BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c293_g1_i1 len=1163 path=[1797:0-1162]

Length=1163
                                                                      Score     E

ref|XP_007050753.1|  Peroxidase superfamily protein                     440   9e-150   
ref|XP_002270603.1|  PREDICTED: peroxidase 3                            435   2e-148   Vitis vinifera
ref|XP_006357003.1|  PREDICTED: peroxidase 39-like                      434   5e-148   
ref|XP_010320977.1|  PREDICTED: peroxidase 39-like                      433   1e-147   
ref|XP_007035436.1|  Peroxidase superfamily protein                     434   2e-147   
emb|CAN71671.1|  hypothetical protein VITISV_044355                     434   6e-147   Vitis vinifera
ref|XP_002317707.1|  hypothetical protein POPTR_0012s03980g             431   1e-146   Populus trichocarpa [western balsam poplar]
gb|KDP21543.1|  hypothetical protein JCGZ_22014                         430   2e-146   
ref|XP_010242563.1|  PREDICTED: peroxidase 3-like                       432   4e-146   
gb|KHN28247.1|  Peroxidase 3                                            429   5e-146   
ref|XP_011003762.1|  PREDICTED: peroxidase 3-like                       429   5e-146   
ref|XP_008234970.1|  PREDICTED: peroxidase 3-like                       428   1e-145   
ref|XP_007200009.1|  hypothetical protein PRUPE_ppa024711mg             428   1e-145   
gb|ABQ18321.1|  putative peroxidase                                     426   1e-144   Cinnamomum micranthum f. kanehirae
gb|ABQ23446.1|  putative peroxidase                                     424   7e-144   Cinnamomum micranthum f. kanehirae
gb|KDP40039.1|  hypothetical protein JCGZ_02037                         423   2e-143   
ref|XP_010261101.1|  PREDICTED: peroxidase 3-like                       423   2e-143   
gb|ABM66586.1|  putative peroxidase                                     421   7e-143   Cinnamomum micranthum f. kanehirae
ref|XP_003518944.1|  PREDICTED: peroxidase 3-like                       419   3e-142   
ref|XP_003536895.1|  PREDICTED: peroxidase 3-like                       417   2e-141   
ref|XP_008345186.1|  PREDICTED: peroxidase 3-like                       416   6e-141   
ref|XP_010098323.1|  Peroxidase 24                                      417   8e-141   
ref|XP_003521524.1|  PREDICTED: peroxidase 3-like                       414   5e-140   
ref|XP_010914387.1|  PREDICTED: peroxidase 3-like                       412   2e-139   
gb|KDO74974.1|  hypothetical protein CISIN_1g020619mg                   412   3e-139   
ref|XP_010243339.1|  PREDICTED: peroxidase 3-like                       411   7e-139   
ref|XP_009419515.1|  PREDICTED: peroxidase 24-like                      410   2e-138   
ref|XP_010070010.1|  PREDICTED: peroxidase 3-like                       410   2e-138   
ref|XP_006419700.1|  hypothetical protein CICLE_v10007121mg             409   4e-138   
ref|XP_004494311.1|  PREDICTED: peroxidase 3-like                       409   5e-138   
ref|XP_007163044.1|  hypothetical protein PHAVU_001G201300g             409   6e-138   
ref|XP_006489267.1|  PREDICTED: peroxidase 3-like                       408   8e-138   
ref|XP_008366006.1|  PREDICTED: peroxidase 39-like                      408   1e-137   
ref|XP_007144575.1|  hypothetical protein PHAVU_007G167200g             407   2e-137   
gb|AFK41025.1|  unknown                                                 407   4e-137   
ref|XP_010914386.1|  PREDICTED: peroxidase 3-like                       405   9e-137   
ref|XP_006419701.1|  hypothetical protein CICLE_v10005432mg             405   1e-136   
gb|AFK41517.1|  unknown                                                 404   3e-136   
ref|XP_010042783.1|  PREDICTED: peroxidase 3-like                       402   7e-136   
ref|XP_010261100.1|  PREDICTED: peroxidase 3-like                       403   9e-136   
ref|XP_002520704.1|  peroxidase, putative                               415   4e-135   Ricinus communis
ref|XP_009385027.1|  PREDICTED: peroxidase 3-like                       402   6e-135   
ref|XP_010272777.1|  PREDICTED: peroxidase 3-like                       400   8e-135   
ref|XP_003638079.1|  Peroxidase                                         400   1e-134   
ref|XP_006489185.1|  PREDICTED: peroxidase 24-like                      399   3e-134   
ref|XP_006479844.1|  PREDICTED: peroxidase 3-like                       400   3e-134   
ref|XP_008812662.1|  PREDICTED: peroxidase 3-like                       399   3e-134   
ref|XP_010091374.1|  Peroxidase 3                                       397   3e-133   
ref|XP_004292686.1|  PREDICTED: peroxidase 3-like                       396   6e-133   
ref|XP_009382093.1|  PREDICTED: peroxidase 24-like                      392   2e-131   
gb|EYU43875.1|  hypothetical protein MIMGU_mgv1a017718mg                390   7e-131   
gb|AGH14256.1|  Peroxidase                                              390   1e-130   
ref|XP_010024493.1|  PREDICTED: peroxidase 24-like                      388   1e-129   
ref|XP_010242552.1|  PREDICTED: uncharacterized protein LOC104586872    400   4e-129   
gb|AHL39180.1|  class III peroxidase                                    385   1e-128   
ref|XP_010244668.1|  PREDICTED: uncharacterized protein LOC104588433    398   2e-128   
ref|XP_009760980.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 2...    383   6e-128   
ref|XP_009588152.1|  PREDICTED: peroxidase 24-like                      383   7e-128   
ref|XP_010024491.1|  PREDICTED: peroxidase 24-like                      381   3e-127   
ref|XP_009609714.1|  PREDICTED: peroxidase 24-like                      379   2e-126   
gb|KDP40041.1|  hypothetical protein JCGZ_02039                         379   2e-126   
ref|XP_010545061.1|  PREDICTED: peroxidase 27-like                      378   9e-126   
emb|CDP09300.1|  unnamed protein product                                375   1e-125   
ref|XP_010250084.1|  PREDICTED: peroxidase 3-like                       377   1e-125   
ref|XP_011091056.1|  PREDICTED: peroxidase 24                           375   2e-125   
ref|XP_009787965.1|  PREDICTED: peroxidase 24-like                      377   3e-125   
ref|XP_004968777.1|  PREDICTED: peroxidase 24-like                      373   9e-124   
ref|XP_007035435.1|  Peroxidase 24, putative                            372   1e-123   
ref|XP_010322270.1|  PREDICTED: peroxidase 24                           372   2e-123   
emb|CDO98934.1|  unnamed protein product                                370   1e-122   
ref|XP_010320973.1|  PREDICTED: peroxidase 24                           369   1e-122   
ref|XP_006356970.1|  PREDICTED: peroxidase 24-like                      369   2e-122   
ref|XP_010320971.1|  PREDICTED: peroxidase 24-like                      370   3e-122   
dbj|BAJ86701.1|  predicted protein                                      368   8e-122   
ref|XP_006855377.1|  hypothetical protein AMTR_s00057p00128320          367   1e-121   
ref|XP_006357005.1|  PREDICTED: peroxidase 24-like                      369   1e-121   
ref|XP_006356731.1|  PREDICTED: peroxidase 24-like                      367   2e-121   
ref|XP_002516846.1|  Peroxidase 24 precursor, putative                  367   2e-121   Ricinus communis
ref|XP_002516845.1|  Peroxidase 27 precursor, putative                  366   3e-121   Ricinus communis
emb|CDO98933.1|  unnamed protein product                                363   1e-120   
ref|XP_003567710.2|  PREDICTED: peroxidase 56-like                      364   2e-120   
gb|EMS59487.1|  Peroxidase 56                                           364   3e-120   
ref|XP_006356969.1|  PREDICTED: peroxidase 24-like                      363   4e-120   
ref|XP_008458503.1|  PREDICTED: peroxidase 24                           361   3e-119   
ref|XP_002527239.1|  Peroxidase 27 precursor, putative                  360   5e-119   Ricinus communis
ref|XP_010677712.1|  PREDICTED: peroxidase 24-like                      360   9e-119   
gb|KCW58562.1|  hypothetical protein EUGRSUZ_H01218                     357   1e-118   
ref|XP_004145044.1|  PREDICTED: peroxidase 24-like                      359   2e-118   
gb|AII99881.1|  peroxidase                                              356   1e-117   
gb|KHN43563.1|  Peroxidase 3                                            355   2e-117   
ref|XP_007045601.1|  Peroxidase superfamily protein                     356   3e-117   
gb|EMT31813.1|  Peroxidase 56                                           356   7e-117   
ref|XP_009631264.1|  PREDICTED: peroxidase 27-like                      354   2e-116   
ref|XP_004245974.1|  PREDICTED: peroxidase 27-like                      354   2e-116   
ref|XP_002277879.1|  PREDICTED: peroxidase 24                           353   4e-116   Vitis vinifera
ref|XP_009630374.1|  PREDICTED: peroxidase 27-like                      352   7e-116   
emb|CDO98926.1|  unnamed protein product                                352   9e-116   
gb|ABK26805.1|  unknown                                                 352   9e-116   Picea sitchensis
emb|CDP16566.1|  unnamed protein product                                352   2e-115   
ref|XP_006380314.1|  hypothetical protein POPTR_0007s02560g             351   3e-115   
dbj|BAJ90491.1|  predicted protein                                      351   3e-115   
gb|KDP40040.1|  hypothetical protein JCGZ_02038                         352   5e-115   
ref|XP_002280216.1|  PREDICTED: peroxidase 27                           350   7e-115   Vitis vinifera
gb|KDP40042.1|  hypothetical protein JCGZ_02040                         350   8e-115   
ref|XP_010035573.1|  PREDICTED: peroxidase 27-like                      349   2e-114   
ref|XP_006387149.1|  hypothetical protein POPTR_1693s00200g             348   2e-114   
ref|XP_009796690.1|  PREDICTED: peroxidase 27-like                      348   2e-114   
ref|XP_004298090.1|  PREDICTED: peroxidase 24-like                      348   3e-114   
ref|XP_009604224.1|  PREDICTED: peroxidase 27-like                      348   3e-114   
ref|XP_006352037.1|  PREDICTED: peroxidase 56-like                      358   4e-114   
ref|XP_011100418.1|  PREDICTED: peroxidase 27-like                      348   5e-114   
ref|XP_002274157.2|  PREDICTED: peroxidase 27-like                      345   4e-113   Vitis vinifera
gb|EYU24791.1|  hypothetical protein MIMGU_mgv1a010031mg                345   4e-113   
ref|XP_009794257.1|  PREDICTED: peroxidase 27-like                      345   4e-113   
ref|XP_008340867.1|  PREDICTED: peroxidase 24                           345   5e-113   
ref|XP_009800459.1|  PREDICTED: peroxidase 27-like                      345   6e-113   
ref|XP_006352038.1|  PREDICTED: peroxidase 27-like                      344   7e-113   
ref|XP_004287925.1|  PREDICTED: peroxidase 3-like                       344   9e-113   
ref|XP_007226156.1|  hypothetical protein PRUPE_ppa014996mg             345   9e-113   
ref|XP_002309830.2|  hypothetical protein POPTR_0007s02570g             344   1e-112   Populus trichocarpa [western balsam poplar]
emb|CBI28955.3|  unnamed protein product                                345   2e-112   
ref|XP_010240936.1|  PREDICTED: peroxidase 27-like                      344   2e-112   
ref|XP_009784557.1|  PREDICTED: peroxidase 27-like                      343   2e-112   
gb|EYU24795.1|  hypothetical protein MIMGU_mgv1a021569mg                342   3e-112   
ref|XP_009604229.1|  PREDICTED: peroxidase 27-like                      343   4e-112   
gb|EYU24792.1|  hypothetical protein MIMGU_mgv1a009974mg                342   5e-112   
ref|XP_011003204.1|  PREDICTED: peroxidase 27-like                      342   8e-112   
ref|XP_004287926.1|  PREDICTED: peroxidase 27-like                      342   1e-111   
gb|EYU24800.1|  hypothetical protein MIMGU_mgv1a010045mg                342   1e-111   
ref|XP_007217744.1|  hypothetical protein PRUPE_ppa008516mg             342   1e-111   
gb|EYU24801.1|  hypothetical protein MIMGU_mgv1a009942mg                342   1e-111   
ref|XP_009369145.1|  PREDICTED: peroxidase 24-like                      341   2e-111   
gb|KHG20863.1|  Peroxidase 27 -like protein                             341   2e-111   
gb|KDP41154.1|  hypothetical protein JCGZ_03648                         341   3e-111   
ref|XP_008223147.1|  PREDICTED: peroxidase 24                           340   4e-111   
gb|EYU24797.1|  hypothetical protein MIMGU_mgv1a010025mg                340   5e-111   
ref|XP_010240935.1|  PREDICTED: peroxidase 27-like                      340   5e-111   
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       340   5e-111   
emb|CDY46845.1|  BnaA10g03290D                                          340   5e-111   
ref|XP_008368371.1|  PREDICTED: peroxidase 24-like                      344   5e-111   
emb|CBI28956.3|  unnamed protein product                                351   6e-111   
ref|XP_010267771.1|  PREDICTED: peroxidase 27-like                      340   6e-111   
ref|XP_009604225.1|  PREDICTED: peroxidase 27-like                      340   7e-111   
gb|AHJ86268.1|  peroxidase                                              339   8e-111   
ref|XP_004487389.1|  PREDICTED: peroxidase 3-like                       339   8e-111   
ref|XP_002529736.1|  Peroxidase 27 precursor, putative                  339   1e-110   Ricinus communis
ref|XP_011100296.1|  PREDICTED: peroxidase 3-like                       339   1e-110   
ref|XP_008784560.1|  PREDICTED: peroxidase 3-like                       339   1e-110   
ref|XP_004251512.1|  PREDICTED: peroxidase 27-like                      338   1e-110   
ref|XP_006418047.1|  hypothetical protein EUTSA_v10008189mg             338   2e-110   
ref|XP_010931832.1|  PREDICTED: peroxidase 3-like                       338   3e-110   
emb|CDY10037.1|  BnaC08g44140D                                          337   5e-110   
ref|XP_008230092.1|  PREDICTED: peroxidase 27-like                      337   5e-110   
gb|EYU24798.1|  hypothetical protein MIMGU_mgv1a009213mg                338   5e-110   
ref|XP_011003205.1|  PREDICTED: peroxidase 56-like                      337   8e-110   
ref|XP_008379618.1|  PREDICTED: peroxidase 3                            337   1e-109   
emb|CDY55811.1|  BnaCnng29190D                                          336   1e-109   
ref|XP_009118603.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    336   2e-109   
ref|XP_006664072.1|  PREDICTED: peroxidase 24-like                      337   2e-109   
ref|XP_009620797.1|  PREDICTED: peroxidase 3-like                       336   2e-109   
ref|XP_010522326.1|  PREDICTED: peroxidase 3                            336   3e-109   
ref|XP_010931166.1|  PREDICTED: peroxidase 56-like                      336   3e-109   
ref|XP_010543013.1|  PREDICTED: peroxidase 2-like                       335   3e-109   
ref|XP_008230094.1|  PREDICTED: peroxidase 3                            335   4e-109   
ref|XP_008777796.1|  PREDICTED: peroxidase 3-like                       335   4e-109   
ref|XP_010240937.1|  PREDICTED: peroxidase 3-like                       335   4e-109   
ref|XP_010267770.1|  PREDICTED: peroxidase 27-like                      335   4e-109   
ref|XP_010931180.1|  PREDICTED: peroxidase 3-like isoform X1            335   4e-109   
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           335   4e-109   
emb|CDY43275.1|  BnaC05g48680D                                          335   5e-109   
ref|XP_004243525.1|  PREDICTED: peroxidase 3-like                       335   6e-109   
emb|CDY13252.1|  BnaC09g24040D                                          335   7e-109   
ref|XP_009802836.1|  PREDICTED: peroxidase 3-like                       335   8e-109   
emb|CDP20341.1|  unnamed protein product                                334   1e-108   
gb|KFK31897.1|  hypothetical protein AALP_AA6G173300                    334   1e-108   
ref|XP_009342265.1|  PREDICTED: peroxidase 3-like                       334   1e-108   
ref|XP_010475209.1|  PREDICTED: peroxidase 3                            334   1e-108   
ref|XP_002889542.1|  CBRCI35                                            334   1e-108   
ref|XP_006305430.1|  hypothetical protein CARUB_v10009829mg             333   1e-108   
ref|XP_008341973.1|  PREDICTED: peroxidase 3-like                       333   2e-108   
ref|XP_010484852.1|  PREDICTED: peroxidase 3-like                       333   2e-108   
ref|XP_009786925.1|  PREDICTED: peroxidase 3-like                       334   2e-108   
ref|XP_008804375.1|  PREDICTED: peroxidase 3-like                       333   2e-108   
ref|XP_006396925.1|  hypothetical protein EUTSA_v10028797mg             333   2e-108   
ref|XP_006356926.1|  PREDICTED: peroxidase 56-like                      334   2e-108   
ref|XP_007215666.1|  hypothetical protein PRUPE_ppa008540mg             333   2e-108   
ref|XP_009624291.1|  PREDICTED: peroxidase 3-like                       333   2e-108   
ref|XP_009624293.1|  PREDICTED: peroxidase 3-like                       333   2e-108   
ref|XP_009353255.1|  PREDICTED: peroxidase 3                            333   3e-108   
gb|EEE54612.1|  hypothetical protein OsJ_01847                          331   3e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010908222.1|  PREDICTED: peroxidase 3-like                       333   3e-108   
ref|XP_009117679.1|  PREDICTED: peroxidase 27-like                      333   3e-108   
ref|XP_009147405.1|  PREDICTED: peroxidase 27                           332   3e-108   
emb|CDY37537.1|  BnaA05g34020D                                          332   5e-108   
ref|NP_001289850.1|  peroxidase 3 precursor                             332   5e-108   
ref|XP_006357954.1|  PREDICTED: peroxidase 3-like                       332   5e-108   
ref|XP_010557013.1|  PREDICTED: peroxidase 2-like                       332   5e-108   
ref|XP_009353257.1|  PREDICTED: peroxidase 27-like                      332   5e-108   
ref|XP_010457608.1|  PREDICTED: peroxidase 3-like                       332   6e-108   
ref|XP_006447517.1|  hypothetical protein CICLE_v10017908mg             332   7e-108   
ref|XP_009342252.1|  PREDICTED: peroxidase 3                            332   7e-108   
ref|XP_008224769.1|  PREDICTED: peroxidase 27                           332   1e-107   
ref|XP_002889541.1|  predicted protein                                  331   1e-107   
ref|XP_004240142.1|  PREDICTED: peroxidase 3-like                       332   1e-107   
ref|XP_006372959.1|  hypothetical protein POPTR_0017s06570g             331   1e-107   
ref|XP_006372960.1|  hypothetical protein POPTR_0017s06570g             331   1e-107   
ref|XP_006356924.1|  PREDICTED: peroxidase 3-like                       331   1e-107   
gb|KFK42864.1|  hypothetical protein AALP_AA1G049000                    331   1e-107   
gb|AES67274.2|  peroxidase family protein                               331   2e-107   
ref|XP_003597023.1|  Peroxidase                                         332   2e-107   
ref|XP_007213025.1|  hypothetical protein PRUPE_ppa023088mg             331   2e-107   
emb|CDP20342.1|  unnamed protein product                                331   2e-107   
ref|XP_004240143.1|  PREDICTED: peroxidase 27-like                      330   3e-107   
ref|XP_009352323.1|  PREDICTED: peroxidase 24-like                      330   3e-107   
emb|CDY10038.1|  BnaC08g44130D                                          330   3e-107   
ref|XP_011037007.1|  PREDICTED: peroxidase 3-like                       330   3e-107   
ref|XP_010540729.1|  PREDICTED: peroxidase 39                           332   3e-107   
ref|XP_002443277.1|  hypothetical protein SORBIDRAFT_08g016840          331   3e-107   Sorghum bicolor [broomcorn]
gb|KGN63270.1|  hypothetical protein Csa_2G421020                       330   3e-107   
ref|XP_002280274.1|  PREDICTED: peroxidase 3                            330   4e-107   Vitis vinifera
gb|ACN31458.1|  unknown                                                 331   4e-107   Zea mays [maize]
ref|XP_004151878.1|  PREDICTED: peroxidase 39-like                      330   4e-107   
ref|XP_009589067.1|  PREDICTED: peroxidase 3-like                       330   4e-107   
gb|AFY26878.1|  basic peroxidase swpb7                                  330   5e-107   
ref|XP_006582342.1|  PREDICTED: peroxidase 3-like                       330   5e-107   
ref|XP_008341978.1|  PREDICTED: peroxidase 3-like                       330   5e-107   
ref|XP_011079026.1|  PREDICTED: peroxidase 3-like                       330   5e-107   
ref|XP_009603962.1|  PREDICTED: peroxidase 3-like                       330   6e-107   
ref|XP_006356923.1|  PREDICTED: peroxidase 3-like                       330   6e-107   
ref|NP_172018.1|  peroxidase 3                                          329   6e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAT72298.1|  CBRCI35                                                 329   6e-107   Capsella bursa-pastoris
ref|XP_009604384.1|  PREDICTED: peroxidase 3-like                       330   7e-107   
ref|XP_010435105.1|  PREDICTED: peroxidase 39                           329   7e-107   
gb|AAM61240.1|  putative peroxidase                                     329   7e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192868.1|  peroxidase 39                                         329   7e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540317.1|  PREDICTED: peroxidase 39-like                      329   8e-107   
ref|XP_006357953.1|  PREDICTED: peroxidase 3-like                       329   8e-107   
emb|CAA67337.1|  peroxidase                                             329   9e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598812.1|  PREDICTED: peroxidase 27-like                      329   1e-106   
ref|XP_009787653.1|  PREDICTED: peroxidase 27-like                      329   1e-106   
ref|XP_006411127.1|  hypothetical protein EUTSA_v10016858mg             330   1e-106   
ref|XP_006306557.1|  hypothetical protein CARUB_v10012652mg             328   1e-106   
emb|CDY49518.1|  BnaC05g03300D                                          328   2e-106   
ref|XP_008455840.1|  PREDICTED: peroxidase 39-like                      328   2e-106   
ref|XP_002892275.1|  hypothetical protein ARALYDRAFT_470522             327   2e-106   
ref|XP_010453647.1|  PREDICTED: peroxidase 56-like                      328   2e-106   
ref|XP_010267773.1|  PREDICTED: peroxidase 3                            328   2e-106   
ref|XP_010271617.1|  PREDICTED: peroxidase 27-like                      328   3e-106   
gb|KHG05441.1|  Peroxidase 3 -like protein                              328   3e-106   
ref|XP_010523998.1|  PREDICTED: peroxidase 3-like                       328   4e-106   
ref|NP_001130061.1|  uncharacterized protein LOC100191153               328   4e-106   Zea mays [maize]
ref|XP_004243458.1|  PREDICTED: peroxidase 3-like                       327   5e-106   
ref|XP_010509077.1|  PREDICTED: peroxidase 24-like                      328   5e-106   
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      327   5e-106   
ref|XP_010551859.1|  PREDICTED: peroxidase 27-like                      328   6e-106   
gb|AHL39150.1|  class III peroxidase                                    327   6e-106   
ref|XP_009787132.1|  PREDICTED: peroxidase 3-like                       327   6e-106   
ref|XP_008379619.1|  PREDICTED: peroxidase 27-like                      327   7e-106   
emb|CDY15538.1|  BnaA08g28220D                                          327   7e-106   
ref|NP_563732.1|  peroxidase 1                                          327   8e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07679.1|  BnaA03g18320D                                          328   8e-106   
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      327   9e-106   
ref|XP_004251490.1|  PREDICTED: peroxidase 27                           327   9e-106   
ref|XP_006356922.1|  PREDICTED: peroxidase 3-like                       326   1e-105   
ref|XP_002881627.1|  hypothetical protein ARALYDRAFT_345680             327   2e-105   
ref|XP_010413829.1|  PREDICTED: peroxidase 27-like                      326   2e-105   
emb|CDY14412.1|  BnaC03g21830D                                          327   2e-105   
ref|XP_002882194.1|  peroxidase 27                                      325   2e-105   
ref|XP_006367274.1|  PREDICTED: peroxidase 3-like                       326   2e-105   
gb|KFK42858.1|  hypothetical protein AALP_AA1G048400                    325   2e-105   
ref|XP_002872571.1|  peroxidase ATP19a                                  325   3e-105   
ref|XP_002309832.1|  peroxidase precursor family protein                325   3e-105   Populus trichocarpa [western balsam poplar]
ref|NP_186768.1|  peroxidase 27                                         325   3e-105   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24799.1|  hypothetical protein MIMGU_mgv1a019406mg                325   4e-105   
ref|XP_006304823.1|  hypothetical protein CARUB_v10012469mg             325   4e-105   
ref|XP_006299954.1|  hypothetical protein CARUB_v10016167mg             325   4e-105   
ref|NP_181437.1|  peroxidase 24                                         326   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       325   4e-105   
dbj|BAD44051.1|  putative peroxidase                                    326   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             325   5e-105   
ref|XP_003540316.1|  PREDICTED: peroxidase 3                            325   5e-105   
ref|XP_006367288.1|  PREDICTED: peroxidase 3-like                       325   6e-105   
ref|XP_009630373.1|  PREDICTED: peroxidase 3                            325   6e-105   
ref|XP_004240140.1|  PREDICTED: peroxidase 3                            324   7e-105   
ref|XP_010517240.1|  PREDICTED: peroxidase 24                           325   7e-105   
ref|XP_010463561.1|  PREDICTED: peroxidase 27                           324   7e-105   
ref|XP_010484836.1|  PREDICTED: peroxidase 2-like isoform X1            324   8e-105   
ref|XP_009768247.1|  PREDICTED: peroxidase 3                            324   8e-105   
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         324   8e-105   
ref|XP_006855828.1|  hypothetical protein AMTR_s00037p00030970          324   1e-104   
ref|XP_009133329.1|  PREDICTED: peroxidase 24                           325   1e-104   
ref|XP_009111057.1|  PREDICTED: peroxidase 2-like                       324   1e-104   
ref|XP_004243459.1|  PREDICTED: peroxidase 3-like                       324   1e-104   
gb|AAD11481.1|  peroxidase precursor                                    325   1e-104   
ref|XP_004515086.1|  PREDICTED: peroxidase 3-like                       323   1e-104   
ref|XP_002871652.1|  hypothetical protein ARALYDRAFT_325975             324   1e-104   
ref|XP_006363505.1|  PREDICTED: peroxidase 27-like                      323   1e-104   
emb|CDP11801.1|  unnamed protein product                                323   1e-104   
ref|XP_009796691.1|  PREDICTED: peroxidase 3-like                       323   1e-104   
ref|XP_010524521.1|  PREDICTED: peroxidase 24                           324   1e-104   
ref|XP_010267772.1|  PREDICTED: peroxidase 56-like                      323   1e-104   
emb|CDY65912.1|  BnaAnng21310D                                          323   1e-104   
emb|CDY55444.1|  BnaC08g46330D                                          323   2e-104   
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   323   2e-104   
ref|XP_006408471.1|  hypothetical protein EUTSA_v10021152mg             323   2e-104   
ref|XP_007132569.1|  hypothetical protein PHAVU_011G105900g             323   2e-104   
ref|XP_010505567.1|  PREDICTED: peroxidase 24                           324   2e-104   
ref|XP_009126036.1|  PREDICTED: peroxidase 56-like                      323   2e-104   
ref|XP_010492345.1|  PREDICTED: peroxidase 56                           323   3e-104   
emb|CDX91005.1|  BnaC02g05920D                                          323   3e-104   
ref|XP_010485528.1|  PREDICTED: peroxidase 27-like                      322   3e-104   
ref|XP_006296442.1|  hypothetical protein CARUB_v10025622mg             323   3e-104   
gb|AIY26420.1|  peroxidase 1b                                           322   4e-104   
gb|AIY26417.1|  peroxidase 1a                                           322   4e-104   
ref|XP_002892276.1|  hypothetical protein ARALYDRAFT_887707             322   4e-104   
ref|NP_197022.1|  peroxidase 56                                         322   4e-104   
gb|AIY26418.1|  peroxidase 1b                                           322   5e-104   
ref|XP_006594890.1|  PREDICTED: peroxidase 3                            322   5e-104   
gb|KEH29649.1|  peroxidase family protein                               322   6e-104   
ref|XP_010908221.1|  PREDICTED: peroxidase 1-like                       322   6e-104   
gb|AIV42033.1|  peroxidase                                              322   6e-104   
ref|XP_009382683.1|  PREDICTED: peroxidase 3-like                       322   6e-104   
ref|XP_007149959.1|  hypothetical protein PHAVU_005G113800g             322   7e-104   
ref|XP_004144487.1|  PREDICTED: peroxidase 56-like                      322   8e-104   
gb|AAD11482.1|  peroxidase precursor                                    322   9e-104   
ref|XP_009118606.1|  PREDICTED: peroxidase 2-like                       321   1e-103   
gb|AHC69832.1|  peroxidase                                              321   1e-103   
gb|ACJ11761.1|  class III peroxidase                                    321   1e-103   
ref|XP_006286841.1|  hypothetical protein CARUB_v10003841mg             321   1e-103   
gb|ACU19509.1|  unknown                                                 321   1e-103   
gb|AIV42034.1|  peroxidase                                              321   2e-103   
ref|XP_011100419.1|  PREDICTED: peroxidase 27-like                      320   2e-103   
ref|XP_002871653.1|  hypothetical protein ARALYDRAFT_909489             321   2e-103   
ref|XP_006367289.1|  PREDICTED: peroxidase 3-like                       323   2e-103   
ref|XP_004159200.1|  PREDICTED: peroxidase 56-like                      320   2e-103   
ref|XP_006581060.1|  PREDICTED: peroxidase isoform X1                   320   2e-103   
ref|XP_010420175.1|  PREDICTED: peroxidase 56-like                      320   2e-103   
ref|XP_008351217.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 2...    320   2e-103   
gb|ACU24335.1|  unknown                                                 320   2e-103   
gb|KFK42862.1|  hypothetical protein AALP_AA1G048800                    320   3e-103   
ref|XP_002437459.1|  hypothetical protein SORBIDRAFT_10g027490          320   3e-103   
gb|KFK28588.1|  hypothetical protein AALP_AA7G016800                    320   3e-103   
ref|XP_006594891.1|  PREDICTED: peroxidase 39-like                      320   3e-103   
ref|XP_007045599.1|  Peroxidase superfamily protein isoform 1           320   3e-103   
ref|XP_009615423.1|  PREDICTED: peroxidase 3-like                       321   3e-103   
gb|KHN41200.1|  Peroxidase 3                                            320   3e-103   
gb|AIY26419.1|  peroxidase 1a                                           320   4e-103   
gb|KHN36550.1|  Peroxidase 39                                           320   5e-103   
ref|XP_004243835.1|  PREDICTED: peroxidase 3-like                       320   6e-103   
ref|XP_011037006.1|  PREDICTED: peroxidase 3-like                       319   7e-103   
ref|XP_010524488.1|  PREDICTED: peroxidase 30                           319   7e-103   
gb|AFY26879.1|  anionic peroxidase swpa9                                320   7e-103   
emb|CDP11799.1|  unnamed protein product                                319   8e-103   
ref|XP_010484845.1|  PREDICTED: peroxidase 2-like                       319   8e-103   
gb|KFK37581.1|  hypothetical protein AALP_AA3G001800                    318   9e-103   
ref|XP_004962867.1|  PREDICTED: peroxidase 24-like                      319   9e-103   
emb|CDP20391.1|  unnamed protein product                                319   1e-102   
ref|XP_009118605.1|  PREDICTED: peroxidase 2-like                       318   1e-102   
gb|AAU04879.1|  peroxidase a                                            319   1e-102   
ref|NP_001066921.1|  Os12g0530100                                       319   1e-102   
emb|CDP11800.1|  unnamed protein product                                318   1e-102   
ref|XP_002268360.1|  PREDICTED: peroxidase 27                           318   1e-102   
ref|XP_009121602.1|  PREDICTED: peroxidase 56                           318   1e-102   
ref|XP_008809845.1|  PREDICTED: peroxidase 1-like                       318   1e-102   
ref|NP_001234644.1|  peroxidase precursor                               318   1e-102   
ref|NP_001149755.1|  peroxidase 39 precursor                            318   1e-102   
gb|AIY26421.1|  peroxidase 1a                                           318   2e-102   
ref|XP_002518541.1|  Peroxidase 27 precursor, putative                  318   2e-102   
emb|CDX85056.1|  BnaC05g19990D                                          318   2e-102   
ref|XP_004240141.1|  PREDICTED: peroxidase 3-like                       318   2e-102   
tpe|CAH69380.1|  TPA: class III peroxidase 138 precursor                318   2e-102   
ref|XP_009119176.1|  PREDICTED: peroxidase 2-like                       318   2e-102   
ref|NP_001241977.1|  uncharacterized protein LOC100784922 precursor     318   2e-102   
ref|XP_010457607.1|  PREDICTED: peroxidase 2-like                       317   3e-102   
ref|XP_008804400.1|  PREDICTED: peroxidase 56-like                      318   3e-102   
ref|XP_006855827.1|  hypothetical protein AMTR_s00037p00025630          317   3e-102   
ref|XP_010510594.1|  PREDICTED: peroxidase 30                           317   4e-102   
emb|CDY65910.1|  BnaAnng21290D                                          318   4e-102   
gb|KFK36806.1|  hypothetical protein AALP_AA4G173700                    318   4e-102   
gb|KDP25860.1|  hypothetical protein JCGZ_22890                         317   4e-102   
emb|CDY49516.1|  BnaC05g03280D                                          317   4e-102   
emb|CDY46843.1|  BnaA10g03270D                                          317   7e-102   
gb|EPS63360.1|  hypothetical protein M569_11425                         317   7e-102   
ref|XP_006418048.1|  hypothetical protein EUTSA_v10008157mg             317   7e-102   
emb|CCJ34832.1|  horseradish peroxidase isoenzyme HRP_2021              317   9e-102   
gb|AIY26422.1|  peroxidase 1b                                           316   1e-101   
gb|KFK39497.1|  hypothetical protein AALP_AA3G251500                    316   1e-101   
ref|XP_010109530.1|  Peroxidase 3                                       325   1e-101   
ref|XP_004987268.1|  PREDICTED: peroxidase 1-like                       316   1e-101   
ref|XP_010488198.1|  PREDICTED: peroxidase 30-like                      316   1e-101   
ref|XP_009109348.1|  PREDICTED: peroxidase 30                           316   1e-101   
gb|AHZ89831.1|  peroxidase                                              316   1e-101   
emb|CDX75919.1|  BnaC03g40020D                                          316   1e-101   
emb|CDY19299.1|  BnaC01g31810D                                          316   2e-101   
ref|XP_009419593.1|  PREDICTED: peroxidase 39-like                      315   2e-101   
emb|CDY55649.1|  BnaA01g36520D                                          315   2e-101   
emb|CDY59801.1|  BnaAnng16320D                                          315   2e-101   
gb|KHN22848.1|  Peroxidase 3                                            315   3e-101   
ref|XP_010088079.1|  Peroxidase 27                                      317   3e-101   
gb|KFK42860.1|  hypothetical protein AALP_AA1G048600                    315   3e-101   
ref|XP_006298132.1|  hypothetical protein CARUB_v10014176mg             315   3e-101   
ref|XP_004966236.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    315   4e-101   
gb|EYU24796.1|  hypothetical protein MIMGU_mgv1a010112mg                315   4e-101   
emb|CDY69305.1|  BnaAnng29930D                                          314   6e-101   
ref|XP_006400035.1|  hypothetical protein EUTSA_v10014085mg             314   6e-101   
ref|XP_006406236.1|  hypothetical protein EUTSA_v10021123mg             314   6e-101   
emb|CBI26133.3|  unnamed protein product                                311   8e-101   
ref|XP_009800216.1|  PREDICTED: peroxidase 3-like                       314   8e-101   
ref|XP_006418049.1|  hypothetical protein EUTSA_v10008202mg             313   9e-101   
gb|ABK93918.1|  unknown                                                 313   1e-100   
dbj|BAK00543.1|  predicted protein                                      313   1e-100   
ref|NP_001068411.1|  Os11g0661600                                       313   1e-100   
ref|XP_010923934.1|  PREDICTED: peroxidase 1-like                       313   1e-100   
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             313   1e-100   
ref|XP_002440020.1|  hypothetical protein SORBIDRAFT_09g024580          313   2e-100   
ref|XP_010057733.1|  PREDICTED: peroxidase 27-like                      313   3e-100   
gb|AIV42032.1|  peroxidase                                              313   3e-100   
ref|XP_010999629.1|  PREDICTED: peroxidase 27-like                      312   3e-100   
gb|EMT05880.1|  Peroxidase 3                                            312   3e-100   
gb|AHL39151.1|  class III peroxidase                                    312   4e-100   
gb|KCW74965.1|  hypothetical protein EUGRSUZ_E03708                     312   4e-100   
ref|XP_010696607.1|  PREDICTED: peroxidase 3                            312   5e-100   
ref|XP_003568173.1|  PREDICTED: peroxidase 1-like                       311   5e-100   
ref|XP_004961613.1|  PREDICTED: peroxidase 1-like                       311   6e-100   
emb|CDY55446.1|  BnaC08g46340D                                          311   1e-99    
ref|XP_002316610.2|  hypothetical protein POPTR_0011s00280g             311   1e-99    
ref|XP_004965312.1|  PREDICTED: peroxidase 1-like                       311   1e-99    
ref|XP_006357991.1|  PREDICTED: peroxidase 3-like                       310   1e-99    
gb|AHL39168.1|  class III peroxidase                                    310   2e-99    
gb|EAY81751.1|  hypothetical protein OsI_36925                          310   2e-99    
gb|EEC70680.1|  hypothetical protein OsI_02005                          310   2e-99    
ref|NP_188814.1|  peroxidase 30                                         310   2e-99    
ref|XP_010057739.1|  PREDICTED: peroxidase 27-like                      310   3e-99    
ref|XP_006656386.1|  PREDICTED: peroxidase 3-like                       310   3e-99    
emb|CAA66965.1|  peroxidase                                             310   3e-99    
ref|XP_004965313.1|  PREDICTED: peroxidase 1-like                       310   4e-99    
gb|KFK42859.1|  hypothetical protein AALP_AA1G048500                    310   4e-99    
ref|XP_002438300.1|  hypothetical protein SORBIDRAFT_10g011290          310   4e-99    
emb|CAA67360.1|  peroxidase ATP7a                                       309   4e-99    
ref|XP_002459202.1|  hypothetical protein SORBIDRAFT_02g000470          310   5e-99    
ref|XP_002436932.1|  hypothetical protein SORBIDRAFT_10g011510          310   5e-99    
ref|XP_010231205.1|  PREDICTED: peroxidase 1-like                       309   5e-99    
ref|XP_009405648.1|  PREDICTED: peroxidase 27-like                      309   7e-99    
ref|XP_006663651.1|  PREDICTED: peroxidase 1-like                       309   7e-99    
ref|XP_008801172.1|  PREDICTED: peroxidase 1-like                       309   8e-99    
ref|XP_011007886.1|  PREDICTED: peroxidase 27-like                      309   8e-99    
gb|ACR61552.1|  peroxidase 2                                            308   9e-99    
ref|XP_006357004.1|  PREDICTED: peroxidase 24-like                      306   1e-98    
ref|XP_006657390.1|  PREDICTED: peroxidase 1-like                       309   1e-98    
ref|XP_010057976.1|  PREDICTED: peroxidase 27-like                      308   1e-98    
gb|AAM61382.1|  putative peroxidase                                     308   2e-98    
ref|XP_009145451.1|  PREDICTED: peroxidase 30                           308   2e-98    
ref|XP_006371331.1|  Peroxidase 27 precursor family protein             308   2e-98    
emb|CAA76374.2|  peroxidase                                             308   2e-98    
ref|XP_010689572.1|  PREDICTED: peroxidase 27-like                      308   2e-98    
ref|XP_006288216.1|  hypothetical protein CARUB_v10001453mg             307   2e-98    
ref|XP_003568172.1|  PREDICTED: peroxidase 1                            307   3e-98    
ref|XP_008455410.1|  PREDICTED: peroxidase 27-like                      307   4e-98    
ref|XP_009111058.1|  PREDICTED: peroxidase 2-like                       307   4e-98    
ref|XP_010057737.1|  PREDICTED: peroxidase 27-like                      307   5e-98    
ref|XP_002883319.1|  peroxidase 30                                      307   5e-98    
gb|ACL52390.1|  unknown                                                 307   6e-98    
gb|KCW75372.1|  hypothetical protein EUGRSUZ_E04120                     308   8e-98    
ref|XP_002304934.1|  hypothetical protein POPTR_0004s02240g             306   8e-98    
ref|XP_002436934.1|  hypothetical protein SORBIDRAFT_10g011530          306   1e-97    
ref|NP_001058379.1|  Os06g0681600                                       306   1e-97    
gb|EPS73906.1|  hypothetical protein M569_00850                         305   1e-97    
tpe|CAH69331.1|  TPA: class III peroxidase 89 precursor                 306   1e-97    
emb|CDY10040.1|  BnaC08g44110D                                          305   2e-97    
ref|XP_002488879.1|  hypothetical protein SORBIDRAFT_2674s002010        305   2e-97    
ref|XP_006654599.1|  PREDICTED: peroxidase 1-like                       305   2e-97    
ref|NP_001055955.1|  Os05g0499300                                       305   2e-97    
dbj|BAA03644.1|  peroxidase                                             305   3e-97    
ref|XP_008643745.1|  PREDICTED: peroxidase 39 isoform X1                306   4e-97    
emb|CDY33143.1|  BnaCnng07140D                                          306   4e-97    
gb|ACF84679.1|  unknown                                                 305   4e-97    
ref|NP_001147671.1|  peroxidase 1 precursor                             305   4e-97    
gb|KFK42861.1|  hypothetical protein AALP_AA1G048700                    304   4e-97    
gb|AHL39131.1|  class III peroxidase                                    304   5e-97    
gb|EMT04116.1|  Peroxidase 1                                            303   7e-97    
gb|KHN41201.1|  Peroxidase 3                                            301   8e-97    
ref|XP_002515748.1|  Peroxidase 39 precursor, putative                  303   9e-97    
dbj|BAD62399.1|  putative peroxidase 1 precursor                        303   1e-96    
gb|EAZ00663.1|  hypothetical protein OsI_22684                          303   1e-96    
gb|KHN25776.1|  Peroxidase 39                                           301   1e-96    
gb|ACT35472.1|  peroxidase 30                                           304   1e-96    
gb|ACG38470.1|  peroxidase 1 precursor                                  303   1e-96    
gb|EMT00309.1|  Peroxidase 1                                            303   1e-96    
ref|XP_011007637.1|  PREDICTED: peroxidase 27-like                      303   2e-96    
ref|XP_010227737.1|  PREDICTED: peroxidase 1-like                       302   2e-96    
ref|XP_004967723.1|  PREDICTED: peroxidase 24-like                      302   4e-96    
gb|ACI00836.1|  class III peroxidase                                    301   5e-96    
ref|NP_001146942.1|  peroxidase 1 precursor                             302   5e-96    
gb|EMS60389.1|  Peroxidase 1                                            301   5e-96    
gb|EEC81377.1|  hypothetical protein OsI_24583                          302   5e-96    
tpe|CAH69339.1|  TPA: class III peroxidase 97 precursor                 302   6e-96    
emb|CDY46844.1|  BnaA10g03280D                                          301   7e-96    
gb|KFK42863.1|  hypothetical protein AALP_AA1G048900                    301   9e-96    
ref|XP_009119175.1|  PREDICTED: peroxidase 2-like                       300   1e-95    
ref|XP_008659484.1|  PREDICTED: peroxidase 1-like                       301   2e-95    



>ref|XP_007050753.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX94910.1| Peroxidase superfamily protein [Theobroma cacao]
Length=357

 Score =   440 bits (1131),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 252/305 (83%), Gaps = 1/305 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             +C+   + K++YK  CP+ EEIV+++T +    NP LPAKLLR+HFHDCFVRGCD S+LL
Sbjct  53    SCQGDGIGKNYYKVTCPHAEEIVKNVTEKHVCKNPSLPAKLLRMHFHDCFVRGCDASLLL  112

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +STT+N AEK A PNL+++GF+VID+IKA +E  CPGVVSCAD++ALAARDSVS++ ++ 
Sbjct  113   NSTTNNTAEKQAIPNLTLSGFDVIDDIKAEVEKTCPGVVSCADVLALAARDSVSFELQRP  172

