVDVIPADMVVNAIVVAMVAH-ANRRFDDAIYQVGSSVRNPVRYTNLQDFAF  356

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDSKGKLSTKLEN  1707
             ++F  KP+I   GKP+ V R+K+ SSM     H +        L  L  +        EN
Sbjct  357   DYFTKKPWIGKDGKPVKVGRVKMLSSMANF--HRYMAIRYLLLLKGLELANIAFCHYFEN  414

Query  1708  I---CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDW  1872
             +     K ++    L  +Y PY F+ G FD+ N +KL     +   E   F F+ + IDW
Sbjct  415   MYTDLNKKIKFVMKLVELYRPYLFFRGVFDDMNTEKLRMAAGENNIETDMFYFDPKEIDW  474

Query  1873  KDYISNVHIPGLRRHVMK  1926
             +DY++N+HIPG+ ++V +
Sbjct  475   EDYLTNIHIPGVVKYVFR  492



>ref|XP_003543433.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
1 [Glycine max]
 gb|KHN21438.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/495 (40%), Positives = 310/495 (63%), Gaps = 16/495 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             ++ FL  K+ LI G TGFL K+ +EKILR  P+V K+++L++A + + A  RL+ EII+ 
Sbjct  6     VLNFLEDKTILIVGATGFLAKIFLEKILRVQPNVKKLFLLLRASDAKSANYRLQNEIIAK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF  LK+  G +++ F+  K+  V G++   DLG+ D    E I  + D+IVN AA T 
Sbjct  66    DLFIVLKEKLGANFKSFISEKVTLVPGDISYEDLGLKDSILREEICNQTDVIVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+AL +N  G   +M FA QC KLK+ LHVSTAYV G+R G I+E+P+  G+S+ 
Sbjct  126   FDERYDIALGLNIFGVKHVMNFAKQCTKLKVVLHVSTAYVCGERGGLILEEPYNFGDSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++ + E ++    V D+++ +   +QG ++  +   MK LG+ RA  +GW +TYVF
Sbjct  186   GVSGLDIDAERTI----VCDKLDEL--REQGATEREIKIAMKNLGISRAKVYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKA+GEM+++ ++G + VVI+RP+++ ST +EPFPGW+EG R +D + + YGKG+LT FL
Sbjct  240   TKAVGEMLVEQLKGRLSVVIMRPTIVTSTLREPFPGWVEGVRTIDSLAVTYGKGKLTCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              + NGV+D VPADMVVNA L AM  H  A +P   IYH+ SS+ NPL + +L     ++F
Sbjct  300   GNINGVVDAVPADMVVNAMLVAMVAH--ANQPSDIIYHVGSSLRNPLTYLNLQDYGLKYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKL--STKLEN  1707
              +KP+I+  G P+ V R+ + + M++   +++ R  +   GL     +  +    T LE 
Sbjct  358   TAKPWINKDGTPVKVGRVTVLTDMDSFQRYMFIRYLLPLKGLELANTALCQYFRGTYLE-  416

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC--MSKEERWQFGFEVESIDWKDY  1881
                + ++    +  +Y PY F+ G FD+ N +KL      S  E   F F+ + ++W+DY
Sbjct  417   -LHRKIQVVMRMVELYRPYMFFNGVFDDINTEKLRIAAKQSGTETDLFYFDTKEVNWEDY  475

Query  1882  ISNVHIPGLRRHVMK  1926
                 H+PG+ +HV K
Sbjct  476   FMKTHLPGIVKHVFK  490



>ref|XP_006341242.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum tuberosum]
Length=409

 Score =   382 bits (981),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/351 (53%), Positives = 255/351 (73%), Gaps = 27/351 (8%)
 Frame = +1

Query  442   HEDGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLK  621
             +++GIGIV F  GK+ L+TG TGFL K LIEK+LRT P V+KIY+LI+A +KE A  RLK
Sbjct  4     NDNGIGIVEFFEGKNILVTGATGFLAKALIEKMLRTTPKVNKIYLLIRAKDKEAAFHRLK  63

Query  622   KEIISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNS  801
              EI+ +ELFK L++ +G++Y++F+ +KL+P+VGN+ E +LG+D  T++ IA+E+D+IV+S
Sbjct  64    AEIMESELFKCLEEMHGETYKLFIQNKLIPIVGNIYEPNLGMDIITSDKIAQEIDLIVDS  123

Query  802   AANTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCI  981
             AA TTFDERYD+ALD N  GP +LM FA +C KLKL +H STA+ NG+R+G I+EKPF +
Sbjct  124   AAITTFDERYDLALDANVNGPYQLMMFAKKCKKLKLLMHYSTAFANGEREGLILEKPFTM  183

Query  982   GESIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQ  1161
             GESI   ++ N          N+                  + Q MK+ GLERA  +GWQ
Sbjct  184   GESILKNNITN----------NI-----------------GLEQIMKDFGLERAKLYGWQ  216

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             DTY FTKA+GEMMI+NMR  IP++I+RPS I S++KEPFPGW++G R++DP++  Y KG 
Sbjct  217   DTYSFTKAIGEMMINNMRDEIPILIIRPSGITSSYKEPFPGWIQGFRIVDPLVFFYRKGD  276

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNP  1494
             L G L DPN ++D+VP DMVVN T+AAMAKHG    P  ++YH+ASS +NP
Sbjct  277   LPGLLADPNCLVDLVPVDMVVNTTMAAMAKHGNLQNPQLNVYHVASSSINP  327



>gb|AES67032.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/499 (40%), Positives = 301/499 (60%), Gaps = 23/499 (5%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL G++ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + E A +R + EII  
Sbjct  6     ILHFLEGRTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAKDSESAAQRFRNEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANTT  816
             +LFK LK+  G  +  F+  KL  V G++ +  L + +    E I  + D+IVN AA T 
Sbjct  66    DLFKLLKENQGPKFNSFVSEKLTLVPGDISKEGLNLKESILEEEICNQTDVIVNLAATTK  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL INT G   ++ FA +C +LK+ +HVSTAYV G+R G I+E P   G S+ 
Sbjct  126   FDERYDVALGINTLGVKHVLSFAKKCIQLKVLVHVSTAYVCGERGGLILEDPHRYGVSLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLS-----AKQGLSDGAMAQKMKELGLERANKFGWQ  1161
             G           VP L+++ E ++V         QG ++  +   MK+LG+ERA K+GW 
Sbjct  186   G-----------VPGLDIDMEKKLVEEKLNQFQAQGTTEHDIEVAMKDLGMERATKYGWP  234

Query  1162  DTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQ  1341
             +TYVFTKAMGEM+++  + N+ VVIVRP+++ ST +EPFPGW+EG R +D I++ YGKG+
Sbjct  235   NTYVFTKAMGEMLVETFKENMSVVIVRPTIVTSTFREPFPGWVEGLRTIDSIVVAYGKGK  294

Query  1342  LTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLAR  1518
             LT F+ D + V DV+PADMVVNA + AM  H  A +P  + IYH+ SS+ NP+ +     
Sbjct  295   LTSFMADLDAVFDVIPADMVVNAIIVAMMAH--ANQPNDNIIYHVGSSIRNPITYRTFRD  352

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWR-DAIDKSGLTALGDSKGKLST  1695
                 +F  KP I+  GK I V  + +FS++ +   +++    +   GL        +   
Sbjct  353   YNLRYFTKKPLINKDGKSIKVGNITVFSNIASFRRYMFICYMLPLKGLEVANSILCQYFQ  412

Query  1696  KLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESID  1869
              +     + +     L  +Y PY F+ G FD+ N QKL+  + +E  E   F F+ + ID
Sbjct  413   GIYTDLNRKISTVMRLIDLYLPYLFFNGIFDDMNTQKLLLAVKQEGVEVNLFYFDPKIID  472