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGR+S+ SEAL+N+PSPFSNF+TLV+ FASKGL VHDLV+LSGGHTIG+GH
Sbjct  173   LWEVLTGRRDGRVSRISEALANIPSPFSNFTTLVRNFASKGLDVHDLVVLSGGHTIGIGH  232

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTG+GDQDPSLNP+YA  L+TKC++L D  + VEMDP SS +FD  Y+VI
Sbjct  233   CNLFSNRLYNFTGRGDQDPSLNPAYASFLKTKCRSLRDIITTVEMDPRSSLNFDNHYYVI  292

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LKQKMGLF SDAALLTD  A K VD+++D   FF  FA+SM+KMGAI VLTG +GE+RK 
Sbjct  293   LKQKMGLFQSDAALLTDDSALKTVDELLDSSKFFVEFAQSMQKMGAIGVLTGTAGEIRKK  352

Query  1006  CRVPN  1020
             C V N
Sbjct  353   CYVVN  357



>ref|XP_002270603.1| PREDICTED: peroxidase 3 [Vitis vinifera]
 emb|CBI32280.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   435 bits (1119),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 246/303 (81%), Gaps = 0/303 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K +YK  CP  EEIV+ +TW+  SSNP LPAKL+R+HFHDCFVRGCDGS+LL+
Sbjct  20    CQGGSLRKKYYKSACPLAEEIVQKVTWRHVSSNPNLPAKLIRMHFHDCFVRGCDGSVLLN  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST ++ AE+ AAPNLS+AGF+VID+IK+ +E  CPGVVSCADI+ALA+RDSVS+QFKK M
Sbjct  80    STANSTAERDAAPNLSLAGFDVIDDIKSQLEKTCPGVVSCADILALASRDSVSFQFKKPM  139

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG++S ASEAL+N+P P  NFS+L Q FASKGL VHDLV+LSG HTIG+GHC
Sbjct  140   WEVLTGRRDGKVSLASEALANIPPPVFNFSSLKQSFASKGLTVHDLVVLSGAHTIGVGHC  199

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
             N FSNRLYNFTGKGD DPSLN +YA  L+TKC++L+DT+ VEMDP SS++FD++YF ILK
Sbjct  200   NGFSNRLYNFTGKGDADPSLNSTYAAFLKTKCRSLSDTTAVEMDPQSSRNFDSNYFAILK  259

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
             Q  GLF SDAALLT+  ARKI  ++ D   FF  FA+SM++MGAI VLTG +GE+RK C 
Sbjct  260   QNKGLFQSDAALLTNKGARKIALELQDSADFFTEFAQSMKRMGAIGVLTGRAGEIRKKCS  319

Query  1012  VPN  1020
             + N
Sbjct  320   IVN  322



>ref|XP_006357003.1| PREDICTED: peroxidase 39-like [Solanum tuberosum]
Length=325

 Score =   434 bits (1116),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
              L K FYK  CP  E+IV++ITW+R +SN  LPAKLLR+HFHDCFVRGCDGS+L+DST +
Sbjct  26    QLRKDFYKSSCPQAEQIVQNITWKRVASNSTLPAKLLRMHFHDCFVRGCDGSVLIDSTAN  85

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             N AEKAA PNLS+ GF+VIDEIK A+E  C GVVSCADI+ LAARDSVS+QFKK MW V 
Sbjct  86    NSAEKAAIPNLSLGGFDVIDEIKTALENTCQGVVSCADILTLAARDSVSFQFKKPMWEVV  145

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDGRIS++SEALS +PSPF NF++L Q FA+K   VHDLV+LSGGHTIG+GHCNLFS
Sbjct  146   TGRRDGRISKSSEALSEIPSPFFNFTSLKQSFANKSFTVHDLVVLSGGHTIGVGHCNLFS  205

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQKM  840
             NRLYNFTGKGD DPSLN +Y   L+TKC++L+D T+ VEMDPGSS  FD +YF +LKQ+ 
Sbjct  206   NRLYNFTGKGDSDPSLNSTYVTFLKTKCQSLSDNTTTVEMDPGSSLTFDNNYFSVLKQQK  265

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALLT+  A+ IVD+M+    FF  F++SM++MGAI VLTG++GE+RK C V N
Sbjct  266   GLFQSDAALLTNQGAKNIVDEMLIAGKFFTEFSQSMKRMGAIGVLTGSNGEIRKKCNVVN  325



>ref|XP_010320977.1| PREDICTED: peroxidase 39-like [Solanum lycopersicum]
Length=324

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
              L K FYK  CP  E+IV++ITW+R ++N  LPAKLLR+HFHDCFVRGCDGSIL+DST +
Sbjct  25    QLRKDFYKSSCPQAEQIVQNITWKRVATNSTLPAKLLRMHFHDCFVRGCDGSILIDSTAN  84

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             N AEKAA PNLS+ GF+VIDEIK A+E  C GVVSCADI+ LAARDSVS+QFKK MW V 
Sbjct  85    NSAEKAAIPNLSLGGFDVIDEIKTALENTCQGVVSCADILTLAARDSVSFQFKKPMWEVV  144

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDGRIS++SEALS +PSPF NF++L Q FA+K L VHDLV+LSGGHTIG+GHCNLFS
Sbjct  145   TGRRDGRISKSSEALSEIPSPFFNFTSLKQSFANKSLTVHDLVVLSGGHTIGVGHCNLFS  204

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQKM  840
             NRLYNFTGKGD DPSLN +Y   L+TKC++L D T+ VEMDPGSS  FD +YF +LKQ+ 
Sbjct  205   NRLYNFTGKGDSDPSLNSTYVTFLKTKCQSLLDNTTIVEMDPGSSLTFDNNYFSVLKQQK  264

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALLT+  A+ IVD+M+    FF  F++SM++MGAI VLTG++GE+RK C V N
Sbjct  265   GLFQSDAALLTNKGAKNIVDEMLIDGKFFTEFSQSMKRMGAIGVLTGSNGEIRKKCNVVN  324



>ref|XP_007035436.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY06362.1| Peroxidase superfamily protein [Theobroma cacao]
Length=357

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 242/305 (79%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L  +FY+  CP  E IV+SITW   +SN  LPAK LR+HFHDCFVRGCDGS+LLD
Sbjct  53    CQGGALCNNFYETSCPLAEHIVQSITWTYVASNFTLPAKFLRMHFHDCFVRGCDGSVLLD  112

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N AEK A PN S+AGF+VIDEIK+ +E  CPGVVSCADI+AL ARDSVS+QF K +
Sbjct  113   STANNSAEKEAIPNQSLAGFDVIDEIKSKLEETCPGVVSCADILALVARDSVSFQFGKPL  172

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP GRRDG IS+ASEAL+N+PSPF NF+TL Q FA+KGL V DLV+LSGGHTIG+GHC
Sbjct  173   WEVPTGRRDGTISRASEALANIPSPFFNFTTLKQSFANKGLTVQDLVVLSGGHTIGVGHC  232

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             N FSNRLYNFTGKGD DPSLN +YAD L+TKC++L+D T+ VEMDPGSS  FD +YF IL
Sbjct  233   NFFSNRLYNFTGKGDADPSLNSTYADFLKTKCQSLSDNTTIVEMDPGSSLSFDNNYFTIL  292

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLTD  +  IVD+M++   FF  F +SM +MG I+VLTG++GE+RK C
Sbjct  293   KQNEGLFQSDAALLTDQGSSNIVDEMLNSKTFFTEFRQSMVRMGTIEVLTGSAGEIRKKC  352

Query  1009  RVPNS  1023
              V NS
Sbjct  353   TVINS  357



>emb|CAN71671.1| hypothetical protein VITISV_044355 [Vitis vinifera]
Length=376

 Score =   434 bits (1115),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 244/297 (82%), Gaps = 0/297 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K +YK  CP  EEIV+ +TWQ  SSNP LPAKL+R+HFHDCFVRGCDGS+LL+
Sbjct  20    CQGGSLRKKYYKSACPLAEEIVQKVTWQHVSSNPNLPAKLIRMHFHDCFVRGCDGSVLLN  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST ++ AE+ AAPNLS++GF+VID+IK+ +E  CPGVVSCADI+ALA+RDSVS+QFKK M
Sbjct  80    STANSTAERDAAPNLSLSGFDVIDDIKSKLEKTCPGVVSCADILALASRDSVSFQFKKPM  139

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG++S ASEAL+N+P P  NFS+L QRFASKGL VHDLV+LSG HTIG+GHC
Sbjct  140   WEVLTGRRDGKVSLASEALANIPPPVFNFSSLKQRFASKGLTVHDLVVLSGAHTIGVGHC  199

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
             N FSNRLYNFTGKGD DPSLN +YA  L+TKC++L+DT+ VEMDP SS++FD++YF ILK
Sbjct  200   NGFSNRLYNFTGKGDADPSLNSTYAAFLKTKCRSLSDTTAVEMDPQSSRNFDSNYFAILK  259

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             Q  GLF SDAALLT+  ARKI  ++ D   FF  FA+SM++MGAI VLTG +GE+RK
Sbjct  260   QNKGLFQSDAALLTNKGARKIALELQDSADFFTEFAQSMKRMGAIGVLTGRAGEIRK  316



>ref|XP_002317707.1| hypothetical protein POPTR_0012s03980g [Populus trichocarpa]
 gb|EEE95927.1| hypothetical protein POPTR_0012s03980g [Populus trichocarpa]
 gb|AHL39171.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   431 bits (1107),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 243/305 (80%), Gaps = 2/305 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+A  L K FY+  CP  E IV++IT  R +SNP LPAKLLR+HFHDCFVRGCD SIL++
Sbjct  19    CQAGDLRKDFYRTSCPAAESIVKNITETRAASNPNLPAKLLRMHFHDCFVRGCDASILIN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             S  S  AEK A PNLS+A F+VIDEIK  +E +C G VSCADI+ALAARD+VS+QFKK M
Sbjct  79    SANST-AEKDAIPNLSLANFDVIDEIKTELENKCAGKVSCADILALAARDAVSFQFKKPM  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S ASE L+N+PSPF NFS+LVQ F SKGL VHDLV+LSG HTIG+GHC
Sbjct  138   WEVLTGRRDGNVSVASEVLTNIPSPFLNFSSLVQSFKSKGLTVHDLVVLSGAHTIGVGHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFSNRLYNFTGK DQDPSLN +YA  L+TKC++L+D T+ VEMDPGSSQ+FD  YFVIL
Sbjct  198   NLFSNRLYNFTGKADQDPSLNSTYAAFLKTKCQSLSDRTTTVEMDPGSSQNFDASYFVIL  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ+ GLF SDAALLTD  +  IV ++V    FFK F++SM++MGAI VLTGNSGE+RK C
Sbjct  258   KQQKGLFQSDAALLTDKTSSNIVGELVKSTDFFKEFSQSMKRMGAIGVLTGNSGEIRKTC  317

Query  1009  RVPNS  1023
              V NS
Sbjct  318   GVINS  322



>gb|KDP21543.1| hypothetical protein JCGZ_22014 [Jatropha curcas]
Length=324

 Score =   430 bits (1106),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 243/306 (79%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C    L K FY+K CP  EEIVR+ITW    SNP LPAKLLR+HFHDCF+RGCDGSIL+
Sbjct  19    VCRGGGLRKEFYQKTCPQAEEIVRNITWNHVPSNPNLPAKLLRMHFHDCFLRGCDGSILI  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST ++ AEK A PNL++AGF+VI+EIK+ IE  CPG+VSCADI+ALAARDSVS+QFKK 
Sbjct  79    NSTANSTAEKDAIPNLTLAGFDVIEEIKSEIEKACPGIVSCADILALAARDSVSFQFKKP  138

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S ASE   N+PSPF+NFSTL+Q F +KGL VHDLV+LSGGHTIG GH
Sbjct  139   LWPVLTGRRDGIVSLASEVSDNIPSPFANFSTLLQNFKNKGLNVHDLVVLSGGHTIGRGH  198

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTGKGDQDP+LN +Y++ L+TKC+++ D T+ VE+DP SS  FD DYFVI
Sbjct  199   CNLFSNRLYNFTGKGDQDPTLNSTYSEFLKTKCQSIADSTTTVELDPDSSLTFDNDYFVI  258

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LKQ  GL  SDAALLT+  A KI  +++  + FF+ F++SM++MGAIQVLTG  GE+R  
Sbjct  259   LKQNKGLLQSDAALLTNKIASKIAGELLRSNVFFREFSQSMKRMGAIQVLTGTQGEIRNK  318

Query  1006  CRVPNS  1023
             C V NS
Sbjct  319   CSVINS  324



>ref|XP_010242563.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=386

 Score =   432 bits (1110),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/304 (67%), Positives = 241/304 (79%), Gaps = 1/304 (0%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +   L K+FYK  CP  EEIV++ITW+  +SN +LPAKLLR+HFHDCFVRGCD S+L+DS
Sbjct  83    QGGGLRKNFYKDSCPLAEEIVQNITWKHVASNSELPAKLLRMHFHDCFVRGCDASVLIDS  142

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T +N AEK+AAPNLS+AGF+VIDE+K  +E  CPGVVSCADIVALAARDSVS+QF   +W
Sbjct  143   TANNTAEKSAAPNLSLAGFDVIDEVKTQLENTCPGVVSCADIVALAARDSVSFQFNTSIW  202

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              V  GRRDG+IS ASEALSN+PSPFSNF+TL Q FASK L  HDLV+LSG HTIG+GHCN
Sbjct  203   EVLTGRRDGKISNASEALSNIPSPFSNFTTLKQNFASKALTEHDLVVLSGAHTIGVGHCN  262

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             LFSNRLYNF+GKGD DPSLN +YA  LRTKCK+L D T+ VEMDP SS  FD  YFV LK
Sbjct  263   LFSNRLYNFSGKGDADPSLNSTYAAFLRTKCKSLADNTTTVEMDPQSSLTFDNHYFVNLK  322

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
                GLF SDAALLTD  +  IVD+M+    FF  F +SM++MGAI VLTG++GE+RK C 
Sbjct  323   INQGLFQSDAALLTDKSSGNIVDEMLVSSKFFTEFGQSMKRMGAIGVLTGSAGEIRKKCN  382

Query  1012  VPNS  1023
             V NS
Sbjct  383   VVNS  386



>gb|KHN28247.1| Peroxidase 3 [Glycine soja]
Length=322

 Score =   429 bits (1103),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 247/306 (81%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C+  +L K FYKK CP  EEIVR+   +  S+ P LPAKL+R+HFHDCFVRGCDGS+LL
Sbjct  17    VCQGGNLRKKFYKKTCPQAEEIVRTKIQEHVSARPDLPAKLIRMHFHDCFVRGCDGSVLL  76

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST +N AEK + PNLS+AGF+VID+IK A+EA+CPG VSCADI+ALAARD+VS +F K 
Sbjct  77    DSTATNTAEKDSIPNLSLAGFDVIDDIKEALEAKCPGTVSCADILALAARDTVSVKFNKP  136

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W V  GRRDG +S + EAL+NLP+PF NF+ L + FASKGL VHDLV+LSG HTIG+GH
Sbjct  137   TWEVLTGRRDGTVSISGEALANLPAPFFNFTQLKESFASKGLTVHDLVVLSGAHTIGIGH  196

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRL+NFTGKGDQDPSLNP+YA+ L+TKC+ L+D T+ VEMDP SS  FD+DY+ I
Sbjct  197   CNLFSNRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDTTTTVEMDPNSSNTFDSDYYSI  256

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L+Q  GLF SDAALLT   +R IV+++V+Q+ FF  F +SM++MGAI+VLTG++GE+RK 
Sbjct  257   LRQNKGLFQSDAALLTTKISRNIVNELVNQNKFFTEFGQSMKRMGAIEVLTGSAGEIRKK  316

Query  1006  CRVPNS  1023
             C V NS
Sbjct  317   CSVVNS  322



>ref|XP_011003762.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=323

 Score =   429 bits (1103),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 247/305 (81%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+A  L K+FY+  CP  E  V++IT +  +SNP LPAKLLR+HFHDCFVRGCD S+L++
Sbjct  19    CQAGDLRKNFYRISCPAAEGTVKNITERHVASNPNLPAKLLRMHFHDCFVRGCDASVLIN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST ++ AEK A PNLS+AGF+VIDEIK  +E +C G VSCADI+ALA RD+VS QFKK M
Sbjct  79    STANSTAEKDAIPNLSLAGFDVIDEIKTELENKCAGKVSCADILALATRDAVSVQFKKPM  138

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG++S ASEAL+N+PSPF NFS+LVQ F +KGL +HDL++LSG HTIG GHC
Sbjct  139   WKVLTGRRDGKVSVASEALANIPSPFLNFSSLVQSFKNKGLTLHDLIVLSGAHTIGDGHC  198

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFSNRLYNFTGKGDQDPSLN +YA  L+TKC++L+D T+ VEMDPGSSQ+FD+ YFVIL
Sbjct  199   NLFSNRLYNFTGKGDQDPSLNSTYAAFLKTKCQSLSDTTTTVEMDPGSSQNFDSSYFVIL  258

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ+ GLF SDAALLTD  + KIV +++    F K F++SM++MGAI VLTGNSGE+RK C
Sbjct  259   KQQKGLFQSDAALLTDKQSNKIVGELLKSTDFLKEFSQSMKRMGAIGVLTGNSGEIRKKC  318

Query  1009  RVPNS  1023
              V NS
Sbjct  319   GVINS  323



>ref|XP_008234970.1| PREDICTED: peroxidase 3-like [Prunus mume]
Length=324

 Score =   428 bits (1100),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/306 (66%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC+   L K+FY+  CP  EEIVR++TW   SSNP LPAKLLR+HFHDCFVRGCDGS+LL
Sbjct  18    ACQGGQLRKNFYRSTCPSAEEIVRNVTWNHVSSNPNLPAKLLRMHFHDCFVRGCDGSVLL  77

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEK AAPNLS+AGF VID+IK  +E +CPG+VSCADI+ALAARDSVS+QFK+ 
Sbjct  78    NSTANNTAEKDAAPNLSLAGFNVIDDIKENVENKCPGIVSCADILALAARDSVSFQFKRS  137

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG IS+  EAL N+P P  NF+ L QRFASK L VHDLV+LSG HTIG+GH
Sbjct  138   LWKVLTGRRDGTISRTREALINIPPPAFNFTQLKQRFASKNLTVHDLVVLSGSHTIGVGH  197

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             C  FSNRLYNFTGKGDQDPSLN +YA  L+TKC +LND T+ VEMDPGSS  FDT Y+  
Sbjct  198   CPTFSNRLYNFTGKGDQDPSLNATYAAFLKTKCPSLNDTTTTVEMDPGSSLKFDTGYYAT  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LKQ  GLF SDAALLT+  A  IV ++ D D FF  FA+SM +MGAI+VLTG SGE+R  
Sbjct  258   LKQHKGLFQSDAALLTNKGAANIVQELGDNDKFFTEFAQSMVRMGAIEVLTGTSGEIRSK  317

Query  1006  CRVPNS  1023
             C   NS
Sbjct  318   CWAVNS  323



>ref|XP_007200009.1| hypothetical protein PRUPE_ppa024711mg [Prunus persica]
 gb|EMJ01208.1| hypothetical protein PRUPE_ppa024711mg [Prunus persica]
Length=324

 Score =   428 bits (1100),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/306 (66%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC+   L K+FY+  CP  EEIVR++TW   SSNP LPAKLLR+HFHDCFVRGCDGS+LL
Sbjct  18    ACQGGQLRKNFYRSTCPSAEEIVRNVTWNHVSSNPNLPAKLLRMHFHDCFVRGCDGSVLL  77

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEK AAPNLS+AGF VID+IK  +E +CPG+VSCADI+ALAARDSVS+QFK+ 
Sbjct  78    NSTANNTAEKDAAPNLSLAGFNVIDDIKENLENKCPGIVSCADILALAARDSVSFQFKRS  137

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG IS+  EAL N+P P  NF+ L QRFASK L VHDLV+LSG HTIG+GH
Sbjct  138   LWKVLTGRRDGTISRTREALINIPPPAFNFTQLKQRFASKNLTVHDLVVLSGSHTIGVGH  197

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             C  FSNRLYNFTGKGDQDPSLN +YA  L+TKC +LND T+ VEMDPGSS  FDT Y+  
Sbjct  198   CPTFSNRLYNFTGKGDQDPSLNATYAAFLKTKCPSLNDTTTTVEMDPGSSLKFDTGYYAT  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LKQ  GLF SDAALLT+  A  IV ++ D D FF  FA+SM +MGAI+VLTG SGE+R  
Sbjct  258   LKQHKGLFQSDAALLTNKGAANIVQELGDNDKFFAEFAQSMVRMGAIEVLTGTSGEIRSK  317

Query  1006  CRVPNS  1023
             C   NS
Sbjct  318   CWAVNS  323



>gb|ABQ18321.1| putative peroxidase [Cinnamomum micranthum f. kanehirae]
Length=325

 Score =   426 bits (1094),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 242/306 (79%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C    L K+FYKK CP+ E+IV++I W+  +SN  LPAKLLR+HFHDCFVRGCD S+L+
Sbjct  20    GCNGGQLRKNFYKKSCPHAEDIVKNIIWKHVASNSSLPAKLLRMHFHDCFVRGCDASVLV  79

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEK A PNLS+AGF+VIDE+KA +E  CPGVVSCADI+AL+ARDSVS+QFKK 
Sbjct  80    NSTANNTAEKDAIPNLSLAGFDVIDEVKAQLETTCPGVVSCADILALSARDSVSFQFKKS  139

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG +S ASEAL+N+PSPFSNF+TL Q FA+KGL V DLV+LSG HTIG GH
Sbjct  140   MWKVRTGRRDGIVSLASEALANIPSPFSNFTTLTQDFANKGLNVTDLVVLSGAHTIGRGH  199

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTG GD DPSLN +YA  L+T+C++L+D T+ VEMDP SS  FD+ Y+  
Sbjct  200   CNLFSNRLYNFTGNGDADPSLNSTYAAFLKTECQSLSDTTTTVEMDPQSSLSFDSHYYTN  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LK K GLF SDAALLT+  A  IVD++ D   FF  FA+SM++MGAI VLTG+SGE+R  
Sbjct  260   LKLKQGLFQSDAALLTNDDASNIVDELRDSADFFTEFAESMKRMGAIGVLTGDSGEIRTK  319

Query  1006  CRVPNS  1023
             C V NS
Sbjct  320   CSVVNS  325



>gb|ABQ23446.1| putative peroxidase [Cinnamomum micranthum f. kanehirae]
Length=325

 Score =   424 bits (1089),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C    L K+FYKK CP+ E+IV++I W+  +SN  LPAKLLR+HFHDCFVRGCD S+L+
Sbjct  20    GCNGGQLRKNFYKKSCPHAEDIVKNIIWKHVASNSSLPAKLLRMHFHDCFVRGCDASVLV  79

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEK A PNLS+AGF+VIDE+KA +E  CPGVVSCADI+AL+ARDSVS+QFKK 
Sbjct  80    NSTANNTAEKDAIPNLSLAGFDVIDEVKAQLETTCPGVVSCADILALSARDSVSFQFKKS  139

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG +S ASEAL+N+PSPFSNF+TL Q FA+KGL V DLV+LSG HTIG GH
Sbjct  140   MWKVRTGRRDGIVSLASEALANIPSPFSNFTTLTQDFANKGLNVTDLVVLSGAHTIGRGH  199

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTG GD DPSLN +YA  L+T+C++L+D T+ VEMDP SS  FD+ Y+  
Sbjct  200   CNLFSNRLYNFTGNGDADPSLNSTYAAFLKTECQSLSDTTTTVEMDPQSSLSFDSHYYTN  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LK   GLF SDAALLT+  A  IVD++ D   FF  FA+SM++MGAI VLTG+SGE+R  
Sbjct  260   LKLNQGLFQSDAALLTNDDASNIVDELRDSADFFTEFAESMKRMGAIGVLTGDSGEIRAK  319

Query  1006  CRVPNS  1023
             C V NS
Sbjct  320   CSVVNS  325



>gb|KDP40039.1| hypothetical protein JCGZ_02037 [Jatropha curcas]
Length=325

 Score =   423 bits (1087),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 240/300 (80%), Gaps = 1/300 (0%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L K+FY+  CP  EEIV++I W+R +SN  LPAK LR+HFHDCFVRGCD S+LLDST +N
Sbjct  26    LRKNFYEHTCPQAEEIVKTIIWKRVASNLTLPAKFLRMHFHDCFVRGCDASVLLDSTPNN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEKAAAPNLS+ GFEVIDE+K+ +E ECPGVVSCADIVALAARDSVS+Q+++ +W V  
Sbjct  86    AAEKAAAPNLSLGGFEVIDEVKSQLEKECPGVVSCADIVALAARDSVSFQYQRPLWEVLT  145

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG IS+ SEA SN+PSP SNF+ L Q FA+K L VHDLV+LSGGHTIG+ HCN FSN
Sbjct  146   GRRDGTISRTSEAPSNIPSPLSNFTLLKQSFANKSLTVHDLVVLSGGHTIGIAHCNFFSN  205

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTGKGD DPSLNP YA  L+TKC+ L D T+ V MDP S   FDT YF +LK   G
Sbjct  206   RLYNFTGKGDTDPSLNPFYAAFLKTKCRTLTDNTTTVPMDPFSPLSFDTTYFHLLKLNEG  265

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             LF SDAALLTD  +  IVD+++D   FF  FA+SM+++GAI+VLTG++G++RKNCRV NS
Sbjct  266   LFQSDAALLTDKGSSNIVDELLDPAKFFTEFAQSMKRLGAIEVLTGSAGQIRKNCRVVNS  325



>ref|XP_010261101.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=327

 Score =   423 bits (1087),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 244/305 (80%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             CE   L K+FY+  CP  EEIV+++ W+R +S+  LPA L+RLHFHDCFVRGCD S+LL+
Sbjct  23    CEGGSLRKNFYRSSCPRAEEIVKTVVWKRVASDSGLPAALVRLHFHDCFVRGCDASVLLN  82

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N+AEK AAPNL++ G +VIDE+K  +E  CPGVVSCADI+ALAARDSV++QFKK M
Sbjct  83    STQNNQAEKDAAPNLTLDGLDVIDEVKTEVEKTCPGVVSCADIIALAARDSVAFQFKKSM  142

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S+AS+AL+N+P+P  NF+TL   FASKGL VHDLV+LSG HTIG GHC
Sbjct  143   WEVLTGRRDGTVSRASDALANIPAPTFNFTTLKSNFASKGLTVHDLVVLSGAHTIGQGHC  202

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             N FSNRLYNFTGKGD DPSL+P YA  LRT+CK+L+D T+ V MDP S   FD+ Y+ ++
Sbjct  203   NAFSNRLYNFTGKGDADPSLDPEYAAFLRTQCKSLSDNTTQVFMDPNSGVSFDSHYYAVV  262

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLT+  + KIV ++++Q+ FF  FA+SME+MGAI+VLTG+SGE+RKNC
Sbjct  263   KQNKGLFQSDAALLTNKISSKIVTELLNQNKFFTEFAQSMERMGAIEVLTGSSGEIRKNC  322

Query  1009  RVPNS  1023
              V NS
Sbjct  323   AVVNS  327



>gb|ABM66586.1| putative peroxidase [Cinnamomum micranthum f. kanehirae]
Length=325

 Score =   421 bits (1083),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C    L K+FY+K CP+ E+IV++I W+  +SN  LPAKLLR+HFHDCFVRGCD S+L+
Sbjct  20    GCNGGQLRKNFYRKSCPHAEDIVKNIIWKHVASNSSLPAKLLRMHFHDCFVRGCDASVLV  79

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AE+ A PNLS+AGF+VIDE+KA +E  CPGVVSCADI+AL+ARDSVS+QFKK 
Sbjct  80    NSTANNTAERDAIPNLSLAGFDVIDEVKAQLETTCPGVVSCADILALSARDSVSFQFKKS  139

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG +S ASEAL+N+PSPFSNF+TL Q FA+KGL V DLV+LSG HTIG GH
Sbjct  140   MWKVRTGRRDGIVSLASEALANIPSPFSNFTTLTQDFANKGLNVTDLVVLSGAHTIGRGH  199

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTG GD DPSLN +YA  L+T+C++L+D T+ VEMDP SS  FD+ Y+  
Sbjct  200   CNLFSNRLYNFTGNGDADPSLNSTYAAFLKTECQSLSDTTTTVEMDPQSSLSFDSHYYTN  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LK   GLF SDAALLT+  A  IVD++ D   FF  FA+SM++MGAI VLTG+SGE+R  
Sbjct  260   LKLNQGLFQSDAALLTNDDASNIVDELRDSADFFTKFAESMKRMGAIGVLTGDSGEIRAK  319

Query  1006  CRVPNS  1023
             C V NS
Sbjct  320   CSVVNS  325



>ref|XP_003518944.1| PREDICTED: peroxidase 3-like [Glycine max]
 gb|KHN46603.1| Peroxidase 3 [Glycine soja]
Length=322

 Score =   419 bits (1078),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 242/305 (79%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K FYK  C   E+I++S T Q  S+NP LPAKLLR+HFHDCFVRGCD S+LL+
Sbjct  18    CQGGSLRKKFYKDSCSQAEDIIKSKTQQHVSANPDLPAKLLRMHFHDCFVRGCDASVLLN  77

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N AE+ A PNLS+AGF+VID+IK+ +EA+CP  VSCADI+ALAARD+VS QF K M
Sbjct  78    STANNTAERDAIPNLSLAGFDVIDDIKSELEAKCPKTVSCADILALAARDAVSVQFNKSM  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S ++EAL+N+P+PF NF+ L Q FASKGL +HDLV+LSG HTIG+GHC
Sbjct  138   WEVLTGRRDGTVSNSNEALANIPAPFFNFTQLKQNFASKGLTLHDLVVLSGAHTIGIGHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFSNRLYNFTGKGDQDPSLN +YA+ L+TKC++L+D T+ VEMDPGSS +FD+DY+  L
Sbjct  198   NLFSNRLYNFTGKGDQDPSLNSTYAEFLKTKCQSLSDTTTTVEMDPGSSTNFDSDYYPNL  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GLF SDAALLT+  +  I  ++VDQD FF  FA+SM++MGAI VLT ++GE+R  C
Sbjct  258   LQNKGLFQSDAALLTEEQSEDIAKELVDQDKFFTEFAQSMKRMGAIDVLTDSAGEIRNKC  317

Query  1009  RVPNS  1023
              V NS
Sbjct  318   SVVNS  322



>ref|XP_003536895.1| PREDICTED: peroxidase 3-like [Glycine max]
Length=322

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 242/305 (79%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K FY+  CP  E+I+++ T Q  S+NP LPAKLLR+HFHDCFVRGCD S+LL+
Sbjct  18    CQGGSLRKKFYRDSCPQAEDIIKTKTQQHVSANPDLPAKLLRMHFHDCFVRGCDASVLLN  77

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST SN AE+ A PNLS+AGF+VID+IK+A+EA+C   VSCADI+ALAARD+VS QF K M
Sbjct  78    STASNTAERDAIPNLSLAGFDVIDDIKSAVEAKCSKTVSCADILALAARDAVSVQFNKPM  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S ++EAL+N+P+PF NF+ L + FA KGL +HDLV+LSG HTIG+GHC
Sbjct  138   WEVLTGRRDGTVSNSNEALANIPAPFFNFTQLKESFAGKGLTLHDLVVLSGAHTIGIGHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFSNRLYNFTGKGDQDPSLN +YA+ L+TKC++L+D T+ VEMDPGSS  FD+DY+  L
Sbjct  198   NLFSNRLYNFTGKGDQDPSLNTTYAEFLKTKCQSLSDTTTTVEMDPGSSTKFDSDYYPNL  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GLF SDAALLT   +  I  ++VDQ+ FF  FA+SM++MGAI+VLTG++GE+R  C
Sbjct  258   LQNKGLFQSDAALLTQEQSEDIAKELVDQNKFFTEFAQSMKRMGAIEVLTGSAGEIRNKC  317

Query  1009  RVPNS  1023
              V NS
Sbjct  318   SVVNS  322



>ref|XP_008345186.1| PREDICTED: peroxidase 3-like [Malus domestica]
Length=324

 Score =   416 bits (1070),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 242/306 (79%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             ACE   L K FY+K CP  E+IVR +TW   SSNP+LPAKLLR+ FHDCFVRGCDGSILL
Sbjct  18    ACEGGQLRKCFYEKXCPSAEDIVRDVTWNHVSSNPRLPAKLLRMXFHDCFVRGCDGSILL  77

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEKAA PNLS++GF+VID+IK  +E +CPGVVSCADI+ALAARDSVS+Q+ K 
Sbjct  78    NSTANNTAEKAAVPNLSLSGFDVIDDIKEXLEZKCPGVVSCADILALAARDSVSFQYNKS  137

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG IS   EAL N+P+PF NF+ L Q FA K L VHDLV+LSGGHTIG+  
Sbjct  138   MWEVLTGRRDGTISLVREALINIPAPFFNFTQLKQSFAXKNLTVHDLVVLSGGHTIGVXG  197

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             C  FSNRLYNFTGKGDQDPSL+ +YA++L+TKC++L D T+ VEMDPGS+++FD+ Y+ +
Sbjct  198   CPSFSNRLYNFTGKGDQDPSLDATYAELLKTKCRSLKDNTTFVEMDPGSARNFDSSYYTV  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             +KQ  GLF SDAALLT+  A  IV ++ D + FF  FA+SM++MGA++VLTG SG++RK 
Sbjct  258   VKQHKGLFQSDAALLTNKGASNIVAELEDLNKFFTEFAQSMKRMGAVEVLTGTSGQIRKK  317

Query  1006  CRVPNS  1023
             C   NS
Sbjct  318   CWAVNS  323



>ref|XP_010098323.1| Peroxidase 24 [Morus notabilis]
 gb|EXB74827.1| Peroxidase 24 [Morus notabilis]
Length=361

 Score =   417 bits (1072),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 235/303 (78%), Gaps = 2/303 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C    L+K FY   CP  EEIV SITW+R ++N  LPAK LR+HFHDCFVRGCD SILLD
Sbjct  18    CNGGQLKKQFYADTCPLAEEIVTSITWKRVATNSSLPAKFLRMHFHDCFVRGCDASILLD  77

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             STT+N AEK A PNLS+ GF+VIDEIK  +E  CPGVVSCADI+AL  RDSVSYQFKK M
Sbjct  78    STTNNTAEKEAVPNLSLGGFDVIDEIKTQLEKTCPGVVSCADILALVTRDSVSYQFKKSM  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S+ASEA +N+PSP  NFS+L Q FA+K L VHDLV+LSGGH+IG+GHC
Sbjct  138   WEVQTGRRDGALSRASEASANIPSPSFNFSSLKQSFANKSLTVHDLVVLSGGHSIGVGHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             N FSNRLYN+TGKGD DPSLN +YA  L T+C++L+D T+ VE+DPGSS  FD  YF IL
Sbjct  198   NFFSNRLYNYTGKGDADPSLNATYAAFLSTECRSLSDNTTTVEVDPGSSGSFDNHYFKIL  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKM-VDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             K   GLF SDAALLTD  A  +VD++ ++ D FF  F +S+++MGAI+VLTG+ GE+RK 
Sbjct  258   KLHQGLFQSDAALLTDKGASNVVDELQMNSDKFFTEFGRSIKRMGAIEVLTGSQGEIRKK  317

Query  1006  CRV  1014
             C V
Sbjct  318   CNV  320



>ref|XP_003521524.1| PREDICTED: peroxidase 3-like [Glycine max]
 gb|KHN28248.1| Peroxidase 3 [Glycine soja]
Length=322

 Score =   414 bits (1063),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 242/305 (79%), Gaps = 3/305 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+  +L K FY+K CP  E+IVR+   Q  S+ P LPAKL+RLHFHDCFVRGCDGS+LLD
Sbjct  20    CQGGNLRKKFYRKSCPQAEQIVRTKIQQHVSACPNLPAKLIRLHFHDCFVRGCDGSVLLD  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N AEK A PNLS+AGF+VID+IK A+EA+CPG+VSCADI+ALAARDSVS    K  
Sbjct  80    STATNIAEKDAIPNLSLAGFDVIDDIKEALEAKCPGIVSCADILALAARDSVSAV--KPA  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S + EAL+NLP+PF NF+TL   FASK L VHDLV+LSG HTIG+GHC
Sbjct  138   WEVLTGRRDGTVSVSGEALANLPAPFYNFTTLKASFASKNLNVHDLVVLSGAHTIGIGHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFS RL+NFTGKGDQDPSLNP+YA+ L+TKC+ L+D T+ V+MDP SS  FD++Y+ IL
Sbjct  198   NLFSKRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDNTTTVKMDPNSSNTFDSNYYSIL  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             +Q  GLF SDAALLT   +R IV+K+V +D FF  F  SM++MGAI+VLTG++GE+R+ C
Sbjct  258   RQNKGLFQSDAALLTTKMSRNIVNKLVKKDKFFTKFGHSMKRMGAIEVLTGSAGEIRRKC  317

Query  1009  RVPNS  1023
              V N+
Sbjct  318   SVVNA  322



>ref|XP_010914387.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=326

 Score =   412 bits (1060),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/304 (63%), Positives = 236/304 (78%), Gaps = 1/304 (0%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +A+ LE HFYKK CP  EEIV+ I W+  ++N +LPAK LR+ FHDCFVRGCD S+L++S
Sbjct  23    QAASLEHHFYKKSCPQAEEIVQDIIWKHVANNSELPAKFLRMFFHDCFVRGCDASVLINS  82

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T ++ AEK AAPNLS+AGF+VIDE+K A+E  CP  VSCADI+ALAARDSVS+QF + +W
Sbjct  83    TANSTAEKDAAPNLSLAGFDVIDEVKTALEKTCPDTVSCADIIALAARDSVSFQFNRSLW  142

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              V  GRRDG IS ASEA +N+PSPFSNF+TL  RF +K L V DLV+LSG HTIG+GHCN
Sbjct  143   EVQTGRRDGTISLASEARANIPSPFSNFTTLANRFTNKTLDVEDLVVLSGAHTIGIGHCN  202

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
              FSNRLYNFTGKGD DPSLN +YA  L+T+CK+L+D T+ V MDPGSS  FDT Y+  LK
Sbjct  203   FFSNRLYNFTGKGDADPSLNATYAAFLKTQCKSLSDNTTTVPMDPGSSLTFDTHYYENLK  262

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
                G+F SDAALLTD  +  I+DKM+D   FF +F  S+++MG I+VLTG +GE+RK C 
Sbjct  263   LHQGMFQSDAALLTDQCSANIIDKMLDTTNFFNAFKNSIKRMGTIEVLTGTNGEIRKKCS  322

Query  1012  VPNS  1023
             V NS
Sbjct  323   VVNS  326



>gb|KDO74974.1| hypothetical protein CISIN_1g020619mg [Citrus sinensis]
Length=323

 Score =   412 bits (1059),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 234/305 (77%), Gaps = 1/305 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC    L K+FYK+ CP  E+IV+ I W+  + N  LPAK LR+HFHDCFVRGCD S+L+
Sbjct  19    ACRGGGLGKNFYKETCPEAEDIVQKIIWKNVALNSTLPAKFLRMHFHDCFVRGCDASVLI  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST SN AEK + PN +V GF+VI+E+K  +E +CPG+VSCADIVALA RDSVS+QF+K 
Sbjct  79    DSTASNSAEKDSIPNQTVGGFDVIEEVKTELEKKCPGIVSCADIVALATRDSVSFQFEKP  138

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGRIS  SEA S +P+P  NFS L Q FASKGL VHDLV+LSGGHTIG+GH
Sbjct  139   LWEVLTGRRDGRISLVSEANSQIPAPSFNFSRLKQSFASKGLTVHDLVVLSGGHTIGVGH  198

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CN FS RLYNFTGKGD DPSL+ +YA  LRTKC++L D T+ VEMDPGS  DFD +Y+ I
Sbjct  199   CNFFSRRLYNFTGKGDADPSLDSTYAAFLRTKCRSLADNTTIVEMDPGSGMDFDNNYYKI  258

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L+Q  G+F SDAALLTD  A  IVD+++D   FF  FA+SME++GA+ VLTG SGE+RK 
Sbjct  259   LRQNKGMFQSDAALLTDNGASNIVDELLDPAKFFTEFAQSMERLGAVGVLTGTSGEIRKK  318

Query  1006  CRVPN  1020
             C V N
Sbjct  319   CNVVN  323



>ref|XP_010243339.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=326

 Score =   411 bits (1056),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 190/304 (63%), Positives = 241/304 (79%), Gaps = 1/304 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+A  L K+FYK  CP+ EEIV+++ W+R +S+  LPA L+R+HFHDCFVRGCD S+LL+
Sbjct  22    CQAGGLRKNFYKTSCPHAEEIVKNVVWKRVASDSGLPAALVRMHFHDCFVRGCDASVLLN  81

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +NKAEK A PNL++ GF VIDE+K A+E  CPGVVSC+DI+ALAARDSV++QFKK M
Sbjct  82    STKNNKAEKDAPPNLTLDGFAVIDEVKTAVEKACPGVVSCSDIIALAARDSVAFQFKKPM  141

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S+ASEA+SN+P P  NF++L Q FA KGL VHDLV+LSG HTIG  HC
Sbjct  142   WEVLTGRRDGTVSRASEAVSNIPPPTFNFASLKQNFAKKGLTVHDLVVLSGAHTIGQAHC  201

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             N FS RLYNF+GKGD DPSL+P YA  LRTKC++L+D T+ V MDP S   FD+ Y+ ++
Sbjct  202   NSFSKRLYNFSGKGDADPSLDPKYAAFLRTKCRSLSDNTTQVFMDPNSGVSFDSHYYAVV  261

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLT+  + KIV ++++Q+ FF  FA+SM+KMGAI+VLTG+SG+VRK C
Sbjct  262   KQHKGLFQSDAALLTNKISSKIVTELLNQNTFFTEFAQSMKKMGAIEVLTGSSGQVRKKC  321

Query  1009  RVPN  1020
              V N
Sbjct  322   AVVN  325



>ref|XP_009419515.1| PREDICTED: peroxidase 24-like [Musa acuminata subsp. malaccensis]
Length=323

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 232/302 (77%), Gaps = 0/302 (0%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +A  L+KHFYKK CP  EE+V+ + W    SN  LPAKLLRL FHDCFVRGCD S+LLDS
Sbjct  21    QADELKKHFYKKLCPQAEEMVQDLVWASVESNSTLPAKLLRLFFHDCFVRGCDASVLLDS  80

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T +  AEK A PN S+AGFEVID++KAA+E  CPG VSCADIVALAARDSVS+QF+K +W
Sbjct  81    TANISAEKDAIPNRSLAGFEVIDQVKAALEKACPGRVSCADIVALAARDSVSFQFQKPLW  140

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              V  GRRDG +S ASEAL+++PSP +NF+ LVQ+FASK L V DLV+LSG HTIG+GHC 
Sbjct  141   EVKTGRRDGNVSLASEALADIPSPGANFTRLVQQFASKNLDVEDLVVLSGAHTIGVGHCG  200

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
             +  NRLYNFTGKGD DPSLN ++A  L+T+C   + T+ VEMDPGSS  FD  Y+VILKQ
Sbjct  201   IIRNRLYNFTGKGDTDPSLNATHAAFLKTQCSPTDRTTTVEMDPGSSLSFDDHYYVILKQ  260

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
             K GLF SDAALLTD  + KIVDK++D   FF +F KS+ KMG I VLTG  G++R NCR 
Sbjct  261   KEGLFQSDAALLTDGKSSKIVDKLLDDGDFFDAFGKSITKMGNIGVLTGTDGQIRSNCRA  320

Query  1015  PN  1020
              N
Sbjct  321   VN  322



>ref|XP_010070010.1| PREDICTED: peroxidase 3-like [Eucalyptus grandis]
Length=329

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 245/318 (77%), Gaps = 1/318 (0%)
 Frame = +1

Query  58    HHNLIlvcslfvvfcvvACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLR  237
              H+LIL C L  +  +  C    L+K+FY K CP  EEIVR++TW+  ++N  LPAK LR
Sbjct  8     RHSLILGCVLGFLVLLGGCHGGSLKKNFYSKSCPLAEEIVRNVTWRHVAANITLPAKFLR  67

Query  238   LHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCAD  417
             +HFHDCFVRGCDGS+LL+ST +N AEK A PNL++AGF+VID+IKA +E +CPGVVSCAD
Sbjct  68    MHFHDCFVRGCDGSVLLNSTKNNTAEKEAIPNLTLAGFDVIDDIKAEVEKKCPGVVSCAD  127

Query  418   IVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLG  597
             I+ALAARDSVS+QFK+  W V  GRRDG +S ASEAL+N+PSPF NF+ L Q FA+KGL 
Sbjct  128   ILALAARDSVSFQFKRSTWKVLTGRRDGTVSLASEALANIPSPFLNFTALQQNFANKGLS  187

Query  598   VHDLVILSGGHTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPV  774
             V DLV+LSG HTIG+GHCN FS RLYNF+GKGDQDPSLN +YA  L+ +CKNL D T+ V
Sbjct  188   VRDLVVLSGAHTIGVGHCNAFSVRLYNFSGKGDQDPSLNSTYAASLKNQCKNLTDNTTFV  247

Query  775   EMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEK  954
              MDP +   FDT YF +L+Q+ GLF SDAALLT+ ++  I  +M++   FFKSF  S+++
Sbjct  248   PMDPITPLSFDTRYFTVLRQRRGLFESDAALLTNPNSASITREMLNSRRFFKSFRTSIKR  307

Query  955   MGAIQVLTGNSGEVRKNC  1008
             MGAI VLTG SGE+RK C
Sbjct  308   MGAISVLTGKSGEIRKVC  325



>ref|XP_006419700.1| hypothetical protein CICLE_v10007121mg [Citrus clementina]
 gb|ESR32940.1| hypothetical protein CICLE_v10007121mg [Citrus clementina]
Length=323

 Score =   409 bits (1051),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 232/305 (76%), Gaps = 1/305 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC    L K FYK+ CP  E+IV+ I W+  + N  LPAK LR+HFHDCFVRGCD SIL+
Sbjct  19    ACRGGGLGKSFYKETCPEAEDIVQKIIWKNVALNSTLPAKFLRMHFHDCFVRGCDASILI  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST SN AEK + PN +V GF+VI+E+K  +E +CPG+VSCADIVALAARDSVS+QF+K 
Sbjct  79    DSTASNSAEKDSIPNQTVGGFDVIEEVKTELEKKCPGIVSCADIVALAARDSVSFQFEKP  138

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGRIS  SEA S +P+P  NFS L Q FASKGL VHDLV+LSGGHTIG+GH
Sbjct  139   LWEVLTGRRDGRISLVSEANSQIPAPSFNFSRLKQSFASKGLTVHDLVVLSGGHTIGVGH  198

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CN FS RLYNFTGKGD DPSL+ +YA  LRTKC++L D T+ VEMDPGS   FD +Y  I
Sbjct  199   CNFFSRRLYNFTGKGDADPSLDSTYAAFLRTKCRSLADNTTIVEMDPGSGMYFDNNYHKI  258

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L+Q  G+F SDAALLTD  A  IVD+++D   FF  FA+SME+MGA+ VLTG SGE+RK 
Sbjct  259   LRQNKGMFQSDAALLTDNGASNIVDELLDPAKFFTEFAQSMERMGAVGVLTGTSGEIRKK  318

Query  1006  CRVPN  1020
             C V N
Sbjct  319   CNVVN  323



>ref|XP_004494311.1| PREDICTED: peroxidase 3-like [Cicer arietinum]
Length=324

 Score =   409 bits (1050),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 243/304 (80%), Gaps = 2/304 (1%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             E   L K+FYKK CP  E+I+ + T +  SS P+LPAKLLRLHFHDCFVRGCDGS+LL+S
Sbjct  21    EGGSLSKNFYKKSCPQAEQIILTKTQEHVSSRPELPAKLLRLHFHDCFVRGCDGSVLLES  80

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFK-KKM  471
             T++N AEK + PNLS+AGF+VID+IK A+E +CPG+VSCADI+ALA RD+VS QFK KK+
Sbjct  81    TSNNTAEKDSFPNLSLAGFDVIDDIKIAVEEKCPGIVSCADILALATRDAVSIQFKNKKL  140

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S++ E L +LP+PF N + L Q FA+K L +HDLV+LSG HT+G+GHC
Sbjct  141   WEVLTGRRDGTVSKSDEVLLSLPAPFHNITVLRQLFANKKLTLHDLVVLSGAHTLGIGHC  200

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             N+FSNRLYNFTGKGDQDPSLNP+YAD L+  C++L+D T+ VEMDP SS DFD+DY+ +L
Sbjct  201   NVFSNRLYNFTGKGDQDPSLNPTYADSLKQTCQSLSDTTTTVEMDPSSSTDFDSDYYPVL  260

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GLF SDAAL+T   ++ IV ++V Q+ FF  FA+SM++MGAI+VL+G+ GE+R+ C
Sbjct  261   LQNKGLFQSDAALVTTKQSKNIVKQLVSQNKFFTEFAQSMKRMGAIEVLSGSDGEIRRKC  320

Query  1009  RVPN  1020
              V N
Sbjct  321   SVVN  324



>ref|XP_007163044.1| hypothetical protein PHAVU_001G201300g [Phaseolus vulgaris]
 gb|ESW35038.1| hypothetical protein PHAVU_001G201300g [Phaseolus vulgaris]
Length=322

 Score =   409 bits (1050),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 240/306 (78%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC+  +L K+FYK+ C   E+IVR+   +  S+ P LPAKL+R+HFHDCFVRGCDGS+LL
Sbjct  17    ACQGGNLRKNFYKQTCSQAEQIVRTKIQEHVSARPDLPAKLIRMHFHDCFVRGCDGSVLL  76

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST +N AEK + PNLS++GF+VID+IK A+EA+CPG VSCADI+ LAARD+VS QF K 
Sbjct  77    DSTATNTAEKDSIPNLSLSGFDVIDDIKKALEAKCPGTVSCADILTLAARDAVSVQFNKP  136

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDGR+S + EAL+NLP+PF N + L + F SK L VHDLV+LSG HT G+GH
Sbjct  137   MWEVLTGRRDGRVSISGEALANLPAPFFNINQLRKSFESKKLTVHDLVVLSGAHTFGVGH  196

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNR++NFTGKGDQDPSLNP+YA++L++KCK L+D T+ VEMDP S   FD+DY+ I
Sbjct  197   CNLFSNRIFNFTGKGDQDPSLNPTYANILKSKCKGLSDTTTAVEMDPNSPITFDSDYYSI  256

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L Q  GLF SDAALLT   +R IV+++V QD FF  F +SM++MGAI+VLT + GE+R  
Sbjct  257   LLQNKGLFQSDAALLTAKVSRNIVNELVKQDKFFTEFGQSMKRMGAIEVLTDSDGEIRTK  316

Query  1006  CRVPNS  1023
             C V NS
Sbjct  317   CSVVNS  322



>ref|XP_006489267.1| PREDICTED: peroxidase 3-like [Citrus sinensis]
Length=323

 Score =   408 bits (1049),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 232/305 (76%), Gaps = 1/305 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC    L K+FYK+ CP  E+IV+ I W+  + N  LPAK LR+HFHDCFVRGCD S+L+
Sbjct  19    ACRGGGLGKNFYKETCPEAEDIVQKIIWKNVALNSTLPAKFLRMHFHDCFVRGCDASVLI  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST SN AEK + PN +V GF+VI+E+K  +E +CPG+VSCADIVALAARDSVS+QF+K 
Sbjct  79    DSTASNSAEKDSIPNQTVGGFDVIEEVKTELEKKCPGIVSCADIVALAARDSVSFQFEKP  138

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGRIS  SEA S +P+P  NFS L Q FASKGL VHDLV+LSGGHTIG+GH
Sbjct  139   LWEVLTGRRDGRISLVSEANSQIPAPSFNFSRLKQSFASKGLTVHDLVVLSGGHTIGVGH  198

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CN FS RLYNFTGKGD DPSL+ +YA  LRTKC +L D T+ VEMDPGS   FD +Y+ I
Sbjct  199   CNFFSRRLYNFTGKGDADPSLDSTYAAFLRTKCTSLADNTTIVEMDPGSGMYFDNNYYKI  258

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L+Q  G+F SDAALLTD  A  IVD+++D    F  FA+SME+MGA+ VLTG SGE+RK 
Sbjct  259   LRQNKGMFQSDAALLTDNGASNIVDELLDPAKIFTEFAQSMERMGAVGVLTGTSGEIRKK  318

Query  1006  CRVPN  1020
             C V N
Sbjct  319   CNVVN  323



>ref|XP_008366006.1| PREDICTED: peroxidase 39-like [Malus domestica]
Length=324

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             ACE   L K FY+K CP  E+IVR +TW    SNP+LPAKLLR+ FHDCFVRG DGSILL
Sbjct  18    ACEGGQLRKXFYEKTCPSAEDIVRDVTWNHVXSNPRLPAKLLRMXFHDCFVRGXDGSILL  77

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEKAA PNLS++GF+VID+IK  +E +CPGVVSCADI+ALAARDSVS+Q+ K 
Sbjct  78    NSTANNTAEKAAVPNLSLSGFDVIDDIKEKLEEKCPGVVSCADILALAARDSVSFQYNKS  137

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG IS   EAL N+P+PF NF+ L Q FA K L VHDLV+LSGGHTIG+G 
Sbjct  138   MWEVLTGRRDGTISLVREALINIPAPFFNFTQLKQSFARKNLTVHDLVVLSGGHTIGVGG  197

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             C  FSNRLYNFTGKGDQDPSL+ +YA+ L+TKC++L D T+ VEMDP S+++FD+ Y+ +
Sbjct  198   CPSFSNRLYNFTGKGDQDPSLDATYAEXLKTKCRSLXDXTTFVEMDPXSARNFDSSYYTV  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             +KQ  GLF SDA LLT+  A  IV ++ D + FF  FA+SM++MGA++VLTG SG++RK 
Sbjct  258   VKQHKGLFQSDAXLLTNKGASNIVAELEDLNKFFTEFAQSMKRMGAVEVLTGTSGQIRKK  317

Query  1006  CRVPNS  1023
             C   NS
Sbjct  318   CWAVNS  323



>ref|XP_007144575.1| hypothetical protein PHAVU_007G167200g [Phaseolus vulgaris]
 gb|ESW16569.1| hypothetical protein PHAVU_007G167200g [Phaseolus vulgaris]
Length=321

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 242/306 (79%), Gaps = 2/306 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K+FY+  CP  E+I++S T Q  S+NP LPAKL+RLHFHDCFVRGCDGS+LL 
Sbjct  16    CQGGSLTKNFYRNSCPQAEDIIKSQTQQHVSANPNLPAKLIRLHFHDCFVRGCDGSVLLS  75

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQF-KKK  468
             ST +N AE+ A PNLS+AGF+VID IK+A+EA+CP  VSCADI+ALAARD+VS QF  K+
Sbjct  76    STANNTAERDAIPNLSLAGFDVIDAIKSAVEAKCPKTVSCADILALAARDAVSVQFNNKQ  135

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG++S ++EAL+N+P+PF N + L Q FASKGL +HDLV+LSG HTIG+GH
Sbjct  136   MWEVLTGRRDGKVSTSNEALANIPAPFFNLTQLRQSFASKGLTLHDLVVLSGAHTIGVGH  195

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTGKGDQDPSLN +YA  L+TKC++L+D T+ VEMDP SS +FD+D++  
Sbjct  196   CNLFSNRLYNFTGKGDQDPSLNDTYAAFLKTKCQSLSDRTTTVEMDPESSTNFDSDFYPN  255

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L QK GLF SDAALLT   +  I  ++ D+D FF  FA+SM++MG I+VLT ++GE+R  
Sbjct  256   LLQKKGLFQSDAALLTLDQSADIAGELADKDKFFTEFAQSMKRMGNIEVLTDSAGEIRNK  315

Query  1006  CRVPNS  1023
             C V NS
Sbjct  316   CSVVNS  321



>gb|AFK41025.1| unknown [Lotus japonicus]
Length=325

 Score =   407 bits (1045),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 241/307 (79%), Gaps = 2/307 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C+   L + FY+K C   E+IV++   Q  SS P+LPAKLLR+HFHDCFVRGCDGS+LL
Sbjct  19    VCQGGSLREQFYRKSCSQAEQIVKTTIQQHVSSRPELPAKLLRMHFHDCFVRGCDGSVLL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST  N AEK A PNLS++GF+VIDEIK A+EA+CP +VSCADI+ALAARD+VS QF  +
Sbjct  79    NSTAGNTAEKDAIPNLSLSGFDVIDEIKEALEAKCPKIVSCADILALAARDAVSVQFNNE  138

Query  469   -MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMG  645
               W V  GRRDG +S++SE L+N+P+PF  F+ L Q F SK L +HD+V+LSGGHTIG+G
Sbjct  139   PKWEVLTGRRDGTVSKSSEVLTNIPAPFFTFTQLKQSFESKKLTLHDMVVLSGGHTIGVG  198

Query  646   HCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFV  822
             HCNLFSNRLYNFTGKGDQDPSLNP+YA+ L+TKCK+L+D T+ V+MDP S   FD++Y+ 
Sbjct  199   HCNLFSNRLYNFTGKGDQDPSLNPTYAEFLKTKCKSLSDTTTTVDMDPNSGTTFDSNYYS  258

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             IL Q  G+F SDAALL    ++KIV+++V Q+ FF  F +SM++MGAI+VL+G +GE+R+
Sbjct  259   ILLQNKGMFQSDAALLATKQSKKIVNELVGQNKFFTEFGQSMKRMGAIEVLSGTAGEIRR  318

Query  1003  NCRVPNS  1023
              C V NS
Sbjct  319   KCSVVNS  325



>ref|XP_010914386.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=325

 Score =   405 bits (1042),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 238/304 (78%), Gaps = 1/304 (0%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +AS L+ HFYKK CP  E I++ I W+R +  P+L AK LR+ FHDCFVRGCD S+L++S
Sbjct  22    QASGLKYHFYKKSCPEAEPIIQDIIWKRVAERPELAAKFLRMLFHDCFVRGCDASVLINS  81

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T +N AEK A PNLS+AGF+VIDE+KAA+E  CP  VSCADI+ALAARDSVS+QFK+ +W
Sbjct  82    TANNSAEKDAVPNLSLAGFDVIDEVKAALENACPDTVSCADIIALAARDSVSFQFKRPLW  141

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              V  GRRDG IS+ SEAL+N+P+P  NF+TLV+RFASK L V DLV+LSG HTIG+G CN
Sbjct  142   EVQTGRRDGTISKKSEALANIPAPTFNFTTLVRRFASKTLDVKDLVVLSGAHTIGVGLCN  201

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
              FSNRLYNFTGKGD DPSLNP YA  LRT+CK+L+D T+ V MDPGSS  FDT Y+  LK
Sbjct  202   FFSNRLYNFTGKGDADPSLNPPYAAFLRTQCKSLSDNTTSVPMDPGSSLIFDTHYYENLK  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
                GLF SDAALLT+  +  IVDKM++ + FF +F  S+++MGAI+VLTG +G++RK C 
Sbjct  262   MHQGLFQSDAALLTNQRSVHIVDKMLNTEKFFHAFKNSIKRMGAIEVLTGTNGQIRKKCS  321

Query  1012  VPNS  1023
             V NS
Sbjct  322   VVNS  325



>ref|XP_006419701.1| hypothetical protein CICLE_v10005432mg [Citrus clementina]
 gb|ESR32941.1| hypothetical protein CICLE_v10005432mg [Citrus clementina]
Length=322

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 229/305 (75%), Gaps = 1/305 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC    L K+FY++ CP  E IV +I W+  + NP L AKLLR+HFHDCFVRGCD S+L+
Sbjct  18    ACSGGELRKNFYEETCPEAENIVHNIVWKNAALNPTLAAKLLRVHFHDCFVRGCDASVLI  77

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST SN  EK A PN ++ GF+VI+E+K  +E +CPG+VSCADIVALAARDSVS+QFK+ 
Sbjct  78    DSTESNSGEKDALPNETLGGFDVIEEVKTELEKKCPGIVSCADIVALAARDSVSFQFKRT  137

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGRIS ASEA  ++PSPF NFS+L Q F + GL VHDLV+LSGGHT+G+G 
Sbjct  138   LWEVLTGRRDGRISLASEANRDMPSPFFNFSSLQQSFENNGLTVHDLVVLSGGHTLGVGR  197

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDT-SPVEMDPGSSQDFDTDYFVI  825
             C  F +RLYNFTGKGD DPSLNP+YA  LRTKC+N+ D  + V MDPGS   FDT+YF I
Sbjct  198   CRFFRDRLYNFTGKGDADPSLNPTYAAFLRTKCRNVEDNKTAVGMDPGSDLSFDTNYFKI  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L Q  GLF SDAALLTD  AR  V+ ++D   FF  F  SM++MGAI VLTGNSGE+RK 
Sbjct  258   LTQHKGLFQSDAALLTDKGARNFVNVLLDSKRFFMEFGLSMKRMGAIGVLTGNSGEIRKK  317

Query  1006  CRVPN  1020
             C V N
Sbjct  318   CNVIN  322



>gb|AFK41517.1| unknown [Lotus japonicus]
Length=325

 Score =   404 bits (1039),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 239/307 (78%), Gaps = 2/307 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C+   L K FY+K C   E+IV++   Q  SS P+LPAKLLR+HFHDCFVRGCDGS+LL
Sbjct  19    VCQGGSLRKQFYRKSCSQAEQIVKTTIQQHVSSRPELPAKLLRMHFHDCFVRGCDGSVLL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST  N AEK A PNLS++GF+VIDEIK A+EA+CP +VSCADI+ALAARD+VS QF  +
Sbjct  79    NSTAGNTAEKDAIPNLSLSGFDVIDEIKEALEAKCPKIVSCADILALAARDAVSVQFNNE  138

Query  469   -MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMG  645
               W V  GRRDG +S++SE L+N+P+PF  F+ L Q F SK L +HD+V+LS GHTIG+G
Sbjct  139   PKWEVLTGRRDGTVSKSSEVLTNIPAPFFTFTQLKQSFESKKLTLHDMVVLSRGHTIGVG  198

Query  646   HCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFV  822
             HCNLFSNRLYNFTGKGDQDPSLNP+YA+ L+TKCK+L+D T+ V+MDP S   FD++Y+ 
Sbjct  199   HCNLFSNRLYNFTGKGDQDPSLNPTYAEFLKTKCKSLSDTTTTVDMDPNSGTTFDSNYYS  258

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             IL Q  G+F SDAALL    ++KIV+++V Q+ FF  F +SM++MGAI+VL+G +GE+R 
Sbjct  259   ILLQNKGMFQSDAALLATKQSKKIVNELVGQNKFFTEFGQSMKRMGAIEVLSGTAGEIRT  318

Query  1003  NCRVPNS  1023
              C V NS
Sbjct  319   KCSVVNS  325



>ref|XP_010042783.1| PREDICTED: peroxidase 3-like, partial [Eucalyptus grandis]
Length=289

 Score =   402 bits (1033),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 223/279 (80%), Gaps = 1/279 (0%)
 Frame = +1

Query  115  EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
            E   L K+FYK  CP  EEIV+ ITW+  +SN  LPAK LR+HFHDCFVRGCDGS+LLDS
Sbjct  11   EGGDLRKNFYKSACPLAEEIVKDITWKHAASNSALPAKFLRMHFHDCFVRGCDGSVLLDS  70

Query  295  TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
            TT+NKAEK A PN S+ GF+VIDEIK  +E  CPGVVSCADI+ALAARDSVS+QFKK MW
Sbjct  71   TTNNKAEKVAVPNQSLTGFDVIDEIKEKLEETCPGVVSCADILALAARDSVSFQFKKSMW  130

Query  475  SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             V  GRRDGRIS+ SEALSN+PSPF NF+TL Q FA+K L +HDLV+LSGGHTIG+GHCN
Sbjct  131  EVLTGRRDGRISRESEALSNIPSPFFNFTTLKQSFANKSLTLHDLVVLSGGHTIGVGHCN  190

Query  655  LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDT-SPVEMDPGSSQDFDTDYFVILK  831
             FSNRLYNFTGKGDQDPSL+P+YA  L+ +CK L+D  + V MDPGS   FD+ Y+  + 
Sbjct  191  FFSNRLYNFTGKGDQDPSLDPTYASQLKAQCKTLSDNATTVAMDPGSPLSFDSHYYKAVN  250

Query  832  QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSM  948
            +K GLF SDAALLT+  +RKIV++++DQD FF  F +SM
Sbjct  251  RKQGLFQSDAALLTNLESRKIVNELLDQDGFFTEFGQSM  289



>ref|XP_010261100.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=325

 Score =   403 bits (1036),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 235/304 (77%), Gaps = 1/304 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             CE   L K FYK  CP  EEI++++ W+R + +  LPA L+R+HFHDCFVRGCDGS+LL+
Sbjct  21    CEGGPLRKKFYKSSCPNAEEIIKTVVWKRVAQDSGLPAALVRMHFHDCFVRGCDGSVLLN  80

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  N AEK A PNL++ GF+VIDE+K  +E  CPGVVSCADIVAL+ARDSV++QFKK +
Sbjct  81    STKDNTAEKDAPPNLTLTGFDVIDEVKTEVEKACPGVVSCADIVALSARDSVAFQFKKPL  140

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S+ASEA++NLP P  +F+TL Q FA +GL VHDLV+LSG HTIG  HC
Sbjct  141   WDVLTGRRDGTLSRASEAVANLPQPTFDFNTLKQNFARQGLNVHDLVVLSGAHTIGQAHC  200

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             N FSNRLYNFTGKGD DPSL+P+YA +LRT+CK+L+D T+ V MDP S   FD+ Y+  +
Sbjct  201   NAFSNRLYNFTGKGDADPSLDPTYAAVLRTQCKSLSDNTAQVFMDPNSGTSFDSHYYAAV  260

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLT+     IV ++++Q+ FF  FA+S++KMGAI VLTGNSG++RK C
Sbjct  261   KQHKGLFQSDAALLTNKITSNIVTELLNQNAFFTEFAQSIQKMGAIGVLTGNSGQIRKIC  320

Query  1009  RVPN  1020
              V N
Sbjct  321   SVVN  324



>ref|XP_002520704.1| peroxidase, putative [Ricinus communis]
 gb|EEF41666.1| peroxidase, putative [Ricinus communis]
Length=709

 Score =   415 bits (1066),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 238/293 (81%), Gaps = 1/293 (0%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L K FY+K CP  E+IVR +T +   SNP LPAKLLR+HFHDCFVRGCDGSIL++STT+N
Sbjct  387   LRKKFYRKSCPQAEDIVRKVTERHVLSNPNLPAKLLRMHFHDCFVRGCDGSILIESTTNN  446

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK + PNL++ GF+VI++IK+ +E  CPG+VSCADI+ALAARDSVSYQFKK +W V  
Sbjct  447   TAEKDSIPNLTLTGFDVIEDIKSELEKVCPGLVSCADILALAARDSVSYQFKKPLWEVLT  506

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG +S ASE  +++PSPF+NFS L Q F SKGL VHDLV+LSGGHTIG+GHCNLFSN
Sbjct  507   GRRDGSVSLASEVFAHIPSPFANFSALKQNFKSKGLTVHDLVVLSGGHTIGVGHCNLFSN  566

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTGKGDQDPSL+ +YA+ L+ KC++L D T+ VEMDP SS  FD DYFVILKQ  G
Sbjct  567   RLYNFTGKGDQDPSLSATYAEFLKAKCRSLADTTTTVEMDPDSSFTFDNDYFVILKQHKG  626

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             LF SDAALLT+  A KI  ++++   FF  FA+SM++MGAI+VLTG+ GE+RK
Sbjct  627   LFQSDAALLTNKIASKIAGELLNSKAFFTEFAQSMKRMGAIEVLTGSKGEIRK  679


 Score =   399 bits (1025),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 231/287 (80%), Gaps = 1/287 (0%)
 Frame = +1

Query  112  CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
            C+A  L K FY++ CP  E+ +R IT +   SNP LPAKLLR+HFHDCFVRGCDGSIL++
Sbjct  18   CQAGGLRKKFYRRSCPQAEDTIRKITEKHVLSNPNLPAKLLRMHFHDCFVRGCDGSILIE  77

Query  292  STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
            STT++ AEK + PNL++ GF+VI++IK+ +E  CPG+VSCADI+ALAARDSVS+QFKK +
Sbjct  78   STTNSTAEKDSIPNLTLTGFDVIEDIKSELEKACPGLVSCADILALAARDSVSFQFKKPL  137

Query  472  WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
            W V  GRRDG +S ASE  +N+PSPF++FSTL Q F SKGL VHDLV+LSGGHTIG+GHC
Sbjct  138  WEVLTGRRDGNVSLASEVFANIPSPFADFSTLKQNFKSKGLTVHDLVVLSGGHTIGVGHC  197

Query  652  NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
            NLFSNRLYNFTGKGDQDPSL+ +YA+ L+ KC++L D T+ VEMDP SS  FD DYFVIL
Sbjct  198  NLFSNRLYNFTGKGDQDPSLSATYAEFLKAKCRSLADTTTTVEMDPDSSFTFDNDYFVIL  257

Query  829  KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQ  969
            KQ  GLF SDAALLT+  A KI  ++++   FF  FA+SM++MGAI+
Sbjct  258  KQHKGLFQSDAALLTNKIASKIAGELLNSKAFFTEFAQSMKRMGAIE  304



>ref|XP_009385027.1| PREDICTED: peroxidase 3-like [Musa acuminata subsp. malaccensis]
Length=351

 Score =   402 bits (1033),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 233/307 (76%), Gaps = 4/307 (1%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +A  L+K FYK  CP  EE VRSI W   SSN +LPAKLLRL FHDCFVRGCD SIL++S
Sbjct  45    QAEGLKKGFYKNSCPQAEETVRSIIWNHVSSNSELPAKLLRLFFHDCFVRGCDASILIES  104

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T+ N AEK A PNLS+AGF+VI+E+K A+E  CPG VSCADIVALAARDSVS+QF K +W
Sbjct  105   TSDNVAEKDAGPNLSLAGFDVIEEVKTALETACPGTVSCADIVALAARDSVSFQFNKLLW  164

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              V  GRRDG IS+ SEALS+LPSP SNFS L  +FA+KGL V DLV+LSG HTIG+GHCN
Sbjct  165   KVKTGRRDGTISRRSEALSDLPSPASNFSVLAGQFANKGLHVKDLVVLSGAHTIGVGHCN  224

Query  655   LFSNRLYNFTGK---GDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFV  822
             LFS RLYNFTG+    D DPSL+P+YA +L+TKC++L D T+ VEMDPGSS DFD  Y+ 
Sbjct  225   LFSQRLYNFTGQNAENDTDPSLDPTYAALLKTKCRSLADNTTTVEMDPGSSTDFDNHYYA  284

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              L++K GLF SDAALLTD  + K+V K++    FF  F  S+ +MGAI VLTG  GE+R 
Sbjct  285   NLQEKKGLFVSDAALLTDQRSAKLVGKLLHPGDFFDDFKNSITRMGAIGVLTGTDGEIRN  344

Query  1003  NCRVPNS  1023
              C V NS
Sbjct  345   KCSVVNS  351



>ref|XP_010272777.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=325

 Score =   400 bits (1029),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 237/305 (78%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K+FYK  CP  E+IVR + W+  +S+P LPA+L+RL+FHDCFVRGCD S+LL+
Sbjct  21    CQGGALRKNFYKDSCPLAEKIVRDVIWKLAASDPALPAELVRLNFHDCFVRGCDASVLLN  80

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N AEK A PNL++ G ++ID++K  +E  CPGVVSCADI+ALAARDSV++QFKK M
Sbjct  81    STPNNVAEKDAVPNLTLDGADIIDKVKDEVEKACPGVVSCADIIALAARDSVAFQFKKPM  140

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S ASEA++NLP P S+F+TL   FA KGL +HDLV+LSG HT G GHC
Sbjct  141   WEVLTGRRDGTVSLASEAVANLPQPSSDFATLRSNFAKKGLTLHDLVVLSGAHTFGHGHC  200

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             + FS RLYNFTGKGD DPSL+P+YA  L+T+CK L+D T+ V+MDP S Q FD  Y+V+L
Sbjct  201   DAFSKRLYNFTGKGDVDPSLDPTYAAFLKTQCKTLSDNTTTVDMDPESPQSFDNHYYVVL  260

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLT+  +  IVD++++Q+ FF  F +SM++MGAI VLTGNSGE+RK C
Sbjct  261   KQHKGLFQSDAALLTNKMSSNIVDELLNQNKFFTEFGQSMKRMGAIGVLTGNSGEIRKKC  320

Query  1009  RVPNS  1023
              V NS
Sbjct  321   GVVNS  325



>ref|XP_003638079.1| Peroxidase [Medicago truncatula]
 gb|KEH24352.1| cationic peroxidase [Medicago truncatula]
Length=320

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 238/304 (78%), Gaps = 6/304 (2%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             E   L K+FYKK CP  EEIV++IT Q  SS P+LPAKL+RLHFHDCFVRGCD S+LL+S
Sbjct  21    EGGSLRKNFYKKSCPQAEEIVKNITLQHVSSRPELPAKLIRLHFHDCFVRGCDASVLLES  80

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK-M  471
             T  N AEK A PNLS+AGF+VI++IK A+E +CPG+VSCADI+ LA RD+    FK K  
Sbjct  81    TAGNTAEKDAIPNLSLAGFDVIEDIKEALEEKCPGIVSCADILTLATRDA----FKNKPN  136

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S++ EAL N+P+PF N + L Q FA+K L +HDLV+LSG HTIG+GHC
Sbjct  137   WEVLTGRRDGTVSRSIEALINIPAPFHNITQLRQIFANKKLTLHDLVVLSGAHTIGVGHC  196

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFSNRL+NFTGKGDQDPSLNP+YA+ L+TKC+ L+D T+ VEMDP SS  FD DY+ +L
Sbjct  197   NLFSNRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDTTTTVEMDPNSSTTFDNDYYPVL  256

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GLF SDAALLT   +R IV+++V Q+ FF  F++SM++MGAI+VLTG++GE+R+ C
Sbjct  257   LQNKGLFTSDAALLTTKQSRNIVNELVSQNKFFTEFSQSMKRMGAIEVLTGSNGEIRRKC  316

Query  1009  RVPN  1020
              V N
Sbjct  317   SVVN  320



>ref|XP_006489185.1| PREDICTED: peroxidase 24-like [Citrus sinensis]
Length=323

 Score =   399 bits (1026),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 228/306 (75%), Gaps = 2/306 (1%)
 Frame = +1

Query  109   ACE-ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSIL  285
             AC     L K+FY++ CP  E IV +I W+  + NP L AKLLR+HFHDCFVRGCD S+L
Sbjct  18    ACSTGGELRKNFYEETCPEAENIVHNIVWKNAALNPTLAAKLLRVHFHDCFVRGCDASVL  77

Query  286   LDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKK  465
             +DST SN  EK A PN ++ GF+VI+E+K  +E +CPG+VSCADIVALAARDSVS+QFK+
Sbjct  78    IDSTESNSGEKDALPNETLGGFDVIEEVKTELEKKCPGIVSCADIVALAARDSVSFQFKR  137

Query  466   KMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMG  645
              +W V  GRRDGRIS ASEA  ++PSPF NFS+L Q F + GL VHDLV+LSGGHT+G+G
Sbjct  138   TLWEVLTGRRDGRISLASEANRDMPSPFFNFSSLQQSFENNGLTVHDLVVLSGGHTLGVG  197

Query  646   HCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDT-SPVEMDPGSSQDFDTDYFV  822
              C  F +RLYNFTGKGD DPSLNP+YA  LRTKC N+ D  + V MDPGS   FDT+YF 
Sbjct  198   RCRFFRDRLYNFTGKGDADPSLNPTYAAFLRTKCGNVEDNKTAVGMDPGSDLSFDTNYFK  257

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             IL Q  GLF SDAALLTD  AR  V+ ++D   FF  F  SM++MGAI VLTGNSGE+RK
Sbjct  258   ILTQHKGLFQSDAALLTDKGARNFVNVLLDSKRFFMEFGLSMKRMGAIGVLTGNSGEIRK  317

Query  1003  NCRVPN  1020
              C V N
Sbjct  318   KCNVIN  323



>ref|XP_006479844.1| PREDICTED: peroxidase 3-like [Citrus sinensis]
 gb|KDO87429.1| hypothetical protein CISIN_1g019629mg [Citrus sinensis]
Length=338

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 235/306 (77%), Gaps = 2/306 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K+FY+  C   E+IVRSITW+  +SNP LPAKL+R+HFHDCFVRGCD S+L++
Sbjct  24    CQGGELRKNFYRDSCKSAEDIVRSITWKNAASNPDLPAKLIRMHFHDCFVRGCDASVLIN  83

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKK-K  468
             ST  NKAE+ A PNLS+ GFEVI+EIK+ +E+ CPG+VSCADIVALA RDSVS+QF+K  
Sbjct  84    STAGNKAERDAVPNLSLGGFEVINEIKSELESRCPGIVSCADIVALATRDSVSFQFQKPD  143

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S A+EA   LPSPF+NFS L + F  KGL V DLV+LSGGHTIG+ H
Sbjct  144   LWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSH  203

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPV-EMDPGSSQDFDTDYFVI  825
             C  FSNRLYNFTG GDQDPSL+P YA  L+TKCK+L DT+   E+DPGS + FD+ Y+ I
Sbjct  204   CTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDI  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L +  GLF SDAALLT+  AR IV ++ +QD FF  FA+SM++MGA+ VLTG  GE+RK 
Sbjct  264   LIENKGLFQSDAALLTNKGARNIVMELRNQDKFFTEFAQSMKRMGAMNVLTGTQGEIRKK  323

Query  1006  CRVPNS  1023
             C V N+
Sbjct  324   CSVINN  329



>ref|XP_008812662.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=326

 Score =   399 bits (1025),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 235/304 (77%), Gaps = 1/304 (0%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +A+ L+ HFYKK CP  E+IV+ I W+  +  P+L AK LR+ FHDCFVRGCD S+L++S
Sbjct  23    QAAGLKHHFYKKSCPEAEQIVQDIIWKHVAKKPELAAKFLRMFFHDCFVRGCDASVLINS  82

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T +N AEK A PNLS+AGF+VIDE+KA +E  CP  VSCADI+ALAARDSVS+QFK+ +W
Sbjct  83    TANNSAEKDATPNLSLAGFDVIDEVKAELEKACPDTVSCADIIALAARDSVSFQFKRPLW  142

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              V  GRRDG IS+ SEAL+N+P+P  NF+TLVQ FA+K L V DLV+LSG HTIG+G CN
Sbjct  143   EVQTGRRDGTISRRSEALANIPAPTFNFTTLVQSFANKTLDVKDLVVLSGAHTIGVGLCN  202

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
              FSNRLYNFTGKGD DPSLNPSYA  L+T+CK+L+D T+ V MDPGSS  FDT Y+  LK
Sbjct  203   FFSNRLYNFTGKGDADPSLNPSYAAFLKTQCKSLSDNTTSVPMDPGSSLIFDTHYYENLK  262

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
                GLF SDAALLT+  +  IVDKM+  + FF +F  S+++MGA++V TG +GE+RK C 
Sbjct  263   LHQGLFQSDAALLTNQRSTHIVDKMLGTENFFNAFKNSIKRMGAVEVRTGTNGEIRKKCS  322

Query  1012  VPNS  1023
             V NS
Sbjct  323   VVNS  326



>ref|XP_010091374.1| Peroxidase 3 [Morus notabilis]
 gb|EXB44364.1| Peroxidase 3 [Morus notabilis]
Length=330

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 230/300 (77%), Gaps = 1/300 (0%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L K+FYKK C   E IV+ +T +  ++NP LPAKLLR+HFHDCFVRGCDGS+LL ST SN
Sbjct  31    LVKNFYKKSCRRAEAIVKEVTEENVANNPNLPAKLLRMHFHDCFVRGCDGSVLLSSTESN  90

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A PN S+AGF+VID IK  +E ECPG+VSCADI+ALAARDSV+Y+FKK  W V  
Sbjct  91    TAEKDAVPNQSLAGFDVIDAIKEKVEKECPGIVSCADILALAARDSVTYKFKKPTWDVLT  150

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG +S  SEAL N+PSP SNF+ L   FA KGL VH LV+LSGGHTIG+ HCN FS+
Sbjct  151   GRRDGTVSLISEALLNIPSPSSNFTKLKNTFARKGLNVHHLVVLSGGHTIGVAHCNFFSD  210

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCK-NLNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTGKGDQDPSL+ +YA+ L++KC  N    + VE+D  SS DFDT+++ ILK+  G
Sbjct  211   RLYNFTGKGDQDPSLDSNYAEFLKSKCSPNDAGATTVEIDNNSSLDFDTNFYKILKENKG  270

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             LF SDAALLT+  AR  V ++VD+D FFK FA+SM+ MGAI+VLTG +GE+R  C   NS
Sbjct  271   LFQSDAALLTNKVARNTVGELVDRDTFFKEFAQSMKTMGAIEVLTGTAGEIRNKCSAVNS  330



>ref|XP_004292686.1| PREDICTED: peroxidase 3-like [Fragaria vesca subsp. vesca]
Length=328

 Score =   396 bits (1017),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 229/306 (75%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C    L K+FYKK CP  E+IV+  TW   S+NP LPAKLLR+HFHDCFVRGCD S+LL
Sbjct  22    GCLGGSLRKNFYKKTCPRAEQIVKDATWNHVSANPNLPAKLLRMHFHDCFVRGCDASVLL  81

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
              ST +N AE+ + PNLS+ GF+VID+IK  +E  CPGVVSCADI+ALA RDSVS+QFKK 
Sbjct  82    SSTANNTAERDSFPNLSLKGFDVIDDIKEQLEKACPGVVSCADILALATRDSVSFQFKKS  141

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W V  GRRDG +S A+E   NLPSPF NF+ L Q FA+KGL V DLV+LSG H+IG+GH
Sbjct  142   QWDVLTGRRDGNVSIANEVSGNLPSPFFNFAQLKQSFANKGLTVQDLVVLSGAHSIGVGH  201

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFS RLYNFTGKGDQDPS++ +YA +L+T+C+   D T+ VE+DPGS Q+FD  ++ I
Sbjct  202   CNLFSKRLYNFTGKGDQDPSMDSTYAALLKTQCQGPGDRTTTVELDPGSFQNFDNSFYTI  261

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LKQK GLF SDAALLT+  +   V K++  + FF  F +SM++MGAI VLTG SG++R  
Sbjct  262   LKQKKGLFQSDAALLTNKVSSNAVQKLLKGNDFFTEFGQSMKRMGAIGVLTGTSGQIRTQ  321

Query  1006  CRVPNS  1023
             C   NS
Sbjct  322   CGFVNS  327



>ref|XP_009382093.1| PREDICTED: peroxidase 24-like [Musa acuminata subsp. malaccensis]
Length=328

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 227/304 (75%), Gaps = 0/304 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C ++ L+ +FY   CP  E+IV++I ++    NP LPAKLLR+ FHDCFVRGCD S+LL
Sbjct  25    GCPSAGLKPNFYGSSCPNAEQIVQTIIYKEAEKNPILPAKLLRMFFHDCFVRGCDASLLL  84

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST+ + AEK A PNLS+AGFEVID +K A+E  CPG VSCADIVALAARDSVS+ F K 
Sbjct  85    NSTSESTAEKDAPPNLSLAGFEVIDMVKEALEQACPGTVSCADIVALAARDSVSFPFGKS  144

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S  SEAL N+P P SNF+TLV+ FA+K LGV DLVILSG HTIG+GH
Sbjct  145   LWDVKTGRRDGNVSLLSEALVNIPRPTSNFTTLVRSFANKSLGVDDLVILSGAHTIGVGH  204

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVIL  828
             CNLF+ RLYNFTGKGD DPSL+P+YA  LRTKC   ++T+ V MDPGS   FD+ Y+V L
Sbjct  205   CNLFAERLYNFTGKGDSDPSLDPAYAAFLRTKCSPTDNTTTVIMDPGSGLKFDSHYYVNL  264

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDA LLTD  A K+VD+MVD   F  +F  S+ KMG + VLTG  GE+RK+C
Sbjct  265   KQNKGLFQSDAVLLTDGAASKVVDEMVDFGAFIAAFRNSITKMGDVGVLTGKEGEIRKHC  324

Query  1009  RVPN  1020
             R  N
Sbjct  325   RFVN  328



>gb|EYU43875.1| hypothetical protein MIMGU_mgv1a017718mg, partial [Erythranthe 
guttata]
Length=304

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 228/302 (75%), Gaps = 1/302 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             CE   L  +FY   CP  E+IV+ I  +  +++  LPAKLLR+HFHDCFVRGCDGS+L+D
Sbjct  2     CECGGLTNNFYSTSCPNAEKIVKKIISKHVANDATLPAKLLRMHFHDCFVRGCDGSVLID  61

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  +KAEK A PNLS+ GFEVI+EIK  +E  CPG+VSCAD++ALAARDSVS++F K M
Sbjct  62    STAKHKAEKEAVPNLSLGGFEVIEEIKTQLEKTCPGIVSCADVLALAARDSVSFKFNKPM  121

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG +S+ S+AL+ LPSP S+F TL Q FA KGL V DLV+LSG HTIG+G C
Sbjct  122   WEVETGRRDGIVSRESDALNELPSPASDFKTLKQSFADKGLSVKDLVVLSGAHTIGVGKC  181

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
              +FSNRLYNFTGKGD D SLN +YA  LR+KC++L+D T+ VEMDP SS DFD  YF  L
Sbjct  182   IVFSNRLYNFTGKGDTDTSLNTTYAATLRSKCRSLSDQTTTVEMDPTSSLDFDNHYFTAL  241

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             K + GLF SDAALLT+  AR +VD+M+    F+  F KSM+KMGAI VLTG+ G++RK C
Sbjct  242   KLRQGLFQSDAALLTNDVARGVVDQMLTSGKFYTQFGKSMKKMGAIGVLTGDEGKIRKKC  301

Query  1009  RV  1014
              +
Sbjct  302   NI  303



>gb|AGH14256.1| Peroxidase [Musa acuminata AAA Group]
Length=328

 Score =   390 bits (1002),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 227/304 (75%), Gaps = 0/304 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C ++ L+ +FY   CP  E+IV++I ++    NP LPAKLLR+ FHDCFVRGCD S+LL
Sbjct  25    GCPSAGLKPNFYGSSCPNAEQIVQTIIYKEAEKNPILPAKLLRMFFHDCFVRGCDASLLL  84

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST+ + AEK A PNLS+AGFEVID +K A+E  CPG VSCADIVALAARDSVS+ F K 
Sbjct  85    NSTSESTAEKDAPPNLSLAGFEVIDMVKEALEQACPGTVSCADIVALAARDSVSFPFGKS  144

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S  SEAL N+P P SNF+TLV+ FA+K LGV DLVILSG HTIG+GH
Sbjct  145   LWDVKTGRRDGNVSLLSEALVNIPRPTSNFTTLVRSFANKSLGVDDLVILSGAHTIGVGH  204

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVIL  828
             CNLF+ RLYNFTGKGD DPSL+P+YA  LRTKC   ++T+ V MDPGS   FD+ Y+V L
Sbjct  205   CNLFAERLYNFTGKGDSDPSLDPAYAAFLRTKCSPTDNTTTVIMDPGSGLKFDSHYYVNL  264

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDA LLTD  A K+VD+MV+   F  +F  S+ KMG + VLTG  GE+RK+C
Sbjct  265   KQNKGLFQSDAVLLTDGAASKVVDEMVNFGAFIAAFRNSITKMGDVGVLTGKEGEIRKHC  324

Query  1009  RVPN  1020
             R  N
Sbjct  325   RFVN  328



>ref|XP_010024493.1| PREDICTED: peroxidase 24-like [Eucalyptus grandis]
 gb|KCW60934.1| hypothetical protein EUGRSUZ_H03667 [Eucalyptus grandis]
Length=328

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 228/308 (74%), Gaps = 4/308 (1%)
 Frame = +1

Query  109   ACEASH---LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGS  279
             AC A     L K+FYKK CP  E++VR ITW +  ++P L AKLLR+H+HDCFVRGCDGS
Sbjct  19    ACNADDDGGLRKNFYKKSCPQAEKLVRDITWSKAQADPTLGAKLLRVHYHDCFVRGCDGS  78

Query  280   ILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQF  459
             +LLD   +N++EK A PNL++AGF+VID+IK  +E  CP  VSCAD+++LAARD+VS+ F
Sbjct  79    VLLDPVGTNQSEKNAVPNLTLAGFDVIDDIKKQVEQACPNTVSCADVLSLAARDAVSFPF  138