Query  1870  WKDYISNVHIPGLRRHVMK  1926
             W+DY  N+HIPG+ ++ +K
Sbjct  473   WEDYFMNIHIPGIFKYALK  491



>ref|XP_002305561.2| hypothetical protein POPTR_0004s19580g [Populus trichocarpa]
 gb|EEE86072.2| hypothetical protein POPTR_0004s19580g [Populus trichocarpa]
Length=492

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 209/500 (42%), Positives = 318/500 (64%), Gaps = 24/500 (5%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +V+FL  K+ LITG TGFL K+L+EKILR  P+V KIY+L++A + + A +RL+ EI+  
Sbjct  6     VVQFLEDKTILITGATGFLAKILLEKILRVQPNVKKIYLLLRAADAKSASQRLQNEILGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVC-ESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
             +LF  LK+ +G      +  K+V V G++  + DLG+ D +  E I  ++D++VN AA T
Sbjct  66    DLFTLLKEKWGADLNSLISKKIVLVPGDISYDDDLGVKDSNLREEIWSQLDVVVNLAATT  125

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA +C KLK+ +HVSTAYV+G+R G I+E  +  G+++
Sbjct  126   NFDERYDVALGINTMGAKHVLCFAKKCVKLKVLVHVSTAYVSGERAGLILEASYGRGDTL  185

Query  994   AGESVVNGNQESSV--PKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
              G S ++ ++E  +   KLN   E++      +G +  A+ + MK++G+ERA  +GW +T
Sbjct  186   NGVSGLDIDEEKKLVDQKLN---ELQ-----AEGATTEAIKEAMKDMGIERAKVYGWPNT  237

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++ +++ N+ VVI+RP+++ ST KEPFPGW+EG R +D + + YGKG+LT
Sbjct  238   YVFTKAMGEMLVGDLKENLSVVIIRPTIVTSTLKEPFPGWVEGIRTIDSLAVGYGKGRLT  297

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKP-GTSIYHIASSVVNPLVFDDLARLL  1524
              FL D  G++DV+PADMVVNA + AM  H  A +P   +IY + SSV NP+ + +L    
Sbjct  298   CFLGDITGIVDVIPADMVVNAIVVAMVAH--ANRPFDDAIYQVGSSVRNPVRYTNLQDFG  355

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAID-KSGLTALGDSKGKLSTKL  1701
             +++F  KP+I   GKP+ V R+K+ SSM     ++   AI     L  L  +        
Sbjct  356   FDYFTKKPWIGKDGKPVKVGRVKVLSSMANFHGYM---AIRYLLLLKGLELANIAFCHYF  412

Query  1702  ENICRKSVEQAKY---LASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESI  1866
             EN+      + K+   L  +Y PY F+ G FD+ N +KL     +   E   F F+ ++I
Sbjct  413   ENMYTDLNRKIKFVMKLVELYRPYLFFRGVFDDMNTEKLRMAAGENNIETDMFYFDPKAI  472

Query  1867  DWKDYISNVHIPGLRRHVMK  1926
             DW+DY +N+HIPG+ ++V +
Sbjct  473   DWEDYFTNIHIPGVVKYVFR  492



>gb|AFK38315.1| unknown [Medicago truncatula]
 gb|AES88360.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   385 bits (988),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 201/496 (41%), Positives = 305/496 (61%), Gaps = 15/496 (3%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I  FL  K+ L+ G  GFL K+ +EKILR  P+V K+Y+L++A + E A  R+  EI+ 
Sbjct  6     SIAHFLEDKNVLVLGAAGFLAKIFVEKILRVQPNVKKLYLLLRATDAESATRRMHNEILR  65

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
              +LFK LK+ +G  +  F+  K+  V G++ + +  + D +  + +  + D+IVN AA T
Sbjct  66    KDLFKLLKENHGAKFNSFISEKVTMVPGDISQENFNLKDSNLLQELYNKTDVIVNLAATT  125

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL +NT G   ++ FA  C  L++ +HVSTAYV G+R G I+E P+ +G S+
Sbjct  126   NFDERYDVALGLNTFGAKHVLNFAKNCINLRVLVHVSTAYVCGERGGLIVEDPYQLGVSL  185

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G   ++ ++E  V    VE+++ M+   ++G ++      MK+LG+ERA  +GW +TYV
Sbjct  186   NGVQGLDIDEEKRV----VEEKLNML--QQEGATEKDTRIAMKDLGMERAKLYGWPNTYV  239

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM++  M+  + +VIVRP++I ST+KEPFPGW+EG R +D +I+ YGKG+LT F
Sbjct  240   FTKAMGEMLVGTMKEKLSIVIVRPTIITSTYKEPFPGWVEGVRTIDSLIVAYGKGKLTCF  299

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKP-GTSIYHIASSVVNPLVFDDLARLLYE  1530
             L D   V DV+PADMVVNA L AM  H  A +P   SIYH+ SSV NP+ ++ L    + 
Sbjct  300   LADLEAVFDVIPADMVVNAMLVAMVSH--ANQPCDDSIYHVGSSVGNPVRYESLRDYCFR  357

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGK-LSTKLE  1704
             +F +KP  D +GK I V ++ +  +M +   +++ R  +   GL  +  +  +   +   
Sbjct  358   YFTAKPCFDKEGKAIKVGKVTVLENMNSFQRYMYIRYLLPLKGLELVNAAFCRYFQSTCF  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKD  1878
             +I RK V     L  +Y PY F+ G FDN NA+KL     +   E   F F+ + I+W+D
Sbjct  418   DISRK-VHTVMRLVELYRPYVFFNGVFDNMNAEKLQIAARQSGVEMDLFYFDPKMINWED  476

Query  1879  YISNVHIPGLRRHVMK  1926
             Y  N+HIPG+ ++  K
Sbjct  477   YFMNIHIPGIVKYSFK  492



>ref|XP_010271727.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nelumbo 
nucifera]
Length=490

 Score =   385 bits (988),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 312/495 (63%), Gaps = 12/495 (2%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             +GI+  L  K+ L+TG TGF+ K+ +EK+LR  P+V K+Y+L++A + + A++RL  E++
Sbjct  4     VGILESLENKTILVTGATGFVAKIFVEKVLRVQPNVKKLYLLLRAPHTKSAIQRLHNEVL  63

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAAN  810
               E+F+ L+Q  G  +  FM  K++PV G++   +LG+++    + + +EVDI+VN AA 
Sbjct  64    GKEVFRVLRQKLGSGFDSFMSEKVIPVPGDITCKNLGVEETDLRDKMWREVDIVVNIAAT  123

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
               FDERYD +L INT G   +++FA +C KL++F+HVSTAYV GQ++G ++EKP+ +GE+
Sbjct  124   VNFDERYDDSLFINTMGAKHVLEFAKKCSKLQIFVHVSTAYVGGQQEGLMLEKPYQMGET  183

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G   ++  QE  V     E+ ++ + + K  + +  +A  MKELGL+RA  +GW +TY
Sbjct  184   LNGTLGLDIQQELKV----AEERLKELQAEKITIKEERIA--MKELGLKRARLYGWPNTY  237

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
              FTKAMGEM++ + R NIP+VI+RP++I ST+ EPFPGW+EG R +D +IL YGKG+LTG
Sbjct  238   AFTKAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYGKGRLTG  297

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             F  DP  ++DV+P DMVVN+ + AM  H         IYH+ SSV +P  F  L    Y 
Sbjct  298   FPGDPKLIMDVIPGDMVVNSIIVAMVAH--LNHSSEFIYHVGSSVRHPAQFAMLRETSYR  355

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F   P +DS  KP+ V R+++ S+M+    ++  R  I    L  L  +  +    +  
Sbjct  356   YFSVNPCMDSYEKPVKVGRVEMLSTMDDFRRYMAIRYLIPLKVLQVLNMAFCQYFKGIYG  415