Query  460   KKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIG  639
             KK +W V MGRRDG IS AS    NLPSPF++FSTL Q F+ KGL V+DLV+LSG HTIG
Sbjct  139   KKPIWDVLMGRRDGNISLASNIPGNLPSPFADFSTLAQIFSKKGLNVNDLVVLSGAHTIG  198

Query  640   MGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDY  816
             + HC  FS RLYNFTGKGD DPSLN +YA  LRT+C N  N  + VEMDP SS  FD+ Y
Sbjct  199   VAHCGTFSRRLYNFTGKGDADPSLNATYAASLRTQCPNPANPATTVEMDPQSSLSFDSHY  258

Query  817   FVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEV  996
             F IL +  GLF SDAALLT+  A K+V  +   D FF  F KSM+KMGAI+VLTG +GE+
Sbjct  259   FDILIENEGLFQSDAALLTNQGAAKVVQHLRSPDAFFSEFGKSMKKMGAIEVLTGTAGEI  318

Query  997   RKNCRVPN  1020
             RK CRV N
Sbjct  319   RKQCRVVN  326



>ref|XP_010242552.1| PREDICTED: uncharacterized protein LOC104586872 [Nelumbo nucifera]
Length=726

 Score =   400 bits (1027),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 237/305 (78%), Gaps = 2/305 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C+   L K+FYK  CP  E+ +++I W+  +++  LPA LLR+HFHDCFVRGCDGS+LL
Sbjct  423   VCQGGGLRKNFYKHSCPGAEDTIKNIIWKNVAADSGLPADLLRMHFHDCFVRGCDGSVLL  482

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DS  +  AEK + PNL++ GF+VIDE+KAA+E  CPGVVSCADI+AL ARD+V++QFKK 
Sbjct  483   DSP-NKTAEKDSIPNLTLEGFDVIDEVKAAVEKLCPGVVSCADILALTARDAVAFQFKKP  541

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGR+S+ S+A +N+PSPFSNF+TL Q FA+KGL VHDLV+LSG HTIG GH
Sbjct  542   LWEVLTGRRDGRVSRKSDADANIPSPFSNFTTLKQNFAAKGLTVHDLVVLSGAHTIGQGH  601

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRLYNFTGKGD DPSL+PSYA  LRT+C++L D T+ V MDP S + FD  YFV 
Sbjct  602   CNLFSNRLYNFTGKGDADPSLDPSYAAFLRTQCRSLADNTTKVAMDPRSDESFDNHYFVS  661

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             LKQ  GLF SDAALLT   +  IV+++++   FF  FA+S++KMGAI+VLTG +GE+RK 
Sbjct  662   LKQHKGLFQSDAALLTTKISSNIVNELINSRKFFTEFAQSIKKMGAIEVLTGTNGEIRKK  721

Query  1006  CRVPN  1020
             C   N
Sbjct  722   CNAVN  726


 Score =   369 bits (947),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 226/305 (74%), Gaps = 2/305 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C+   L K+FY+  CP  EE +R++TW+  +++  L A LLR+HFHDCFVRGCDGS+LL
Sbjct  19    VCQGGALRKNFYQTSCPKAEETIRNVTWKNVAADSGLVADLLRMHFHDCFVRGCDGSLLL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DS   N AEK ++PNL++ GF+VIDE+K  +E  CPGVVSCADI+ALAARD+VS+QFK+ 
Sbjct  79    DSA-DNTAEKDSSPNLTLEGFDVIDEVKTEVEKICPGVVSCADIIALAARDAVSFQFKRS  137

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDGR+S  SEA +N+P P  NF TL QRFA+KGL V DLV+LSG HTIG GH
Sbjct  138   VWDVFTGRRDGRVSLKSEADANIPLPSFNFDTLRQRFAAKGLTVRDLVVLSGAHTIGHGH  197

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             C  FSNRLYNFTGKGD DPSL+ +YAD LR++C++L+D T+ V MDP S   FD  YF  
Sbjct  198   CKDFSNRLYNFTGKGDADPSLDSTYADSLRSQCQSLSDTTTTVPMDPQSDTTFDNHYFAN  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L Q  GLF SDAALLT+  ++ IV+ +++ + FF  F  +++K+G+I VLTG +GE+R  
Sbjct  258   LMQNKGLFQSDAALLTNPVSQNIVNVLLNSNAFFTEFGIAIQKLGSIGVLTGTAGEIRNK  317

Query  1006  CRVPN  1020
             C   N
Sbjct  318   CNAVN  322



>gb|AHL39180.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 232/301 (77%), Gaps = 3/301 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L K FYK  CP  E+IVR++TW+R +++  LPAKLLR HFH CFVRGCD S+L++ST +N
Sbjct  28    LRKKFYKISCPAAEDIVRNVTWRRAATSLNLPAKLLRTHFHGCFVRGCDASVLVNSTANN  87

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV-P  483
              AEK A PNLS+ GF+VIDEIK  +E  CPG VSCADI+AL+ARDSV++Q  + +     
Sbjct  88    TAEKDAIPNLSLEGFDVIDEIKTQLENTCPGKVSCADILALSARDSVAFQVLRAVQKPRV  147

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
             +GRRDG +S+A EA +++PSPF NF T +Q F SKGL VHDLV+LSGGHTIG GHCNL S
Sbjct  148   VGRRDGIVSEALEAFTDIPSPFFNFWTPLQSFKSKGLSVHDLVVLSGGHTIGAGHCNLVS  207

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQKM  840
             NRLYNFTGKGDQDPSLNP+Y   L+ KCK LN+ T+ VE+DPGSSQ+FDT YF   KQ+ 
Sbjct  208   NRLYNFTGKGDQDPSLNPTYVAFLKNKCKILNEATTTVEIDPGSSQNFDTAYFAT-KQRK  266

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALLT+    KIV ++++ + FF+ FA+ M++MGAI VL G SGE+RK C V N
Sbjct  267   GLFQSDAALLTNRTPNKIVGELLNSNVFFREFAQPMKRMGAIGVLPGTSGEIRKKCSVIN  326

Query  1021  S  1023
             S
Sbjct  327   S  327



>ref|XP_010244668.1| PREDICTED: uncharacterized protein LOC104588433 [Nelumbo nucifera]
Length=726

 Score =   398 bits (1022),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 238/304 (78%), Gaps = 2/304 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C+   L K+FY+  CP  EE ++S+ W+R +++  LPA+LLR+HFHDCFVRGCDGS+LLD
Sbjct  20    CQGWFLRKNFYQHCCPKAEETIKSVIWKRVAADSGLPAELLRMHFHDCFVRGCDGSVLLD  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             S  +N AEK +APNL++ GF+VIDE K A+E  CPG+VSCADI+ALAARDSVS+QFK+ +
Sbjct  80    SP-NNTAEKDSAPNLTLEGFDVIDEAKTAVEKICPGIVSCADILALAARDSVSFQFKRPL  138

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDGR+S+ SEA +N+PSPFS+F+TL Q F +KGL VHDLV+LSG HTIG GHC
Sbjct  139   WEVLTGRRDGRVSRKSEADANIPSPFSDFNTLKQNFKAKGLTVHDLVVLSGAHTIGHGHC  198

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             NLFSNRLYNF GKGD DPSL+P+YA  LR KC++L D T+ V MDP S + FDT YFV L
Sbjct  199   NLFSNRLYNFRGKGDADPSLDPTYAAFLRNKCRSLADNTTTVAMDPQSDESFDTHYFVNL  258

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLT+  +  IV+++++   FF  FA S++KMG I+VLTG +GE+RK C
Sbjct  259   KQHKGLFQSDAALLTNKVSVNIVNELLNSHRFFTEFAISIKKMGDIEVLTGTAGEIRKKC  318

Query  1009  RVPN  1020
              V N
Sbjct  319   NVVN  322


 Score =   392 bits (1006),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/305 (62%), Positives = 227/305 (74%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C    L+++FY+  CP  EEIV+SITW+R  ++P+L AKLLR++FHDCFVRGCD S+LLD
Sbjct  421   CNGGVLKRNFYRYNCPQAEEIVKSITWRRVEASPELAAKLLRMYFHDCFVRGCDASVLLD  480

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             +  S  +EK A PNLS+AGF+VIDEIK  IE  CP  VSCADI+ALA RDSVSYQF++ M
Sbjct  481   TVGSETSEKDAPPNLSLAGFDVIDEIKFQIEQICPRTVSCADILALATRDSVSYQFQRPM  540

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             WSV  GRRDG +S ASE LSNL SPF+NF+ L Q FASKGL   DLV+LSG HT+G+ HC
Sbjct  541   WSVLTGRRDGNVSLASEVLSNLASPFANFNQLQQLFASKGLNTKDLVVLSGAHTLGVSHC  600

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSP-VEMDPGSSQDFDTDYFVIL  828
             ++ SNRLYNF G+G+ DPSLNP+YAD LRT+C N  D S  VEMDP SS +FD  YF I+
Sbjct  601   SIISNRLYNFDGQGNPDPSLNPAYADFLRTQCPNPADPSTVVEMDPQSSLNFDNHYFAIV  660

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q MGLF SDAALLTD  +   V  + + + FF  F KS+ KMG I VLTGN GE+R  C
Sbjct  661   NQNMGLFQSDAALLTDPVSAMTVQSLQNANTFFSEFTKSLTKMGNIGVLTGNEGEIRTQC  720

Query  1009  RVPNS  1023
             RV NS
Sbjct  721   RVVNS  725


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +1

Query  256  FVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAA  435
            F  GCD S+LLDS     AEK AAPNL++ GF+VIDE+K A++  CPGV SCADIVALAA
Sbjct  324  FTYGCDASVLLDSP-DKTAEKDAAPNLTLEGFDVIDEVKTAVDKICPGVTSCADIVALAA  382

Query  436  RDSVSYQ  456
            RD+VS+Q
Sbjct  383  RDAVSFQ  389



>ref|XP_009760980.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 24-like [Nicotiana 
sylvestris]
Length=324

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 221/305 (72%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+ ++Y K CP VE IVR ITW R +++P LPAKLLRLH+HDCFVRGCD S+LLD
Sbjct  20    CNADKLKMNYYHKSCPSVESIVRDITWSRVAADPSLPAKLLRLHYHDCFVRGCDASVLLD  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  N AEKAA PN S+ G+EVID+IK  +E  CP  VSC DI+AL  RD+VSYQ  + M
Sbjct  80    STKKNSAEKAALPNRSLGGYEVIDDIKKKLEEMCPHKVSCVDILALVTRDAVSYQLGRSM  139

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W +P GR+DGR+S+ASEAL+ LPSPF+NF+TL+Q+F    L + DLV LSG HTIG+ HC
Sbjct  140   WKIPTGRKDGRVSKASEALATLPSPFANFTTLLQQFQDNDLDIVDLVTLSGAHTIGITHC  199

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVIL  828
              L + RLYNFTGKGD DPSLNP+YA  LRT C N +N  + VE+DP SS  FD+ Y+  L
Sbjct  200   TLVARRLYNFTGKGDADPSLNPNYATTLRTMCPNPINPNTVVELDPKSSLSFDSHYYEAL  259

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GL  SDAAL+T+ H+ +IV K+ +   F   FA+SM+KMG I VL    GE+R NC
Sbjct  260   NQNKGLLRSDAALMTNSHSAQIVRKLQNPHVFLAFFARSMKKMGVIGVLADGEGEIRNNC  319

Query  1009  RVPNS  1023
             RV N+
Sbjct  320   RVVNA  324



>ref|XP_009588152.1| PREDICTED: peroxidase 24-like [Nicotiana tomentosiformis]
Length=324

 Score =   383 bits (983),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 225/305 (74%), Gaps = 1/305 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+ ++Y K CP VE IVR ITW R +++P LPAKLLRLH+HDCFVRGCD S+LLD
Sbjct  20    CNADKLKMNYYHKSCPSVERIVREITWSRVAADPSLPAKLLRLHYHDCFVRGCDASVLLD  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  N AEKAA PN S+ G+EVID+IK  +E  CP  VSCADI+AL  RD+VSYQF + M
Sbjct  80    STPKNSAEKAALPNRSLGGYEVIDDIKKKLEQVCPHKVSCADILALVTRDAVSYQFGRSM  139

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W +P GR+DGR+S+ASEAL++LPSPF+NF+TL+++F    L + DLV LSG HTIG+ HC
Sbjct  140   WKIPTGRKDGRVSKASEALASLPSPFANFTTLLRQFQDNDLDIVDLVTLSGAHTIGITHC  199

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVIL  828
              L + RLYNFTGKGD DPSLNP+YA  LRT C N +N  + +E+DP SS  FD+ Y+  L
Sbjct  200   TLVAKRLYNFTGKGDADPSLNPNYATTLRTMCPNPINPKTVLELDPKSSLSFDSHYYEAL  259

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GL  SDAALLT+ H+ +IV K+ +   F   F++SM+KMG I+VL    GE+RKNC
Sbjct  260   NQNKGLLRSDAALLTNSHSAQIVRKLQNPHVFLAFFSRSMKKMGDIRVLADGEGEIRKNC  319

Query  1009  RVPNS  1023
             R  N+
Sbjct  320   RAVNA  324



>ref|XP_010024491.1| PREDICTED: peroxidase 24-like [Eucalyptus grandis]
 gb|KCW60933.1| hypothetical protein EUGRSUZ_H03666 [Eucalyptus grandis]
Length=326

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 225/306 (74%), Gaps = 2/306 (1%)
 Frame = +1

Query  109   ACEA-SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSIL  285
             AC A   L ++FYKK CP  E++VR ITW +  S+P L AKLLR+H+HDCFV+GCDGSIL
Sbjct  19    ACNADGKLRENFYKKSCPQAEKLVRDITWSKAQSDPTLGAKLLRMHYHDCFVQGCDGSIL  78

Query  286   LDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKK  465
             LD   + ++EK A PNL++AGF+VID+IK  +E  CP +VSCAD+++LAARD+VS+ F K
Sbjct  79    LDPVGTTQSEKNAVPNLALAGFDVIDDIKTQVEQACPNIVSCADVLSLAARDAVSFPFNK  138

Query  466   KMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMG  645
              MW+V  GRRDG++S AS     LPSPF+NFSTL Q F+  GL V+DLV+LSG HTIG+ 
Sbjct  139   SMWNVLTGRRDGKVSLASNVAGKLPSPFANFSTLAQSFSETGLNVNDLVVLSGAHTIGVA  198

Query  646   HCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFV  822
             HC + SNRLYNFTGKGD DPSLN +YA  LRT+C N  N    V+MDP SS  FD+ YF 
Sbjct  199   HCGIISNRLYNFTGKGDADPSLNAAYAASLRTQCPNPANPAKTVDMDPQSSLSFDSHYFD  258

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             IL +  GLF SDAALLT+  A K+V ++     FF  F KSM+KMG I+VLTG +GE+RK
Sbjct  259   ILTENKGLFQSDAALLTNRGAAKVVQRLRSPAKFFAEFGKSMKKMGDIEVLTGTAGEIRK  318

Query  1003  NCRVPN  1020
              CRV N
Sbjct  319   QCRVVN  324



>ref|XP_009609714.1| PREDICTED: peroxidase 24-like [Nicotiana tomentosiformis]
 dbj|BAA07664.1| cationic peroxidase isozyme 40K precursor [Nicotiana tabacum]
Length=331

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +1

Query  130   EKHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
              K+FYK   CP  E+ VR ITW +  ++  L AKLLRLH+HDCFVRGCD SILLD   ++
Sbjct  33    RKNFYKSTRCPNAEQFVRDITWSKAKNDSTLGAKLLRLHYHDCFVRGCDASILLDKVGTD  92

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             + EK A PNLS+ GF+VID+IK  +E +CPG+VSCADI+ALA RD+VS++FKK +W V  
Sbjct  93    QFEKEARPNLSLGGFDVIDDIKRQVEEKCPGIVSCADILALATRDAVSFRFKKSLWDVAT  152

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DG +S ASE   NLPSPFS+F+TL Q FA KGL V+DLV LSG HTIG+ HC  FS 
Sbjct  153   GRKDGNVSLASEVNGNLPSPFSDFATLQQLFAKKGLNVNDLVALSGAHTIGVAHCGAFSR  212

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RL+NFTGKGD DPSL+ +YA+ L+  C N  N  + VEMDP SS  FD++YF IL Q  G
Sbjct  213   RLFNFTGKGDVDPSLSSTYAESLKQLCPNPANPATTVEMDPQSSTSFDSNYFNILTQNKG  272

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             LF SDAALLTD  + K+V ++   + FF  FAKSM+KMGAI+VLTGN+GE+RKNCRV N
Sbjct  273   LFQSDAALLTDKKSAKVVKQLQKTNAFFSEFAKSMQKMGAIEVLTGNAGEIRKNCRVRN  331



>gb|KDP40041.1| hypothetical protein JCGZ_02039 [Jatropha curcas]
Length=327

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 222/304 (73%), Gaps = 1/304 (0%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L ++FY   CP  E IVR+IT  R  SNP L AKLLR+HFHDCFVRGCD SILLD
Sbjct  23    CRADGLVENFYSSSCPQAEAIVRNITRNRAQSNPPLVAKLLRMHFHDCFVRGCDASILLD  82

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             +  S KAEK   PNLS++GF+VIDEIK  +E  CPGVVSCADI+ALAARD+V++   K  
Sbjct  83    AVGSIKAEKDTIPNLSLSGFDVIDEIKTQLEEVCPGVVSCADILALAARDAVTFPLVKPR  142

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDG IS AS+A  NLP PF++F+TL+Q F SKGL ++DLV+LSGGHTIG+ HC
Sbjct  143   WEVLTGRRDGNISLASDADENLPPPFADFTTLIQAFTSKGLDLNDLVVLSGGHTIGVAHC  202

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVIL  828
              +FSNRLYNFTG GD DPSL+ +YAD LRT+C N  N    VEMDP SS  FD  YF  L
Sbjct  203   AMFSNRLYNFTGNGDSDPSLDETYADFLRTQCPNPANPAIAVEMDPESSLGFDNSYFNTL  262

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              Q  GL  SDAALL +  + KIV ++   + F   FA SM+KMGAI+VLTG++GE+RKNC
Sbjct  263   LQNKGLLQSDAALLQNEQSSKIVRQLKISNAFHAKFAISMKKMGAIEVLTGDAGEIRKNC  322

Query  1009  RVPN  1020
             RV N
Sbjct  323   RVTN  326



>ref|XP_010545061.1| PREDICTED: peroxidase 27-like [Tarenaya hassleriana]
Length=340

 Score =   378 bits (971),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 227/305 (74%), Gaps = 1/305 (0%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+++FY+K CP  EEIVR+ITW R ++NP LPAKLLR+ FHDCFVRGCD S+L+ ST  N
Sbjct  32    LKRNFYEKTCPLAEEIVRNITWSRVAANPVLPAKLLRMSFHDCFVRGCDASVLIKSTPGN  91

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AE  A PNLS+AG +VIDEIKA +E  C G+VSCADI+ LAARD+VS+Q+K  +W V  
Sbjct  92    QAELEAPPNLSLAGMDVIDEIKAKLEEVCEGIVSCADIIPLAARDAVSFQYKLPVWGVLT  151

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGRIS+  EA ++LPSPF NF  L++ FA +GL   DLV+LSGGHTIGM HC LF+N
Sbjct  152   GRRDGRISKMEEANASLPSPFMNFDELLKNFADQGLNKKDLVVLSGGHTIGMAHCFLFNN  211

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCK-NLNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTG GDQDPSL+P YAD L+TKC  +  D S VEMDP S   +D+ YF IL +  G
Sbjct  212   RLYNFTGAGDQDPSLDPDYADFLKTKCTPSPTDLSTVEMDPDSGFSYDSHYFKILLEDKG  271

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             LF SDAALLTD  + ++ +K++    FF  FAK+M+K+ AI+V  G  GE+RKNC V N 
Sbjct  272   LFQSDAALLTDPDSARLAEKLIRPGKFFDKFAKAMKKLNAIKVKVGEDGEIRKNCGVVNP  331

Query  1024  *IKIT  1038
              I + 
Sbjct  332   VISMV  336



>emb|CDP09300.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 213/268 (79%), Gaps = 8/268 (3%)
 Frame = +1

Query  238   LHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCAD  417
             +HFHDCFVRGCDGSILL+ST  N AEK A PNLS+AGF+VIDEIK  +E+EC   VSCAD
Sbjct  1     MHFHDCFVRGCDGSILLNSTADNTAEKDAIPNLSLAGFDVIDEIKRKLESECEKTVSCAD  60

Query  418   IVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLG  597
             I+ALAARD+VSYQF K MW V  GR+DG+IS+ +EAL+NLPSP S+FSTL QRF+SKGL 
Sbjct  61    ILALAARDAVSYQFGKSMWDVKTGRKDGKISRDTEALANLPSPLSSFSTLKQRFSSKGLS  120

Query  598   VHDLVILS------GGHTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLN  759
             V DLV+LS      GGHTIG+GHCNLFSNRLYNFTGKGDQDPSLN +YA  L+TKC NL 
Sbjct  121   VRDLVVLSGMMCPAGGHTIGIGHCNLFSNRLYNFTGKGDQDPSLNSTYASFLKTKCPNLA  180

Query  760   DTSPVEMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFA  939
              TS V+MDPGS+Q+FD  YFV LKQ  G+F SDAALLTD  AR+ VD +VD   F   FA
Sbjct  181   ATSQVDMDPGSAQNFDPHYFVGLKQNSGMFQSDAALLTDAEARQYVDLLVDPKVFNAEFA  240

Query  940   KSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             KSM  MGAI  LTGN GE+R++CRV NS
Sbjct  241   KSMLNMGAI--LTGNGGEIRRDCRVVNS  266



>ref|XP_010250084.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=322

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 226/304 (74%), Gaps = 3/304 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C    L+KHFYKK CP  E+I+R + W+  + +  +PA L+RLH+HDCFVRGCDGS+LL+
Sbjct  21    CHGDGLKKHFYKKSCPQAEDIIRKVVWKNVAQDATIPAGLVRLHYHDCFVRGCDGSVLLN  80

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  + AE+ A PNL++ GFEV+DE K A++  CPGVVSCADI+ALAARD+V++QFKK M
Sbjct  81    STKDHLAERDAQPNLTLDGFEVVDEAKDAVDKACPGVVSCADILALAARDAVAFQFKKPM  140

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GRRDGR+S A EA+ NLP P  NF+ LV+ FASKGL VHDLV+LSG HTIG  HC
Sbjct  141   WKVLTGRRDGRVSIAKEAVDNLPPPSFNFAELVKNFASKGLDVHDLVVLSGAHTIGQAHC  200

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNL-NDTSPVEMDPGSSQDFDTDYFVIL  828
               F  RL+     G  + SL+P YA  L ++C NL N T+ V+MDP S++ FD  Y+V L
Sbjct  201   ESFFKRLHK--NHGGAEKSLDPKYAAFLASQCPNLSNKTTQVDMDPQSAESFDNHYYVNL  258

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             KQ  GLF SDAALLT+  + KIV+K++DQ  FFK+FA SM+KMGAI+VLTGNSGEVRK C
Sbjct  259   KQHKGLFHSDAALLTNKKSEKIVNKLLDQKAFFKAFAHSMKKMGAIEVLTGNSGEVRKKC  318

Query  1009  RVPN  1020
              V N
Sbjct  319   TVVN  322



>ref|XP_011091056.1| PREDICTED: peroxidase 24 [Sesamum indicum]
Length=298

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 217/295 (74%), Gaps = 1/295 (0%)
 Frame = +1

Query  139   FYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNKAEK  318
             +Y K+CP  E IVR ITW R  +NP L AKLLRLH+HDCFVRGCD S+LLDST +N AEK
Sbjct  3     YYHKKCPLAETIVREITWNRVEANPSLAAKLLRLHYHDCFVRGCDASVLLDSTQNNTAEK  62

Query  319   AAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMGRRD  498
             +A PN S++G+++ID+IK  +E ECPGVVSCADIVALAARD+VSYQF + MW V  GR D
Sbjct  63    SAPPNRSLSGYDIIDDIKTQLEEECPGVVSCADIVALAARDAVSYQFGRPMWQVFTGRED  122

Query  499   GRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNRLYN  678
             G++S ASEA + LPS F++F+TL++ FA  GL + DLV LSG HTIG+  C L + RLYN
Sbjct  123   GKVSLASEAAAKLPSAFADFTTLLKIFADNGLDISDLVALSGAHTIGVSRCLLVARRLYN  182

Query  679   FTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPS  855
             FTGKGD DPSLN  YA+ LR  C N +N ++ +EMDP SS  FD+ YFV L QK GLF S
Sbjct  183   FTGKGDSDPSLNVEYANKLRAICPNPINSSTIIEMDPQSSLSFDSHYFVALNQKKGLFVS  242

Query  856   DAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             DAALLTD  A  I     +   FF  FA+SM KMGA+ VLT   GE+RKNCRV N
Sbjct  243   DAALLTDPQAALIARNFENPHVFFARFARSMVKMGAVGVLTNGKGEIRKNCRVVN  297



>ref|XP_009787965.1| PREDICTED: peroxidase 24-like [Nicotiana sylvestris]
 dbj|BAA07663.1| cationic peroxidase isozyme 38K precursor [Nicotiana tabacum]
Length=329

 Score =   377 bits (967),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 222/298 (74%), Gaps = 2/298 (1%)
 Frame = +1

Query  133   KHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNK  309
             K+FYK   CP  E+ VR ITW +  ++  L AKLLRLH+HDCFVRGCD SILLD   +++
Sbjct  32    KNFYKNTRCPNAEQFVRDITWSKAKNDATLSAKLLRLHYHDCFVRGCDASILLDKVGTDQ  91

Query  310   AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMG  489
             +EK A PNLS+ GF+VID+IK  +E +CP +VSCADI+ALAARD+VS+ FKK +W V  G
Sbjct  92    SEKEARPNLSLGGFDVIDDIKRQVEEKCPEIVSCADILALAARDAVSFPFKKSLWDVATG  151

Query  490   RRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNR  669
             R+DG +S  SE   NLPSPFS+F+TL Q FA KGL V+DLV LSG HTIG+ HC  FS R
Sbjct  152   RKDGNVSFGSEVNGNLPSPFSDFATLQQLFAKKGLNVNDLVALSGAHTIGVAHCGAFSRR  211

Query  670   LYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             L+NFTGKGD DPSLNP+Y + L+  C N  N  + VEMDP SS  FD++YF IL Q  GL
Sbjct  212   LFNFTGKGDMDPSLNPTYVESLKQLCPNPANPATTVEMDPQSSTSFDSNYFNILTQNKGL  271

Query  847   FPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDA LLTD  + K+V ++   + FF  FAKSM+KMGAI+VLTGN+GE+RK+CRV N
Sbjct  272   FQSDAVLLTDKKSAKVVKQLQKTNTFFSEFAKSMQKMGAIEVLTGNAGEIRKSCRVRN  329



>ref|XP_004968777.1| PREDICTED: peroxidase 24-like [Setaria italica]
Length=339

 Score =   373 bits (957),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 227/312 (73%), Gaps = 9/312 (3%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             + +A+ L+K FYKK CP  E+I R + W R + N +L AK LR+ FHDCFVRGCD S+LL
Sbjct  29    SAQAAGLKKGFYKKSCPQAEDIARKVVWGRVAGNGELAAKFLRMFFHDCFVRGCDASVLL  88

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DS T N  EK A PNLS+AGF+VIDE+KA +E  CPGVVSCADIVALAARDSVS+Q+K+ 
Sbjct  89    DSPT-NTVEKNAPPNLSLAGFDVIDEVKAELERACPGVVSCADIVALAARDSVSFQYKRN  147

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S   EAL+++P+P S F  L+  F+SKGLG+ DLV+LSGGHTIG+G+
Sbjct  148   LWEVETGRRDGTVSSDQEALNDIPAPTSTFDVLLSNFSSKGLGLQDLVVLSGGHTIGVGN  207

Query  649   CNLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKC-KNLND----TSPVEMDPGSSQDF  804
             CNLFS+RL+NFTGK    D DPSLNPSYA  L+ +C +NL D    T+ V MDPGSS  F
Sbjct  208   CNLFSSRLFNFTGKNNPSDIDPSLNPSYAKFLQGQCRRNLQDPNDNTTVVPMDPGSSLSF  267

Query  805   DTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGN  984
             D  YFV LK   G+F SDA LLT+  A  IVDK+ D   FF +F  S+++MG I VLTG 
Sbjct  268   DNHYFVNLKAHQGMFTSDATLLTNGRAANIVDKLQDPGVFFDTFKNSIKRMGQIGVLTGA  327

Query  985   SGEVRKNCRVPN  1020
             +G++R  C V N
Sbjct  328   NGQIRNKCNVVN  339



>ref|XP_007035435.1| Peroxidase 24, putative [Theobroma cacao]
 gb|EOY06361.1| Peroxidase 24, putative [Theobroma cacao]
Length=334

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 225/302 (75%), Gaps = 2/302 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             S+L  ++Y++ CP  E+IVR I  +R   NP L AKL+R+ FHDCFVRGCD S+LLD+  
Sbjct  32    SNLSYNYYRRTCPRAEKIVRGIIRERARINPALGAKLIRMQFHDCFVRGCDASVLLDTVN  91

Query  301   -SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              S  +EK A PNLS++GF+VID+IK A+E  CP VVSCADI+ALAARD+VS  F +++W 
Sbjct  92    GSFPSEKKAVPNLSLSGFDVIDDIKTALEKACPKVVSCADILALAARDAVSAPFGRRLWD  151

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP+GRRDGRIS ASE   N+P P +NFS+L+Q F  KGL V+DLVILSG HTIG+ HC  
Sbjct  152   VPLGRRDGRISLASEINGNIPGPSANFSSLLQTFNKKGLDVNDLVILSGAHTIGVSHCGA  211

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQ  834
             FS RLYNFTGKGD DPSL+ +YA  LR +C N  + T  VEMDPGSS  FDT Y+ +L Q
Sbjct  212   FSRRLYNFTGKGDADPSLDRTYAIFLRKQCPNPASQTITVEMDPGSSLKFDTHYYDVLLQ  271

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
               GLF SDAALLTD H+R +V  +  +  FF +FA SM KMGAI+VLTGN+GE+R NCRV
Sbjct  272   NKGLFQSDAALLTDGHSRGLVTTLRRKRSFFPAFATSMMKMGAIEVLTGNAGEIRANCRV  331

Query  1015  PN  1020
              N
Sbjct  332   VN  333



>ref|XP_010322270.1| PREDICTED: peroxidase 24 [Solanum lycopersicum]
Length=325

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 220/300 (73%), Gaps = 1/300 (0%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+ ++Y K CP VE+IV+ ITW + +++P L AKLLRLH+HDCFVRGCD SILLDST +N
Sbjct  26    LKMNYYHKSCPSVEKIVKEITWSKVAADPTLAAKLLRLHYHDCFVRGCDASILLDSTPNN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
               EK A PN SV G+EVID+IK  +E  CP  VSCADI+ LAARD+VSYQF + MW VP 
Sbjct  86    SGEKTALPNRSVGGYEVIDDIKKKVEQVCPHQVSCADILTLAARDAVSYQFGRSMWQVPT  145

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DGR+S ASEAL+NLPS F+NFSTL+ +F    L + DLV LSG HTIG+ HC L + 
Sbjct  146   GRKDGRVSIASEALNNLPSGFANFSTLLGQFEDNNLDIVDLVTLSGAHTIGVTHCTLVAR  205

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTGKGD DPSLNP+YA  LR  C N +N ++ +E+DP SS  FD+ YF  L Q MG
Sbjct  206   RLYNFTGKGDVDPSLNPNYATALRKLCPNPINRSTILELDPKSSFSFDSHYFEALNQHMG  265

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             L  SDAAL+T+  +  IV KM +   F   F +SM+KMG I+VL G  GE+RKNCRV N+
Sbjct  266   LLGSDAALVTNSLSALIVKKMQNPHVFLAYFGRSMKKMGGIRVLVGGEGEIRKNCRVVNA  325



>emb|CDO98934.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 223/306 (73%), Gaps = 1/306 (0%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC A  L++++Y+K C  VE+IVR ITW+  S+NP L  KLLRLH+HDCFVRGCDGS+LL
Sbjct  20    ACNAGELQRNYYRKSCRGVEQIVRDITWRNVSANPSLAPKLLRLHYHDCFVRGCDGSVLL  79

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST +N +EK A PN S++GF+ ID +K+ +E ECPG VSCADI+AL ARD+VSYQF++ 
Sbjct  80    DSTPNNPSEKEAIPNRSLSGFDFIDFVKSILEEECPGAVSCADILALGARDAVSYQFQRP  139

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GR+DGR+S  SEAL+ LPSP S+F TL+Q F S  L V DLV LSG HTIG+ H
Sbjct  140   MWQVFTGRQDGRVSVDSEALAGLPSPSSDFPTLLQNFQSNNLDVVDLVTLSGAHTIGVTH  199

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCK-NLNDTSPVEMDPGSSQDFDTDYFVI  825
             C+L + RLYNFTGKGD DPSL+  YA  L+T C   +  T+ + MDPGSS  FD+ YFV 
Sbjct  200   CSLVAKRLYNFTGKGDTDPSLDSEYAQTLKTICPLPIVRTTTLGMDPGSSDSFDSHYFVA  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L Q M LF SD+ALLT+  +  I   + +   FF  FA+SM KMGAI VLT   GE+R+N
Sbjct  260   LSQNMTLFQSDSALLTNPLSSTIASHLQNPRLFFALFARSMTKMGAIGVLTNGEGEIRQN  319

Query  1006  CRVPNS  1023
             CRV N+
Sbjct  320   CRVVNA  325



>ref|XP_010320973.1| PREDICTED: peroxidase 24 [Solanum lycopersicum]
Length=328

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 224/300 (75%), Gaps = 3/300 (1%)
 Frame = +1

Query  130   EKHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
              K+FYK   CP  E+++R ITW +  ++  L AKLLR+H+HDCFVRGCD SILLD   + 
Sbjct  29    RKNFYKSTRCPNAEQLIRDITWSKAKNDATLGAKLLRVHYHDCFVRGCDASILLDKVGTV  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              +EK A PNLS+ GFEVID+IK  +EA+CPG+VSCADI+AL+ARD+VS++FK  MW V  
Sbjct  89    DSEKEARPNLSLGGFEVIDDIKRQVEAKCPGIVSCADILALSARDAVSFRFKTSMWEVET  148

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DG IS AS+   NLPSPFS+F+TL Q F++KGL V DLV LSG HTIG+ HC  FS 
Sbjct  149   GRKDGNISLASDVNGNLPSPFSDFATLKQIFSNKGLNVDDLVALSGAHTIGVSHCGAFSR  208

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYF-VILKQKM  840
             RL+NFTGKGD DP+LN +YA+ L+  C N  N  + VEMDP SS  FD++YF +++ Q  
Sbjct  209   RLFNFTGKGDMDPTLNATYAESLKKLCPNPANPNTTVEMDPLSSTSFDSNYFNILINQNK  268

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALL D  +  ++ K++    FF  FAKSM+KMGAIQ+LTGN+GE+RKNCRV N
Sbjct  269   GLFQSDAALLNDKDSVIVIKKLLKDKTFFIEFAKSMKKMGAIQLLTGNAGEIRKNCRVKN  328



>ref|XP_006356970.1| PREDICTED: peroxidase 24-like [Solanum tuberosum]
Length=325

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 222/300 (74%), Gaps = 4/300 (1%)
 Frame = +1

Query  127   LEKHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
             L  +FYK   CP  E+++R+ITW +  ++  L A+LLRLH+HDCF+RGCD S+LLD+  +
Sbjct  28    LRNNFYKSTRCPNAEQLIRNITWSKAKNDVTLGARLLRLHYHDCFLRGCDASVLLDTEGT  87

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
              ++EK A PNLS+ GF+VID+IK  +EA+CPG+VSCADI+AL+ARD+VS+ FK  MW V 
Sbjct  88    EQSEKEAGPNLSLGGFDVIDDIKRQVEAKCPGIVSCADILALSARDAVSFPFKTSMWEVE  147

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GR+DG +S ASE  SNLP P SN STL Q FA KGL V DLV LSG HTIG  HC  FS
Sbjct  148   TGRKDGNVSLASEVSSNLPLPDSNISTLQQLFAKKGLNVDDLVALSGAHTIGFAHCGAFS  207

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYF-VILKQKM  840
              RL+NFTGKGD DPSLN +YA+ L+  C NL +   VEMDP SS  FD++YF +++ Q  
Sbjct  208   KRLFNFTGKGDMDPSLNATYAESLKKSCTNLANI--VEMDPMSSTSFDSNYFNILINQNK  265

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALL D ++  +V K+ +   FF  F KSM+KMGAI+VLTGN+G++RKNCRV N
Sbjct  266   GLFQSDAALLNDTNSVNVVKKLQNDKAFFVEFGKSMKKMGAIEVLTGNAGQIRKNCRVKN  325



>ref|XP_010320971.1| PREDICTED: peroxidase 24-like [Solanum lycopersicum]
Length=377

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 225/299 (75%), Gaps = 3/299 (1%)
 Frame = +1

Query  133   KHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNK  309
             K++Y+   CP VE+++R ITW + + +P L AKLLR+H+HDCFV+GCD SILLD   S+ 
Sbjct  79    KNYYQSTHCPNVEQLIRDITWSKVAQDPTLGAKLLRIHYHDCFVKGCDASILLDKVGSDD  138

Query  310   AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMG  489
             +EK A PNLS+AGFEVID+IK  +E++CPG+VSCADI+AL ARD+VSY FK  MW V  G
Sbjct  139   SEKEARPNLSLAGFEVIDDIKREVESKCPGIVSCADILALVARDAVSYPFKTSMWEVETG  198

Query  490   RRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNR  669
             R+DG +S AS    NLPSPFS+F+TL Q FA+KGL V DLV LSG HTIG+ HC  FS R
Sbjct  199   RKDGFVSLASNVNGNLPSPFSDFATLKQIFANKGLNVDDLVALSGAHTIGVAHCGAFSRR  258

Query  670   LYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYF-VILKQKMG  843
             L+NF+GKGD DPSLN +YA  L+  C N  N  + VEMDP SS  FD++YF +++ Q  G
Sbjct  259   LFNFSGKGDMDPSLNATYAKDLKDVCPNPANPATIVEMDPMSSTSFDSNYFNILINQNKG  318

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             LF SDAALL D  +  ++ K+ D + FF  FAKSM+KMGAI++LTGN+GE+RKNCRV N
Sbjct  319   LFQSDAALLNDKDSVIVIKKLQDDNTFFSEFAKSMKKMGAIELLTGNAGEIRKNCRVKN  377



>dbj|BAJ86701.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   368 bits (944),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 224/313 (72%), Gaps = 9/313 (3%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A +A+ L+K FYKK CP  E+I + + W   + N +L AK LR+ FHDCFVRGCD S+LL
Sbjct  23    AAQAAGLKKGFYKKSCPQAEDIAQKVVWNHVAGNRELAAKFLRMFFHDCFVRGCDASVLL  82

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DS T N AEK A PNLS+AGFEVIDE+KAA+E  CPGVVSCADIVALAARDSVS+Q+ KK
Sbjct  83    DSPT-NTAEKDAPPNLSLAGFEVIDEVKAALERACPGVVSCADIVALAARDSVSFQYGKK  141

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG  S   +A   +P+P S F  L+  F+ KGLG+ DLV+LSGGHTIG+G+
Sbjct  142   LWEVETGRRDGTTSFLQQAFDEIPAPSSTFDILLANFSGKGLGLQDLVVLSGGHTIGIGN  201

Query  649   CNLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKC-KNLND----TSPVEMDPGSSQDF  804
             CNLFS+R++NFTGK    D DPSLNP YA  L+ +C +NL D    T+ V MDPGSS  F
Sbjct  202   CNLFSSRVFNFTGKNNPTDIDPSLNPPYAKFLQGQCRRNLQDPNDNTTVVPMDPGSSTSF  261

Query  805   DTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGN  984
             D+ YFV LK + G+F SDA LLT+  A  +VDK+ D   FF  F  S+++MG I VLTG 
Sbjct  262   DSHYFVNLKARQGMFTSDATLLTNGRAAALVDKLQDNGVFFDHFKNSIKRMGQIDVLTGA  321

Query  985   SGEVRKNCRVPNS  1023
             SG++R  C V NS
Sbjct  322   SGQIRNKCNVVNS  334



>ref|XP_006855377.1| hypothetical protein AMTR_s00057p00128320 [Amborella trichopoda]
 gb|ERN16844.1| hypothetical protein AMTR_s00057p00128320 [Amborella trichopoda]
Length=315

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 222/307 (72%), Gaps = 3/307 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSS--NPQLPAKLLRLHFHDCFVRGCDGSIL  285
             C    L K+FYKK CP  EE VR+  W + S+  N  LPAKLLRLHFHDCFVRGCD SIL
Sbjct  9     CSGGSLRKNFYKKTCPKAEETVRNFIWGQLSNGNNSALPAKLLRLHFHDCFVRGCDASIL  68

Query  286   LDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKK  465
             L+ST+++ AEK A PNL++AGF+++D +KA +E++C G VSCADI+ALAARD+VS+Q+K+
Sbjct  69    LNSTSNSTAEKDAVPNLTLAGFDILDRLKALLESKCQGQVSCADILALAARDAVSFQYKR  128

Query  466   KMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMG  645
              +W V  GRRDG +S ASE   NLPSP SN + L Q FA+KGL + DLV+LSG HTIG+G
Sbjct  129   PLWEVLTGRRDGNVSLASEVGPNLPSPSSNVTLLRQNFANKGLALKDLVVLSGAHTIGVG  188

Query  646   HCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFV  822
             HC + +NRLYNFTGKGD DPSLN +Y   L+TKC N  N T  V MDP SS  FD  YF 
Sbjct  189   HCGIITNRLYNFTGKGDSDPSLNSTYVAFLKTKCPNPPNFTITVGMDPNSSLSFDNHYFE  248

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ILK+  G F SDA LLT+ ++R  VD+M +   FF  FA SM++MG I VL G +GE+RK
Sbjct  249   ILKEHKGFFISDATLLTNANSRFFVDQMQNSRNFFTEFAASMKRMGDIGVLAGKAGEIRK  308

Query  1003  NCRVPNS  1023
              C   NS
Sbjct  309   ICSKTNS  315



>ref|XP_006357005.1| PREDICTED: peroxidase 24-like [Solanum tuberosum]
Length=379

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 224/299 (75%), Gaps = 3/299 (1%)
 Frame = +1

Query  133   KHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNK  309
             K++Y+   CP VE+++R ITW + + +  L AKLLR+H+HDCFVRGCD SILLD   ++ 
Sbjct  81    KNYYQSTHCPNVEQLIRDITWSKVAKDATLGAKLLRIHYHDCFVRGCDASILLDKVGTDD  140

Query  310   AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMG  489
             +EK A PNLS+ GFEVID+IK  +EA+CPG+VSCADI+AL ARD+VSY FK  MW V  G
Sbjct  141   SEKEARPNLSLGGFEVIDDIKREVEAKCPGIVSCADILALVARDAVSYPFKTLMWEVETG  200

Query  490   RRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNR  669
             R+DG +S AS+   NLPSPFS+F+TL Q FA+KGL V DLV LSG HTIG+ HC  FS R
Sbjct  201   RKDGFVSLASDVNGNLPSPFSDFATLKQIFANKGLNVDDLVALSGAHTIGVAHCGAFSRR  260

Query  670   LYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYF-VILKQKMG  843
             L+NFTGKGD DPSLN +YA  L+  C N  N  + VEMDP SS  FD++YF +++ Q  G
Sbjct  261   LFNFTGKGDMDPSLNATYAKDLKDFCPNPANPNTTVEMDPMSSTSFDSNYFNILINQNKG  320

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             LF SDAALL D  +  ++ K+ + + FF  FAKSM+KMGAI++LTGN+GE+RKNCRV N
Sbjct  321   LFQSDAALLNDKDSVIVIKKLQEDETFFSQFAKSMQKMGAIELLTGNAGEIRKNCRVKN  379



>ref|XP_006356731.1| PREDICTED: peroxidase 24-like [Solanum tuberosum]
Length=324

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 217/300 (72%), Gaps = 1/300 (0%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+ ++Y K CP VE+IV+ ITW + +++P L AKLLRLH+HDCFVRGCD SILLD+T +N
Sbjct  25    LKMNYYHKSCPSVEKIVKEITWSKVAADPTLAAKLLRLHYHDCFVRGCDASILLDATPTN  84