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC--MSKEERWQFGFEVESIDWKDY  1881
               ++ +     L  +YEPY ++ G FD+ N + L +   ++ ++   F F+ + I+W++Y
Sbjct  416   DLKRKINFVMRLVELYEPYLYFKGVFDDLNTEMLRKAALVNYDDASMFQFDPKCINWENY  475

Query  1882  ISNVHIPGLRRHVMK  1926
               N+H PGL ++V K
Sbjct  476   FMNIHFPGLVKYVFK  490



>ref|XP_004974195.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X2 [Setaria 
italica]
Length=497

 Score =   385 bits (989),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 207/508 (41%), Positives = 307/508 (60%), Gaps = 29/508 (6%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             D   I+ +  GKS LITG TGFLGK+L+EKILR  P VHKIY+L++  ++  A +R+++E
Sbjct  4     DAASIIGYFNGKSILITGATGFLGKILVEKILRVQPQVHKIYLLVRGIDEPTARQRVQQE  63

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             +I  ELF  L++ +GK +Q F+  K+V + G++   +LG +    E ++KE+D+IVN AA
Sbjct  64    VIDTELFGLLREKHGKGFQQFVEEKVVALAGDIIHHNLGQEAPMLEALSKEIDVIVNIAA  123

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T F ERYDV+LD+N  G   L +FA QC +LK+F+ VSTA+V+G  +G I+EKP   GE
Sbjct  124   TTNFYERYDVSLDVNVMGVKHLCQFAKQCARLKMFMQVSTAFVSGFSEGLILEKPIKPGE  183

Query  988   SIAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLS--DGAMA--------QKMKELGLE  1137
             S+         +E +   L+++ E+ +V   K+ L+  DGA +        + MKELGL+
Sbjct  184   SL---------REGT--HLDIDTELRLVREVKKQLTMNDGAASDDKKAEERKAMKELGLQ  232

Query  1138  RANKFGWQDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPI  1317
             RA  FGW +TYVFTKAMGE+++ ++RG+IPVVI+RPS+I S   +P PGWM+G R +D I
Sbjct  233   RARHFGWSNTYVFTKAMGEVLLGHLRGDIPVVIMRPSIITSVRADPVPGWMQGTRTIDTI  292

Query  1318  ILHYGKGQLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPL  1497
             I+ Y K  L+ FL D + V+DV+P DMVVNA +AAM  H +  K    +YH  SS+ NP 
Sbjct  293   IIGYAKQNLSCFLADLDLVMDVIPGDMVVNAMMAAMVAH-SEEKGALVVYHSTSSLRNPA  351

Query  1498  VFDDLARLLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAIDKSGLTALGDS  1677
              ++ L +    HF   P +   GK I    M  F ++     HL+     K  L  L   
Sbjct  352   KYNVLYQSGRRHFYENPRVGKDGKAIPTREMYFFPTIARF--HLYMIFTYKIPLEILHLV  409

Query  1678  KGKLS---TKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQ--KLMECMSKEERWQ  1842
                L    ++L N   +  +   +L  +Y P+ F+ G FD+ N +  +LM  M   E   
Sbjct  410   NLLLCGFFSRLYNDLNRKYKFVMHLVDVYGPFAFFKGCFDDMNLERLRLMMAMKTPEDQM  469

Query  1843  FGFEVESIDWKDYISNVHIPGLRRHVMK  1926
             F F+ ++IDW DY + +HIPG+ +++ K
Sbjct  470   FNFDPKTIDWDDYFTRIHIPGVLKYLCK  497



>ref|XP_002449116.1| hypothetical protein SORBIDRAFT_05g005340 [Sorghum bicolor]
 gb|EES08104.1| hypothetical protein SORBIDRAFT_05g005340 [Sorghum bicolor]
Length=513

 Score =   385 bits (990),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 206/513 (40%), Positives = 312/513 (61%), Gaps = 38/513 (7%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             +VR+ RGKS LITG TGFLGKVL+EKILR  PDV KI++LI+A + E A +R++ E+   
Sbjct  11    VVRYFRGKSILITGSTGFLGKVLVEKILRVQPDVKKIFLLIRAADVESAKQRVETEVTGR  70

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAANTTF  819
             E+F+ LK  +G  ++ F+  K+ P+ G+V   +LG+       + KE+DIIVN AA T F
Sbjct  71    EIFQILKNKHGNGFEGFIQEKICPLPGDVMYENLGLGPAKLREVCKEIDIIVNGAATTNF  130

Query  820   DERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIAG  999
              ERYDVA D N  G   + +FA +C KLK+ LHVSTAYV G+++G ++EKPF +GE++  
Sbjct  131   YERYDVAFDTNVMGAKHICEFAKRCSKLKMLLHVSTAYVAGEQEGVVLEKPFRLGETL--  188

Query  1000  ESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK-----MKELGLERANKFGWQD  1164
                    +E +   L++E E+ ++   ++ L     ++K     MK+LGL+RA +FGW +
Sbjct  189   -------REGT--HLDIESELNLIKETRRELKANCSSEKVERRTMKDLGLKRAREFGWPN  239

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEM++ ++RG++PVVIVRPS+I S   EP PGWMEG R +D  I+ Y K  L
Sbjct  240   TYVFTKAMGEMLLGHLRGDLPVVIVRPSIITSILNEPLPGWMEGIRTIDSFIIGYAKQAL  299

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
             + FLVD   ++DV+P DMVVNA + AMA H        SIYH+ SSV +P  +  LA   
Sbjct  300   SIFLVDLELIMDVIPGDMVVNAMMVAMAAHSEEQAQQLSIYHLTSSVRHPAPYAVLAECG  359

Query  1525  YEHFQSKPYI--------DSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDS  1677
             + +F   P +         + G+P+   RM+ F ++    +++  +  + +  L  L  +
Sbjct  360   HRYFLHNPLMRSGSGSGGKNSGEPVRPARMRFFRTLPRFRAYMAVKFRLPREILRLLNIA  419

Query  1678  K-GKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMS----------  1824
               G  S + + + RK      ++A +Y PY  + G FD+SN ++L   M+          
Sbjct  420   LCGAFSRRYDELSRK-YRYVMHIAELYAPYALFKGCFDDSNTERLRVAMANNNNNNNNNG  478

Query  1825  KEERW-QFGFEVESIDWKDYISNVHIPGLRRHV  1920
             ++ ++ +FGF+ + IDW DY   VHIPG+ +++
Sbjct  479   QDRKYDEFGFDPKCIDWDDYFYRVHIPGVVKYL  511



>ref|XP_006347238.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=491

 Score =   384 bits (987),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 189/494 (38%), Positives = 311/494 (63%), Gaps = 11/494 (2%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              +++FL  +S L+TG TGFL K+ +EKILR  P+V K+Y+L++A +   A++R   E ++
Sbjct  5     SVLKFLENRSILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAQDNNAALQRFNNEAVA  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
              +LFK L++ +G +    +  +   + G++   +LG+ D +  E + +EVD++VN AA T
Sbjct  65    KDLFKLLREKHGANLNTLISERTRIIPGDITFENLGVKDSNLLEEMWREVDVVVNLAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDV+L +NT G   ++ FA +C KLK+ LHVSTAYV+G+++G I+E P+ +GE++
Sbjct  125   NFDERYDVSLGLNTFGAINVLNFAKKCSKLKVLLHVSTAYVSGEKRGLILETPYNLGETL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G S ++   E  V    +E+ ++ +    +G S  ++   MKELGL+RA K+GW + YV
Sbjct  185   NGTSGLDIYTEKKV----MEETLKQL--RLEGSSQESITSAMKELGLQRARKYGWPNPYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKA+ EM++ +++ ++P+VI RP+++ ST ++PFPGW+EG R +D + + YGKG+LT F
Sbjct  239   FTKALAEMILGDLKEDVPLVIFRPTIVTSTLQDPFPGWVEGIRTIDSLAVGYGKGKLTCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             L DP  ++D++PADMVVNA +  M  H A  +    IYH+ +SV NP+ F       + +
Sbjct  299   LGDPEAIIDLIPADMVVNAMIVTMMAH-ADQRGSQIIYHVGTSVSNPVTFACPQENAFRY  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENI  1710
             F+  P+ID +GKP+ V ++ + SSM++   ++  R  +   GL  L     +L     + 
Sbjct  358   FKEHPWIDKQGKPVIVGKVNVLSSMDSFRRYMALRYMLPLKGLEILNTILCQLFQDKYSE  417

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYI  1884
               + ++    L  +YEPY F+ G +D+ N +KL     +   E   F F  +SI+W+DY 
Sbjct  418   LDRKIKFVMRLIDLYEPYLFFKGVYDDMNTEKLRRAAKESGIETDVFNFNPKSINWEDYF  477

Query  1885  SNVHIPGLRRHVMK  1926
              N HIPG+ ++V+K
Sbjct  478   RNTHIPGVVKYVLK  491



>ref|XP_004241314.1| PREDICTED: fatty acyl-CoA reductase 3 [Solanum lycopersicum]
Length=491

 Score =   384 bits (987),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 193/502 (38%), Positives = 312/502 (62%), Gaps = 27/502 (5%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              +++FL  ++ L+TG TGFL K+ +EKILR  P+V K+Y+L++A +   A++R   E ++
Sbjct  5     SVLKFLENRAILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAQDNNAALQRFNNEAVA  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANT  813
              +LFK L++ +G +   F+  +   + G++   +LG+ D +  E + +EVD++VN AA T
Sbjct  65    KDLFKLLREKHGANLNTFISERTTIIPGDITIENLGVKDTNLLEEMWREVDVVVNLAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL +NT G   ++ FA +C KLK+ LHVSTAYV+G+++G I+E P+ +GE++
Sbjct  125   NFDERYDVALGLNTFGAINVLNFAKKCSKLKVLLHVSTAYVSGEKRGLILETPYNLGETL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G S ++   E  V    +E+ ++ +    +G S  ++   MKELGL+RA K+GW + YV
Sbjct  185   NGTSGLDIYTEKKV----MEETLKQL--RVEGSSQESITSAMKELGLQRARKYGWPNPYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKA+ EM++ +M+ ++ +VI RP+++ ST ++PFPGW+EG R +D + + YGKG+LT F
Sbjct  239   FTKALAEMILGDMKEDVLLVIFRPTIVTSTLRDPFPGWVEGIRTIDSLAVGYGKGKLTCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             L DP  ++D++PADMVVNA +  M  H A  +    IYH+ +SV NP+ F       + H
Sbjct  299   LGDPEAIIDLIPADMVVNAMIVTMMAH-ADQRGSQIIYHVGTSVSNPVKFTCPQEYAFRH  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALG--------DSKGK  1686
             F+  P+ID +GKP+ V ++ + SSM++   ++  R  +   GL  +         D   +
Sbjct  358   FKEHPWIDKQGKPVIVGKVNVLSSMDSFRRYMALRYMLPLKGLEIVNTILCQFFQDKYSE  417

Query  1687  LSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVE  1860
             L  K++ + R        L  +YEPY F+ G +D+ N +KL     +   E   F F  +
Sbjct  418   LDRKIKFVMR--------LIDLYEPYLFFKGVYDDMNTEKLRRAAKESGIETDVFNFNPK  469

Query  1861  SIDWKDYISNVHIPGLRRHVMK  1926
             SI+W+DY  N HIPG+ ++V K
Sbjct  470   SINWEDYFMNTHIPGVVKYVFK  491



>emb|CDY48435.1| BnaA08g11440D [Brassica napus]
Length=480

 Score =   384 bits (986),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 202/495 (41%), Positives = 299/495 (60%), Gaps = 25/495 (5%)
 Frame = +1

Query  448   DGIGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKE  627
             + + ++++L  KS L+ G  GFL  + +EKILR  P+V K+Y+L++A N++ A +R K E
Sbjct  6     EAVSVLQYLDNKSILVIGAAGFLANIFVEKILRVAPNVKKLYLLLRASNEKSATQRFKDE  65

Query  628   IISAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTAEMIAKEVDIIVNSAA  807
             I+  +L+K +K+ YG +       K+  V G++C +DLGI D  A  +  +VD I+N AA
Sbjct  66    ILGKDLYKVVKEKYGPNLTQLTSEKVTVVNGDICLADLGIQDSLAHEMIHQVDAIINLAA  125

Query  808   NTTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGE  987
              T FDERYDVAL INT GP  ++ FA +C   K+F+HVSTAYV+G++ G I+E P+ +GE
Sbjct  126   TTKFDERYDVALGINTLGPLNVLDFAKKCENAKIFVHVSTAYVSGEKSGLIMETPYRMGE  185

Query  988   SIAGESVVNGNQESSVPKLNVEDEM-EMVLSAKQGLSDGAMAQKMKELGLERANKFGWQD  1164
             ++ G + ++ N E  +    V+D   EM+++                  + RA  +GW +
Sbjct  186   TLNGTTGLDINHERKL----VQDVYGEMIINLHN---------------IYRAKMYGWPN  226

Query  1165  TYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQL  1344
             TYVFTKAMGEMM+   R NI +V++RPS+I ST KEPFPGW EG R +D + + YGKG+L
Sbjct  227   TYVFTKAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGRL  286

Query  1345  TGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLL  1524
             T FL D N + DV+PADMVVN+ L +MA    AGK    IYH+ SS  NPL  +    + 
Sbjct  287   TCFLGDLNAISDVMPADMVVNSILVSMA--AQAGKQKEIIYHLGSSQKNPLKNEKFPEVA  344

Query  1525  YEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKL  1701
             Y++F +KP+ +  GKP+ V ++++ SSM +   ++    +I   GL  L     KL  K 
Sbjct  345   YQYFTTKPWTNKDGKPVHVRKIEILSSMPSFHRYMAIHYSIPLKGLAVLNMVLCKLLDKS  404

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWK  1875
                  + +  A  L  +Y+PY F+ G FD+SN +KL   + K   E   F F+ + I+W 
Sbjct  405   VKDFHRKINLALRLVDLYQPYLFFYGVFDDSNTEKLQRMVLKTGIETEMFYFDPKIINWD  464

Query  1876  DYISNVHIPGLRRHV  1920
             DY    HIPGL ++V
Sbjct  465   DYFVKTHIPGLVKYV  479



>ref|XP_003539817.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
1 [Glycine max]
 gb|KHN21131.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   384 bits (987),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 203/497 (41%), Positives = 313/497 (63%), Gaps = 17/497 (3%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             I+ FL+ K+ LITG TGFL KVL+EKILR  P+V K+Y+L++A + + A  RL  EII  
Sbjct  6     ILHFLQDKNILITGATGFLAKVLLEKILRVQPNVKKLYLLLRAADAKSATHRLNNEIIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANTT  816
             +LF+ LK+  G ++  F+  KL  V G++   DLG++D    E I  + D+I+N AA T 
Sbjct  66    DLFRVLKEKLGANFNSFVSKKLTLVPGDISREDLGLEDSILREEIYDQTDVIINLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQ--RQGKIIEKPFCIGES  990
             FDERYD++L +NT G   ++ FA +C KL++ +HVSTAYV G+  R+G I+EKP+ +G+S
Sbjct  126   FDERYDISLGLNTFGVKYVINFAKKCTKLEVLVHVSTAYVCGEGGREGLILEKPYHLGDS  185