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
               EK A PN SV G+EVID+IK  +E  CP  VSCADI+ LAARD+VSYQF + MW VP 
Sbjct  85    SGEKTALPNRSVGGYEVIDDIKKKVEQVCPHQVSCADILTLAARDAVSYQFGRSMWQVPT  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DGR+S ASEAL +LPS  +NFSTL+ +F    L + DLV LSG HTIG+ HC L + 
Sbjct  145   GRKDGRVSIASEALDSLPSASANFSTLLGQFQDNNLDIVDLVTLSGAHTIGVTHCTLVAR  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTGKGD DPSLNP+YA  LR  C N +N  + +EMDP SS  FD+ YF  L Q MG
Sbjct  205   RLYNFTGKGDVDPSLNPNYATTLRKLCPNPINRATILEMDPQSSLSFDSHYFEALNQHMG  264

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             L  SDAAL+T+  +  IV KM +   F   F +SM+KMG I+VL G  GE+RKNCRV N+
Sbjct  265   LLGSDAALMTNSLSALIVRKMQNPHVFLAFFGRSMKKMGEIRVLAGGEGEIRKNCRVVNA  324



>ref|XP_002516846.1| Peroxidase 24 precursor, putative [Ricinus communis]
 gb|EEF45460.1| Peroxidase 24 precursor, putative [Ricinus communis]
Length=348

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 221/300 (74%), Gaps = 3/300 (1%)
 Frame = +1

Query  130   EKHFYKK--ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
             ++H  KK   CP +E I R ITW R +SNP LPAKL+R+HFHDCFVRGCD SILLDST +
Sbjct  49    KQHGGKKVNSCPQLETISRDITWGRVASNPTLPAKLIRMHFHDCFVRGCDASILLDSTGN  108

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
              KAEK A PN S+ GF+VID+IKA +E ECPG +SCADI+ALAARD+VS+QF + +W V 
Sbjct  109   TKAEKEAIPNRSLTGFDVIDDIKAKLEEECPGQISCADIIALAARDAVSFQFGRPLWPVA  168

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GR+DGRIS  SEA  +LPSP ++F TL+ +F S GL V DLV LSG HTIG+GHC + +
Sbjct  169   FGRKDGRISLESEATRDLPSPAADFKTLLSQFRSHGLDVTDLVALSGAHTIGVGHCVIIA  228

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKM  840
              RL+NFTG GD DPSL+ +YAD L+ +C N  N T+ VEMDPGSS  FDT+YFV +  K 
Sbjct  229   KRLFNFTGIGDTDPSLDKNYADFLKKQCSNPPNPTTTVEMDPGSSLSFDTNYFVAINHKK  288

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALLT+  A ++     + + FF  FA+SM KMG+I VLTG  GE+RKNC   N
Sbjct  289   GLFQSDAALLTNPEAARLSSNFENPNVFFPRFAQSMVKMGSIGVLTGKQGEIRKNCHFVN  348



>ref|XP_002516845.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF45459.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=326

 Score =   366 bits (939),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/302 (59%), Positives = 225/302 (75%), Gaps = 2/302 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L   FY   CP  E IVR+IT  R  S+  L AKLLR+HFHDCFVRGCD SILLD+ 
Sbjct  25    ADGLSLRFYNTSCPDAELIVRNITRNRAQSDSALGAKLLRMHFHDCFVRGCDASILLDAV  84

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
                ++EK   PN S++GF+VIDEIK  +E  CPGVVSCADI+ALA+RD+VS  F+K +W 
Sbjct  85    -GIQSEKDTIPNQSLSGFDVIDEIKTQLEQVCPGVVSCADILALASRDAVSLSFQKPLWD  143

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDG +S ASE   N+PSPF++F+TL+Q+F++KGL V+DLV+LSGGHTIG+ HC  
Sbjct  144   VLTGRRDGTVSLASEVNGNIPSPFADFNTLMQQFSNKGLDVNDLVVLSGGHTIGVAHCAT  203

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQ  834
             F+NRLYNFTG GD DPSL+ +YA++L+TKC N  N  + VEMDP SS  FD +Y+ IL Q
Sbjct  204   FTNRLYNFTGIGDMDPSLDKTYAELLKTKCPNPSNPATTVEMDPQSSLTFDKNYYDILLQ  263

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
               GLF SDAALL +  + +IV ++   + FF  FA SM+KMGAI+VLTGN+G++R+NCRV
Sbjct  264   NKGLFQSDAALLENTQSARIVRQLKTSNAFFAKFAISMKKMGAIEVLTGNAGQIRQNCRV  323

Query  1015  PN  1020
              N
Sbjct  324   VN  325



>emb|CDO98933.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 204/264 (77%), Gaps = 1/264 (0%)
 Frame = +1

Query  232   LRLHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSC  411
             LR+HFHDCFVRGCD S+LLDST  N AEK A PNLS+AGF+VIDEIK  +E  CPG VSC
Sbjct  10    LRMHFHDCFVRGCDASVLLDSTAKNTAEKDAVPNLSLAGFDVIDEIKNQLEKACPGKVSC  69

Query  412   ADIVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKG  591
             ADI+ALAARDSVS+QF K +W V  GR DGR S ASEA +N+PSPFSNF+TL+Q FASK 
Sbjct  70    ADILALAARDSVSFQFNKPIWEVLTGRGDGRTSHASEAPANIPSPFSNFTTLMQSFASKN  129

Query  592   LGVHDLVILSGGHTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TS  768
             L VHD V+LSG HTIG+GHCNLFS RLYNFTGK   DPSLN +YA   RTKCK+L+D T+
Sbjct  130   LTVHDRVVLSGSHTIGIGHCNLFSKRLYNFTGKAAADPSLNSTYAAFSRTKCKSLSDNTT  189

Query  769   PVEMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSM  948
              VEMDPGSS   D  YF  LK + GLF SDAALLTD  A  I+D+M+    FF  F +SM
Sbjct  190   TVEMDPGSSVASDNHYFSNLKHQQGLFQSDAALLTDRGASNIIDEMLTAGKFFTEFGQSM  249

Query  949   EKMGAIQVLTGNSGEVRKNCRVPN  1020
             ++MGAI VLTGN+GE+RK C V N
Sbjct  250   KRMGAIGVLTGNAGEIRKKCSVVN  273



>ref|XP_003567710.2| PREDICTED: peroxidase 56-like [Brachypodium distachyon]
Length=344

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 223/313 (71%), Gaps = 9/313 (3%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A +A+ L+K FYKK CP  E+I + + W R + N +L AK LR+ FHDCFVRGCD S+LL
Sbjct  33    AAQAAGLKKGFYKKSCPQAEDIAQKVVWNRVAGNRELAAKFLRMFFHDCFVRGCDASVLL  92

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DS T   AEK +APNLS+AGFEVIDE+KAA+E  CPGVVSCADIVALAARDSVS+Q+ KK
Sbjct  93    DSPT-RTAEKDSAPNLSLAGFEVIDEVKAALERACPGVVSCADIVALAARDSVSFQYGKK  151

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG IS   +AL  +P+P S F  L   F+SKGLGV DLV+LSGGHTIG+G+
Sbjct  152   LWEVETGRRDGSISSDQQALDEIPAPSSTFDVLASNFSSKGLGVQDLVVLSGGHTIGIGN  211

Query  649   CNLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKCK----NLND-TSPVEMDPGSSQDF  804
             CNL S+R++NFTGK    D DPSLNP YA  L+ +C+    + ND T+ V MD GSS  F
Sbjct  212   CNLVSSRIFNFTGKNNPSDIDPSLNPPYAKFLQGQCRRNQADPNDNTTVVPMDTGSSTSF  271

Query  805   DTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGN  984
             D+ YFV LK   GLF SDA L+T+  A  +VDK+ D   F   F  S+++MG I VLTG 
Sbjct  272   DSHYFVNLKAGQGLFTSDATLVTNARAASLVDKLQDNGVFLDHFKNSIKRMGQIGVLTGA  331

Query  985   SGEVRKNCRVPNS  1023
             +G++R  C V NS
Sbjct  332   NGQIRNRCNVVNS  344



>gb|EMS59487.1| Peroxidase 56 [Triticum urartu]
Length=338

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 228/318 (72%), Gaps = 14/318 (4%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A +A+ L+K FYKK CP  E+I + + W+  + N +L AK LR+ FHDCFVRGCD S+LL
Sbjct  22    AAQAAGLKKGFYKKSCPQAEDIAQKVVWKHVAGNRELAAKFLRMFFHDCFVRGCDASVLL  81

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DS T N AEK A PNLS+AGFEVIDE+KAA+E  CPGVVSCADIVALAARDSVS+Q+ KK
Sbjct  82    DSPT-NTAEKDAPPNLSLAGFEVIDEVKAALERACPGVVSCADIVALAARDSVSFQYGKK  140

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S  ++AL+ +P+P S F  L+  F+ KGLG+ DLV+LSGGHTIG+G+
Sbjct  141   LWEVETGRRDGTLSSDTQALNEIPAPSSTFDILLTNFSGKGLGLQDLVVLSGGHTIGIGN  200

Query  649   CNLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKCK----NLND-TSPVEMDPGSSQDF  804
             CNLFS+RL+NFTGK    D DPSLNP YA  L+ +C+    + ND T+ V MDP SS  F
Sbjct  201   CNLFSSRLFNFTGKNNPTDTDPSLNPPYAKFLQGQCRRNQQDPNDNTTVVPMDPASSTSF  260

Query  805   DTDYFVILK-----QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQ  969
             D+ YFV LK      + G+F SDA LLT+  A  +VDK+ D   FF  F  S+++MG I 
Sbjct  261   DSHYFVNLKARQGVARQGMFTSDATLLTNGRAAALVDKLQDNGVFFDHFKNSIKRMGQIG  320

Query  970   VLTGNSGEVRKNCRVPNS  1023
             VLTG SG++R  C V NS
Sbjct  321   VLTGASGQIRNKCNVVNS  338



>ref|XP_006356969.1| PREDICTED: peroxidase 24-like [Solanum tuberosum]
Length=328

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/300 (58%), Positives = 222/300 (74%), Gaps = 3/300 (1%)
 Frame = +1

Query  130   EKHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
              K+FYK   CP  E+++R ITW +  ++  L AKLLR+H+HDCFVRGCD SILLD   + 
Sbjct  29    RKNFYKSTRCPNAEQLIRDITWSKAKNDATLGAKLLRVHYHDCFVRGCDASILLDKVGTV  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              +EK A PNLS+ GF+VID+IK  +EA+CPG+VSCADI+AL+ARD+VS+ FK  MW V  
Sbjct  89    DSEKEARPNLSLGGFDVIDDIKRQVEAKCPGIVSCADILALSARDAVSFPFKTSMWEVET  148

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DG +S AS+   NLPSPFS+F+TL + F +KGL V DLV LSG HTIG+ HC  FS 
Sbjct  149   GRKDGNVSLASDVNGNLPSPFSDFATLKKIFENKGLNVDDLVALSGAHTIGVSHCGAFSR  208

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYF-VILKQKM  840
             RL+NFTGKGD DP+LN +YA+ L+  C N  N  + VEMDP SS  FD++YF +++ QK 
Sbjct  209   RLFNFTGKGDMDPTLNATYAESLKKLCPNPANPNTTVEMDPLSSTSFDSNYFNILINQKK  268

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALL D ++  ++ K+     FF  FAKSM+KMGAIQ+LTGN+GE+RKNC V N
Sbjct  269   GLFQSDAALLNDTNSVIVIKKLQKNKTFFVEFAKSMQKMGAIQLLTGNAGEIRKNCHVKN  328



>ref|XP_008458503.1| PREDICTED: peroxidase 24 [Cucumis melo]
Length=327

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 218/301 (72%), Gaps = 3/301 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L  +FY++ CP  E I++ +T++   SNP L A+LLRL FHDCFVRGCD SILLD+  +N
Sbjct  27    LVNNFYRRTCPLAERIIQDVTFRLVRSNPGLGAQLLRLQFHDCFVRGCDASILLDTVGTN  86

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK-MWSVP  483
              +EK A PNLS+ GF+ ID+IK+ +E  C GVVSCADI+ALA RD+VS+ FK +  W V 
Sbjct  87    PSEKEARPNLSLLGFDAIDQIKSEVERVCSGVVSCADILALATRDAVSFPFKNRPRWPVL  146

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDG IS++S+   N+PSPFS F TL Q F  KGL V DLVILSGGHTIG+ HC  FS
Sbjct  147   TGRRDGTISRSSDVTGNIPSPFSGFDTLKQIFEKKGLTVSDLVILSGGHTIGVAHCGTFS  206

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTS-PVEMDPGSSQDFDTDYFVILKQKM  840
              RLYNFTGKGD DPSL+P YAD LRTKC N  D S  VEMDP SS  FD++YF IL Q  
Sbjct  207   RRLYNFTGKGDADPSLDPKYADFLRTKCPNPADPSITVEMDPRSSASFDSNYFRILTQNK  266

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTG-NSGEVRKNCRVP  1017
             GLF SDAALL +  + ++V  + +  FF  SFA+SM KM AI+VLTG N+GE+RK CR  
Sbjct  267   GLFQSDAALLNNTSSSRLVRSLQNPRFFSSSFARSMLKMAAIEVLTGNNNGEIRKRCRFV  326

Query  1018  N  1020
             N
Sbjct  327   N  327



>ref|XP_002527239.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF35165.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=328

 Score =   360 bits (925),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 212/300 (71%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY+K CP  E IV  I ++  S +P L A LLR+HFHDCFVRGCDGS+LLDST  N
Sbjct  29    LQLGFYRKTCPNAEYIVHDIAYKYISRDPTLAAPLLRMHFHDCFVRGCDGSVLLDSTKKN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEKAA PN ++ GF VID IK  +E  CPG+VSCADI+ALAARDSV        WSVP 
Sbjct  89    QAEKAAIPNQTLRGFNVIDAIKFELERRCPGIVSCADILALAARDSV-LMIGGPSWSVPT  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S +SEAL+ LPSPF+N + L Q FASKGL V DLV+LSGGHTIG+GHC + SN
Sbjct  148   GRRDGRVSISSEALNQLPSPFANINQLKQNFASKGLSVKDLVVLSGGHTIGIGHCFIISN  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DPSL+P YA  L+ KCK  N  + VEMDPGS + FD DY+ ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPSLDPLYAAQLKKKCKPGNSNTIVEMDPGSFKTFDEDYYTVVAKRRGL  267

Query  847   FPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALL D      V    + +   F + FA SM KMG I VLTGN GE+RK C   N
Sbjct  268   FQSDAALLNDIETSTYVKLQALTNGITFAQDFANSMVKMGHIGVLTGNQGEIRKQCAFVN  327



>ref|XP_010677712.1| PREDICTED: peroxidase 24-like [Beta vulgaris subsp. vulgaris]
Length=329

 Score =   360 bits (923),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 215/302 (71%), Gaps = 0/302 (0%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             E   L  +FY + C   EEIV+++  +  S +P LPAKLLRL+FHDC VRGCD S+LL S
Sbjct  28    ENGGLVANFYGQNCSRAEEIVQTVIKRHVSDDPSLPAKLLRLYFHDCVVRGCDASVLLSS  87

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T + ++E+ +  N  + GFE ID+IKA +E EC G+VSCADI+ALA RD+VS Q+ + +W
Sbjct  88    TENFQSEQESGANRRLGGFEAIDDIKAELEKECQGIVSCADILALATRDAVSLQYGRPLW  147

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP GRRDG IS A EA  N+P+ FS+F+ +   F  KGL + DLV LSG HTIG+G C+
Sbjct  148   EVPTGRRDGTISSALEASRNIPTAFSSFNVIKDIFRRKGLSIDDLVALSGAHTIGVGRCS  207

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
             LFS+RLYNFTGKGDQDPS+NPSYAD LRTKC   +  + VEMDP SS+ FD  Y+ ILK 
Sbjct  208   LFSHRLYNFTGKGDQDPSINPSYADFLRTKCGPNDGRTTVEMDPESSRSFDNHYYEILKD  267

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
               GLF SDA LLT+  A K+  KM+D + FF  FAKSM KMGAI+VLTG  G++RK C  
Sbjct  268   NKGLFTSDATLLTNKKASKVASKMLDSETFFDEFAKSMLKMGAIEVLTGTQGQIRKKCNS  327

Query  1015  PN  1020
              N
Sbjct  328   IN  329



>gb|KCW58562.1| hypothetical protein EUGRSUZ_H01218 [Eucalyptus grandis]
Length=262

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/258 (65%), Positives = 207/258 (80%), Gaps = 1/258 (0%)
 Frame = +1

Query  238   LHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCAD  417
             +HFHDCFVRGCDGS+LL+ST +N AEK A PNL++AGF+VID+IKA +E +CPGVVSCAD
Sbjct  1     MHFHDCFVRGCDGSVLLNSTKNNTAEKEAIPNLTLAGFDVIDDIKAEVEKKCPGVVSCAD  60

Query  418   IVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLG  597
             I+ALAARDSVS+QFK+  W V  GRRDG +S ASEAL+N+PSPF NF+ L Q FA+KGL 
Sbjct  61    ILALAARDSVSFQFKRSTWKVLTGRRDGTVSLASEALANIPSPFLNFTALQQNFANKGLS  120

Query  598   VHDLVILSGGHTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPV  774
             V DLV+LSG HTIG+GHCN FS RLYNF+GKGDQDPSLN +YA  L+ +CKNL D T+ V
Sbjct  121   VRDLVVLSGAHTIGVGHCNAFSVRLYNFSGKGDQDPSLNSTYAASLKNQCKNLTDNTTFV  180

Query  775   EMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEK  954
              MDP +   FDT YF +L+Q+ GLF SDAALLT+ ++  I  +M++   FFKSF  S+++
Sbjct  181   PMDPITPLSFDTRYFTVLRQRRGLFESDAALLTNPNSASITREMLNSRRFFKSFRTSIKR  240

Query  955   MGAIQVLTGNSGEVRKNC  1008
             MGAI VLTG SGE+RK C
Sbjct  241   MGAISVLTGKSGEIRKVC  258



>ref|XP_004145044.1| PREDICTED: peroxidase 24-like [Cucumis sativus]
 ref|XP_004153839.1| PREDICTED: peroxidase 24-like [Cucumis sativus]
 ref|XP_004163098.1| PREDICTED: peroxidase 24-like [Cucumis sativus]
 gb|KGN46183.1| hypothetical protein Csa_6G067410 [Cucumis sativus]
Length=326

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 220/301 (73%), Gaps = 3/301 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L  +FY++ CP  E IV+ +T++   SNP+L A+LLRL FHDCFVRGCD SILLD+  +N
Sbjct  26    LVNNFYRRTCPQAERIVQDVTFRLVRSNPRLGAQLLRLQFHDCFVRGCDASILLDTVGTN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK-MWSVP  483
             ++EK A PNLS+ GF  ID+IK+ +E  C GVVSCADI+ALAARD+VS+ FK +  W V 
Sbjct  86    QSEKEARPNLSLLGFNEIDQIKSEVEKACSGVVSCADILALAARDAVSFPFKNRPRWPVL  145

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDG IS++SE   N+PSPFS+F+TL Q F +K L V DLVILSGGHT+G  HC  FS
Sbjct  146   TGRRDGTISRSSEVSGNIPSPFSDFATLKQIFENKRLNVIDLVILSGGHTLGEAHCGTFS  205

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTS-PVEMDPGSSQDFDTDYFVILKQKM  840
              RLYNFTGKGD DPSL+P YAD LRTKC N  D S  VEMDP SS+ FD++YF IL Q  
Sbjct  206   RRLYNFTGKGDADPSLDPRYADFLRTKCPNPADPSITVEMDPRSSRSFDSNYFKILTQHK  265

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTG-NSGEVRKNCRVP  1017
             GLF SDAALL D  + ++V  + +   F  SFA SM KM AI+VLTG N+GE+RK CR  
Sbjct  266   GLFQSDAALLNDTSSSRLVRSLQNPKVFSFSFASSMLKMAAIEVLTGNNNGEIRKQCRFV  325

Query  1018  N  1020
             N
Sbjct  326   N  326



>gb|AII99881.1| peroxidase [Cicer arietinum]
Length=307

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 222/307 (72%), Gaps = 20/307 (7%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             AC+   L K+FY+  CP  + I+++ T Q  ++NP LPAKLLR+HFHDCFVRGCD S+LL
Sbjct  19    ACQGGSLRKNFYQHSCPQADNIIKNKTLQHVAANPNLPAKLLRMHFHDCFVRGCDASVLL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +ST +N AEK A PNL++AGF VID+IK A+EA  P  VSCADI+ALAARD+VS QF K 
Sbjct  79    NSTDNNTAEKDAIPNLTLAGFNVIDDIKNAVEAIYPKTVSCADILALAARDAVSVQFNKP  138

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDG +S+ SEAL+N+P+P  NF+ L Q FASKGL +HDLV+LSG HTIG GH
Sbjct  139   MWEVLTGRRDGTVSKRSEALANIPAPTFNFTQLKQNFASKGLTLHDLVVLSGAHTIGTGH  198

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CN FSNRLYNFT                  TKCK+L+D T+ V MDPGSS +FD+ Y+  
Sbjct  199   CNFFSNRLYNFT------------------TKCKSLSDNTTRVAMDPGSSNNFDSHYYPN  240

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMV-DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             L QK GLF SDAALLT   +  I +++V +++ FF  FA+SM++MGAI+VL G++GE+R 
Sbjct  241   LLQKKGLFQSDAALLTQDQSTDIAEELVNNKNKFFTEFAQSMKRMGAIEVLVGSAGEIRI  300

Query  1003  NCRVPNS  1023
              C V NS
Sbjct  301   KCSVVNS  307



>gb|KHN43563.1| Peroxidase 3 [Glycine soja]
Length=290

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 212/306 (69%), Gaps = 35/306 (11%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C+  +L K FYKK CP  E+IVR+   +  S  P LPAKL+R+HFHDCFVRGCDGS+LL
Sbjct  19    VCQGGNLRKQFYKKTCPQAEQIVRTKIQEHVSGRPDLPAKLIRMHFHDCFVRGCDGSVLL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST +N AEK A PNLS+AGF+                                  F K 
Sbjct  79    DSTATNTAEKDAIPNLSLAGFD----------------------------------FNKP  104

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GRRDGR+S + E L+NLP+PF NF+ L Q FASKGL VHDLV+LSG H IG+GH
Sbjct  105   MWEVLTGRRDGRVSISGETLANLPAPFFNFTQLKQSFASKGLTVHDLVVLSGAHAIGIGH  164

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             CNLFSNRL+NFTGKGDQDPSLNP+YA+ L+TKC+ L+D T+ +EMDP SS  FD+DY+ I
Sbjct  165   CNLFSNRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDTTTTIEMDPNSSNTFDSDYYSI  224

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L+Q  GLF SDAALLT   +R IV+++V Q+ F   F +SM +MGAI+VLTG++GE+R+ 
Sbjct  225   LRQNKGLFQSDAALLTTKISRNIVNELVKQNKFCTEFGQSMTRMGAIEVLTGSAGEIRRK  284

Query  1006  CRVPNS  1023
             C V NS
Sbjct  285   CSVVNS  290



>ref|XP_007045601.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY01433.1| Peroxidase superfamily protein [Theobroma cacao]
Length=328

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 217/303 (72%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  +Y K CP  E I+R  T++  S  P L A LLR+HFHDCFVRGCDGS+LL+ST
Sbjct  27    AEGLKLGYYYKTCPKAESIIRKTTYRFISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNST  86

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              ++++EKAA PNLS+ GF VID +K+A+E  CPGVVSCAD +AL ARDSVS  +    W 
Sbjct  87    KNSQSEKAAVPNLSLQGFHVIDAVKSAVEEACPGVVSCADTLALVARDSVSMIYGP-FWE  145

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP+GRRDGR+S  +E  +NLPSPF+N +TL Q FA KGL + DL +LSGGHTIG  HCN 
Sbjct  146   VPLGRRDGRVSLLNEVFANLPSPFANITTLKQMFAVKGLSLKDLAVLSGGHTIGTSHCNA  205

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             F+NRLYNFTGKGD DPS++P+Y   L+ KCK  + T+ VEMDPGS ++F+ DYF ++ ++
Sbjct  206   FTNRLYNFTGKGDTDPSMDPNYIVKLKKKCKPADTTTLVEMDPGSFKNFEEDYFTLVAKR  265

Query  838   MGLFPSDAALLTDYHARK--IVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL D   +   I+        F K FA+SM KMG + VLTG+ GE+RK+C 
Sbjct  266   RGLFQSDAALLNDKETKAYVILQSSTHGSTFGKDFAESMVKMGKVGVLTGHQGEIRKHCA  325

Query  1012  VPN  1020
             V N
Sbjct  326   VVN  328



>gb|EMT31813.1| Peroxidase 56 [Aegilops tauschii]
Length=356

 Score =   356 bits (913),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 225/330 (68%), Gaps = 32/330 (10%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+K FYKK CP  E+I + + W+  + N +L AK LR+ FHDCFVRGCD S+LLDS T N
Sbjct  28    LKKGFYKKSCPQAEDIAQKVVWKHVAGNRELAAKFLRMFFHDCFVRGCDASVLLDSPT-N  86

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A PNLS+AGFEVIDE+KAA+E  CPGVVSCADIVALAARDSVS+Q+ KK+W V  
Sbjct  87    TAEKDAPPNLSLAGFEVIDEVKAALERACPGVVSCADIVALAARDSVSFQYGKKLWEVET  146

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSG--------------  624
             GRRDG +S  ++AL+ +P+P S F  L+  F+ KGLG+ DLV+LS               
Sbjct  147   GRRDGTVSSDTQALNEIPAPSSTFDILLTNFSGKGLGLQDLVVLSAPQGMLQKTLEAGVG  206

Query  625   ---------GHTIGMGHCNLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKC-KNL---  756
                      GHTIG+G+CNLFS+RL+NFTGK    D DPSLNP YA  L+ KC +NL   
Sbjct  207   WKLPTTATSGHTIGIGNCNLFSSRLFNFTGKNNPTDTDPSLNPPYAKFLQGKCRRNLQAP  266

Query  757   -NDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKS  933
              ++T+ V MDPGSS  FD+ YFV LK + G+F SDA LLT+  A  +VDK+ D   FF  
Sbjct  267   NDNTTVVPMDPGSSTSFDSHYFVNLKARQGMFTSDATLLTNSRAAALVDKLQDNGVFFDH  326

Query  934   FAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             F  S+++MG I VLTG SG++R  C V NS
Sbjct  327   FKNSIKRMGQIGVLTGASGQIRNKCNVVNS  356



>ref|XP_009631264.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 215/300 (72%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    VEVGFYKKTCPNVEAIVKQTTAHYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+V        W+VP+
Sbjct  86    QAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVEL-INGPTWAVPL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  S+AL NLP+PF NF+TL   F S GL V DLV+LSGGHTIGM HC  FS+
Sbjct  145   GRRDGRVSILSDALKNLPTPFDNFTTLKTTFGSLGLNVKDLVVLSGGHTIGMSHCFSFSS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+++ +Y   L+ KCK  + T+ VEMDPGS + FDTDY+ ++ ++ GL
Sbjct  205   RLYNFTGKGDMDPNMDQNYIGRLKIKCKPGDVTTIVEMDPGSFKSFDTDYYTMVSKRRGL  264

Query  847   FPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALLTD   +  V   V+     FFK F +SM KMG I VLTG +GE+RK+C   N
Sbjct  265   FTSDAALLTDSQTKAYVLSQVNPYGSTFFKDFGESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_004245974.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=322

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 220/305 (72%), Gaps = 5/305 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             CE   +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+
Sbjct  21    CEG--VEVGFYKKTCPNVEAIVKETTKHYISIAPTLAAPLLRMHFHDCFVRGCDGSVLLN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  NKAEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+VS       
Sbjct  79    STKGNKAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVSL-INGPT  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             WSVP+GRRDGR+S  SEA  NLP+PF NF+TL   F + GL V DLV+LSGGHTIGM HC
Sbjct  138   WSVPLGRRDGRVSILSEASKNLPTPFDNFTTLKTTFGALGLNVKDLVVLSGGHTIGMSHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
               FS+RLYNFTGKGD DP+++ +Y + L+ KCK  + T+ VEMDPGS + FD DY+ ++ 
Sbjct  198   FSFSSRLYNFTGKGDMDPNMDQNYINHLKIKCKPGDVTTIVEMDPGSFKSFDADYYTMIA  257

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             ++ GLF SDAALL++   ++ V   +++    FF+ F +SM KMG I VLTGN+GE+RK+
Sbjct  258   KRRGLFASDAALLSNTQTKEYVLSQLNRHGSTFFEDFGESMVKMGQIGVLTGNAGEIRKH  317

Query  1006  CRVPN  1020
             C   N
Sbjct  318   CAFRN  322



>ref|XP_002277879.1| PREDICTED: peroxidase 24 [Vitis vinifera]
Length=328

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 214/305 (70%), Gaps = 2/305 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKK-ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             C A  L K+FYK+  CP  E +VR++T  +  +NP L AKL+R+ FHDCFVRGCD SILL
Sbjct  24    CNADGLRKNFYKQTSCPQAENVVRNLTRIKVQANPALAAKLIRMQFHDCFVRGCDASILL  83

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             D   +++ EK A PNLS++G++ I++IK+ +E  CPGVVSCADI+ALAARD+VS+  +  
Sbjct  84    DRVGTDQTEKDARPNLSLSGYDEINDIKSKLEQACPGVVSCADILALAARDAVSFPSRTP  143

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V  GRRDG +S ASE   N+PSPFS+FSTL Q F  KGL V+DLV LSG HTIG  H
Sbjct  144   LWDVLTGRRDGNVSLASEVNGNIPSPFSDFSTLKQLFVKKGLNVNDLVALSGAHTIGFAH  203

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVI  825
             C  FS RLYNFTGKGD DPSLN +Y + L+ +C N  N  + VEMDP SS  FD+ YF I
Sbjct  204   CGTFSRRLYNFTGKGDADPSLNATYIESLKAQCPNPANAQTTVEMDPQSSGSFDSSYFNI  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             L Q  GLF SDAALLTD  + K V ++     F   F KSM+KM AI VLTG +GE+RK 
Sbjct  264   LVQNKGLFQSDAALLTDKASSKTVQQLRKPRAFLDEFGKSMKKMAAIGVLTGKAGEIRKQ  323

Query  1006  CRVPN  1020
             C V N
Sbjct  324   CGVVN  328



>ref|XP_009630374.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   352 bits (904),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 173/300 (58%), Positives = 214/300 (71%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    VELGFYKKTCPNVEAIVKQTTAHYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+V        W+VP+
Sbjct  86    QAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVEL-INGPTWAVPL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S   +AL NLP+PF NF+TL   F S GL V DLV+LSGGHTIGM HC  FS+
Sbjct  145   GRRDGRVSILLDALKNLPTPFDNFTTLKTTFGSLGLNVKDLVVLSGGHTIGMSHCFSFSS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+++ +Y   L+ KCK  + T+ VEMDPGS + FDTDY+ ++ ++ GL
Sbjct  205   RLYNFTGKGDMDPNMDQNYVGRLKIKCKPGDVTTIVEMDPGSFKSFDTDYYTMVSKRRGL  264

Query  847   FPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALLTD   +  V   V+     FFK F +SM KMG I VLTG +GE+RK+C   N
Sbjct  265   FASDAALLTDSQTKAYVLSQVNPYGSTFFKDFGESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>emb|CDO98926.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 216/300 (72%), Gaps = 2/300 (1%)
 Frame = +1

Query  127   LEKHFYK-KECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
             L  +FY+   CP  E +V+++T  +  S+P L  KLLR+H+HDCFV+GCD SILLD+  +
Sbjct  34    LRPNFYRFTRCPQAEMLVKALTISKVRSDPTLAPKLLRVHYHDCFVKGCDASILLDTVGT  93

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             N++EK A PN ++ GFE ID+IKA +E  CPG+VSCADI+ALAARD+VS+ F + +W VP
Sbjct  94    NQSEKDARPNQTLGGFEAIDDIKAQVEKACPGIVSCADILALAARDAVSFPFGRNLWEVP  153

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRD R+S  S+   NLPSPFS+F TL Q FA K L V+DLV LSG HTIG+ HC  FS
Sbjct  154   TGRRDSRVSLISDVNGNLPSPFSDFPTLQQLFAKKNLNVNDLVALSGAHTIGVAHCGAFS  213

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKM  840
              RL+NFTGKGD DPSL+ +YA+ L+ +C N  N  + V MDP SS+ FDT YF IL QK 
Sbjct  214   RRLFNFTGKGDMDPSLDATYAETLKQQCPNPANPATTVGMDPQSSRSFDTHYFTILNQKK  273

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALLT+  +  IV+++     FF  F +SM  MG I+VLTG +GE+RKNCRV N
Sbjct  274   GLFQSDAALLTNADSAAIVNRLQFPRNFFFEFGRSMVNMGNIEVLTGTAGEIRKNCRVIN  333



>gb|ABK26805.1| unknown [Picea sitchensis]
Length=324

 Score =   352 bits (903),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 215/301 (71%), Gaps = 1/301 (0%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  LE +FY K CP V  +V ++     S  P L A LLR+HFHDCFVRGCDGS+LL+ST
Sbjct  25    AGGLELNFYDKTCPGVSNVVEAVIAHYISKAPTLAAPLLRMHFHDCFVRGCDGSVLLNST  84

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              S KAEK AAPNL++ GF+VID  KAA+E  CPGVVSCADI+AL ARD+V +      W+
Sbjct  85    KSRKAEKEAAPNLTLRGFQVIDAAKAAVEKVCPGVVSCADILALVARDAV-HMLGGPFWN  143

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDG +S  +EA++ LP P   FS L   FAS GL V DLV+LSGGHTIGM HCN 
Sbjct  144   VPTGRRDGVVSIQNEAVAKLPPPNGTFSKLKSIFASNGLDVKDLVVLSGGHTIGMSHCNS  203

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             FS+RLYNFTGKGD DPSL+ SYA  L+ KCK  ++ + VEMDPGS + FDT Y+V +K+ 
Sbjct  204   FSSRLYNFTGKGDMDPSLDKSYAAHLKIKCKPGDNKTIVEMDPGSFRTFDTHYYVNVKKN  263

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
              GLF SDAALLT+  A+  ++K ++   F   FA+SMEKMG I VLTG +G++R++C   
Sbjct  264   RGLFQSDAALLTNNEAQSYINKGLESSSFLWDFARSMEKMGRIGVLTGTAGQIRRHCAFT  323

Query  1018  N  1020
             N
Sbjct  324   N  324



>emb|CDP16566.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 216/300 (72%), Gaps = 2/300 (1%)
 Frame = +1

Query  127   LEKHFYK-KECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
             L  +FY+   CP  E +V+++T ++  S+P L  KLLR+H+HDCFV+GCD SILLD+  +
Sbjct  34    LRPNFYRFTRCPQAEMLVKALTIRKVRSDPTLAPKLLRVHYHDCFVKGCDASILLDTVGT  93

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             N++EK A PN ++ GFE ID+IKA +E  CPG+VSCADI+ALAARD+VS+ F + +W VP
Sbjct  94    NQSEKDARPNQTLGGFEAIDDIKAQVEKACPGIVSCADILALAARDAVSFPFGRNLWEVP  153

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRD R+S  S+   NLPSPFS+F TL Q FA K L V+DLV LSG HTIG+ HC  FS
Sbjct  154   TGRRDSRVSLISDVNGNLPSPFSDFPTLQQLFAKKNLNVNDLVALSGAHTIGVAHCGAFS  213

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKM  840
              RL+NFTGKGD DPSL+ +YA  L+ +C N  N  + V MDP SS+ FDT YF IL QK 
Sbjct  214   RRLFNFTGKGDMDPSLDATYAGTLKQQCPNPANPATTVGMDPQSSRSFDTHYFTILNQKK  273

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             GLF SDAALLT+  +  IV+++     FF  F +SM  MG I+VLTG +GE+RKNCRV N
Sbjct  274   GLFQSDAALLTNAVSAAIVNRLQFPRNFFFEFGRSMVNMGNIEVLTGTAGEIRKNCRVIN  333



>ref|XP_006380314.1| hypothetical protein POPTR_0007s02560g [Populus trichocarpa]
 gb|ERP58111.1| hypothetical protein POPTR_0007s02560g [Populus trichocarpa]
 gb|AHL39148.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 212/303 (70%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY+  CP  E IV    ++  S +P L A LLR+HFHDCF+RGC+GS+LL ST
Sbjct  26    AGGLQLGFYQGACPDAELIVHQTLYRYISRDPTLAAPLLRMHFHDCFIRGCEGSVLLSST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PN ++ GF VID +K+A+E +CPGVVSCADI+AL ARD+V        W 
Sbjct  86    KNNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCADILALVARDAV-LMIGGPRWD  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S A+EAL NLPSPF+N + L Q+FA+ GL V DL +LSGGHTIG+GHC +
Sbjct  145   VPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTI  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTGKGD DPSL+P YA  L+ KCK  N  + VEMDPGS + FD DY+ I+ ++
Sbjct  205   ISNRLYNFTGKGDTDPSLDPRYAAQLKNKCKPGNSNTVVEMDPGSFKSFDEDYYNIVAKR  264

Query  838   MGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL D   R  V    M     F + FA+SM KMG I VLTG  GE+RK+C 
Sbjct  265   RGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKHCA  324

Query  1012  VPN  1020
             V N
Sbjct  325   VVN  327



>dbj|BAJ90491.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 216/308 (70%), Gaps = 5/308 (2%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQ-LPAKLLRLHFHDCFVRGCDGSILLD  291
             EA+ L+ HFY+  CP  E +VR I   R +++P  LPA+LLRL FHDCFVRGCD S+L+D
Sbjct  24    EAALLKAHFYRPSCPAAEAVVRDIVLARVAADPAALPARLLRLFFHDCFVRGCDASLLID  83

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  N AEK AAPN S+ GF+VID  KA +EA CPGVVSCADIVALAARD++S+QF + +
Sbjct  84    STAGNTAEKDAAPNGSLGGFDVIDTAKAVLEAVCPGVVSCADIVALAARDAISFQFGRDL  143

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V +GRRDG +S ASE LS++PSP  NF+ L  +FASKGL V DLVILSG HTIG+GHC
Sbjct  144   WDVQLGRRDGVVSSASEVLSDIPSPSDNFTVLEAKFASKGLDVKDLVILSGAHTIGVGHC  203

Query  652   NLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYF  819
             NLF +RL++ T  G     DP+LN +YA  LR  C +  N+ + V MDPGS   FD+ Y+
Sbjct  204   NLFGSRLFSSTTSGVAPATDPTLNAAYASQLRAACGSPSNNVTAVPMDPGSPARFDSHYY  263

Query  820   VILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVR  999
             V LK   GLF SDA LL D  +  ++  +  + +F + F  ++ KMG + VLTG  GE+R
Sbjct  264   VNLKLGRGLFRSDAQLLADRRSASMIHALTKEGYFLQEFKNAVRKMGRVGVLTGGQGEIR  323

Query  1000  KNCRVPNS  1023
             +NCR  NS
Sbjct  324   RNCRAVNS  331



>gb|KDP40040.1| hypothetical protein JCGZ_02038 [Jatropha curcas]
Length=365

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/297 (59%), Positives = 216/297 (73%), Gaps = 5/297 (2%)
 Frame = +1

Query  133   KHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNKA  312
             K   +  CP +E I R ITW+R S+NP   AK+LR+HFHDCFVRGCDGSILLDST +N A
Sbjct  73    KQHGQNSCPQLEAISREITWRRVSANPAFIAKILRMHFHDCFVRGCDGSILLDST-NNPA  131

Query  313   EKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMGR  492
             EK A PN S+AGF+VIDEIKA +E ECPG VSCADI+ALAARD+V++QFK+ +W V +GR
Sbjct  132   EKEAIPNKSLAGFDVIDEIKAKLEEECPGQVSCADILALAARDAVAFQFKRSLWPVSIGR  191

Query  493   RDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNRL  672
             +DGR+S   EA  +LP+P +NF+TL Q+F S GL V DLV LSG HTIG+GHC + + RL
Sbjct  192   KDGRVSSKDEADRDLPAPSANFTTLRQQFQSHGLDVTDLVALSGAHTIGLGHCVIIAKRL  251

Query  673   YNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQKMGLF  849
              +FT +GD DPSLN  YA+ L+ KC N  N  + +EMDPGSS  FD+ YFV L Q  GLF
Sbjct  252   VDFTERGDTDPSLNKEYANFLKQKCSNPPNPNTTLEMDPGSSLSFDSHYFVALNQSKGLF  311

Query  850   PSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
              SDAALLT+  A ++     +Q  FF  FA SM KMG+I    G+ GE+R+NCRV N
Sbjct  312   ESDAALLTNPEAARLSSIFQNQPVFFAQFALSMVKMGSI---GGDQGEIRRNCRVVN  365



>ref|XP_002280216.1| PREDICTED: peroxidase 27 [Vitis vinifera]
Length=327

 Score =   350 bits (897),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 215/307 (70%), Gaps = 9/307 (3%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +A +L+  FYK  CP  E+IVR  T Q  S  P L A LLR+HFHDCFVRGCDGS+LL+S
Sbjct  25    DAQYLKLGFYKNTCPAAEDIVRETTAQYISKAPTLAASLLRIHFHDCFVRGCDGSVLLNS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T  N+AEK A PNLS+ G++VID  K+A+E +CPGVVSCADI+AL ARD+VS       W
Sbjct  85    TKHNQAEKDAIPNLSLRGYQVIDAAKSAVEKKCPGVVSCADILALVARDAVS-MINGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP GRRDG++S A EAL+NLP PF+N + L   F SKGL + DL +LSGGHTIG+ HC+
Sbjct  144   QVPTGRRDGKLSVALEALTNLPPPFANITQLKAMFQSKGLSIKDLAVLSGGHTIGISHCS  203

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+NRLYNFTGKGD DPS++P+Y   L+ KCK  + ++ VEMDPGS + FD DY+ ++ +
Sbjct  204   SFTNRLYNFTGKGDTDPSMDPNYVIQLKKKCKPGDVSTVVEMDPGSFKSFDEDYYSVVAK  263

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF-----FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             + GLF SDAALL D    K V     Q F     F + FA SM KMG I VLTGN+GE+R
Sbjct  264   RRGLFQSDAALLDDVETSKYVRL---QSFSHGKSFGRDFAASMVKMGRIGVLTGNAGEIR  320

Query  1000  KNCRVPN  1020
             K C   N
Sbjct  321   KYCAFVN  327



>gb|KDP40042.1| hypothetical protein JCGZ_02040 [Jatropha curcas]
Length=328

 Score =   350 bits (897),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 220/306 (72%), Gaps = 2/306 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
              C A  L ++FY   CP  E IVR+I+  R  S+P + AKLLR+HFHDCFVRGCDGSILL
Sbjct  22    VCRADGLVENFYNTSCPQAEAIVRNISRSRAESSPPMVAKLLRMHFHDCFVRGCDGSILL  81

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             D   + KAEK   PNLS++G+++IDEIK  +E  CPGVVSCADI+ALAARD+V+Y   K 
Sbjct  82    DGVGNVKAEKDTIPNLSLSGYDLIDEIKTEVEKVCPGVVSCADILALAARDAVTYPNDKA  141

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W V  GRRDG +S  +E+  +LP+P SNF++L+Q F +KGL V DLV+LSGGHTIG+ +
Sbjct  142   RWEVLTGRRDGNVSLGTESDESLPNPSSNFTSLIQLFKTKGLDVTDLVVLSGGHTIGVAN  201

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNL-NDTSPVEMDPGSSQDFDTDYFVI  825
             C  F NRLYNFTGKGD DPSLN +YAD L+T C  + +  + VEMDP SS  FD +YF  
Sbjct  202   CATFINRLYNFTGKGDADPSLNTTYADFLKTLCPVVPSPATTVEMDPESSLVFDNNYFKA  261

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKM-VDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             + +  GL  SDAALL +  + +IV ++ +    F + FA SM+KMGAI VLTG++G++RK
Sbjct  262   VLENKGLLESDAALLQNEESTEIVRQLTMTNSTFDEKFAISMQKMGAIGVLTGDAGQIRK  321