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G S ++ N E  V    V D++  +   + G ++  + + MK+LG+ RA  +GW +TY
Sbjct  186   LNGVSGLDINAEEKV----VRDKLSEL--QQLGATEKEIKEVMKDLGISRAKLYGWPNTY  239

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM+++ ++GN+ VV +RP+++ ST KEPFPGW EG R +D + + YGKG+LT 
Sbjct  240   VFTKAMGEMLVEQLKGNLSVVTIRPTIVTSTFKEPFPGWAEGVRTIDSLAVAYGKGKLTC  299

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTS-IYHIASSVVNPLVFDDLARLLY  1527
             FL D   ++D +PADMVVNA L AM  H  A  P    IYH+ SSV  PL + +L    +
Sbjct  300   FLGDLKAIVDAIPADMVVNAILVAMVAH--ANHPSDDVIYHVGSSVRRPLRYGNLQEYGF  357

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGK-LSTKL  1701
              +F +KP I+  G+P+ V ++ + S+M++   +++ R  +   GL     +  +      
Sbjct  358   RYFTAKPCINKDGRPVKVGKVTVLSNMDSFRRYMFIRYLLVLKGLELANTAFCQYFQGTY  417

Query  1702  ENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWK  1875
              N+ RK ++    L  +Y+PY F+   FD+ N +KL     +   E   F F+ E IDW+
Sbjct  418   LNLNRK-IQIVMRLVDLYKPYLFFKAAFDDMNTEKLRMAARQGGVETDLFYFDPELIDWE  476

Query  1876  DYISNVHIPGLRRHVMK  1926
             DY  N+H+PG+ ++++K
Sbjct  477   DYFLNIHLPGVVKYILK  493



>gb|KDP42364.1| hypothetical protein JCGZ_01940 [Jatropha curcas]
Length=492

 Score =   384 bits (987),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 196/500 (39%), Positives = 306/500 (61%), Gaps = 22/500 (4%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              ++ F+  K+ L+TG TG+L K+ +EKILR  P V K Y+L++A +   A ER   E++ 
Sbjct  5     SVLEFIENKTILVTGATGYLAKIFVEKILRVQPKVKKFYLLLRASDANSANERFHDEVLG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
              +LFK L++ YG +   F+  KL+PV G++   DLG+ D +  + + KE+D+++N AA T
Sbjct  65    KDLFKVLREKYGANLNSFVSEKLIPVAGDISCEDLGVKDSYLRDEMFKEIDLVINFAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYD+AL INT G   ++ FA +C K K+ +HVSTAYV G+  G I+EKPF +G   
Sbjct  125   NFDERYDIALGINTLGALHVLNFAKKCLKAKMLVHVSTAYVCGEDSGIILEKPFTMGRPK  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G S ++   E  +    +E+++  ++S  +  S+  +   MK+ G+ERA  FGW +TYV
Sbjct  185   KGTSEIDIEMEKKL----LEEKLNELIS--ENASEKEITAFMKDFGIERARAFGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKA+GEM++ + + N+P++I+RP++I ST+KEPFPGW+EG R +D +I  Y KG++T F
Sbjct  239   FTKAIGEMLLMHFKKNMPLLIIRPTMITSTYKEPFPGWIEGVRTIDSVIAGYAKGKVTCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             + DP   LDV+P DMVVN  + AMA    A +    IYH+ SS+ NP+   ++    + +
Sbjct  299   ISDPQSTLDVIPGDMVVNGIIVAMA--ARAKQSSEIIYHLGSSLRNPVKLSNIHDFTFHY  356

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLWRDAID-KSGLTALGDSKGKLSTKLENI  1710
             F + P+I   G P+ + R  + SSM     ++   AI  +  L AL  +   +  K E+ 
Sbjct  357   FSANPWISKDGSPVKIQRGTILSSMARFRMYM---AIRFQLPLQALKLANTMVFKKYEDT  413

Query  1711  ---CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLM-----ECMSKEERWQFGFEVESI  1866
                  + +     L  +Y+PY F+ G FD++N++KL      + M+ E    F F+  +I
Sbjct  414   YASLNRKINLVMRLVDLYKPYVFFQGIFDDTNSEKLRIAARDQTMATEAN-GFNFDPTTI  472

Query  1867  DWKDYISNVHIPGLRRHVMK  1926
             DW+ Y+ NVHIPGL ++VMK
Sbjct  473   DWEKYMMNVHIPGLVKYVMK  492



>ref|XP_010271728.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nelumbo nucifera]
Length=490

 Score =   384 bits (986),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 310/495 (63%), Gaps = 12/495 (2%)
 Frame = +1

Query  454   IGIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEII  633
             +GI+  L  K+ L TG TGF+ K+ +EK+LR  P+V K+Y+L++A + + A++RL  E++
Sbjct  4     VGIMESLENKTILATGATGFVAKIFVEKVLRVQPNVKKLYLLLRAPHTKSAIQRLHNEVL  63

Query  634   SAELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAAN  810
               E+F+ L+Q  G  +  FM  K++PV G++   +LG+++    + + +EVDI+VN AA 
Sbjct  64    GKEVFRVLRQKLGSGFDSFMSEKVIPVPGDITCKNLGVEETDLRDKMWREVDIVVNIAAT  123

Query  811   TTFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGES  990
               FDERYD +L INT G   +++FA +C KL++F+HVSTAYV GQ++G I+EKP+ +GE+
Sbjct  124   VNFDERYDDSLHINTMGAKHVLEFAKKCSKLQIFVHVSTAYVGGQQEGLILEKPYQMGET  183

Query  991   IAGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTY  1170
             + G   ++  QE  V     E+ ++ + + K  + +  +A  MKELGL+RA  +GW +TY
Sbjct  184   LNGTLGLDIQQELKV----AEERLKELQAEKITIKEERIA--MKELGLKRARLYGWPNTY  237

Query  1171  VFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTG  1350
             VFTKAMGEM++ + R NIP+VI+RP++I ST+ EPFPGW+EG R +D +IL Y KG LTG
Sbjct  238   VFTKAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYSKGGLTG  297

Query  1351  FLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYE  1530
             F  DP  ++DV+P DMV N+   A+  H     P   IYH+ SSV +P+ F  L    Y 
Sbjct  298   FPGDPKLIMDVIPGDMVANSITVAIVAH--LNHPSEFIYHVGSSVTHPVQFAMLRETAYR  355

Query  1531  HFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLEN  1707
             +F   P +DS  KP+ V R+++F++M+    ++  R  I    L  L  +  +    +  
Sbjct  356   YFSVNPCMDSYEKPVKVGRIEMFNNMDDFRRYMAIRYFIPLKVLQVLNMAFCQYFKGIYG  415

Query  1708  ICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMEC--MSKEERWQFGFEVESIDWKDY  1881
               ++ +     L  +YEPY ++ G FD+ N + L +   ++  +   F F+ + I+W++Y
Sbjct  416   DLKRKINFVMRLVELYEPYLYFKGVFDDLNTEMLRKAALVNYADASMFQFDPKCINWENY  475

Query  1882  ISNVHIPGLRRHVMK  1926
               N+H PGL ++V K
Sbjct  476   FVNIHFPGLVKYVFK  490



>ref|XP_002263184.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase isoform X1 
[Vitis vinifera]
 emb|CBI28354.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 199/498 (40%), Positives = 309/498 (62%), Gaps = 20/498 (4%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              IV FL  KS L+TG TGFL K+ +EKILR  P+V K+++L++A + + A +RL  E++ 
Sbjct  5     SIVEFLENKSILVTGATGFLAKIFVEKILRIQPNVKKLFLLLRAADTKSATQRLHNEVLG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANT  813
              ELF+ LK  +G +   F+  K+ P+ G++   +LG+ + +  E I +EVD+I+N AA T
Sbjct  65    KELFRVLKDKWGSNLNSFISEKVTPIPGDISCENLGVTNLNLREEIWREVDVILNLAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G + ++ F+ +C KLK+ LHVSTAYV+G+R+G I+E P  +G+++
Sbjct  125   KFDERYDVALGINTLGASHVLNFSKKCVKLKMLLHVSTAYVSGEREGLILESPLKMGKAL  184

Query  994   AGESVVNGNQESSVPK--LNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDT  1167
              G S ++ ++E  + +  LN  +E++         ++  ++  MKELG++RA  +GW +T
Sbjct  185   NGASGLDVDKEKKLVEEGLNELNELQA--------TEETISLTMKELGMKRALMYGWPNT  236

Query  1168  YVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLT  1347
             YVFTKAMGEM++   + N+P+VI+RP++I ST+ EPF GW+EG R +D ++  Y KG+LT
Sbjct  237   YVFTKAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDNVLAGYCKGKLT  296

Query  1348  GFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLY  1527
               L DP  +LD +P DMVVN  + AM  H  A +P   IY + SS+ NPL   DL    +
Sbjct  297   CLLADPECILDAIPGDMVVNCMIVAMVAH--ANQPCEIIYQVGSSLKNPLKLLDLHDFFF  354

Query  1528  EHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLE  1704
             ++F   P+I+  GK + V ++ LFS+      +L  R  +    L  L     ++   + 
Sbjct  355   KYFHENPWINKDGKAVKVSKLILFSTTFVFHGYLAVRYMLPLKVLQFLNFLLCQILCGMC  414

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKL----MECMSKEERWQFGFEVESIDW  1872
                 + ++   YL  +Y+PY F+ G FD+ N  KL     E  SK +   F F+ + IDW
Sbjct  415   TDHNRKIKMLMYLVELYKPYLFFKGIFDDLNTDKLRLAATESSSKADL--FYFDPKCIDW  472

Query  1873  KDYISNVHIPGLRRHVMK  1926
             +DY  N+HIPG+ ++V+K
Sbjct  473   EDYFINIHIPGVLKYVLK  490



>ref|XP_010943712.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Elaeis guineensis]
Length=490

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/494 (39%), Positives = 304/494 (62%), Gaps = 12/494 (2%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
             GI+  L+ K+ L+TG TGFL K+ +EK+LR  P+V K+++L++A +   AM R++ E+I 
Sbjct  5     GILERLKDKNLLVTGCTGFLAKIFVEKVLRVQPNVKKLFLLVRAIDTTSAMHRVQTEVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANT  813
              ELFK LK+ +G  +Q F+  KL PV G++   +LGI D    E + K++DI+VN AA T
Sbjct  65    KELFKILKEGHGNGFQSFIAEKLFPVAGDIIHENLGIRDSDLIEELRKKIDIVVNVAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVALDIN  G   +++FA +C KL++ LHVS+A+V G ++G I+E  F +GE++
Sbjct  125   AFDERYDVALDINVIGAKHVLEFAKKCVKLEMLLHVSSAFVAGMKEGLILETAFRMGETL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
                S ++   E     L + +E +  L A + + D      MKE+G++RA  FGW +TYV
Sbjct  185   KENSYLDIEAE-----LMLVEEKKRELRANRSVEDDE-TTAMKEMGMKRARFFGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             +TKA+GEM++ ++RG++P+VI+RP++I S +KEP PGW+EG+R +D +I+ Y KG+L+ F
Sbjct  239   YTKALGEMLLGHLRGDLPLVILRPTIITSIYKEPLPGWIEGSRTIDILIIGYAKGKLSCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
               +P  + D+VP DMV NA +  M  H    +    IYHI+S V NP+ +  L +  + +
Sbjct  299   FGEPELIADLVPGDMVANAMIVTMTAH--LNQRSEFIYHISSGVSNPVTYATLEQCGFRY  356

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENI  1710
             F   P +   G+ I   R+ +F +M    +++  R  +   GL  +  +  +L  K    
Sbjct  357   FLENPRVGKDGRTIKTKRLSIFRTMSGFQTYVTLRYRLPLEGLRLVNLAFCRLFDKRYKE  416

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEE--RWQFGFEVESIDWKDYI  1884
              R+  +   +L  +Y PY F+ G FD+ N ++L   M K+        F+ +SIDWKDY 
Sbjct  417   LRRKFDFMMHLVDLYSPYAFFKGCFDDINLERLRMTMMKDNVVATSLNFDPKSIDWKDYF  476

Query  1885  SNVHIPGLRRHVMK  1926
               VHIPG+ ++V K
Sbjct  477   YRVHIPGVLKYVCK  490



>ref|NP_197642.1| fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
 sp|Q39152.1|FACR1_ARATH RecName: Full=Fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
 emb|CAA68191.1| male sterility 2-like protein [Arabidopsis thaliana]
 dbj|BAB09122.1| male sterility 2-like protein [Arabidopsis thaliana]
 gb|AAK59547.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|AAK93752.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|ABZ10951.1| fatty acyl CoA reductase [Arabidopsis thaliana]
 gb|AED93034.1| fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
Length=491

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 210/505 (42%), Positives = 309/505 (61%), Gaps = 37/505 (7%)
 Frame = +1

Query  463   VRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISAE  642
             V+FL  K+ LITG  GFL KVL+EKILR  P+V KIY+L++A +++ AM+RL+ E++  +
Sbjct  6     VQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKIYLLLRAPDEKSAMQRLRSEVMEID  65

Query  643   LFKFLKQTYGK-SYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANTT  816
             LFK L+   G+ +    M  K+VPV G++   +LG+ D    + +  E+DII+N AA T 
Sbjct  66    LFKVLRNNLGEDNLNALMREKIVPVPGDISIDNLGLKDTDLIQRMWSEIDIIINIAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYD+ L INT G   ++ FA +C K +L LHVSTAY++G++ G ++EKPF +GE+++
Sbjct  126   FDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYISGEQPGLLLEKPFKMGETLS  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G+  ++ N E         D M+  L   Q  SD  ++Q MK+ G+ RA   GW +TYVF
Sbjct  186   GDRELDINIE--------HDLMKQKLKELQDCSDEEISQTMKDFGMARAKLHGWPNTYVF  237

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++   R N+P+VI+RP++I ST  EPFPGW+EG + +D +I+ YGKG+L  FL
Sbjct  238   TKAMGEMLMGKYRENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGRLKCFL  297

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFDDLARLLYEH  1533
              D N V D++PADMVVNA +AA   H  +G  G  +IYH+ SS  NP+ F  L      +
Sbjct  298   ADSNSVFDLIPADMVVNAMVAAATAH--SGDTGIQAIYHVGSSCKNPVTFGQLHDFTARY  355

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---WRDAIDKSGLTAL------GDSKGK  1686
             F  +P I   G PI V +  + S+M   S ++   ++  +    L  +      GD+   
Sbjct  356   FAKRPLIGRNGSPIIVVKGTILSTMAQFSLYMTLRYKLPLQILRLINIVYPWSHGDNYSD  415

Query  1687  LSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKEERWQ-----FGF  1851
             LS K        ++ A  L  +Y+PY  + G FD+ N ++L   M ++E  +     F F
Sbjct  416   LSRK--------IKLAMRLVELYQPYLLFKGIFDDLNTERLR--MKRKENIKELDGSFEF  465

Query  1852  EVESIDWKDYISNVHIPGLRRHVMK  1926
             + +SIDW +YI+N HIPGL  HV+K
Sbjct  466   DPKSIDWDNYITNTHIPGLITHVLK  490