Query  1003  NCRVPN  1020
             NCRV N
Sbjct  322   NCRVAN  327



>ref|XP_010035573.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=326

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/302 (56%), Positives = 214/302 (71%), Gaps = 2/302 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FYK  CP  EEIV+       S  P L A LLR+HFHDCFVRGCDGS+LL+ST
Sbjct  26    AQGLKIGFYKNTCPQAEEIVKKAAASFISRAPSLAAPLLRMHFHDCFVRGCDGSVLLNST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             +SN+AEK A PNLS+ G++VI+  K A+E +CPGVVSCADI+AL ARD+VS       W 
Sbjct  86    SSNQAEKDAFPNLSLRGYQVIEAAKDALEKKCPGVVSCADILALVARDAVS-MMNGPYWQ  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S+  +AL+NLP+P  + S L   FA+KGL V DL +LSGGHT+GM HC+ 
Sbjct  145   VPTGRRDGRVSKLQDALNNLPAPTFSISALKSSFAAKGLSVKDLAVLSGGHTLGMSHCSS  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             F+NRLYNFTGK D DPS++P+Y   L+TKCK  + T+ VEMDPGS++ FD DY+ ++ ++
Sbjct  205   FTNRLYNFTGKNDADPSMDPNYVAQLKTKCKPNDATTIVEMDPGSAKTFDVDYYTLVSKR  264

Query  838   MGLFPSDAALLTDYHARKIVD-KMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
              GLF SDAALLTD   +  V  ++  +  F K F  SM  MG + VLTGNSGE+RK C +
Sbjct  265   RGLFQSDAALLTDSTTKSYVQLQLTSKSTFAKDFGVSMVNMGNVGVLTGNSGEIRKKCYL  324

Query  1015  PN  1020
              N
Sbjct  325   VN  326



>ref|XP_006387149.1| hypothetical protein POPTR_1693s00200g [Populus trichocarpa]
 gb|ERP46063.1| hypothetical protein POPTR_1693s00200g [Populus trichocarpa]
Length=327

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 212/303 (70%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY++ CP  E IV    ++  S +  L A LLR+HFHDCF+RGC+GS+LL ST
Sbjct  26    AGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFIRGCEGSVLLSST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PN ++ GF VID +K+A+E +CPGVVSCADI+AL ARD+V        W 
Sbjct  86    KNNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCADILALVARDAV-LMIGGPRWD  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S A+EAL NLPSPF+N + L Q+FA+ GL V DL +LSGGHTIG+GHC +
Sbjct  145   VPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTI  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTGKGD DPSL+P YA  L+ KCK  N  + VEMDPGS + FD DY+ I+ ++
Sbjct  205   ISNRLYNFTGKGDTDPSLDPRYAAQLKNKCKPGNSNTVVEMDPGSFKSFDEDYYNIVAKR  264

Query  838   MGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL D   R  V    M     F + FA+SM KMG I VLTG  GE+RK+C 
Sbjct  265   RGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKHCA  324

Query  1012  VPN  1020
             V N
Sbjct  325   VVN  327



>ref|XP_009796690.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=324

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/300 (57%), Positives = 212/300 (71%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    VEVGFYKKTCPNVEAIVKQTTAHYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+V        W+VP+
Sbjct  86    QAEKDAIPNQSLRGFQVIDAAKSALEQECPGIVSCSDILALAARDAVEL-INGPTWAVPL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S   +AL NLP+PF NF+TL   F S GL V DL +LSGGHTIGM HC  FS+
Sbjct  145   GRRDGRVSILLDALKNLPTPFDNFTTLKTTFGSLGLNVKDLAVLSGGHTIGMSHCFSFSS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             R+YNFTGKGD DP ++ +Y   L+ KCK  + T+ VEMDPGS + FDTDY+ ++ ++ GL
Sbjct  205   RMYNFTGKGDTDPKMDQNYIGRLKIKCKPGDVTTIVEMDPGSFKSFDTDYYTMVSKRRGL  264

Query  847   FPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALLTD   +  V   ++     FFK F +SM KMG I VLTG +GE+RK+C   N
Sbjct  265   FASDAALLTDSQTKAYVLSQLNPYASTFFKDFGESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_004298090.1| PREDICTED: peroxidase 24-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 215/309 (70%), Gaps = 5/309 (2%)
 Frame = +1

Query  109   ACEASH--LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSI  282
             +C   H  L   FY+K C   E IVRSITW + ++NP   AKLLRLH+HDCFV+GCD SI
Sbjct  20    SCNGGHDQLSPWFYRKSCQQFENIVRSITWSKVAANPNFAAKLLRLHYHDCFVQGCDASI  79

Query  283   LLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFK  462
             L+DST  N AEK A PN SV G+E+IDEIKA +E ECP  VSCADIVALAARD+VSYQF 
Sbjct  80    LIDSTDGNTAEKDARPNRSVEGYEIIDEIKAKLEEECPDTVSCADIVALAARDAVSYQFG  139

Query  463   KKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGM  642
             + MW V  GR+DGR+S A+EA  +LPS  +N++TL  +FA  GL   DLV LSG HT+G+
Sbjct  140   RSMWLVFGGRKDGRVSLATEATRDLPSGGANYTTLRDQFAGLGLNYIDLVALSGAHTLGV  199

Query  643   GHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKC--KNLNDTSPVEMDPGSSQDFDTDY  816
              HC +F+ RL NFTGKGD DPSL+P+YA+ L+T+C     N  + VE+D  SS  FD+ Y
Sbjct  200   AHCVVFARRL-NFTGKGDIDPSLDPAYAEFLKTQCPSSTPNPATTVELDESSSISFDSHY  258

Query  817   FVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEV  996
             FV L+ K GL  SDAALLTD  A  +     +   F   F +SM+KMG I + TGN GE+
Sbjct  259   FVGLRHKKGLLGSDAALLTDRRAAWVARSFQNFHVFMAHFGQSMKKMGDIGIKTGNDGEI  318

Query  997   RKNCRVPNS  1023
             RKNCRV N+
Sbjct  319   RKNCRVINA  327



>ref|XP_009604224.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 213/300 (71%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    VELGFYKKTCPNVEAIVKQTTAHYISHAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+V        W+VP+
Sbjct  86    QAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVEL-INGPTWAVPL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S   +AL NLP+PF NF+TL   F S GL V DLV+LSGGHTIGM HC  FS+
Sbjct  145   GRRDGRVSILLDALKNLPTPFDNFTTLKTTFGSLGLNVKDLVVLSGGHTIGMSHCFSFSS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+++ +Y   L+ KCK  + T+ VEMDPGS + FDTDY+ ++ ++  L
Sbjct  205   RLYNFTGKGDMDPNMDQNYIGRLKIKCKPGDVTTIVEMDPGSFKSFDTDYYTMVSKRRRL  264

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALLTD   +  +   V+     FFK F +SM KMG I VLTG +GE+RK+C   N
Sbjct  265   FASDAALLTDSQTKAYILSQVNPYGSTFFKDFGESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_006352037.1| PREDICTED: peroxidase 56-like, partial [Solanum tuberosum]
Length=641

 Score =   358 bits (920),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 220/305 (72%), Gaps = 5/305 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             CE   +E  FYK+ CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+
Sbjct  340   CEG--VEVGFYKQTCPNVEAIVKETTKHYISIAPTLAAPLLRMHFHDCFVRGCDGSVLLN  397

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  NKAEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+VS       
Sbjct  398   STKGNKAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVSL-INGPT  456

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             WSVP+GRRDGR+S  SEA  NLP+PF NF+TL   F + GL V DLV+LSGGHTIGM HC
Sbjct  457   WSVPLGRRDGRVSILSEASKNLPTPFDNFTTLKTTFGALGLNVKDLVVLSGGHTIGMSHC  516

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
               FS+RLYNFTGKGD DP+++ +Y + L+ KCK  + T+ VEMDPGS + FDTDY+ ++ 
Sbjct  517   FSFSSRLYNFTGKGDMDPNMDQNYINRLKIKCKPGDVTTIVEMDPGSFKSFDTDYYSMVS  576

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             ++ GLF SDAALLTD   +  V   ++Q    FFK F +SM KMG I VLTGN+GE+RK+
Sbjct  577   KRRGLFVSDAALLTDTQTKHYVLSQLNQHGSTFFKDFGESMVKMGQIGVLTGNAGEIRKH  636

Query  1006  CRVPN  1020
             C   N
Sbjct  637   CAFRN  641


 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 217/301 (72%), Gaps = 5/301 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             CE   +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+
Sbjct  13    CEG--VEVGFYKKTCPNVEAIVKETTKHYISIAPTLAAPLLRMHFHDCFVRGCDGSVLLN  70

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  NKAEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+VS       
Sbjct  71    STKGNKAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVSL-INGPT  129

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             WSVP+GRRDGR+S  SEA  NLP+PF NF+TL   F + GL V DLV+LSGGHTIGM HC
Sbjct  130   WSVPLGRRDGRVSILSEASKNLPTPFDNFTTLKTTFGALGLNVKDLVVLSGGHTIGMSHC  189

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
               FS+RLYNFTGKGD DP+++ +Y + L+ KC+  + T+ VEMDPGS + FDTDY+ ++ 
Sbjct  190   FSFSSRLYNFTGKGDMDPNMDQNYINRLKIKCRPADVTTIVEMDPGSFKSFDTDYYTMVS  249

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             ++ GLF SDAALLTD   +  V   ++     FFK F +SM KMG I +LTG +GE+RK+
Sbjct  250   KRRGLFASDAALLTDTQTKHYVLSQLNPHGSTFFKDFGESMVKMGQIGILTGRAGEIRKH  309

Query  1006  C  1008
             C
Sbjct  310   C  310



>ref|XP_011100418.1| PREDICTED: peroxidase 27-like [Sesamum indicum]
Length=328

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 216/305 (71%), Gaps = 4/305 (1%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
              A +L  +FY K CP +E +V+  T Q  S  P L A LLR+HFHDCFVRGCDGS+LL+S
Sbjct  25    NAQNLRTNFYNKTCPSLESVVKKTTAQFISRAPSLAAALLRMHFHDCFVRGCDGSVLLNS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             TTSN AEK A PN S+ GF+VID +KAA+E  CPG VSCADI+AL ARD+VS Q     W
Sbjct  85    TTSNSAEKDAFPNQSLRGFQVIDAVKAAVEKTCPGRVSCADILALVARDAVS-QINGPSW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP+GRRDG +S A+EAL+NLP P  N + L+  FA+KGL V DLV+LSGGHTIG+ HC+
Sbjct  144   AVPLGRRDGNVSTANEALANLPPPNFNITQLIASFAAKGLTVKDLVVLSGGHTIGVSHCS  203

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+NRLYNFTG+ D DPS++P+Y   LR +C   + T+ V+MDPGS ++FDTDY+ ++++
Sbjct  204   SFTNRLYNFTGRNDTDPSMDPNYVAALRRRCPPADTTTIVQMDPGSFKNFDTDYYTLVRK  263

Query  835   KMGLFPSDAALLTDYHARKIVD---KMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             + GL  +DAALL +      V           FFK FA+SM KMG I VLTG++G++R+ 
Sbjct  264   RRGLLQTDAALLNNNVTSAYVQLHSSSSGDSSFFKDFAESMVKMGQIGVLTGSAGQIRRI  323

Query  1006  CRVPN  1020
             C   N
Sbjct  324   CSAIN  328



>ref|XP_002274157.2| PREDICTED: peroxidase 27-like [Vitis vinifera]
Length=328

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 209/300 (70%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FYKK CP  E+IVR  T Q  S  P L A LLR+HFHDCFVRGCDGS+LL+ST +N
Sbjct  29    LKLGFYKKTCPAAEDIVRKTTAQYISKAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKNN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PNLS+ G+ VID  K+A+E +CPGVVSCADI+AL ARD+VS       W VP 
Sbjct  89    QAEKDAIPNLSLRGYHVIDAAKSAVEKKCPGVVSCADILALVARDAVS-MINGPYWKVPT  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG++S A EAL NLP PF+N + L   F SKGL V DLV+LSGGHTIG+ HC+ F+N
Sbjct  148   GRRDGKVSVALEALINLPPPFANITQLKSMFHSKGLSVKDLVVLSGGHTIGISHCSSFTN  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DPS++P+Y   L+ KC+  + T+ VEMDPGS + FD DY+ ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPSMDPNYVIQLKKKCRPGDVTTIVEMDPGSFKTFDGDYYTMVAKRRGL  267

Query  847   FPSDAALLTDYHARKIVD--KMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SD ALL D   RK V          F K FA SM KMG + VLTG +G +RK C   N
Sbjct  268   FQSDVALLDDVQTRKYVKLHSFSHGKSFGKDFAASMVKMGKVGVLTGKAGGIRKYCAFVN  327



>gb|EYU24791.1| hypothetical protein MIMGU_mgv1a010031mg [Erythranthe guttata]
Length=324

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 210/306 (69%), Gaps = 4/306 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+  FYKK CP  E IV+  T    +  P L A +LR+HFHDCFVRGCD SILL+
Sbjct  20    CNAQGLKLGFYKKTCPTAEAIVKKETASIMAVAPTLAAPILRMHFHDCFVRGCDASILLN  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             STT+N+AEK + PNLS+ G+  ID +K+A+E +CPGVVSCADI+AL ARD+VS+      
Sbjct  80    STTNNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSF-LNGAS  138

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP+GRRDG +S ++EAL NLP PF N + L   FASKGL   DLV+LSGGHTIG  HC
Sbjct  139   WPVPLGRRDGNVSNSTEALFNLPPPFFNITQLKASFASKGLNAKDLVVLSGGHTIGTSHC  198

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
             + F+NRLYNFTG GD DPSL+ +Y   L+T+C   + T+ VEMDPGS + FDT+Y+ ++ 
Sbjct  199   SSFTNRLYNFTGVGDSDPSLDSNYVARLKTRCSATDTTTLVEMDPGSFKTFDTEYYTLVA  258

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDF---FFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAALL D   R  V           F K FAKSM KMG I VLTG+ GE+RK
Sbjct  259   KRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIRK  318

Query  1003  NCRVPN  1020
              C   N
Sbjct  319   TCGFIN  324



>ref|XP_009794257.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=327

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/330 (53%), Positives = 223/330 (68%), Gaps = 5/330 (2%)
 Frame = +1

Query  37    MEFSHRRHHNLIlvcslfvvfcvvACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQ  216
             M FS  RH  ++++  + V      C A  L+  FY K CP VE IVR  T Q  S  P 
Sbjct  1     MAFS--RHIVVLILQLMLVPLAFNLCNAQGLKYGFYSKTCPGVESIVRKTTAQFISKAPT  58

Query  217   LPAKLLRLHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECP  396
             L A LLR+ FHDCFVRGCDGS++L+ST +N+AE+ A PN S+ GF+VI+ +K+A+E +CP
Sbjct  59    LAAPLLRMQFHDCFVRGCDGSVMLNSTKNNQAERDAIPNQSLRGFQVINGVKSALENKCP  118

Query  397   GVVSCADIVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQR  576
             GVVSCADIVAL ARD+VS       W VP+GRRDGR+S   EAL+ LP PF+N STL  +
Sbjct  119   GVVSCADIVALVARDAVS-MINGPYWKVPLGRRDGRVSIMLEALTLLPPPFANISTLKSQ  177

Query  577   FASKGLGVHDLVILSGGHTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNL  756
             FAS GL   DLV+LSGGHTIG  HC  F+NR+YNFTG GD DP+++P+Y   L+ KC   
Sbjct  178   FASVGLNAKDLVVLSGGHTIGTSHCFAFTNRMYNFTGNGDADPTMDPNYIAGLKLKCSPT  237

Query  757   NDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDK--MVDQDFFFK  930
             + T+ VEMDPGS + FD  Y+ ++ ++ GLF SD+ALL D   R  V +  +     FFK
Sbjct  238   DVTTLVEMDPGSFKTFDEKYYTLVAKRRGLFQSDSALLDDIETRAYVKRQALTHGKTFFK  297

Query  931   SFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
              FAKSM KMG I VLTG +GE+RK+C   N
Sbjct  298   DFAKSMVKMGKIGVLTGQAGEIRKHCDFVN  327



>ref|XP_008340867.1| PREDICTED: peroxidase 24 [Malus domestica]
Length=327

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 213/304 (70%), Gaps = 11/304 (4%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L   FY K CP +  IVR+ITW + + NP + AKLLR+H+HDCFVRGCD S+LLDST+ N
Sbjct  29    LSXVFYHKSCPEIGRIVRNITWSKVAENPTMAAKLLRMHYHDCFVRGCDASLLLDSTSDN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A  N ++ G+EVIDEIKA +E ECPG+VSCADIVALAARD+VSYQF + MW V  
Sbjct  89    TAEKEAIQNRNIRGYEVIDEIKARLEEECPGIVSCADIVALAARDAVSYQFGRPMWQVLT  148

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DG++S +SEA +NLPS  +NF+TL Q+F   GL V DLV LSG HTIG+ HC +F  
Sbjct  149   GRKDGKVSLSSEASANLPSAGANFTTLYQQFIGLGLNVIDLVALSGAHTIGVAHCXVFQR  208

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSP---VEMDPGSSQDFDTDYFVILKQK  837
             RL N TGKGD DP+L+P YA+ LRT+C     T+P   V +D  SS  FD+ YF  L+Q 
Sbjct  209   RL-NVTGKGDVDPTLDPEYAEFLRTQC-----TTPAVAVALDANSSVSFDSHYFAGLRQN  262

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLT--GNSGEVRKNCR  1011
              GL  SDAALLTD  + +IV +      F   F  SM+KMGAI V T   + GE+RKNCR
Sbjct  263   KGLLTSDAALLTDRRSARIVRRFERFHIFMTYFGNSMKKMGAIGVKTREQDGGEIRKNCR  322

Query  1012  VPNS  1023
             V N+
Sbjct  323   VVNA  326



>ref|XP_009800459.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=324

 Score =   345 bits (884),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 211/300 (70%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    LQVGFYKKTCPNVEAIVKKATTDFVSRTPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             + EK A PN S+ GF+VID  K+A+E +CPG+VSCADI+AL ARD+VS       W V +
Sbjct  86    QTEKDAIPNQSLRGFQVIDAAKSALEKQCPGIVSCADILALVARDAVSL-INGPTWQVEL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S   EA+ NLP+PF NF+TL   F + GL V D+V+LSGGHT+G+ HC  F +
Sbjct  145   GRRDGRVSILLEAIRNLPNPFDNFATLKSSFGALGLSVKDIVVLSGGHTLGVSHCFSFGS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+++ +Y   L+TKCK  + T+ VEMDPGS++ FDTDY+ ++ ++ GL
Sbjct  205   RLYNFTGKGDTDPNMDQNYIGQLKTKCKPNDVTTTVEMDPGSAKSFDTDYYTMVSKRRGL  264

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALLTD   +  V   ++     FFK F  SM  MG I VLTG SGE+RK+C + N
Sbjct  265   FVSDAALLTDSQTKAYVLSQLNSRGSTFFKDFGVSMVNMGKIGVLTGKSGEIRKHCAITN  324



>ref|XP_006352038.1| PREDICTED: peroxidase 27-like, partial [Solanum tuberosum]
Length=311

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 209/300 (70%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             +E  FYKK CP VE+IV+       S  P L A LLR+HFHDCFVRGCDGS+LL+ST SN
Sbjct  13    VEVGFYKKTCPNVEKIVKKAVVDYVSIAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKSN  72

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A  NLS+ GF+VID  K+A+E +CPGVVSCADI+AL ARD+VS       W VP+
Sbjct  73    QAEKDAIANLSLRGFQVIDAAKSALEKQCPGVVSCADILALVARDAVSL-INGPTWQVPL  131

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  SEA +NLP+PF NF+TL  RF S GL V DLV+LSGGHT+G+ HC  F +
Sbjct  132   GRRDGRVSILSEATTNLPTPFDNFTTLKTRFGSLGLSVKDLVVLSGGHTLGVSHCFSFGS  191

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             R+YNFTGKGD DP+++  Y   L+TKCK  + T+ VEMDPGS + FDTDY+ ++ ++ GL
Sbjct  192   RMYNFTGKGDMDPNMDQKYIAQLKTKCKPNDVTTTVEMDPGSFKTFDTDYYTLVSKRRGL  251

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDA LLTD   +  V   +      FF+ F  SM  MG I VLT  SGE+RK C   N
Sbjct  252   FVSDATLLTDKQTKAYVLAQLSSSGSTFFEDFGVSMVNMGKIGVLTEKSGEIRKKCAFIN  311



>ref|XP_004287925.1| PREDICTED: peroxidase 3-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   344 bits (883),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 220/305 (72%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV++   +   + P L A LLR+HFHDCFVRGCD S+L++ST+
Sbjct  23    AQLQLGFYTKNCPKAEKIVKNFVEEHIRNAPSLAAALLRMHFHDCFVRGCDASVLVNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN AEK A PNL++ GF+ ID +K+ +EA+CPGVVSCAD++ALAARDSV        W+V
Sbjct  83    SNTAEKDATPNLTLRGFDFIDRVKSLVEAQCPGVVSCADVIALAARDSV-VTTGGPFWNV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++SEAL+++PSPFSNF+TL   FA++GL + DLV+LSG HTIG+ HC  F
Sbjct  142   PTGRRDGVISKSSEALASIPSPFSNFTTLQTNFANQGLNLKDLVLLSGAHTIGVSHCTSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTGKGDQDP L+  YA  L+  KCK+L+D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   TNRLYNFTGKGDQDPDLDSEYAANLKAKKCKSLSDNTTIVEMDPGSHRTFDLSYYALLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL         + +++      F   FAKSMEKMG I V TG+SGE+RK+C
Sbjct  262   RRGLFQSDSALTKSSTTYNYIKQLIQGSSPNFHAEFAKSMEKMGRINVKTGSSGEIRKHC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   AVVNS  326



>ref|XP_007226156.1| hypothetical protein PRUPE_ppa014996mg [Prunus persica]
 gb|EMJ27355.1| hypothetical protein PRUPE_ppa014996mg [Prunus persica]
Length=330

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 210/307 (68%), Gaps = 4/307 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C    L   FY+K CP +  IVRSITW + ++NP L AKLLRLH+HDCFVRGCD SIL+D
Sbjct  23    CNGRVLSPAFYRKSCPQIGRIVRSITWSKVAANPTLAAKLLRLHYHDCFVRGCDASILID  82

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST+ N AEK A PN S+ G++VIDEIK  +E EC  +VSCADIVALAARD+VSYQF + M
Sbjct  83    STSGNTAEKDAIPNRSIGGYDVIDEIKTKLEEECLDIVSCADIVALAARDAVSYQFGRPM  142

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W V  GR+DGR+S ASEA  +LPS  +NF+TL Q+FA  GL + DLV LSG HTIG+ HC
Sbjct  143   WQVLTGRKDGRVSLASEASRDLPSGNANFTTLQQQFAGLGLNIIDLVALSGAHTIGVAHC  202

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVIL  828
              +F  RL N TGKGD DPSL+P YA  LRT+C    N    V +D  SS  FD+ YF  L
Sbjct  203   AVFQRRL-NATGKGDADPSLDPEYAQFLRTQCTTPPNPAVAVALDANSSVSFDSHYFAGL  261

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTG--NSGEVRK  1002
             +   GL  SDAALLTD  + ++V        F  +F  SM+KMGAI V  G  + GE+RK
Sbjct  262   RHNKGLLRSDAALLTDPRSARVVKSFQGFHVFMANFGLSMKKMGAIGVKKGARDDGEIRK  321

Query  1003  NCRVPNS  1023
             NCRV N+
Sbjct  322   NCRVVNA  328



>ref|XP_002309830.2| hypothetical protein POPTR_0007s02570g [Populus trichocarpa]
 gb|EEE90280.2| hypothetical protein POPTR_0007s02570g [Populus trichocarpa]
 gb|AHL39149.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 208/303 (69%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY++ CP  E IV    ++  S +  L A LLR+HFHDCF+RGCDGS+LL ST
Sbjct  26    AGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFIRGCDGSVLLSST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
               N+AEK A PN ++ GF VID +K+A+E  CPGVVSC+D++AL ARD+V        W 
Sbjct  86    EKNQAEKDAIPNKTLRGFNVIDAVKSALEKNCPGVVSCSDVLALVARDAV-LMIGGPHWD  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S A+EAL NLPSPF+N + L Q+FA+ GL V DL +LSGGHTIG+GHC +
Sbjct  145   VPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTI  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTGKGD DPSL+P YA  L+ KCK  N  + VEMDPGS + FD DY+ I+ ++
Sbjct  205   ISNRLYNFTGKGDTDPSLDPRYAAQLKKKCKPGNSNTVVEMDPGSFKTFDEDYYNIVAKR  264

Query  838   MGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL D   R  V          F + FA+SM KMG I VLTG  GE+RK C 
Sbjct  265   RGLFRSDAALLDDAETRDYVKFQSRTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKRCA  324

Query  1012  VPN  1020
             V N
Sbjct  325   VVN  327



>emb|CBI28955.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 209/300 (70%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FYKK CP  E+IVR  T Q  S  P L A LLR+HFHDCFVRGCDGS+LL+ST +N
Sbjct  29    LKLGFYKKTCPAAEDIVRKTTAQYISKAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKNN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PNLS+ G+ VID  K+A+E +CPGVVSCADI+AL ARD+VS       W VP 
Sbjct  89    QAEKDAIPNLSLRGYHVIDAAKSAVEKKCPGVVSCADILALVARDAVS-MINGPYWKVPT  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG++S A EAL NLP PF+N + L   F SKGL V DLV+LSGGHTIG+ HC+ F+N
Sbjct  148   GRRDGKVSVALEALINLPPPFANITQLKSMFHSKGLSVKDLVVLSGGHTIGISHCSSFTN  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DPS++P+Y   L+ KC+  + T+ VEMDPGS + FD DY+ ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPSMDPNYVIQLKKKCRPGDVTTIVEMDPGSFKTFDGDYYTMVAKRRGL  267

Query  847   FPSDAALLTDYHARKIVD--KMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SD ALL D   RK V          F K FA SM KMG + VLTG +G +RK C   N
Sbjct  268   FQSDVALLDDVQTRKYVKLHSFSHGKSFGKDFAASMVKMGKVGVLTGKAGGIRKYCGARN  327



>ref|XP_010240936.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=329

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 207/304 (68%), Gaps = 4/304 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FYK  CP VE IV   T    S  P L A LLR+HFHDCFVRGCDGS+LL++T
Sbjct  27    AQGLKVGFYKNACPSVEAIVEQTTAHFLSRAPSLAAPLLRMHFHDCFVRGCDGSVLLNAT  86

Query  298   TSNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
              +NK  EK A PN S+ GF+VID +K+A+E  CPGVVSCADI+AL ARD+V +  K   W
Sbjct  87    AANKQTEKTAVPNQSLRGFQVIDAVKSAVEKVCPGVVSCADIIALVARDAVVFD-KGPFW  145

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP GRRDGR+S ASEAL  LP PF+N S L  RF +KGL V DLV+LS  HTIG  HC 
Sbjct  146   EVPTGRRDGRVSNASEALQFLPPPFANISDLKSRFQAKGLSVKDLVVLSAAHTIGTSHCF  205

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+NRLYNFTGKGD DPS++P+Y   L+ KCK  ++T+ VEMDPGS + FD DY+ ++ +
Sbjct  206   NFNNRLYNFTGKGDTDPSMDPNYIARLKNKCKPGDNTTLVEMDPGSRKTFDADYYTLVAK  265

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAALLTD   R  V          FFK F  SM  MG I VLTG +GE+RK+C
Sbjct  266   RRGLFQSDAALLTDSETRAYVKLQASTHGSTFFKDFGVSMVNMGNIGVLTGFAGEIRKHC  325

Query  1009  RVPN  1020
                N
Sbjct  326   AFVN  329



>ref|XP_009784557.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=328

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 213/304 (70%), Gaps = 7/304 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             +E  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    VEVGFYKKTCPNVEAIVKQTTAHYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PN S+ GF+VID  K+A+E ECPG+VSC+DI+ALAARD+V        W+VP+
Sbjct  86    QAEKDAIPNQSLRGFQVIDAAKSALEQECPGIVSCSDILALAARDAVEL-INGPTWAVPL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL---  657
             GRRDGR+S   +AL NLP+PF NF+TL   F S GL V DL +LSGGHTIGM HC     
Sbjct  145   GRRDGRVSILLDALKNLPTPFDNFTTLKTTFGSLGLNVKDLAVLSGGHTIGMSHCFXHCL  204

Query  658   -FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F +RLYNFTGKGD DP+++ +Y   L+ KCK  + T+ VEMDPGS + FDTDY+ ++ +
Sbjct  205   SFGSRLYNFTGKGDTDPNMDQNYIGRLKIKCKPGDVTTIVEMDPGSFKSFDTDYYTMVSK  264

Query  835   KMGLFPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAALLTD   +  V   ++     FFK F +SM KMG I VLTG +GE+RK+C
Sbjct  265   RRGLFASDAALLTDSQTKSYVLSQLNPYTSTFFKDFGESMIKMGKIGVLTGKAGEIRKHC  324

Query  1009  RVPN  1020
              + N
Sbjct  325   ALRN  328



>gb|EYU24795.1| hypothetical protein MIMGU_mgv1a021569mg [Erythranthe guttata]
Length=304

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 209/304 (69%), Gaps = 4/304 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FYKK CP VE IV+  T    S  P L A +LR+HFHDCFVRGCD SILL+ST
Sbjct  2     AFRLKLGFYKKTCPSVEAIVKKETANIMSVAPTLAAPILRMHFHDCFVRGCDASILLNST  61

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             T+N+AEK + PNLS+ G+  ID +K+A+E +CPGVVSCADI+AL ARD+VS+      W 
Sbjct  62    TNNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSF-LNGASWP  120

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP+GRRDG +S ++E L NLP PF N + L   FASKGL   DLV+LSGGHTIG  HC+ 
Sbjct  121   VPLGRRDGNVSNSTETLFNLPPPFFNITQLKASFASKGLNAKDLVVLSGGHTIGTSHCSS  180

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             F+NRLYNFTG GD DPSL+ +Y   L+T+C   + T+ VEMDPGS + FDT+Y+ ++ ++
Sbjct  181   FTNRLYNFTGVGDSDPSLDSNYVARLKTRCSATDTTTLVEMDPGSFKTFDTEYYTLVAKR  240

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF---FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              GLF SDAALL D   R  V           F K FAKSM KMG I VLTG+ GE+RK C
Sbjct  241   RGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIRKTC  300

Query  1009  RVPN  1020
                N
Sbjct  301   GFIN  304



>ref|XP_009604229.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=327

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 222/330 (67%), Gaps = 5/330 (2%)
 Frame = +1

Query  37    MEFSHRRHHNLIlvcslfvvfcvvACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQ  216
             M FS  RH  ++++  + V      C A  L+  FY+K CP VE IVR  T Q  S  P 
Sbjct  1     MAFS--RHIVVLILQLMLVPLAFNLCNAQGLKYGFYRKTCPRVESIVRETTAQYISKAPT  58

Query  217   LPAKLLRLHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECP  396
             L A LLR+ FHDCFVRGCDGS++L+ST +N+AE+ A PN S+ GF+VI+ +K+A+E +CP
Sbjct  59    LAAPLLRMQFHDCFVRGCDGSVMLNSTKTNQAERDAIPNQSLRGFQVINGVKSALENKCP  118

Query  397   GVVSCADIVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQR  576
             GVVSCADI+AL ARD+VS   K   W VP+GRRDG +S   EAL+ LP+PF+N S+L  +
Sbjct  119   GVVSCADIIALVARDAVS-MIKGPYWKVPLGRRDGSVSNMLEALNLLPAPFANISSLKAQ  177

Query  577   FASKGLGVHDLVILSGGHTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNL  756
             F S GL   DLV+LSGGHTIG  HC  F+NR+YNFTG GD DP+++P+Y   L+ KC   
Sbjct  178   FVSLGLNAKDLVVLSGGHTIGTSHCFAFTNRMYNFTGNGDADPTMDPNYIARLKLKCSPT  237

Query  757   NDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDK--MVDQDFFFK  930
             + T+ VEMDPGS + FD  Y+ I+  + GLF SD+ALL D   +  V +  +     FFK
Sbjct  238   DVTTLVEMDPGSFKTFDEKYYTIVANRRGLFQSDSALLDDIETKAYVKRQALTHGKTFFK  297

Query  931   SFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
              F KSM KMG I VLTG +GE+RK+C   N
Sbjct  298   DFGKSMVKMGKIGVLTGQAGEIRKHCDFVN  327



>gb|EYU24792.1| hypothetical protein MIMGU_mgv1a009974mg [Erythranthe guttata]
Length=325

 Score =   342 bits (878),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 209/307 (68%), Gaps = 4/307 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             +C A  L+  FYKK CP  E IV+  T    +  P L A +LR+HFHDCFVRGCD SILL
Sbjct  20    SCNAQGLKLGFYKKTCPSAEAIVKKETASIMAVAPTLAAPILRMHFHDCFVRGCDASILL  79

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +STT+N+AEK + PNLS+ G+  ID +K+A+E +CPGVVSCADI+AL ARD+VS      
Sbjct  80    NSTTNNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSL-LNGA  138

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W VP+GRRDG +S ++E L NLP PF N + L   FASKGL   DLV+LSGGHTIG  H
Sbjct  139   SWPVPLGRRDGNVSNSTEVLFNLPPPFFNITQLKANFASKGLNAKDLVVLSGGHTIGTSH  198

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVIL  828
             C+ F+NRLYNFTG GD DPSL+ +Y   L+T+C   + T+ VEMDPGS + FDT+Y+ ++
Sbjct  199   CSSFTNRLYNFTGVGDSDPSLDSNYVARLKTRCSATDTTTLVEMDPGSFKTFDTEYYTLV  258

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDF---FFKSFAKSMEKMGAIQVLTGNSGEVR  999
              ++ GLF SDAALL D   R  V           F K FAKSM KMG I VLTG+ GE+R
Sbjct  259   AKRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIR  318

Query  1000  KNCRVPN  1020
             K C   N
Sbjct  319   KTCGFIN  325



>ref|XP_011003204.1| PREDICTED: peroxidase 27-like [Populus euphratica]
Length=327

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 208/303 (69%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY++ CP  E IV     +  S +P L A LLR++FHDCF+RGCDGS+LL ST
Sbjct  26    ARGLQLGFYRRTCPDAELIVHKTLHRYISRDPTLAAPLLRMYFHDCFIRGCDGSVLLSST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
               N+AEK A PN ++ GF VID +K+A+E +CPGVVSC+D++AL ARD+V        W 
Sbjct  86    KKNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCSDVLALVARDAV-LMIGGPHWD  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S A+EAL NLPSPF+N S L Q+FA+ GL V DL +LSGGHTIG+GHC +
Sbjct  145   VPTGRRDGRLSIANEALFNLPSPFANISVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTI  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTGKGD DPSL+  YA  L+ KCK  N  + VEMDPGS + FD DY+ I+ ++
Sbjct  205   ISNRLYNFTGKGDTDPSLDRRYAAQLKKKCKPGNSNTVVEMDPGSFKTFDEDYYTIVAKR  264

Query  838   MGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL D   R  V          F + FA+SM KMG I VLTG  GE+RK C 
Sbjct  265   RGLFRSDAALLDDAETRDYVKFQSRTQGSTFAQDFAESMVKMGYIGVLTGKQGEIRKRCA  324

Query  1012  VPN  1020
             V N
Sbjct  325   VVN  327



>ref|XP_004287926.1| PREDICTED: peroxidase 27-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 206/300 (69%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FYK  CP++E+IV   T+   S  P L A LLR+HFHDCFVRGCDGS+LL ST  N
Sbjct  29    LQVGFYKYTCPHLEDIVHYTTYYYVSRTPTLAAPLLRMHFHDCFVRGCDGSVLLKSTAKN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AE+ A PN S+ GF+VID +K A+E  CPGVVSCADI+AL ARD+V        W VP 
Sbjct  89    QAERDAIPNQSLRGFQVIDAVKYAVEKACPGVVSCADILALVARDAV-LMLHGPYWEVPT  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S ASEAL+ LP PF+N + L   FASKGL V DLV+LSGGHTIG  HC+ FSN
Sbjct  148   GRRDGRVSIASEALTGLPPPFANIAQLKGMFASKGLTVKDLVVLSGGHTIGTSHCSSFSN  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+L+ +Y   L+ KCK  +  + VEMDPGS + FD DY+ ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPTLDRNYIAQLKIKCKPGDANTLVEMDPGSFKTFDEDYYTLVAKRRGL  267

Query  847   FPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALL D   +  V    +     F K FA SM KMG I VLTG +GE+RK C   N
Sbjct  268   FQSDAALLDDIETKTYVTTQAITHGATFAKDFAASMVKMGNIGVLTGKNGEIRKQCAFVN  327



>gb|EYU24800.1| hypothetical protein MIMGU_mgv1a010045mg [Erythranthe guttata]
Length=324

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 212/305 (70%), Gaps = 4/305 (1%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
              A +L  +FY++ CP VE IV   T    S  P L A LLR+HFHDCFVRGCDGS+LL+S
Sbjct  21    NAQNLALNFYRRTCPSVESIVNRTTASFISRAPSLAAALLRMHFHDCFVRGCDGSVLLNS  80

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T +N AE+ + PNLS+ GF+VID +K A+E  CP  VSCADI+AL ARD+VS Q K   W
Sbjct  81    TANNTAERDSIPNLSLRGFQVIDAVKTAVERSCPRTVSCADILALVARDAVS-QIKGPFW  139

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP+GRRDG +S ++EAL+NLP PF N + LV  FA+KGL V DLV+LSGGHTIG+ HC+
Sbjct  140   QVPLGRRDGNVSISNEALTNLPPPFFNATQLVASFAAKGLDVKDLVVLSGGHTIGVSHCS  199

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+ R+YNFTG+ D DP+++P+Y   L+ +C   + T+ V+MDPGS   FDTDY+ I+++
Sbjct  200   SFTTRIYNFTGRNDADPTMDPNYVAALKARCPPTDTTTIVQMDPGSFDRFDTDYYTIVRK  259

Query  835   KMGLFPSDAALLTDYHARKIVDK---MVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             + GLF SDAALL +      V +         FF+ FA SM KMG I VLTG +GE+R+ 
Sbjct  260   RRGLFESDAALLRNNVTNAYVQQHSSSSGSSSFFQDFAASMVKMGRIGVLTGTAGEIRRI  319

Query  1006  CRVPN  1020
             C V N
Sbjct  320   CSVAN  324



>ref|XP_007217744.1| hypothetical protein PRUPE_ppa008516mg [Prunus persica]
 gb|EMJ18943.1| hypothetical protein PRUPE_ppa008516mg [Prunus persica]
Length=328

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 204/301 (68%), Gaps = 4/301 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY K CP +E IV   T    S  P L A LLRLHFHDCFVRGCDGS+LL+ST SN
Sbjct  29    LKVGFYHKTCPNLEAIVAKTTQHYISRAPTLAAPLLRLHFHDCFVRGCDGSVLLNSTASN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A PNLS+ GF VID  K+A+E +CPGVVSCADI+AL ARD+V        W VP 
Sbjct  89    SAEKDAIPNLSLRGFHVIDAAKSAVEKKCPGVVSCADILALVARDAVR-MLPGSFWEVPT  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  SEAL  LPSPF+N + L  +FASKGL V DLV+LSGGHTIG  HC+ FS+
Sbjct  148   GRRDGRVSVNSEALRGLPSPFANITQLKAKFASKGLSVKDLVVLSGGHTIGTSHCDSFSS  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP L+ +Y   L+ KCK  +  + VEMDPGS + FD DY+ ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPKLDKNYIARLKKKCKPGDTKTLVEMDPGSFKSFDEDYYTLVAKRRGL  267

Query  847   FPSDAALLTDYHARKIVDKMVDQD---FFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
             F SD+ALL D   R  V +         F K F  SM  MG I VLTGNSGE+RK C + 
Sbjct  268   FHSDSALLDDPETRAYVIQQATSHGGATFLKDFGASMVNMGNIGVLTGNSGEIRKQCALV  327

Query  1018  N  1020
             N
Sbjct  328   N  328



>gb|EYU24801.1| hypothetical protein MIMGU_mgv1a009942mg [Erythranthe guttata]
Length=327

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 220/309 (71%), Gaps = 6/309 (2%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A   + LE ++Y K CP  E+IV     +   + P L A L+R+HFHDCFVRGCD S+LL
Sbjct  20    ASTNADLEMNYYAKSCPKAEKIVVDYVNKHIPNAPTLAAALIRMHFHDCFVRGCDASLLL  79

Query  289   DSTTS--NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFK  462
             +ST+S  N+ EK + PN +V GF+ ID +K+ +EAECPGVVSCADIV+LAARD++     
Sbjct  80    NSTSSTGNRTEKVSPPNRTVRGFDFIDRLKSLLEAECPGVVSCADIVSLAARDAIVVT-G  138

Query  463   KKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGM  642
                W VP GRRDG IS ASEAL+ +P+PFSN STL   FA+KGL + DLV+LSG HTIG+
Sbjct  139   GPFWRVPTGRRDGVISNASEALAQIPAPFSNISTLQNDFANKGLNLTDLVVLSGAHTIGI  198

Query  643   GHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYF  819
              HC+ F+NRLYNFTG GDQDPSL+  YA  L+  KCK++N T+ VEMDPGS + FD  Y+
Sbjct  199   SHCSSFANRLYNFTGVGDQDPSLDSEYATNLKANKCKSINSTTKVEMDPGSFRTFDLSYY  258

Query  820   VILKQKMGLFPSDAALLTDYHARKIVDKMVDQD--FFFKSFAKSMEKMGAIQVLTGNSGE  993
              ++ ++ GLF SDAAL T+     I++++V+ D   FFK FA SMEKMG I V TG+ GE
Sbjct  259   KLVLKRRGLFESDAALTTNSITSSIINQIVNGDSKIFFKEFANSMEKMGRIGVKTGSVGE  318

Query  994   VRKNCRVPN  1020
             +RK+C + N
Sbjct  319   IRKHCALVN  327



>ref|XP_009369145.1| PREDICTED: peroxidase 24-like [Pyrus x bretschneideri]
Length=331

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 212/300 (71%), Gaps = 11/300 (4%)
 Frame = +1

Query  139   FYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNKAEK  318
             FY K CP +  IV++ITW + + NP + AKLLR+H+HDCFVRGCD S+LLDST+ N AEK
Sbjct  37    FYHKSCPEIGRIVKNITWSKVAENPTMAAKLLRMHYHDCFVRGCDASLLLDSTSDNTAEK  96

Query  319   AAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMGRRD  498
              A  N ++ G+EVIDEIKA +E ECPG+VSCADIVALAARD+VSYQF + MW V  GR+D
Sbjct  97    EAIQNRNIRGYEVIDEIKARLEEECPGIVSCADIVALAARDAVSYQFGRPMWQVLTGRKD  156

Query  499   GRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNRLYN  678
             G++S +SEA +NLPS  +NF+TL Q F   GL V DLV LSG HTIG+ HC++F  RL N
Sbjct  157   GKVSLSSEASANLPSAGANFTTLYQHFIGLGLNVIDLVALSGAHTIGVAHCSVFQRRL-N  215

Query  679   FTGKGDQDPSLNPSYADMLRTKCKNLNDTSP---VEMDPGSSQDFDTDYFVILKQKMGLF  849
              TGKGD DP+L+P YA+ LRT+C     T+P   V +D  SS  FD+ YF  L+Q  GL 
Sbjct  216   VTGKGDIDPTLDPEYAEFLRTQC-----TTPAVAVALDANSSVSFDSHYFAGLRQNKGLL  270

Query  850   PSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLT--GNSGEVRKNCRVPNS  1023
              SDAALLTD  + +IV ++     F   F  SM+KMGAI + T   + GE+RK CRV N+
Sbjct  271   TSDAALLTDRRSARIVRRLERFHVFMTYFGNSMKKMGAIGIKTREQDGGEIRKTCRVVNA  330



>gb|KHG20863.1| Peroxidase 27 -like protein [Gossypium arboreum]
Length=326

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 211/302 (70%), Gaps = 3/302 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY + CP  E I+R  T+   S  P L A LLRLHFHDCFVRGCDGS+LL+ST
Sbjct  27    AQGLKLGFYSETCPNAESIIRKTTYGFISRAPTLAAPLLRLHFHDCFVRGCDGSVLLNST  86

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
               N+AEK A PNLS+ G+ VID +K+A+E  CPGVVSCADI+AL ARDSVS       W 
Sbjct  87    -KNQAEKDAIPNLSLRGYHVIDAVKSAVEQACPGVVSCADILALVARDSVS-MINGPSWK  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP+GRRDGR+S+ SEAL+NLPSPF N + L Q FASKGL + DL +LSGGHTIG  HC  
Sbjct  145   VPLGRRDGRVSKLSEALANLPSPFFNVTQLKQNFASKGLNMKDLAVLSGGHTIGTSHCVA  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             F  RLYNF+GKGD DPS++ +Y   L+ KCK  + TS VEMDPGS + FD  Y+ ++ ++
Sbjct  205   FGLRLYNFSGKGDADPSMDLTYVTQLKQKCKPGDITSLVEMDPGSFKTFDEAYYTLVSKR  264