>ref|XP_002263127.1| PREDICTED: fatty acyl-CoA reductase 3 [Vitis vinifera]
 emb|CBI28353.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   383 bits (983),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/501 (39%), Positives = 310/501 (62%), Gaps = 28/501 (6%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             IV FL  KS L+TG TGFL K+ +E+ILRT P+V K+++L++A + + A +RL  E+I  
Sbjct  6     IVEFLENKSILVTGATGFLAKIFVERILRTQPNVKKLFLLLRAGDTKSATQRLHNEVIGK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANTT  816
             ELF  L++ +   +  F+  KL PV G++   DLG+ D +  E + +EVDI+VN AA T 
Sbjct  66    ELFWVLREKWASDFNSFVSKKLTPVPGDISCDDLGVTDSNLREEMWREVDIVVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL IN  G   ++ FA +C K+K+ LHVSTAYV G++ G I+E+PF +GE++ 
Sbjct  126   FDERYDVALGINALGARHVLDFAKKCVKIKMLLHVSTAYVAGEQSGLILEQPFQMGETLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G   ++  +E  +    +E+ ++ + S  +G +  A+   MK+ G++RA   GW +TYVF
Sbjct  186   GTFGLDIEEEKKL----MEERLDELQS--EGATREAVTLAMKDFGIQRAKMHGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TKAMGEM++ +++ N+P+ I+RP+++ ST+KEPFPGW+EG R +D   + YGKG+LT FL
Sbjct  240   TKAMGEMLLGHLKENLPLAILRPTIVSSTYKEPFPGWVEGIRTIDSFAVGYGKGRLTFFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEHF  1536
              D   ++DV+PADMVVN+ + AMA H  A +P   IY + SSV NP+ + +L      +F
Sbjct  300   GDIEAIVDVIPADMVVNSMIVAMAAH--ANQPCEVIYQVGSSVKNPVRYSNLQDFGLRYF  357

Query  1537  QSKPYIDSKGKPIDVPRMKLFSSMEALSSHL---------WRDAIDKSGLTALGDSKGKL  1689
                P+I+  GK + V ++ + S+M++   ++             ++ +       +   L
Sbjct  358   TKNPWINKDGKAVKVGKVTVLSTMDSFHRYMALRYLLLLKGLQFVNTAFCQYFRGTYTDL  417

Query  1690  STKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECM--SKEERWQFGFEVES  1863
             + +++ + R        L  +Y+PY F+ G FD+ N +KL   +  S  E   F F+ + 
Sbjct  418   NRRIKFLLR--------LIELYKPYLFFKGVFDDMNTEKLRMAVTASGAEADLFYFDPKC  469

Query  1864  IDWKDYISNVHIPGLRRHVMK  1926
             IDW+DY  N+HIPG  ++V K
Sbjct  470   IDWEDYFMNIHIPGAVKYVFK  490



>ref|XP_007208215.1| hypothetical protein PRUPE_ppa018909mg [Prunus persica]
 gb|EMJ09414.1| hypothetical protein PRUPE_ppa018909mg [Prunus persica]
Length=493

 Score =   382 bits (981),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 303/496 (61%), Gaps = 11/496 (2%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I+ +L+ K+ L+TG TGFLG V +EKILR  PDV KIY+L++A + + A +R+  +II 
Sbjct  5     SILGYLQNKTILVTGATGFLGMVFVEKILRVQPDVKKIYLLLRASDTKSATDRMHNQIIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHTA-EMIAKEVDIIVNSAANT  813
              ELF+ L++ +G  +  F+  K+V V G+V   DLG+ +    E +  +++II+NSA  T
Sbjct  65    KELFRVLREKWGSEFDSFIAKKVVAVPGDVTFDDLGVKEFKLREEMWTDIEIILNSAGTT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYD+AL +NT G   ++ FA +C KL++ LHVSTAY+ G+R+G I+E   C+ E  
Sbjct  125   NFDERYDIALSVNTFGVQHVLSFAKKCLKLEILLHVSTAYICGEREGLILEDSSCMEEME  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
                +  +      V + N+ +E    L A Q  ++  +   MK+ G+ERA   GW +TYV
Sbjct  185   KEITTFD----FKVQEKNLVEEKLNELKA-QNATEEVITTTMKDFGIERAKLHGWPNTYV  239

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGE+++ + + N+ VVI+RP+V+ ST+KEPFPGW++G R +D +I  Y KG+LT  
Sbjct  240   FTKAMGEILLRHSKDNLSVVIIRPTVVTSTYKEPFPGWVQGFRTIDSVIAGYCKGKLTCL  299

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             LVDP  V D+VP DMVVN+   AM  +  A K  + IYH+ SS+ NP+ F  +   ++ +
Sbjct  300   LVDPKSVFDMVPVDMVVNSITVAMVAN--ANKSSSIIYHVGSSLRNPINFLTIHCFVFRY  357

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHLW-RDAIDKSGLTALGDSKGKLSTKLENI  1710
             F   P+ID  GKP+ V + K+F +M     ++  R  +   GL  +  + G+    L   
Sbjct  358   FTKNPWIDKDGKPVKVGKGKIFKTMATFRMYMQIRFMLPLEGLKFVNKAFGEYFQDLYVN  417

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQFGFEVESIDWKDYI  1884
               + ++    L  +YEPY  + G FD++NA+ L     +   E   F F+ + IDW+DYI
Sbjct  418   YNQKLKLVMRLVELYEPYMLFKGIFDDNNAEDLRRITRESFVESETFNFDPKCIDWEDYI  477

Query  1885  SNVHIPGLRRHVMKGR  1932
              + HIPGL++HVM  R
Sbjct  478   MHTHIPGLQKHVMLKR  493



>ref|XP_009611540.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nicotiana 
tomentosiformis]
Length=492

 Score =   382 bits (981),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 202/497 (41%), Positives = 320/497 (64%), Gaps = 18/497 (4%)
 Frame = +1

Query  460   IVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIISA  639
             IV+FL  ++ L+TG TGFL K+ +EKILR  P+V K+Y+L++A + + A++R   E+++ 
Sbjct  6     IVKFLENRTILVTGATGFLAKIFVEKILRIQPNVKKLYLLLRAADDKAAIQRFNTEVVAK  65

Query  640   ELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGI-DDHTAEMIAKEVDIIVNSAANTT  816
             +LFK LK+  G ++  F+  +   V G++   +LG+ D +  + + +EVDI+VN AA T 
Sbjct  66    DLFKVLKEKCGANFCTFVCQRTTVVPGDITCENLGVKDSNLLDEMWREVDIVVNLAATTN  125

Query  817   FDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESIA  996
             FDERYDVAL INT G   ++ FA +C+KLK+ LHVSTAYV G++ G ++E P+ +GE++ 
Sbjct  126   FDERYDVALGINTFGARHVLSFAKKCNKLKVLLHVSTAYVCGEKPGLMLETPYYMGETLN  185

Query  997   GESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYVF  1176
             G S ++   E  +    +E+ ++ + +  +  SD A+   +KELGLERA K+GW +TYVF
Sbjct  186   GTSGLDIEAEKKL----IEETLKQLKA--EDASDKAITIALKELGLERARKYGWPNTYVF  239

Query  1177  TKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGFL  1356
             TK MGEM++ N++ ++P+VIVRP++I ST KEPFPGW+EG R +D + + YGKG++T FL
Sbjct  240   TKTMGEMLLGNLKEDVPLVIVRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGRITCFL  299

Query  1357  VDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGT-SIYHIASSVVNPLVFDDLARLLYEH  1533
              +P  +LDV+PADMVVNA + AM  H  A + G+ +IY + SSV NPL   +L    + +
Sbjct  300   GNPKTILDVIPADMVVNAMIVAMVAH--ADQMGSETIYQVGSSVSNPLEITNLKEYGFNY  357

Query  1534  FQSKPYIDS-KGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGK-LSTKLE  1704
             F+  P+I+   GKPI V ++ + S+M++   ++     +   GL  +  +  +    K  
Sbjct  358   FRKYPWINKMDGKPIIVGQVTMLSTMDSFRKYMALHYLLPLKGLEIVNTACCQYFQGKYL  417

Query  1705  NICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE---ERWQFGFEVESIDWK  1875
              + RK ++    L  +Y PY F+   FD+ N +KL   ++KE   E   F F+ ++I+W+
Sbjct  418   ELYRK-IKFVMRLIDLYGPYLFFKSIFDDLNTEKL-RMVAKESGVETDIFYFDPKTINWE  475

Query  1876  DYISNVHIPGLRRHVMK  1926
             DY    H+PG+ R+V K
Sbjct  476   DYFMKTHLPGVVRYVFK  492



>ref|XP_010244271.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nelumbo 
nucifera]
Length=492

 Score =   382 bits (980),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 202/509 (40%), Positives = 305/509 (60%), Gaps = 38/509 (7%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
             GIV  +  K+ L+TG TGF+ K+ +EK+LR  P+V K+Y+L++A + + A +RL  E+I 
Sbjct  5     GIVESIGNKTILVTGATGFVAKLFVEKVLRVQPNVKKLYLLLRAPDTKSATQRLHNEVIE  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDD-HTAEMIAKEVDIIVNSAANT  813
              E+F+ L+Q +G  +  F+  K+ PV G++   +LG++D    + + +E+DI+VN AA  
Sbjct  65    KEVFRVLRQKHGAGFDSFISEKVTPVPGDISCENLGVEDCDLRDEMWREIDIVVNMAATV  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYD AL  NT G   ++ FA +C KL++F+HVSTAYV GQ++G I+EKP+ +GE++
Sbjct  125   NFDERYDDALYTNTLGVKHVLNFAKKCAKLQMFVHVSTAYVAGQQEGVIMEKPYRMGETL  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQK-----MKELGLERANKFGW  1158
              G            P L++E E+++     + + D    +K     MKELGL RA  +GW
Sbjct  185   NG-----------TPGLDIEQELKVAEERSKEVQDLGFTKKQERIAMKELGLTRARLYGW  233

Query  1159  QDTYVFTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKG  1338
              +TY FTKAMGEM+I N+R N+PVVI+RP++I ST+ EPFPGW+EG R +D + L YGKG
Sbjct  234   PNTYTFTKAMGEMLIGNLRENMPVVIIRPTMITSTYYEPFPGWIEGLRTIDSLALGYGKG  293

Query  1339  QLTGFLVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLAR  1518
             +LT FL +P  ++D++P DMVVN+ + AM  H    +P   IYH+ SSV  PL    +  
Sbjct  294   KLTFFLGNPKMIIDLIPGDMVVNSIIVAMVAH--LNQPCEHIYHVGSSVSQPLQVTFVQE  351

Query  1519  LLYEHFQSKPYIDSKGKPIDVPRMKLFSSMEALSSH-LWRDAIDKSGLTALG--------  1671
             + Y +F   P +D    PI V ++ +FS+M+    + L R  I   GL  L         
Sbjct  352   IGYHYFAMNPCMDKDENPIKVGKVAIFSNMDDFRRYMLIRYLIPLKGLQLLNVVCCQYFE  411

Query  1672  DSKGKLSTKLENICRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE--ERWQF  1845
              + G L  K+  + R        L  +YEPY F+ G FD+ N + L +   K   E   F
Sbjct  412   GAYGDLKRKISFVLR--------LLELYEPYLFFKGVFDDLNTEMLRKATLKNEVEASMF  463

Query  1846  GFEVESIDWKDYISNVHIPGLRRHVMKGR  1932
              F+ + I+W +Y  N H+PGL ++V + +
Sbjct  464   CFDPKHINWANYFMNTHLPGLVKYVFRSQ  492



>ref|XP_002313667.2| acyl CoA reductase family protein [Populus trichocarpa]
 gb|EEE87622.2| acyl CoA reductase family protein [Populus trichocarpa]
Length=489

 Score =   382 bits (980),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 194/494 (39%), Positives = 312/494 (63%), Gaps = 14/494 (3%)
 Frame = +1

Query  457   GIVRFLRGKSFLITGGTGFLGKVLIEKILRTVPDVHKIYILIKADNKEVAMERLKKEIIS  636
              I++FL  K+ L+TG TG+L K+ +EKILR  P+V + Y+L++A + + A ERL+ E+I 
Sbjct  5     SILQFLENKTILVTGATGYLAKIFVEKILRVQPNVKRFYLLLRAADAKSATERLRDEVIG  64

Query  637   AELFKFLKQTYGKSYQVFMLSKLVPVVGNVCESDLGIDDHT-AEMIAKEVDIIVNSAANT  813
              +LF+ L++ +G S   F+  K+ PV G++   DLG+ D +  + + +E+D+++N AA T
Sbjct  65    KDLFRVLREKHGASLHSFISEKVTPVPGDISYEDLGVKDSSLKDEMWREIDVVLNFAATT  124

Query  814   TFDERYDVALDINTGGPNRLMKFAHQCHKLKLFLHVSTAYVNGQRQGKIIEKPFCIGESI  993
              FDERYDVAL INT G   ++ FA +C K+K  +HVSTAYV G+  G I+E+P+ +G + 
Sbjct  125   NFDERYDVALGINTLGALHVLNFAKKCVKIKTLVHVSTAYVCGEDAGLILEQPYHMGMAK  184

Query  994   AGESVVNGNQESSVPKLNVEDEMEMVLSAKQGLSDGAMAQKMKELGLERANKFGWQDTYV  1173
              G+  ++ N E  + +  + +E+++     Q + +  +   MK+ G+ERA  FGW +TYV
Sbjct  185   RGDEKIDINFEKKMVQEKI-NELKL-----QDVPEKEITSAMKDFGIERARLFGWPNTYV  238

Query  1174  FTKAMGEMMIDNMRGNIPVVIVRPSVIESTHKEPFPGWMEGNRMMDPIILHYGKGQLTGF  1353
             FTKAMGEM++ N + ++P++I+RP+++ ST+KEPFPGW+EG R +D +I+ YGKG++T F
Sbjct  239   FTKAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSVIVGYGKGRVTCF  298

Query  1354  LVDPNGVLDVVPADMVVNATLAAMAKHGAAGKPGTSIYHIASSVVNPLVFDDLARLLYEH  1533
             +  P   LDV+PADMVVNA + AM     A +    IYH+ SS  NP+   +L   ++ +
Sbjct  299   ISGPRSTLDVIPADMVVNAIIVAMV--ARAKQHSEIIYHLGSSFRNPVNISNLHDFIFRY  356

Query  1534  FQSKPYIDSKGKPIDVPRMKLFSSMEALSSHL-WRDAIDKSGLTALGDSKGKLSTKLENI  1710
             F   P+I+ +G+ + + +  + SSM    +++  R  +    L        K    +  +
Sbjct  357   FSEHPWINKEGESVKIGKGIVLSSMSKFYTYMAIRFLLPLKALQLFNILLFKKYQDVYTV  416

Query  1711  CRKSVEQAKYLASIYEPYTFYGGRFDNSNAQKLMECMSKE---ERWQFGFEVESIDWKDY  1881
               + V+    LA +Y+PY F+ G FD+ N++KL   +SKE   E   F F+  +IDW+DY
Sbjct  417   LDRRVKLVMRLADLYKPYVFFEGIFDDLNSEKL-RIISKETCQETDIFDFDPMNIDWEDY  475

Query  1882  ISNVHIPGLRRHVM  1923
             + NVHIPGL ++VM
Sbjct  476   MINVHIPGLVKYVM  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7122666899374