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQ-DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
              GLF SDAALL +   +  V +       F + FA SMEKMG ++VLTGN GE+RK+C +
Sbjct  265   RGLFGSDAALLNNAETKAYVLQASRHGSTFARDFAVSMEKMGKVEVLTGNQGEIRKHCAM  324

Query  1015  PN  1020
              N
Sbjct  325   VN  326



>gb|KDP41154.1| hypothetical protein JCGZ_03648 [Jatropha curcas]
Length=343

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 213/300 (71%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FYK+ CP  E IV ++  +  SS+P L A LLR+HFHDCFVRGCDGS+LL+ST++N
Sbjct  45    LQLGFYKQTCPNAELIVHNVVQKFISSDPTLAAPLLRMHFHDCFVRGCDGSVLLNSTSTN  104

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PN ++ GF VID IK+ IE  C GVVSCADI+ALAARDSV        W VP 
Sbjct  105   QAEKDAIPNQTLRGFNVIDAIKSEIENNCTGVVSCADILALAARDSVQM-IGGPSWDVPT  163

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG +S ASEA + LPSPF+N + L + FA+KGL V DLV+LSG HTIG+G C + S+
Sbjct  164   GRRDGSVSNASEASAQLPSPFANITQLKKNFAAKGLSVEDLVVLSGAHTIGIGQCFVISD  223

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNF+G+GD DPSLN +YA  L+TKCK  + T+ VEMDPGSS+ FD+DY+ ++  + G+
Sbjct  224   RLYNFSGRGDTDPSLNATYAAELKTKCKPGDSTTVVEMDPGSSRTFDSDYYNVVNTRRGI  283

Query  847   FPSDAALLTDYHARK--IVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALL D   R   ++    +   F + F  SM K+G I VLTG+ GE+RK C + N
Sbjct  284   FQSDAALLNDIQTRTYVLLQSSPNGTTFKQDFGSSMVKLGRIGVLTGSQGEIRKQCALVN  343



>ref|XP_008223147.1| PREDICTED: peroxidase 24 [Prunus mume]
Length=331

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 212/308 (69%), Gaps = 5/308 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C    L   FY++ CP +  IVRSITW + ++NP L AKLLRLH+HDCFVRGCD SIL+D
Sbjct  23    CNGRVLSPAFYRRSCPQIGRIVRSITWSKVAANPTLAAKLLRLHYHDCFVRGCDASILID  82

Query  292   STT-SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             ST+ +N AEK A PN S+ G++VIDEIK  +E ECP +VSCADIVALAARD++SYQF + 
Sbjct  83    STSGNNTAEKDAIPNRSIGGYDVIDEIKTKLEEECPDIVSCADIVALAARDAISYQFGRP  142

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             MW V  GR+DGR+S A+EA  +LPS  +NF+TL Q+FA  GL + DLV LSG HTIG+ H
Sbjct  143   MWQVLTGRKDGRVSLATEASRDLPSGNANFTTLQQQFAGLGLNIIDLVALSGAHTIGVAH  202

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKN-LNDTSPVEMDPGSSQDFDTDYFVI  825
             C +F  RL N TGKGD DPSL+P YA  LRT+C    N    V +D  SS  FD+ YFV 
Sbjct  203   CAVFQRRL-NATGKGDADPSLDPEYAQFLRTQCTTPPNPAVAVALDANSSVAFDSHYFVG  261

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTG--NSGEVR  999
             L    GL  SDAALLTD  + ++V        F  +F  SM+KMGAI V  G  + GE+R
Sbjct  262   LSHNKGLLRSDAALLTDPRSARVVKSFQGFHDFMANFGLSMKKMGAIGVKKGARDDGEIR  321

Query  1000  KNCRVPNS  1023
             KNCRV N+
Sbjct  322   KNCRVVNA  329



>gb|EYU24797.1| hypothetical protein MIMGU_mgv1a010025mg [Erythranthe guttata]
Length=324

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 209/306 (68%), Gaps = 4/306 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+  FYKK CP VE IV+  T    +  P L A +LR+HFHDCFVRGC+ SILL+
Sbjct  20    CNAQGLKLGFYKKTCPSVEAIVKKETASIMAVAPTLAAPILRMHFHDCFVRGCEASILLN  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             STT+N+AEK + PNLS+ G+  ID +K+A+E +CPGVVSCADI+AL ARD+VS+      
Sbjct  80    STTNNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSF-LNGAS  138

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP+GRRDG +S ++EAL NLP PF N + L   FASKGL   DLV+LSGGHTIG  HC
Sbjct  139   WPVPLGRRDGNVSNSTEALFNLPPPFFNITQLKASFASKGLNTKDLVVLSGGHTIGTSHC  198

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
             + F+NRLYNFTG GD DPSL+ +Y   L+ +C   + T+ VEMDPGS + FD +Y+ ++ 
Sbjct  199   SSFTNRLYNFTGVGDSDPSLDSNYVARLKRRCSATDTTTLVEMDPGSFKTFDIEYYSVVA  258

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDF---FFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAALL D   R  V           F K FAKSM KMG I VLTG+ GE+RK
Sbjct  259   KRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIRK  318

Query  1003  NCRVPN  1020
              C   N
Sbjct  319   TCGFVN  324



>ref|XP_010240935.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=328

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 208/303 (69%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FYKK CP VE IV+  T    S  P L + LLR+HFHDCFVRGCDGS+LL+ST
Sbjct  27    AQGLKVGFYKKTCPSVEAIVKKTTAHFISRAPTLASPLLRMHFHDCFVRGCDGSVLLNST  86

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK+A PN S+ GF+V+D  KAA+E  CPGVVSCADI+AL ARD VS   +   W 
Sbjct  87    ATNQAEKSAIPNQSLRGFQVVDAAKAAVEKACPGVVSCADILALVARDVVSL-IEGPRWE  145

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S ASEAL+NLP PF N + L   F  KGL V DLV+LSGGHTIG  HC  
Sbjct  146   VPTGRRDGRVSLASEALTNLPPPFFNITQLKASFTRKGLSVKDLVVLSGGHTIGNSHCPS  205

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             F+NRLYNFTGKGD D SL+ +Y   L++KCK  + T+ VEM PGS + FD DY+ ++ ++
Sbjct  206   FTNRLYNFTGKGDTDTSLDSNYIPKLKSKCKPGDVTTIVEMVPGSFKTFDADYYTLVAKR  265

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALLTD   R  V          FF+ F  SM  MG I VLTG++GE+RK+C 
Sbjct  266   RGLFQSDAALLTDSDTRAYVKLQASTHGSTFFQDFGVSMVNMGNIGVLTGSAGEIRKHCA  325

Query  1012  VPN  1020
               N
Sbjct  326   FVN  328



>ref|XP_009119172.1| PREDICTED: peroxidase 3-like [Brassica rapa]
Length=326

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 220/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AEK AAPNL+V GF  I+ IKA +EA+CPG+VSCADI+ALA+RD++ +      WSV
Sbjct  84    GN-AEKDAAPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC +L D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   TNRLYNFTGRGDQDPALDSEYAANLKSRKCPSLKDNTTIVEMDPGSRKTFDLSYYQLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG+SG VRK C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINQILKGSVAGFFSEFAKSMEKMGRINVKTGSSGVVRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>emb|CDY46845.1| BnaA10g03290D [Brassica napus]
Length=326

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 220/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AEK AAPNL+V GF  I+ IKA +EA+CPG+VSCADI+ALA+RD++ +      WSV
Sbjct  84    GN-AEKDAAPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC +L D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   TNRLYNFTGRGDQDPALDSEYAANLKSRKCPSLKDNTTIVEMDPGSRKTFDLSYYQLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG+SG VRK C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINQILKGSVEGFFSEFAKSMEKMGRINVKTGSSGVVRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_008368371.1| PREDICTED: peroxidase 24-like [Malus domestica]
Length=456

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 213/304 (70%), Gaps = 11/304 (4%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L   FY K CP +  IVR+ITW + + NP + AKLLR+H+HDCFVRGCD S+LLDST+ N
Sbjct  29    LSXVFYHKSCPEIGRIVRNITWSKVAENPTMAAKLLRMHYHDCFVRGCDASLLLDSTSDN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A  N ++ G+EVIDEIKA +E ECPG+VSCADIVALAARD+VSYQF + MW V  
Sbjct  89    TAEKEAIQNRNIRGYEVIDEIKARLEEECPGIVSCADIVALAARDAVSYQFGRPMWQVLT  148

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DG++S +SEA +NLPS  +NF+TL Q+F   GL V DLV LSG HTIG+ HC +F  
Sbjct  149   GRKDGKVSLSSEASANLPSAGANFTTLYQQFIGLGLNVIDLVALSGAHTIGVAHCGVFQR  208

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSP---VEMDPGSSQDFDTDYFVILKQK  837
             RL N TGKGD DP+L+P YA+ LRT+C     T+P   V +D  SS  FD+ YF  L+Q 
Sbjct  209   RL-NVTGKGDVDPTLDPEYAEFLRTQC-----TTPAVAVALDANSSVSFDSHYFAGLRQN  262

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLT--GNSGEVRKNCR  1011
              GL  SDAALLTD  + +IV +      F   F  SM+KMGAI V T   + GE+RKNCR
Sbjct  263   KGLLTSDAALLTDRRSARIVRRFERFHIFMTYFGNSMKKMGAIGVKTREQDGGEIRKNCR  322

Query  1012  VPNS  1023
             V N+
Sbjct  323   VVNA  326



>emb|CBI28956.3| unnamed protein product [Vitis vinifera]
Length=671

 Score =   351 bits (901),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 215/306 (70%), Gaps = 9/306 (3%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
             +A +L+  FYK  CP  E+IVR  T Q  S  P L A LLR+HFHDCFVRGCDGS+LL+S
Sbjct  25    DAQYLKLGFYKNTCPAAEDIVRETTAQYISKAPTLAASLLRIHFHDCFVRGCDGSVLLNS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T  N+AEK A PNLS+ G++VID  K+A+E +CPGVVSCADI+AL ARD+VS       W
Sbjct  85    TKHNQAEKDAIPNLSLRGYQVIDAAKSAVEKKCPGVVSCADILALVARDAVS-MINGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP GRRDG++S A EAL+NLP PF+N + L   F SKGL + DL +LSGGHTIG+ HC+
Sbjct  144   QVPTGRRDGKLSVALEALTNLPPPFANITQLKAMFQSKGLSIKDLAVLSGGHTIGISHCS  203

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+NRLYNFTGKGD DPS++P+Y   L+ KCK  + ++ VEMDPGS + FD DY+ ++ +
Sbjct  204   SFTNRLYNFTGKGDTDPSMDPNYVIQLKKKCKPGDVSTVVEMDPGSFKSFDEDYYSVVAK  263

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF-----FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             + GLF SDAALL D    K V     Q F     F + FA SM KMG I VLTGN+GE+R
Sbjct  264   RRGLFQSDAALLDDVETSKYVRL---QSFSHGKSFGRDFAASMVKMGRIGVLTGNAGEIR  320

Query  1000  KNCRVP  1017
             K C  P
Sbjct  321   KYCAFP  326


 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 190/311 (61%), Gaps = 38/311 (12%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY + CP  E+IV     +   + P L A L+R+HFHDCFVRGCDGS+L++ST+SN
Sbjct  366   LKLGFYGESCPKAEKIVLDYVKKHIPNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSSN  425

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK   PNL++ GF+ I+ +K+ +EAECPG+VSCADI+AL ARDS+        W+VP 
Sbjct  426   QAEKDGTPNLTLRGFDFIERVKSVVEAECPGIVSCADILALVARDSIVVT-GGPFWNVPT  484

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG IS +SEA+S++P P +NF+TL   FA+KGL ++DLV+LSG HTIG+ HC+ FSN
Sbjct  485   GRRDGLISNSSEAVSDIPRPVNNFTTLQTLFANKGLDLNDLVLLSGAHTIGVSHCSSFSN  544

Query  667   RLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             RLYNFTG GD+DP+L+  YA  L+  KCK   D + +                I +   G
Sbjct  545   RLYNFTGVGDEDPALDSEYAANLKARKCKVATDNTTIAF--------------ITQILQG  590

Query  844   LFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
                S                      F   FAKSMEKMG I+V TG +GEVRK C     
Sbjct  591   PLSS----------------------FLAEFAKSMEKMGRIEVKTGTAGEVRKQCASCLI  628

Query  1024  *IKITMLIHVH  1056
              I+I +    H
Sbjct  629   PIRIAIFFAAH  639



>ref|XP_010267771.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=329

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 213/304 (70%), Gaps = 4/304 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY+K CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+S+
Sbjct  27    AQGLKVGFYEKTCPSVEAIVKQTTDSFLSRAPSLAAPLLRMHFHDCFVRGCDGSVLLNSS  86

Query  298   TSN-KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             ++N + EK A PN S+ GF+VID  K+A+E  CPGVVSCADI+AL ARD+VS+  K   W
Sbjct  87    SANPQPEKTAFPNQSLRGFQVIDAAKSAVEKTCPGVVSCADIIALVARDAVSFD-KGPFW  145

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP GRRDGR+S +SEAL  LP P +N S L  RF++KGL V DLV+LS GHTIG  HC 
Sbjct  146   EVPTGRRDGRVSNSSEALQFLPPPTANISDLKSRFSAKGLSVKDLVVLSAGHTIGTSHCF  205

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+NRLYNFTGKGD DPSL+P+Y   L+ KC++ + T+ VEMDPGS + FD+DY+ ++ +
Sbjct  206   NFNNRLYNFTGKGDTDPSLDPNYIAKLKNKCRSGDTTTLVEMDPGSFRTFDSDYYTLVSK  265

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAALLTD   +  V+         FFK F  SM  MG I VLTG +GE+RK+C
Sbjct  266   RRGLFQSDAALLTDSETKAYVNLQASTHGSTFFKDFGVSMVNMGNIGVLTGAAGEIRKHC  325

Query  1009  RVPN  1020
                N
Sbjct  326   AFIN  329



>ref|XP_009604225.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 163/300 (54%), Positives = 210/300 (70%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FYKK CP VE IV+  T    S  P L A LLR+HFHDCFVRGCDGS+LL+ST  N
Sbjct  26    LQVGFYKKTCPNVEAIVKKATTDFVSRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKGN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             + EK A PN S+ GF+VID  K+A+E +CPG+VSC DI+AL ARD+VS       W V +
Sbjct  86    QTEKDAIPNQSLRGFQVIDAAKSALEKQCPGIVSCTDILALVARDAVSL-INGPTWQVEL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S   EA+ NLP+PF NF+TL   F + GL V DLV+LSGGHT+G+ HC  F +
Sbjct  145   GRRDGRVSILLEAIRNLPTPFDNFTTLKSSFGALGLSVKDLVVLSGGHTLGVSHCFSFGS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+++ SY   L+TKCK  + T+ VEMDPGS+++FDTDY+ ++ ++ GL
Sbjct  205   RLYNFTGKGDTDPNMDQSYIGQLKTKCKPNDVTTTVEMDPGSAKNFDTDYYTMVSKRRGL  264

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALLT+   +  V   ++     FF+ F  SM  M  I VLTG +GE+RK+C + N
Sbjct  265   FASDAALLTNTQTKAYVLSQLNTPGSTFFEDFGVSMVNMSKIGVLTGKAGEIRKHCAIRN  324



>gb|AHJ86268.1| peroxidase [Pinus massoniana]
Length=325

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 213/301 (71%), Gaps = 1/301 (0%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+ +FY + CP V  +V  +     S  P L A LLR+HFHDCFVRGCDGS+LL++T
Sbjct  26    AGGLQLNFYDQTCPGVSNVVEEVVASYISRAPTLAAALLRMHFHDCFVRGCDGSVLLNTT  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              S+KAEK A PN+++ GF+VID  KAA+E  CPGVVSCADI+AL ARD+V +      W+
Sbjct  86    KSSKAEKDAPPNVTLRGFQVIDAAKAAVEKVCPGVVSCADILALVARDAV-HMLGGPFWN  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDG +S  +EA++ LP P + FS L   FAS GL V DLV+LSG HTIG+ HCN 
Sbjct  145   VPTGRRDGVVSIQNEAVAKLPPPNATFSKLKSIFASNGLDVKDLVVLSGEHTIGISHCNS  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             FS RLYNFTGKGD DPSL+ +YA  L+ KCK  ++ + VEMDPGS + FDT+YFV +K+ 
Sbjct  205   FSGRLYNFTGKGDMDPSLDKNYAARLKIKCKPGDNKTIVEMDPGSFRTFDTNYFVNVKKN  264

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
               LF SDAALLTD  A+  +++ +    FF  FA SMEKMG I+VLTG +G++R++C   
Sbjct  265   RVLFQSDAALLTDNEAQSYINQQLQYLSFFSDFAVSMEKMGRIRVLTGTAGQIRRHCAFS  324

Query  1018  N  1020
             N
Sbjct  325   N  325



>ref|XP_004487389.1| PREDICTED: peroxidase 3-like [Cicer arietinum]
Length=325

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 220/309 (71%), Gaps = 6/309 (2%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A   + L+  FY K CP  E+I+ +   +   + P L A L+R+HFHDCFVRGCDGSILL
Sbjct  19    ASTHAQLQLGFYAKSCPKAEKIILNFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSILL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +STT N+AEK A PNL+V GF+ ID IK+ +EAECPGVVSCADI+AL+ARDS+       
Sbjct  79    NSTT-NQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCADIIALSARDSIVVT-GGP  136

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W VP GRRDG +S+  EA  N+P+PF NF++L   FA++GL + DLV+LSG HTIG+  
Sbjct  137   FWKVPTGRRDGVVSKLQEATQNIPAPFFNFTSLQTSFANQGLDLKDLVLLSGAHTIGISL  196

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFV  822
             C  FSNRLYNFTGKGDQDPSL+  YA  L+T KCKN+ND T+ VEMDPGS   FD  Y+ 
Sbjct  197   CTSFSNRLYNFTGKGDQDPSLDSEYAKNLKTLKCKNINDNTTIVEMDPGSRNTFDLSYYN  256

Query  823   ILKQKMGLFPSDAALLTDYHARKIVDKMV--DQDFFFKSFAKSMEKMGAIQVLTGNSGEV  996
              + ++ GLF SD+ALLT+   + +V +++    + F+  FAKSMEKMG I+V  G+ GE+
Sbjct  257   QVVKRRGLFQSDSALLTNSVTKSLVTQLLHGSIEIFYDEFAKSMEKMGQIKVKIGSEGEI  316

Query  997   RKNCRVPNS  1023
             RK+C + NS
Sbjct  317   RKHCALVNS  325



>ref|XP_002529736.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF32643.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=330

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 209/304 (69%), Gaps = 4/304 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L   FY++ CP  E IV    +Q  S +  L A LLR+HFHDCFVRGCDGS+LL ST
Sbjct  26    AWGLYMRFYRRTCPRAEFIVHRTVYQYVSRDATLAAPLLRMHFHDCFVRGCDGSVLLQST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PN ++ GF VID IK+AIE ECPGVVSCADI+ALAARD+V        W+
Sbjct  86    KNNQAEKDAIPNQTLRGFNVIDAIKSAIERECPGVVSCADILALAARDAV-LMIGGPFWA  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S ASEAL+ LPSPF+N + L Q FA+KGL V DL +LSGGHTIG+GHC +
Sbjct  145   VPTGRRDGRVSIASEALTQLPSPFANITELKQNFAAKGLNVKDLAVLSGGHTIGIGHCFI  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
              SNRLYNFTG+GD DPSL+P YA  L+ KCK    T + VEMDPGS   FD +Y+  + +
Sbjct  205   ISNRLYNFTGRGDTDPSLDPIYAAQLKKKCKPGGSTKTIVEMDPGSFVSFDENYYTTVAK  264

Query  835   KMGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAALL D+     V    +     F + F+ SM K+G + +LTG  GE+RK+C
Sbjct  265   RRGLFQSDAALLDDFETSTYVRLQSLTGGLTFARDFSASMVKLGYVGILTGKQGEIRKHC  324

Query  1009  RVPN  1020
                N
Sbjct  325   GCVN  328



>ref|XP_011100296.1| PREDICTED: peroxidase 3-like [Sesamum indicum]
Length=327

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 217/303 (72%), Gaps = 6/303 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--STT  300
             LE +FY K CP  E+IV     +   + P L A L+R+HFHDCFVRGCD S+LL+  S+T
Sbjct  26    LEMNFYAKSCPKAEKIVLDYVNKHIPNAPSLAASLIRMHFHDCFVRGCDASVLLNFTSST  85

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N+ EK A PN ++ GF+ ID++K  +EAECPGVVSCADIV+L ARD+V        W V
Sbjct  86    GNQTEKVAIPNRTLRGFDFIDQVKGLLEAECPGVVSCADIVSLVARDAV-VATGGPFWRV  144

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS  SEAL+ +P+P SNFSTL   FA+KGL + DLV+LSG HTIG+ HC+ F
Sbjct  145   PTGRRDGVISNVSEALAQIPAPSSNFSTLQTDFANKGLNLKDLVLLSGAHTIGISHCSSF  204

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             +NRLYNFTG GDQDP+L+  YA  L+  KC+++N T+ VEMDPGS + FD  Y+ ++ ++
Sbjct  205   TNRLYNFTGVGDQDPALDSEYAVNLKARKCRSINSTNIVEMDPGSFRTFDLSYYTLVLKR  264

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALLTD   R ++ ++V+     F++ FAKSMEKMG I V TG++GE+RK+C 
Sbjct  265   RGLFQSDAALLTDSRTRSMITQLVEGPVGNFYREFAKSMEKMGRIGVKTGSAGEIRKHCA  324

Query  1012  VPN  1020
             V N
Sbjct  325   VVN  327



>ref|XP_008784560.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=324

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 218/307 (71%), Gaps = 4/307 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C  + L+  FY K CP  E+I+     +   + P L + LLR+HFHDCFVRGCDGS+L++
Sbjct  19    CVRADLQLGFYDKSCPKAEKIISDFVKEHIPNAPTLASPLLRMHFHDCFVRGCDGSVLIN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST+SN+AEKAA PN ++ GF  ID +K+ +E ECPGVVSCADIVAL ARD+V        
Sbjct  79    STSSNQAEKAATPNQTLRGFSFIDRVKSLVEKECPGVVSCADIVALVARDAVGV-IGGPF  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP GRRDG IS ++EAL+++P+P  NFS L   FA+KGL + DLV+LSG HTIG+ HC
Sbjct  138   WRVPTGRRDGLISNSTEALNDIPAPTFNFSALQTSFANKGLNLTDLVLLSGAHTIGISHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
               F  RLYNFTGKGDQDPSL+  YA+ L+ KCK+LND  + VEMDPGS + FD  Y+  +
Sbjct  198   LSFDTRLYNFTGKGDQDPSLDKFYAENLKKKCKSLNDNVTFVEMDPGSFRTFDLGYYKNV  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              ++ GLF SDAAL+T+   +  +  +VD   + FF+ FA SMEKMG ++V TG++GE+RK
Sbjct  258   LKRRGLFQSDAALITNAGTKSSIMNLVDSPPEVFFQEFALSMEKMGRVEVKTGSTGEIRK  317

Query  1003  NCRVPNS  1023
             NC V N+
Sbjct  318   NCAVVNA  324



>ref|XP_004251512.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=324

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 208/300 (69%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             LE  FYKK CP VE+IV+       S  P L A LLR+HFHDCFVRGCDGS+LL+ST SN
Sbjct  26    LEVGFYKKTCPNVEKIVKKAVVDYVSIAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKSN  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A  NLS+ GF+VID  K+A+E +C GVVSCADI+AL ARD+VS       W VP+
Sbjct  86    QAEKDAIANLSLRGFQVIDAAKSALEKQCLGVVSCADILALVARDAVSL-INGPTWQVPL  144

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  SEA +NLP+PF NF+TL  RF S GL V DLV+LSGGHT+G+ HC  F +
Sbjct  145   GRRDGRVSILSEATTNLPTPFDNFTTLKTRFGSLGLSVKDLVVLSGGHTLGVSHCFSFGS  204

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             R+YNFTGKGD DP+++  Y   L+TKCK  + T+ VEMDPGS + FDTDY+ ++ ++ GL
Sbjct  205   RMYNFTGKGDMDPNMDQKYIAQLKTKCKPNDVTTTVEMDPGSFKTFDTDYYNLVSKRRGL  264

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDA LLT+   +  V   +      FF+ F  SM  MG I VLT  SGE+RK C   N
Sbjct  265   FVSDATLLTNKQTKDYVLAQLSSRGSTFFEDFGVSMVNMGKIGVLTDKSGEIRKKCAFIN  324



>ref|XP_006418047.1| hypothetical protein EUTSA_v10008189mg [Eutrema salsugineum]
 gb|ESQ36400.1| hypothetical protein EUTSA_v10008189mg [Eutrema salsugineum]
Length=326

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 221/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHVSNAPSLAAALLRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AEK A PNL+V GF  ID IK+ +EA+CPG+VSCADI+ALA+RD+V +      WSV
Sbjct  84    GN-AEKDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFT-GGPTWSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLRDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC +LND T+ VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGDQDPALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+    + +++++      FF  FAKSMEKMG I + TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLQNINQILKGSVESFFSEFAKSMEKMGRINLKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              + NS
Sbjct  322   SIANS  326



>ref|XP_010931832.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=324

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 217/307 (71%), Gaps = 4/307 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C  + L+  FY K CP  E+I+     +   + P L + LLR+HFHDCFVRGCDGS+L++
Sbjct  19    CVKADLQLGFYDKSCPKAEKIISDFVKKHIPNAPTLASPLLRMHFHDCFVRGCDGSVLIN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST++N+AEKAA PNL++ GF  ID +K+ +E ECPGVVSCADIVAL ARD+V        
Sbjct  79    STSNNQAEKAATPNLTLRGFGFIDSVKSLVEKECPGVVSCADIVALVARDAVGV-IGGPY  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP GRRDG IS ++EAL+N+P+P  NFS L   FA+KGL V DL+ LSG HTIG+GHC
Sbjct  138   WRVPTGRRDGLISNSTEALNNIPAPTFNFSALQTSFANKGLNVTDLIWLSGAHTIGIGHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             + FS+RLYNFTGKG QDPSL+  YA  L+  CK+LND  + VEMDPGS + FD  Y+  +
Sbjct  198   SSFSSRLYNFTGKGGQDPSLDRFYAANLKKACKSLNDNVTFVEMDPGSFRTFDLGYYKNV  257

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              ++ GLF SDAAL+T+   +  +  +V+   + FF+ FA SMEKMG I+V  G +GE+RK
Sbjct  258   LKRRGLFQSDAALITNAPTKSSIMNLVNSPPEVFFQEFALSMEKMGRIEVKAGTTGEIRK  317

Query  1003  NCRVPNS  1023
             NC V NS
Sbjct  318   NCAVVNS  324



>emb|CDY10037.1| BnaC08g44140D [Brassica napus]
Length=326

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AEK A PNL+V GF  I+ IK  +EA+CPG+VSCADI+ALA+RD+V +      WSV
Sbjct  84    GN-AEKDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAVVFT-GGPSWSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC +LND T+ VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGDQDPALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINQLLKGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_008230092.1| PREDICTED: peroxidase 27-like [Prunus mume]
Length=327

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 202/300 (67%), Gaps = 3/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY K CP +E IV   T Q  S  P L A LLR+HFHDCFVRGCDGS+LL+ST+SN
Sbjct  29    LKVGFYHKTCPNIEAIVAKTTQQYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTSSN  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A PN S+ GF VID +K+A+E +CPGVVSCADI+AL ARD+V        W VP 
Sbjct  89    SAEKDAFPNQSLRGFHVIDAVKSAVEKKCPGVVSCADILALVARDAVR-MLHGSFWEVPT  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  SEAL  LP+P +N + L   FASKGL V DLV+LSGGHTIG  HC  FS+
Sbjct  148   GRRDGRVSVNSEALRGLPAPSANITQLKATFASKGLSVKDLVVLSGGHTIGTSHCGPFSS  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP L+ +Y   L+ KCK  +  + VEMDPGS + FD DY+ ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPKLDKNYLAQLKIKCKPGDTKTLVEMDPGSFKSFDEDYYTLVTKRRGL  267

Query  847   FPSDAALLTDYHARKIVDKMVDQD--FFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SD+ALL D   R  V +        F K F  SM  MG I VLTGNSGE+RK C   N
Sbjct  268   FQSDSALLDDPETRAYVIQQATSHGATFLKDFGASMVNMGNIGVLTGNSGEIRKQCAFVN  327



>gb|EYU24798.1| hypothetical protein MIMGU_mgv1a009213mg [Erythranthe guttata]
Length=349

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 207/307 (67%), Gaps = 4/307 (1%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             +C A  L+  FYKK CP  E IV+  T    +  P L A +LR+HFHDCFVRGCD SILL
Sbjct  44    SCNAQGLKLGFYKKTCPSAEAIVKKETASIMAVAPTLAAPILRMHFHDCFVRGCDASILL  103

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +STT+N AEK + PNLS+ G+  ID +K+A+E +CPGVVSCADI+AL ARD+VS      
Sbjct  104   NSTTNNPAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSL-LNGA  162

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W VP+GRRDG +S ++E L NLP PF N + L   FASKGL   DLV+LSGGHTIG  H
Sbjct  163   SWPVPLGRRDGNVSNSTEVLFNLPPPFFNITQLKANFASKGLNAKDLVVLSGGHTIGTSH  222

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVIL  828
             C+ F+NRLYNFTG GD DPSL+ +Y   L+T+C   + T+ VEMDPGS + FD +Y+ ++
Sbjct  223   CSSFTNRLYNFTGVGDSDPSLDSNYVARLKTRCSATDTTTLVEMDPGSFKTFDIEYYTLV  282

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDF---FFKSFAKSMEKMGAIQVLTGNSGEVR  999
              ++ GLF SDAALL D   R  V           F K FAKSM KMG I VLTG+ GE+R
Sbjct  283   AKRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIR  342

Query  1000  KNCRVPN  1020
             K C   N
Sbjct  343   KTCAFIN  349



>ref|XP_011003205.1| PREDICTED: peroxidase 56-like [Populus euphratica]
Length=327

 Score =   337 bits (864),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 204/303 (67%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY+  CP  E IV     +  S +  L A LLR+HFHDCF+RGCDGS+LL ST
Sbjct  26    AGGLQLGFYQGACPDAELIVHQTLHRYISRDRTLAAPLLRMHFHDCFIRGCDGSVLLSST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
               N+AEK A PN ++ GF VID +K+A+E  CPGVVSCADI+AL ARD+V        W 
Sbjct  86    KKNQAEKDAIPNKTLRGFNVIDAVKSALEKRCPGVVSCADILALVARDAV-LMIGGPHWD  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S A+EAL NLPSPF+N + L Q+FA+ GL V DL +LSGGHTIG+GHC +
Sbjct  145   VPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTI  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              S RLYNFTGKGD DPSL+  YA  L+ KCK  N  + VEMDPGS + FD DY+ I+ ++
Sbjct  205   ISIRLYNFTGKGDTDPSLDRRYAAQLKKKCKPGNSNTVVEMDPGSFKTFDEDYYTIVAKR  264

Query  838   MGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL D   R  V          F + FA+SM KMG I VLTG  GE+RK C 
Sbjct  265   RGLFRSDAALLDDAETRDYVRFQSRTQGSTFAQDFAESMVKMGYIGVLTGKQGEIRKRCA  324

Query  1012  VPN  1020
             V N
Sbjct  325   VVN  327



>ref|XP_008379618.1| PREDICTED: peroxidase 3 [Malus domestica]
Length=326

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 214/305 (70%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P L A L+RLHFHDCFVRGCD S+LL+ST+
Sbjct  23    AQLQLGFYSKNCPKAEKIVKDYIEKHIHNAPSLAAALIRLHFHDCFVRGCDASVLLNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A PNL+V GF+ ID IK+ +EA+CPGVVSCAD++ALAARDS+        W V
Sbjct  83    SNQAEKDAPPNLTVRGFDFIDRIKSRLEAQCPGVVSCADVIALAARDSI-VATGGPTWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG I++ +EAL+N+P PFSNFSTL + FA+ GL + DLV+LSG HTIG+ HC  F
Sbjct  142   PTGRRDGVIARRAEALANIPPPFSNFSTLQRTFANVGLDLKDLVLLSGAHTIGVSHCPSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYN TG GDQDP+LN  YA  L+  KCK   D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNXTGVGDQDPALNAQYAANLKANKCKTPTDNTTIVEMDPGSVRTFDLSYYTLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL +       +++++      F+  F KSMEKMG I V TG++GE+RK C
Sbjct  262   RRGLFESDAALTSSSTTLNYINQLLKGSLQNFYDEFGKSMEKMGRINVKTGSAGEIRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVVNS  326



>emb|CDY55811.1| BnaCnng29190D [Brassica napus]
Length=319

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 206/301 (68%), Gaps = 4/301 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY K CP+ E IVR + +      P L A LLR+ FHDCFVRGCDGS+LLDS+
Sbjct  23    AQGLKVGFYSKTCPHAEGIVRKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSS  82

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PNLS+ GF +ID+ KAA+E  CPG+VSC+DI+AL ARD++    +   W 
Sbjct  83    -NNQAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALIARDAM-VALEGPSWE  140

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDGR+S  +E   NLPSPF N + L+  F +KGL   DLVILSGGHTIGMGHC L
Sbjct  141   VETGRRDGRVSNINEV--NLPSPFDNIAKLITDFRTKGLNEKDLVILSGGHTIGMGHCPL  198

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              +NRLYNFTG+GD DPSL+  YA  LR KCK  + T+ +EMDPGS + FD  YF ++ ++
Sbjct  199   MTNRLYNFTGRGDSDPSLDSEYAANLRKKCKPTDTTTALEMDPGSFKTFDVSYFKLVAKR  258

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
              GLF SDAALL +   R  V +      FF  F  SM KMG I VLTG +GE+RK CRVP
Sbjct  259   RGLFQSDAALLDNSKTRAYVLQQARGSTFFHDFGVSMVKMGRIGVLTGRTGEIRKMCRVP  318

Query  1018  N  1020
             N
Sbjct  319   N  319



>ref|XP_009118603.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Brassica rapa]
 emb|CDY59800.1| BnaAnng16310D [Brassica napus]
Length=326

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  I+ IK  +EA+CPG+VSCADI+ALA+RD+V +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAVVFT-GGPSWSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC +LND T+ VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGDQDPALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINQLLKGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_006664072.1| PREDICTED: peroxidase 24-like [Oryza brachyantha]
Length=338

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 207/303 (68%), Gaps = 4/303 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPA-KLLRLHFHDCFVRGCDGSILLDSTTS  303
             L+ H+Y+  CP               ++P     +LLRL FHDCFVRGCD S+L+DST+ 
Sbjct  35    LKAHYYRHACPEAXXXXXXXXXXXXXADPAALPARLLRLFFHDCFVRGCDASVLIDSTSG  94

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             + AEK AAPN S+AG +VID  KA +EA CPGVVSCADIVALAARD+VS+QF + +W V 
Sbjct  95    SSAEKDAAPNGSLAGDDVIDSAKAVLEAVCPGVVSCADIVALAARDAVSFQFGRDLWDVQ  154

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
             +GRRDG +S ASEALSNLP+P  NF+TL   FA KGL V DLVILSG HTIG+GHCNLF 
Sbjct  155   LGRRDGVVSLASEALSNLPAPTDNFTTLRSNFAGKGLDVKDLVILSGAHTIGVGHCNLFG  214

Query  664   NRLYNFTGKG--DQDPSLNPSYADMLRTKCKNL-NDTSPVEMDPGSSQDFDTDYFVILKQ  834
              RL+NFTG      DP+LN +YA  LR  C +  N+ + V MDPGS+  FD  YFV LK 
Sbjct  215   ARLFNFTGAAAPSADPTLNAAYAAQLRATCGSASNNVTAVPMDPGSAARFDAHYFVNLKL  274

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
               GLF SDAALL D HA  ++  +  QD F   F  ++ KMG + VLTG+ GE+R+NCR+
Sbjct  275   GRGLFASDAALLDDRHAAALIHDLTGQDRFLAEFKNAIRKMGRVGVLTGDQGEIRRNCRI  334

Query  1015  PNS  1023
              NS
Sbjct  335   VNS  337



>ref|XP_009620797.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=333

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRL FHDCFVRGCDGS+LL+  S
Sbjct  25    AQLQLNFYAKSCPKAEKIIQDYVQKHIPNAPSLAAALLRLQFHDCFVRGCDGSVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PN ++ GF  ID++K  +EAECPGVVSCADIVAL +RDSV        W
Sbjct  85    STKNQTEKVAIPNQTLRGFSFIDDVKKIVEAECPGVVSCADIVALVSRDSVVVT-GGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDGRIS ASEAL+N+P P SNFS+L   FASKGL + DLV+LSG HTIG+ HC+
Sbjct  144   NVPTGRRDGRISNASEALANIPPPTSNFSSLKTSFASKGLDLKDLVLLSGAHTIGVSHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGSS  FD  YF +
Sbjct  204   SFSTRLYNFTGVLGTQDPSLDSDYAANLKAKKCKSINDNTTIVEMDPGSSSTFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++K+V      F   FAK+MEKMG+I+V TG++GE+R
Sbjct  264   LLKRKGLFQSDAALTTSATTKSYINKLVQGSLKQFNAEFAKAMEKMGSIEVKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C   NS
Sbjct  324   KQCAFVNS  331



>ref|XP_010522326.1| PREDICTED: peroxidase 3 [Tarenaya hassleriana]
Length=330

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 215/305 (70%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  EEIV+    Q   + P L A LLR+HFHDCFVRGCDGS+L++ST 
Sbjct  28    AQLQMNFYADSCPNAEEIVQGFVKQHIPNAPSLAAALLRMHFHDCFVRGCDGSVLINSTR  87

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ +APNL++ GF  ID IKA +EA+CPG+VSCAD++AL+ARDSV        W V
Sbjct  88    GN-AERDSAPNLTLRGFSFIDGIKAVLEAQCPGIVSCADVIALSARDSVVLT-GGPYWRV  145

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+TL + F ++GL + DLV+LSG HTIG+ HC+ F
Sbjct  146   PTGRRDGRISNASEALANIPPPTSNFTTLQRLFGNQGLDLKDLVLLSGAHTIGVSHCSSF  205

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG+GDQDP+L+  YA  L++ KC  LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  206   SNRLYNFTGRGDQDPALDSEYAANLKSRKCPTLNDNVTIVEMDPGSRKTFDLSYYTLVLK  265

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      ++ +V      F+  FA SMEKMG I V TG++G VR+ C
Sbjct  266   RRGLFQSDSALTTNPTTLSAINGLVQGTLQNFYTEFANSMEKMGRINVKTGSAGVVRRQC  325

Query  1009  RVPNS  1023
              V NS
Sbjct  326   GVANS  330



>ref|XP_010931166.1| PREDICTED: peroxidase 56-like [Elaeis guineensis]
Length=336

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 206/314 (66%), Gaps = 12/314 (4%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FYK  CPY E IVR       S +P +   LLRLHFHDCFVRGCDGS+LL+ST
Sbjct  23    AQALKVGFYKNSCPYAEAIVRKAVAGYFSQDPTVSGPLLRLHFHDCFVRGCDGSVLLNST  82

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVS---------  450
              +N AEK A PN S+ GF VID  K A+E  CPG+VSCADIVALAARD+VS         
Sbjct  83    KTNLAEKDAMPNQSLDGFYVIDAAKEALEKACPGIVSCADIVALAARDAVSLATRSVGKG  142

Query  451   -YQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGG  627
              +     +W VP GRRDG +S ASEAL+NLPSP++  + L   FA+KGL   DL ILSG 
Sbjct  143   SWMASNNLWEVPTGRRDGLVSVASEALANLPSPYAEITQLKASFAAKGLSAKDLAILSGA  202

Query  628   HTIGMGHCNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFD  807
             HTIG  HC  F  RLYNFTGKGD DP+L+P YA  LR++CK  ++T+ VEM PGSS  FD
Sbjct  203   HTIGNSHCYSFERRLYNFTGKGDTDPTLDPKYAIKLRSQCKPGDETTTVEMVPGSSTTFD  262

Query  808   TDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTG  981
             T Y+ ++ ++ GLF SD ALL D   R  V   +D  +  FF  F  SM KMG I VLTG
Sbjct  263   TTYYKLVVRRRGLFHSDEALLQDKETRDYVYSRLDSPKSSFFFDFGVSMVKMGQIGVLTG  322

Query  982   NSGEVRKNCRVPNS  1023
              +GE+RK C + NS
Sbjct  323   KAGEIRKQCALVNS  336



>ref|XP_010543013.1| PREDICTED: peroxidase 2-like [Tarenaya hassleriana]
Length=330

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/300 (53%), Positives = 211/300 (70%), Gaps = 4/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  +Y+ +CP  E +V+ +T+Q  S  P L A LLR+HFHDCFVRGCDGS+LL S   +
Sbjct  33    LKLDYYRSKCPDAEAVVQRVTYQYVSRQPSLAAGLLRMHFHDCFVRGCDGSVLLKSPNKD  92

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AE+ A PNLS+ G+EV+D  K+A+E +CPGVVSCAD++AL ARD+VS   +   W VP+
Sbjct  93    -AERDAIPNLSLRGYEVVDAAKSALEKKCPGVVSCADVIALVARDAVSV-IRGPYWPVPL  150

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S+A E  +NLPSPF+N + L Q F +KGL V DLV+LSGGHTIG+ HC++  N
Sbjct  151   GRRDGRVSKALEVFTNLPSPFANIAVLKQNFLAKGLNVKDLVVLSGGHTIGISHCSIIHN  210

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DPS+NPSY   L+ +C   +  + V+MDPGS ++FD+ YF ++ QK GL
Sbjct  211   RLYNFTGKGDFDPSMNPSYVRTLKKRCNPNDFATIVDMDPGSVKNFDSHYFNVVAQKKGL  270

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDA LL D   +  V+  V      F + F+ SM K+G  QVLTG +GE+RK C   N
Sbjct  271   FTSDATLLDDPETKTYVETQVSTGGSSFARDFSDSMIKLGFTQVLTGKAGEIRKKCAFVN  330



>ref|XP_008230094.1| PREDICTED: peroxidase 3 [Prunus mume]
Length=327

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 214/305 (70%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P + A L+R+HFHDCFVRGCD S+LL+ST+
Sbjct  24    AQLQLGFYAKNCPKAEKIVKDFVDEHIHNAPSVAAALIRMHFHDCFVRGCDASVLLNSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK + PNL++ GF  ID IK  +EAECPGVVSCAD +ALAARDS+        W V
Sbjct  84    SNQAEKVSPPNLTLRGFNFIDRIKTLLEAECPGVVSCADTIALAARDSI-VATGGPFWKV  142

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS+ +EAL+N+P+P SNF+TL  RF + GL + DLV+LSG HTIG+ HC+ F
Sbjct  143   PTGRRDGVISRRAEALANIPAPTSNFTTLQTRFGNLGLDLKDLVLLSGAHTIGISHCSSF  202

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GDQDP+L+  YA  L+  KCK+  D T+ VEMDPGS + FD  Y+ +L +
Sbjct  203   SNRLYNFTGVGDQDPALDKQYAANLKANKCKSSTDNTTIVEMDPGSHRTFDLSYYTLLLK  262

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL T       +++++      F+  FAKSMEKMG + V TG++GE+RK C
Sbjct  263   RRGLFQSDAALTTSSTTLNYINQLLKGPLQNFYDEFAKSMEKMGRVNVKTGSAGEIRKQC  322

Query  1009  RVPNS  1023
              V NS
Sbjct  323   AVVNS  327



>ref|XP_008777796.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=332

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 216/307 (70%), Gaps = 5/307 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C  + L+  FY K CP  EEI+     +     P L + LLR+HFHDCFVRGCDGS+L++
Sbjct  26    CVKADLQLGFYHKSCPKAEEIISGFVKEHIPHAPTLASPLLRMHFHDCFVRGCDGSVLIN  85

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST+ N+AEK+A PNL++ GF+ ID +K+ +E ECPGVVSCADI+AL ARD+V        
Sbjct  86    STSKNQAEKSATPNLTLRGFDFIDRVKSLVEKECPGVVSCADILALVARDAVGV-IGGPF  144

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP GRRDG IS ++EAL+N+P+P  NFS L   FA+KGL V DLV LSG HTIG+ HC
Sbjct  145   WRVPTGRRDGLISNSTEALNNIPAPTFNFSALQTSFANKGLSVADLVWLSGAHTIGISHC  204

Query  652   NLFSNRLYNFTGKGDQDPSLNPSY-ADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             + FS RLYNFTGKGDQDPSL+  Y A++ + KCK+ ND TS  EMDPGS + FD  Y+  
Sbjct  205   SSFSKRLYNFTGKGDQDPSLDSFYAANLKKNKCKSPNDNTSIAEMDPGSFRTFDLGYYKN  264

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVR  999
             + ++ GLF SDAAL+T+   +  +  +V+   + FFK FA SMEKMG I+V TG+ GE+R
Sbjct  265   VLKRRGLFQSDAALITNAATKSSIMSLVNSSPEVFFKVFAFSMEKMGRIEVKTGSMGEIR  324

Query  1000  KNCRVPN  1020
             KNC V N
Sbjct  325   KNCAVVN  331



>ref|XP_010240937.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=327

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 216/304 (71%), Gaps = 6/304 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY K CP  E+IV     +   + P L A  +R+HFHDCFVRGCD S+LL+ST++N
Sbjct  25    LKLDFYDKSCPKAEKIVLDFVNKHIHNAPSLAAAFIRMHFHDCFVRGCDASVLLNSTSTN  84

Query  307   K-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             + AEK A PN ++ GF+ ID +K+ +EAECPGVVSCADI+AL ARDS+        W VP
Sbjct  85    QTAEKNAIPNQTLRGFDFIDRVKSLLEAECPGVVSCADIIALVARDSI-VATGGPSWKVP  143

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDG IS ASEALS +P+P +NF+TL +RF+ KGL V DLV+LSG HTIG+ HC  FS
Sbjct  144   TGRRDGVISNASEALSQIPAPTNNFTTLQKRFSDKGLDVKDLVLLSGAHTIGIAHCPAFS  203

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRT-KCKN-LNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             NRLYNFTG GDQDP+L+  YA  L+  KCK   N+T+ VEMDPGS + FD  Y+ +L ++
Sbjct  204   NRLYNFTGVGDQDPALDSEYAANLKAKKCKTPTNNTTIVEMDPGSFRTFDLSYYKLLLKR  263

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SD+AL TD  +R  +++++      F+  FAKSMEKMG I V TG+SGE+RK+C 
Sbjct  264   RGLFVSDSALTTDSTSRSFINQLLQGTLENFYTEFAKSMEKMGQIDVKTGSSGEIRKHCS  323

Query  1012  VPNS  1023
             V NS
Sbjct  324   VVNS  327



>ref|XP_010267770.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=330

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 204/305 (67%), Gaps = 4/305 (1%)
 Frame = +1

Query  115   EASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDS  294
              A  L   FYK  CP VE+IVR  T       P L A LLR+HFHDCFVRGCDGS+LL+S
Sbjct  27    SAQGLRVGFYKNTCPAVEDIVRKTTAHYVLPVPSLAAPLLRMHFHDCFVRGCDGSVLLNS  86

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T +N+AEK+A PN S+ GF +ID +K+A+E  CPGVVSCADI+AL ARD+VS   K   W
Sbjct  87    TANNQAEKSAIPNQSLNGFGIIDAVKSAVEKACPGVVSCADILALVARDAVSL-VKGPYW  145

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
              VP GRRDGR+S ASEAL+NLP PF+  S L  RF +KGL V DLV+LSG HTIG  HC 
Sbjct  146   EVPTGRRDGRVSLASEALTNLPPPFATISDLQTRFMAKGLSVKDLVVLSGAHTIGQSHCP  205

Query  655   LFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
              F+NRLYNFTG+ D DPSL+  Y   L++KCK  +  + VEMDPGS + FDT Y+  + +
Sbjct  206   SFTNRLYNFTGRADSDPSLDSIYIQRLKSKCKAGDVVTSVEMDPGSYKTFDTGYYKNVAK  265

Query  835   KMGLFPSDAALLTDYHARKIVDKM---VDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             + GLF SDAALL D   +  V +         FFK F  SM  MG I VLT ++GE+RK 
Sbjct  266   RRGLFQSDAALLNDADTKAYVIQQSTSSSGSSFFKDFGVSMVNMGNIGVLTASAGEIRKQ  325

Query  1006  CRVPN  1020
             C   N
Sbjct  326   CAFVN  330



>ref|XP_010931180.1| PREDICTED: peroxidase 3-like isoform X1 [Elaeis guineensis]
Length=325

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 217/308 (70%), Gaps = 5/308 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C  + L+  FY + CP  E+I+     +     P L A LLR+HFHDCFVRGCD S+L++
Sbjct  19    CANADLKLGFYDETCPKAEKIIFDYVKKHIPHAPSLAAPLLRVHFHDCFVRGCDASVLIN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST+ N+AEK+A PNLS+ GF+ ID +K+ IEAECPGVVSCADI+AL ARDSV        
Sbjct  79    STSKNQAEKSAFPNLSIRGFDFIDRVKSLIEAECPGVVSCADILALVARDSVVVT-GGPF  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W+VP GRRDG IS + EAL NLP+P  NFS L   FASKGL + DLV+LSG HTIG+ HC
Sbjct  138   WNVPTGRRDGLISNSIEALKNLPAPTFNFSALQTSFASKGLDLKDLVLLSGAHTIGVSHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSY-ADMLRTKCKNLNDTSP-VEMDPGSSQDFDTDYFVI  825
             + FS+RLYNFTGKGD+DPSL+  Y A++ + KCK  NDT+  VEMDPGS + FD  Y+  
Sbjct  198   SSFSSRLYNFTGKGDEDPSLDSFYAANLKKYKCKVPNDTTTIVEMDPGSFRTFDLGYYKH  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GL  SDAAL T+   +  + ++V    + FFK FA SMEKMG I+V TG+SGE+R
Sbjct  258   LLKRRGLLQSDAALTTNTATKASIMELVSSPLEVFFKEFAFSMEKMGRIEVKTGSSGEIR  317

Query  1000  KNCRVPNS  1023
             KNC V NS
Sbjct  318   KNCAVVNS  325



>ref|XP_009108181.1| PREDICTED: peroxidase 39 [Brassica rapa]
 emb|CDX86795.1| BnaA09g21850D [Brassica napus]
Length=326

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 216/306 (71%), Gaps = 8/306 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+++  Q   + P L A L+R+HFHDCFVRGCDGSIL+++T+
Sbjct  23    AQLKLGFYDKTCPNAEKIVQAVVNQHIRNVPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             SN+  EK A PNL+V GF+ ID +K  +E +CPGVVSCADI+ LA RDSV+       W+
Sbjct  83    SNQQVEKVAPPNLTVRGFDFIDLVKTVLERKCPGVVSCADIITLATRDSVA-AIGGPTWN  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS A+EAL+N+P PF NFSTL+  F ++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNATEALNNIPPPFGNFSTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YAD L++ KC ++ D T+ VEMDPGS   FD  YF ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRKCLSIADNTTQVEMDPGSRNTFDLSYFKLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVD---QDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAAL  D  A   V        QDFF + F KSMEKMG I V TG+ GE+R+
Sbjct  262   KRRGLFESDAALTKDPTALGQVRGFAGGSLQDFFVE-FGKSMEKMGRIGVKTGSDGEIRR  320

Query  1003  NCRVPN  1020
              C V N
Sbjct  321   TCSVVN  326



>emb|CDY43275.1| BnaC05g48680D [Brassica napus]
Length=319

 Score =   335 bits (858),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 206/301 (68%), Gaps = 4/301 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY K CP+ E IV+ + +      P L A LLR+ FHDCFVRGCDGS+LLDS+
Sbjct  23    AQGLKVGFYSKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSS  82

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PNLS+ GF++ID+ KAA+E  CPG+VSC+DI+AL ARD++    +   W 
Sbjct  83    -NNQAEKNAVPNLSLRGFDIIDDSKAALEKVCPGIVSCSDILALVARDAM-VALEGPTWE  140

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDGR+S  +E   NLPSPF N S L+  F +KGL   DLVILSGGHTIGMGHC L
Sbjct  141   VETGRRDGRVSNINEV--NLPSPFDNISKLITDFRTKGLNEKDLVILSGGHTIGMGHCPL  198

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTG+GD DPSL+  YA  LR KCK  + T+ +EMDPGS + FD  YF ++ ++
Sbjct  199   MSNRLYNFTGRGDSDPSLDSEYATSLRKKCKPTDTTTALEMDPGSFKTFDVSYFKLVAKR  258

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
              GLF SDAALL +   R  V +      FF  F  SM KMG   VLTG +GE+RK CR+P
Sbjct  259   RGLFQSDAALLDNSKTRAHVLEQARGSTFFHDFGVSMVKMGRTGVLTGRAGEIRKMCRIP  318

Query  1018  N  1020
             N
Sbjct  319   N  319



>ref|XP_004243525.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=331

 Score =   335 bits (858),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 216/307 (70%), Gaps = 8/307 (3%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--ST  297
              L+ +FY K CP  E+I++   +++    P L   LLR+HFHDCFVRGCDGS+LL+  S+
Sbjct  26    QLQLNFYAKSCPQAEKIIQDYVYKQIPKAPSLAPALLRMHFHDCFVRGCDGSVLLNFTSS  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             T N+ EK A PN ++ GF  ID +K A+EAECPGVVSCADIVAL ARDSV        W 
Sbjct  86    TKNQTEKVAVPNQTLRGFSFIDGVKKALEAECPGVVSCADIVALVARDSVVVT-GGPYWK  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS ASEAL+N+P P SNFS+L   FASKGL + DLV+LSG HTIG+ HC  
Sbjct  145   VPTGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPS  204

Query  658   FSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             FS+RLYNFTG  G +DPSL+  YA +L+  KCK++ND T+ VEMDPGSS  FD  YF ++
Sbjct  205   FSSRLYNFTGVWGKKDPSLDSEYAAILKMKKCKSINDNTTIVEMDPGSSSKFDLSYFQLV  264

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              ++ GLF SDAAL T    +  ++++V      F+  F  +MEKMG I+V TG++GE+RK
Sbjct  265   LKRRGLFQSDAALTTSATTKSFINQLVQGSLEQFYAEFGVAMEKMGKIEVKTGSAGEIRK  324

Query  1003  NCRVPNS  1023
             +C V NS
Sbjct  325   HCAVVNS  331



>emb|CDY13252.1| BnaC09g24040D [Brassica napus]
Length=326

 Score =   335 bits (858),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 216/306 (71%), Gaps = 8/306 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+++  Q   + P L A L+R+HFHDCFVRGCDGSIL+++T+
Sbjct  23    AQLKLGFYDKTCPNAEKIVQAVVNQHIRNVPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             SN+  EK A PNL+V GF+ ID +K  +E +CPGVVSCADI+ LA RDSV+       W+
Sbjct  83    SNQQVEKVAPPNLTVRGFDFIDLVKTVLERKCPGVVSCADIITLATRDSVA-AIGGPTWN  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS A+EAL+N+P PF NF+TL+  F ++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNATEALNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YAD L++ KC ++ D T+ VEMDPGS   FD  YF ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRKCLSIADNTTQVEMDPGSRNTFDLSYFKLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVD---QDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAAL  D  A   V        QDFF + F KSMEKMG I V TG+ GE+R+
Sbjct  262   KRRGLFESDAALTKDPTALGQVRSFAGGSLQDFFVE-FGKSMEKMGRIGVKTGSDGEIRR  320

Query  1003  NCRVPN  1020
              C V N
Sbjct  321   TCSVVN  326



>ref|XP_009802836.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=331

 Score =   335 bits (858),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRL FHDCFVRGCDGS+LL+  S
Sbjct  25    AQLQLNFYSKSCPKAEKIIQDYVQKHIPNTPSLAAALLRLQFHDCFVRGCDGSVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T  K EK A PN ++ GF  ID++K  +EAECPGVVSCADIVAL +RDSV        W
Sbjct  85    STKKKTEKVAIPNQTLRGFSFIDDVKKIVEAECPGVVSCADIVALVSRDSVVVT-GGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDGRIS ASEAL+N+P P SNFS+L   FASKGL + DLV+LSG HTIG+ HC+
Sbjct  144   NVPTGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGSS+ FD  YF +
Sbjct  204   SFSTRLYNFTGVLGKQDPSLDSEYAAYLKAKKCKSINDNTTIVEMDPGSSRTFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++++V      F   FAK+MEKMG+I+V TG++GE+R
Sbjct  264   LLKRKGLFQSDAALTTSATTKSYINQLVQGSLKQFNAEFAKAMEKMGSIEVKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C   N+
Sbjct  324   KQCAFVNN  331



>emb|CDP20341.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 207/305 (68%), Gaps = 3/305 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+  FYKK CP  E  V+ +     S  P L A  LR+HFHDCFVRGCDGS+LL+
Sbjct  24    CNAKGLKLDFYKKTCPGAEATVKHMMTGFMSRAPTLAASFLRMHFHDCFVRGCDGSVLLN  83

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST  +K+EK A PN ++ G +VID IK+A+E +CPGVVSCADI+AL ARD+VS       
Sbjct  84    STRKSKSEKDAIPNQTLRGLQVIDTIKSALEKKCPGVVSCADILALVARDAVSL-LNGPF  142

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP+GRRDGR+S  +EAL+NLP PF+N + L   FA+KGL   DL +LSGGHTIG  HC
Sbjct  143   WIVPLGRRDGRVSLMNEALANLPPPFANITELKASFAAKGLNTKDLAVLSGGHTIGNAHC  202

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILK  831
              +FS+RLYNFTGKGD DPSL+P Y   L+ KCK  + T+ VEM PG+ + FD DY+ ++ 
Sbjct  203   FVFSSRLYNFTGKGDTDPSLDPKYIPFLKKKCKPEDVTTLVEMTPGNFKSFDEDYYTLIT  262

Query  832   QKMGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             +  GLF SDAALL D   R  V          FF+ FA SM K+G + VLTG +GE+R++
Sbjct  263   KGRGLFQSDAALLDDRQTRAYVKLQATTHGSTFFRDFAASMVKLGKVGVLTGKAGEIRRH  322

Query  1006  CRVPN  1020
             C + N
Sbjct  323   CALVN  327



>gb|KFK31897.1| hypothetical protein AALP_AA6G173300 [Arabis alpina]
Length=326

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 216/306 (71%), Gaps = 8/306 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+S+  Q   + P L A L+R+HFHDCFVRGCDGSIL+++T+
Sbjct  23    AQLKMGFYDKTCPNAEKIVQSVVNQHIQNVPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              N+  EK A PNL+V GF+ ID +K  +E++CPG+VSCADI+ LA RDS++       WS
Sbjct  83    RNQQVEKVAPPNLTVRGFDFIDLVKFVLESKCPGIVSCADIITLATRDSIA-AIGGPTWS  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS A+EA +N+P PF NF+TL+  F ++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNATEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YA  L+T +C +L D T+ VEMDPGS   FD  YF ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYAANLKTRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMV---DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAAL  +  A   V +     +QD FF  FAKSMEKMG I V TG+ GE+R+
Sbjct  262   KRRGLFESDAALTMNSEALSQVRRFARGSEQD-FFAEFAKSMEKMGRIGVQTGSDGEIRR  320

Query  1003  NCRVPN  1020
              C V N
Sbjct  321   TCSVVN  326



>ref|XP_009342265.1| PREDICTED: peroxidase 3-like [Pyrus x bretschneideri]
Length=325

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/304 (54%), Positives = 211/304 (69%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P L A LLRLHFHDCFVRGCD S+LL+ST+
Sbjct  23    AQLQLGFYAKNCPKAEKIVKDYVEKHIHNAPSLAAALLRLHFHDCFVRGCDASVLLNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A+PNL++ GF+ ID IK+ +EA+CPG+VSCAD+VALAARDS+        W V
Sbjct  83    SNQAEKDASPNLTLRGFDFIDRIKSRLEAQCPGIVSCADVVALAARDSI-VATGGPTWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG I++A+EA++NLP P  N S L + FA+ GL + DLV+LSG HTIG+ HC  F
Sbjct  142   PTGRRDGVIARAAEAVANLPQPTYNVSNLQRFFANVGLDLKDLVLLSGAHTIGISHCTSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQK  837
             SNRLYNFTG GDQDP+LN  YA  L+ KCK   D T+ VEMDPGS + FD  Y+  + ++
Sbjct  202   SNRLYNFTGVGDQDPALNTQYAAKLKAKCKTPTDNTTIVEMDPGSFRTFDRSYYTHILKR  261

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
               LF SDAAL T       +D++++     F+  F KSMEKMG   V TG++GE+RK C 
Sbjct  262   RALFQSDAALATSPTTYNYIDQLLEGSLQNFYDEFGKSMEKMGRANVKTGSAGEIRKQCS  321

Query  1012  VPNS  1023
             V NS
Sbjct  322   VVNS  325



>ref|XP_010475209.1| PREDICTED: peroxidase 3 [Camelina sativa]
Length=326

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  I+ IKA +EA+CPG+VSCADI+ALA+RD++ +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS +SEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNSSEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG+GDQDP+L+  YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   SNRLYNFTGRGDQDPALDSEYAANLKSRKCLSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_002889542.1| CBRCI35 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65801.1| CBRCI35 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANSCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  ID IKA +EA+CPG+VSCADI+ALA+RD+V +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIDAIKAVLEAQCPGIVSCADIIALASRDAVVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SN + L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNF+G+GDQDP+L+ +YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFSGRGDQDPALDSAYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_006305430.1| hypothetical protein CARUB_v10009829mg [Capsella rubella]
 gb|EOA38328.1| hypothetical protein CARUB_v10009829mg [Capsella rubella]
Length=309

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  7     AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  66

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  ID IKA +EA+CPG+VSCADI+ALA+RD++ +      W+V
Sbjct  67    GN-AERDATPNLTVRGFGFIDAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WNV  124

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  125   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  184

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  185   TNRLYNFTGRGDQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  244

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      F+  FAKSMEKMG I V TG++G VR+ C
Sbjct  245   RRGLFQSDSALTTNPTTLSNINRILTGSVESFYSEFAKSMEKMGRINVKTGSAGVVRRQC  304

Query  1009  RVPNS  1023
              V NS
Sbjct  305   SVANS  309



>ref|XP_008341973.1| PREDICTED: peroxidase 3-like [Malus domestica]
Length=325

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 213/305 (70%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P L A LLRLHFHDCFVRGCD S+LL+ST+
Sbjct  23    AQLQLGFYAKNCPNAEKIVKDYVGEHIHNAPSLAAALLRLHFHDCFVRGCDASVLLNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A PNLS+ GF+ ID IK+ +EA+CPG+VSCAD+VAL ARDS+        W V
Sbjct  83    SNQAEKDAPPNLSLRGFDFIDRIKSQLEAQCPGIVSCADVVALVARDSI-VATGGPTWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG I++++EA++NLP P SNFS L   FA+ GL   DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGMIARSAEAIANLPPPTSNFSNLQSLFANVGLDWKDLVLLSGAHTIGISHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVILKQK  837
             SNRLYNFTG GDQDP L   YA  L+ KCK   D T+ VEMDPGS + FD  Y+  L ++
Sbjct  202   SNRLYNFTGVGDQDPDLKTEYAAKLKAKCKTPTDNTTFVEMDPGSFRTFDLSYYTHLLKR  261

Query  838   MGLFPSDAALLTDYHARKIVDKMVD---QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              GLF SDAAL T   A   +++++    Q+FF++ F KSMEKMG   V TG++GE+RK C
Sbjct  262   RGLFQSDAALKTSPKAYNYINQLLKGPLQNFFYE-FGKSMEKMGRANVKTGSAGEIRKQC  320

Query  1009  RVPNS  1023
              V NS
Sbjct  321   SVVNS  325



>ref|XP_010484852.1| PREDICTED: peroxidase 3-like [Camelina sativa]
Length=326

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  I+ IKA +EA+CPG+VSCADI+ALA+RD++ +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS +SEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNSSEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG+GDQDP+L+  YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   SNRLYNFTGRGDQDPALDSEYAANLKSRKCLSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G +R+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTGSAGVIRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_009786925.1| PREDICTED: peroxidase 3-like [Nicotiana sylvestris]
Length=331

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRL FHDCFVRGCD S+LL+  S
Sbjct  25    AQLQLNFYSKSCPKAEKIIQDYVQKHIPNAPSLAAALLRLQFHDCFVRGCDASVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PN ++ GF  ID++K A+EAECPGVVSCADIVAL +RDSV        W
Sbjct  85    STKNQTEKVAIPNQTLRGFSFIDDVKKAVEAECPGVVSCADIVALVSRDSVVVT-GGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDG+IS ASEAL+N+P P SNFS+L   FASKGL + DLV+LSG HTIG+ HC+
Sbjct  144   NVPTGRRDGKISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ +EMDPGSS  FD  YF +
Sbjct  204   SFSTRLYNFTGVLGKQDPSLDSEYAAYLKAKKCKSINDNTTIIEMDPGSSSAFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++++V      F   FAK+MEKMG+I+V TG++GE+R
Sbjct  264   LLKRKGLFQSDAALTTSATTKSYINQLVQGSLKQFNAEFAKAMEKMGSIEVKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C   NS
Sbjct  324   KQCAFVNS  331



>ref|XP_008804375.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=325

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 217/308 (70%), Gaps = 5/308 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C ++ L+  FY + CP  E+I+     +     P L A LLR+HFHDCFV GCD SIL++
Sbjct  19    CASADLKLGFYDESCPKAEKIIFDYVKKHIPHEPSLAAPLLRMHFHDCFVGGCDASILMN  78

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST+ N+AEK+A PNLS+ GF+ ID +K  IEAECPGVVSCADI+AL ARDSV        
Sbjct  79    STSKNQAEKSAFPNLSLRGFDFIDRVKTLIEAECPGVVSCADILALVARDSVIVT-GGPF  137

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W+VP GRRDG IS + E L NLP+P  NFS L   FASKGL + DLV+LSG HTIG+ HC
Sbjct  138   WNVPTGRRDGLISNSIEVLKNLPAPTFNFSILQTSFASKGLSLKDLVLLSGAHTIGVSHC  197

Query  652   NLFSNRLYNFTGKGDQDPSLNPSY-ADMLRTKCKNLNDTSP-VEMDPGSSQDFDTDYFVI  825
             + FS+RLYNFTGKGD+DPSL+  Y A++ + KC+  NDT+  VEMDPGS + FD  Y+  
Sbjct  198   SSFSSRLYNFTGKGDEDPSLDSFYAANLKKYKCQVPNDTTTIVEMDPGSFRTFDLGYYKH  257

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL+T+   +  + ++V+   + FFK FA SMEKMG I+V TG+ GE+R
Sbjct  258   LLKRRGLFQSDAALITNAATKAYIIQLVNNPLEVFFKEFALSMEKMGRIEVKTGSLGEIR  317

Query  1000  KNCRVPNS  1023
             KNC V NS
Sbjct  318   KNCAVVNS  325



>ref|XP_006396925.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
 gb|ESQ38378.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
Length=326

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 218/306 (71%), Gaps = 8/306 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+++  Q   + P L A L+R+HFHDCFVRGCDGSIL+++T+
Sbjct  23    AQLKIGFYDKTCPNAEKIVQNLVNQHIGNVPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              N+  EK + PNL+V GF+ ID +K  +E++CPG+VSCADI+ LA RDSV+       WS
Sbjct  83    RNQQVEKVSPPNLTVRGFDFIDLVKKVLESKCPGIVSCADIITLATRDSVA-AIGGPTWS  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS A+E+L+N+P PF NF+TL+  F ++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNANESLNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YAD L+  +C +L D T+ VEMDPGS   FD  YF ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKARRCLSLADNTTKVEMDPGSRNTFDLSYFRLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMV---DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAAL  +  A  +V +     +QDFF + F KSMEKMG I V TG+ GE+R+
Sbjct  262   KRRGLFESDAALTMNSAALALVRRFAGGSEQDFFVE-FGKSMEKMGRIGVKTGSDGEIRR  320

Query  1003  NCRVPN  1020
              C V N
Sbjct  321   TCAVVN  326



>ref|XP_006356926.1| PREDICTED: peroxidase 56-like [Solanum tuberosum]
Length=337

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 213/306 (70%), Gaps = 4/306 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+  +Y+K CP  E IV   T    S  P L A LLR+HFHDCF+RGCDGS+LL+
Sbjct  33    CNAQGLKLGYYEKTCPGAEAIVEKTTSHYISRAPTLAAPLLRMHFHDCFIRGCDGSVLLN  92

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N AE  A PN S+ GF+VI+  K+ +E +CPGVVSCADI+AL ARD++S   K   
Sbjct  93    STKNNLAEIDAIPNQSLRGFQVIEAAKSELEQKCPGVVSCADILALVARDAISL-IKGPY  151

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W+VP+GRRDG++S   EAL NLP PF+N +TL  +FAS GL   DLV+LSGGHTIG  HC
Sbjct  152   WNVPLGRRDGKVSIMLEALFNLPPPFANITTLKAQFASVGLNAKDLVVLSGGHTIGNSHC  211

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDT-SPVEMDPGSSQDFDTDYFVIL  828
             + F++R+YNFTGKGD DP+++ +Y   L++KC ++ND  + VEMDPGS + FD  Y+ ++
Sbjct  212   SSFTSRIYNFTGKGDTDPTMDANYVARLKSKCTSINDVKTIVEMDPGSFKIFDGSYYSLV  271

Query  829   KQKMGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             +++ GLF SDAALL D   +  V    M     FFK FA+SMEKMG I VLTG +GE+RK
Sbjct  272   EKRRGLFQSDAALLDDNETKAYVKLQAMSHGSTFFKDFAESMEKMGRIGVLTGKAGEIRK  331

Query  1003  NCRVPN  1020
              C   N
Sbjct  332   RCSFIN  337



>ref|XP_007215666.1| hypothetical protein PRUPE_ppa008540mg [Prunus persica]
 gb|EMJ16865.1| hypothetical protein PRUPE_ppa008540mg [Prunus persica]
Length=327

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 213/305 (70%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P + A L+R+HFHDCFVRGCD S+LL+ST+
Sbjct  24    AQLQLGFYAKNCPKAEKIVKDFVDEHIHNAPSVAAALIRMHFHDCFVRGCDASVLLNSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A PNL++ GF  ID IK  +EAECPGVVSCAD +ALAARDS+        W V
Sbjct  84    SNQAEKVAPPNLTLRGFNFIDRIKTLLEAECPGVVSCADAIALAARDSI-VATGGPFWKV  142

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS+ +EAL+N+P+P SNF+TL   F + GL + DLV+LSG HTIG+ HC+ F
Sbjct  143   PTGRRDGVISRRAEALANIPAPTSNFTTLQTSFGNLGLDLMDLVLLSGAHTIGISHCSSF  202

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GDQDP+L+  YA  L+  KCK+  D T+ VEMDPGS + FD  Y+ +L +
Sbjct  203   SNRLYNFTGVGDQDPALDKQYAANLKANKCKSSTDNTTIVEMDPGSHRTFDLSYYTLLLK  262

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL T       +++++      F+  FAKSMEKMG + V TG++GE+RK C
Sbjct  263   RRGLFQSDAALTTSSTTLNYINQLLKGPLQNFYDEFAKSMEKMGRVNVKTGSAGEIRKQC  322

Query  1009  RVPNS  1023
              V NS
Sbjct  323   AVVNS  327



>ref|XP_009624291.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=333

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRL FHDCFVRGCD S+LL+  S
Sbjct  25    AQLQLNFYAKSCPKAEKIIQDYVQKHIPNAPSLAAALLRLQFHDCFVRGCDASVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PN ++ GF  ID++K A+EAECPG+VSCADIVAL +RDSV        W
Sbjct  85    STKNQTEKVAIPNQTLRGFSFIDDVKKAVEAECPGIVSCADIVALVSRDSVVVT-GGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDGRIS ASEAL+N+P P S+FS+L   FASKGL + DLV+LSG HTIG+ HC+
Sbjct  144   NVPTGRRDGRISNASEALANIPPPTSHFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGSS  FD  YF +
Sbjct  204   SFSTRLYNFTGVLGTQDPSLDSEYAANLKAKKCKSINDNTTIVEMDPGSSSTFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++K+V      F   FAK+MEKMG+I+V TG++GE+R
Sbjct  264   LLKRKGLFQSDAALTTSATTKSYINKLVQGSLKQFNAEFAKAMEKMGSIEVKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C   NS
Sbjct  324   KQCAFVNS  331



>ref|XP_009624293.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=331

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRL FHDCFVRGCD S+LL+  S
Sbjct  25    AQLQLNFYAKSCPKAEKIIQDYVQKHIPNAPSLAAALLRLQFHDCFVRGCDASVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PN ++ GF  ID++K A+EAECPG+VSCADIVAL +RDSV        W
Sbjct  85    STKNQTEKVAIPNQTLRGFSFIDDVKKAVEAECPGIVSCADIVALVSRDSVVVT-GGPYW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDGRIS ASEAL+N+P P SNFS+L   FASKGL + DLV+LSG HTIG+ HC+
Sbjct  144   NVPTGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGSS  FD  YF +
Sbjct  204   SFSTRLYNFTGVLGKQDPSLDSEYAANLKAKKCKSINDNTTIVEMDPGSSSTFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++++V      F   FAK+MEKMG+I+V TG++GE+R
Sbjct  264   LLKRKGLFQSDAALTTSATTKSYINQLVQGSLKQFNAEFAKAMEKMGSIEVKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C   N+
Sbjct  324   KQCAFVNN  331



>ref|XP_009353255.1| PREDICTED: peroxidase 3 [Pyrus x bretschneideri]
Length=326

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 212/305 (70%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P L A L+RLHFHDCFVRGCD S+LL+ST+
Sbjct  23    AKLQLGFYSKNCPKAEKIVKDYVEEHIHNAPSLAAALIRLHFHDCFVRGCDASVLLNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A PNL++ GF+ ID IK+ +EA+C  VVSCAD++ALAARDS+        W V
Sbjct  83    SNQAEKDAPPNLTLRGFDFIDRIKSRLEAQCTSVVSCADVIALAARDSI-VATGGPTWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG I++ +EAL+N+P PFSN STL + FA+ GL + DLV+LSG HTIG+ HC  F
Sbjct  142   PTGRRDGVIARRAEALANIPIPFSNLSTLQRTFANVGLDLKDLVLLSGAHTIGVSHCPSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GDQDP+L P YA  L+  KCK   D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNFTGVGDQDPALTPQYAANLKANKCKTPTDNTTIVEMDPGSFRTFDRSYYTLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL T       +++++      F+  F KSMEKMG I V TG++GE+RK C
Sbjct  262   RRGLFESDAALTTSSTTLNYINRLLKGSLQNFYDEFGKSMEKMGRINVKTGSAGEIRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVVNS  326



>gb|EEE54612.1| hypothetical protein OsJ_01847 [Oryza sativa Japonica Group]
Length=269

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/270 (61%), Positives = 202/270 (75%), Gaps = 9/270 (3%)
 Frame = +1

Query  238   LHFHDCFVRGCDGSILLDSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCAD  417
             + FHDCFVRGCD S+LLDS  SN AEK AAPNLS+AGFEVI+E+KAA+E EC GVVSCAD
Sbjct  1     MFFHDCFVRGCDASVLLDSA-SNTAEKNAAPNLSLAGFEVIEEVKAAVERECAGVVSCAD  59

Query  418   IVALAARDSVSYQFKKKMWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLG  597
             IVALAARDSVSYQ+++ +W V  GRRDG +S   EAL+++P+P S F  L+  F++KGLG
Sbjct  60    IVALAARDSVSYQYRRSLWEVETGRRDGTVSSDQEALADIPAPTSTFPILLANFSAKGLG  119

Query  598   VHDLVILSGGHTIGMGHCNLFSNRLYNFTGKG---DQDPSLNPSYADMLRTKCK----NL  756
             + DLV+LSGGHTIG+GHCNLFS+RL+NFTGK    D DPSLNPSYA  L+ +C+    + 
Sbjct  120   LQDLVVLSGGHTIGIGHCNLFSSRLFNFTGKNNPSDVDPSLNPSYARFLQGQCRRNQQDP  179

Query  757   NDTSP-VEMDPGSSQDFDTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKS  933
             ND S  V MDPGSS  FD+ YFV LK + G+F SDA LLTD  A  +VDK+ D   F   
Sbjct  180   NDNSTVVPMDPGSSVSFDSHYFVNLKARQGMFTSDATLLTDGRAAALVDKLRDPGVFLDH  239

Query  934   FAKSMEKMGAIQVLTGNSGEVRKNCRVPNS  1023
             F  S+++MG I VLTG +G++RK C   NS
Sbjct  240   FKNSIKRMGQIGVLTGAAGQIRKRCNAVNS  269



>ref|XP_010908222.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=326

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 219/307 (71%), Gaps = 5/307 (2%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C  + L+  FY K CP  E+ +     +     P L + LLR+HFHDCFVRGCDGS+L++
Sbjct  20    CVKADLQLGFYDKSCPKAEQTISDFVKEHIPHAPTLASPLLRMHFHDCFVRGCDGSVLIN  79

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST++N+AEKAA PNL++ GF+ ID +K+ +E ECPGVVSCADI+AL ARD+V        
Sbjct  80    STSNNQAEKAATPNLTLRGFDFIDRVKSLVEKECPGVVSCADILALVARDAVGV-IGGPF  138

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W VP GRRDG IS ++EAL+N+P+P  NFS L   FA+KGL V DL+ LSG HTIG+ HC
Sbjct  139   WRVPTGRRDGTISNSTEALNNIPAPTFNFSALQTSFANKGLSVADLIWLSGAHTIGISHC  198

Query  652   NLFSNRLYNFTGKGDQDPSLNPSY-ADMLRTKCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
             + FS+RLYNFTGKG QDPSL+  Y A++ + KCK+ ND TS  EMDPGS + FD  Y+  
Sbjct  199   SSFSSRLYNFTGKGGQDPSLDSFYAANLKKNKCKSPNDNTSIAEMDPGSFRTFDLGYYKN  258

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVR  999
             + ++ GLF SDAAL+T+  ++  +  +V+   + FF+ FA SMEKMG I+VLTG++GE+R
Sbjct  259   VLKRRGLFQSDAALITNAASKSAILNIVNSPPEVFFQVFAASMEKMGRIEVLTGSAGEIR  318

Query  1000  KNCRVPN  1020
             K+C V N
Sbjct  319   KHCAVVN  325



>ref|XP_009117679.1| PREDICTED: peroxidase 27-like [Brassica rapa]
Length=319

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 205/301 (68%), Gaps = 4/301 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY K CP+ E IVR + +      P L A LLR+ FHDCFVRGCDGS+LLDS+
Sbjct  23    AQGLKVGFYSKTCPHAEGIVRKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSS  82

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PNLS+ GF +ID+ KAA+E  CPG+VSC+DI+AL ARD++    +   W 
Sbjct  83    -NNQAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALIARDAM-VALEGPSWE  140

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDGR S  +E   NLPSPF N + L+  F +KGL   DLVILSGGHTIGMGHC L
Sbjct  141   VETGRRDGRGSNINEV--NLPSPFDNIAKLIIDFRTKGLSEKDLVILSGGHTIGMGHCPL  198

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              +NRLYNFTG+GD DPSL+  YA  LR KCK  + T+ +EMDPGS + FD  YF ++ ++
Sbjct  199   MTNRLYNFTGRGDSDPSLDSEYAANLRKKCKPTDTTTALEMDPGSFKTFDVSYFKLVAKR  258

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
              GLF SDAALL +   R  V +      FF  F  SM KMG I VLTG +GE+RK CRVP
Sbjct  259   RGLFQSDAALLDNSKTRAYVLQQARGSTFFHDFGVSMVKMGRIGVLTGRTGEIRKMCRVP  318

Query  1018  N  1020
             N
Sbjct  319   N  319



>ref|XP_009147405.1| PREDICTED: peroxidase 27 [Brassica rapa]
Length=319

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 205/301 (68%), Gaps = 4/301 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY K CP+ E IV+ + +      P L A LLR+ FHDCFVRGCDGS+LLDS+
Sbjct  23    AQGLKVGFYSKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSS  82

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PNLS+ GF +ID+ KAA+E  CPG+VSC+DI+AL ARD++    +   W 
Sbjct  83    -NNQAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAM-VALEGPTWE  140

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDGR+S  +E   NLPSPF N + L+  F +KGL   DLV+LSGGHTIGMGHC L
Sbjct  141   VETGRRDGRVSNINEV--NLPSPFDNIAKLITDFRTKGLNEKDLVVLSGGHTIGMGHCPL  198

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTG+GD DPSL+  YA  LR KCK  + T+ +EMDPGS + FD  YF ++ ++
Sbjct  199   MSNRLYNFTGRGDSDPSLDSEYATNLRKKCKPTDTTTALEMDPGSFKTFDVSYFKLVAKR  258

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
              GLF SDAALL +   R  V +      FF  F  SM KMG   VLTG +GE+RK CRVP
Sbjct  259   RGLFQSDAALLDNSKTRAHVLEQARGSTFFHDFGVSMVKMGRTGVLTGRAGEIRKMCRVP  318

Query  1018  N  1020
             N
Sbjct  319   N  319



>emb|CDY37537.1| BnaA05g34020D [Brassica napus]
Length=319

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 205/301 (68%), Gaps = 4/301 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY K CP+ E IV+ + +      P L A LLR+ FHDCFVRGCDGS+LLDS+
Sbjct  23    AQGLKVGFYSKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSS  82

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +N+AEK A PNLS+ GF +ID+ KAA+E  CPG+VSC+DI+AL ARD++    +   W 
Sbjct  83    -NNQAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAM-VALEGPTWE  140

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDGR+S  +E   NLPSPF N + L+  F +KGL   DLV+LSGGHTIGMGHC L
Sbjct  141   VETGRRDGRVSNINEV--NLPSPFDNIAKLITDFRTKGLNEKDLVVLSGGHTIGMGHCPL  198

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              SNRLYNFTG+GD DPSL+  YA  LR KCK  + T+ +EMDPGS + FD  YF ++ ++
Sbjct  199   MSNRLYNFTGRGDSDPSLDSEYATNLRKKCKPTDTTTALEMDPGSFKTFDVSYFKLVAKR  258

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
              GLF SDAALL +   R  V +      FF  F  SM KMG   VLTG +GE+RK CRVP
Sbjct  259   RGLFQSDAALLDNSKTRAHVLEQARGSTFFHDFGVSMVKMGRTGVLTGRAGEIRKMCRVP  318

Query  1018  N  1020
             N
Sbjct  319   N  319



>ref|NP_001289850.1| peroxidase 3 precursor [Solanum lycopersicum]
 gb|AAA65637.1| peroxidase [Solanum lycopersicum]
Length=328

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + LE +FY K CP  E+I++    Q+    P   A +LR+HFHDCFVRGCDGS+LL+  S
Sbjct  22    AQLELNFYAKSCPKAEKIIKDFVQQQVPKAPNTAAAILRMHFHDCFVRGCDGSVLLNFTS  81

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             T  N+ EK A PNL++ GF  ID +K  +EAECPGVVSCADIVAL ARD+V    +   W
Sbjct  82    TNGNQTEKLANPNLTLRGFSFIDAVKRLVEAECPGVVSCADIVALVARDAVVAT-EGPFW  140

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDG IS  SEA  ++P+P SNF+ L Q FA KGL ++DLV+LSG HTIG+  C+
Sbjct  141   NVPTGRRDGTISNVSEANGDIPAPTSNFTRLQQSFAKKGLDLNDLVLLSGAHTIGVSRCS  200

Query  655   LFSNRLYNFTG-KGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YAD L++ KC+++ND T+ VEMDPGS + FD  YF +
Sbjct  201   SFSERLYNFTGVVGTQDPSLDSEYADNLKSRKCRSINDNTTIVEMDPGSFKTFDLSYFKL  260

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++++VD     FF  FAKSMEKMG ++V TG++GE+R
Sbjct  261   LLKRRGLFQSDAALTTRTSTKSFIEQLVDGPLNEFFDEFAKSMEKMGRVEVKTGSAGEIR  320

Query  1000  KNCRVPNS  1023
             K+C   NS
Sbjct  321   KHCAFVNS  328



>ref|XP_006357954.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=331

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 215/307 (70%), Gaps = 8/307 (3%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--ST  297
              L+ +FY K CP  E+I++    ++  + P L A LLRLHFHDCFVRGCDGS+LL+  S+
Sbjct  26    QLQLNFYAKSCPQAEKIIQDYVQKQIPNAPSLAAALLRLHFHDCFVRGCDGSVLLNFTSS  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             T N+ EK A PN ++ GF  ID +K A+EAECPGVVSCADIVAL ARDSV        W 
Sbjct  86    TKNQTEKVAVPNQTLRGFSFIDGVKKALEAECPGVVSCADIVALVARDSVVVT-GGPYWK  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS ASEAL+N+P P SNFS+L   FASKGL + DLV+LSG HTIG+ HC  
Sbjct  145   VPTGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPS  204

Query  658   FSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             FS+RLYNFTG  G +DPSL+  YA  L+  KCK++ND T+ VEMDPGSS  FD  YF ++
Sbjct  205   FSSRLYNFTGVWGKKDPSLDTEYASNLKMKKCKSINDNTTIVEMDPGSSSKFDLSYFQLV  264

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              ++ GLF SDAAL T    +  ++++V      F+  F  +MEKMG I+V TG++GE+RK
Sbjct  265   LKRKGLFQSDAALTTSATTKSFINELVKGSLKQFYAEFGVAMEKMGKIEVKTGSAGEIRK  324

Query  1003  NCRVPNS  1023
             +C   N+
Sbjct  325   HCAAVNT  331



>ref|XP_010557013.1| PREDICTED: peroxidase 2-like [Tarenaya hassleriana]
Length=323

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 207/300 (69%), Gaps = 4/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L   +Y+ +CP  E IV+ +T+Q  S  P L A LLR+HFHDCFVRGCDGS+LL S   +
Sbjct  26    LRLDYYRSKCPDAEAIVQRVTYQYVSRQPSLAASLLRMHFHDCFVRGCDGSVLLKSPNKD  85

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AE+ A PNLS+ G+EV+D  K+A++ +CPG+VSCAD++AL ARD+VS   +   W VP+
Sbjct  86    -AERDAIPNLSLRGYEVVDAAKSALDKKCPGLVSCADVLALVARDAVSV-IRGPFWPVPL  143

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S ASE   NLPSPF+N + L Q F +KGL   DL +LSGGHTIG+ HC++  N
Sbjct  144   GRRDGRVSSASEVFLNLPSPFANIAVLKQNFLAKGLNAKDLAVLSGGHTIGISHCSIIHN  203

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             R+YNFTGKGD DP++NPSY   L+ +C   + T+ V+MDPGS + FD+ YF ++ QK GL
Sbjct  204   RIYNFTGKGDSDPTMNPSYVRTLKKRCNPNDFTTIVDMDPGSGKTFDSHYFNVVAQKKGL  263

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDA LL D   +  V   V      F K FA+SM K+G+  VLTG +GE+RK C   N
Sbjct  264   FTSDATLLDDPETKTYVQTQVSTGGSSFAKDFAESMVKLGSTGVLTGKAGEIRKKCAFVN  323



>ref|XP_009353257.1| PREDICTED: peroxidase 27-like [Pyrus x bretschneideri]
Length=327

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 203/303 (67%), Gaps = 3/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY K CP +E IV   T Q  S  P L A +LR+HFHDCFVRGCDGS+LL+ST
Sbjct  26    AQKLKVGFYCKTCPDLEAIVSRTTHQYISRAPTLAAPILRMHFHDCFVRGCDGSVLLNST  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              +++AEK A PN S+ GF+VID +K+A+E +CPGVVSCADI+AL  RD+V        W 
Sbjct  86    PNSQAEKGAVPNQSLRGFDVIDAVKSAVEKKCPGVVSCADILALVTRDAVR-MVHGSFWE  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGR+S ASEA   LP PF+N + L   FA+KGL   DL +LSGGHTIG  HC  
Sbjct  145   VPTGRRDGRVSLASEANRGLPPPFANITQLKALFAAKGLSAKDLAVLSGGHTIGTSHCPS  204

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             F+NRLYNFTGKGD DP L+ +Y   L+TKCK  + TS VEMDPGS + FD DY+ ++ ++
Sbjct  205   FTNRLYNFTGKGDTDPKLDKNYIAQLKTKCKPGDTTSRVEMDPGSFKTFDEDYYTLVAKR  264

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SD+ALL D   +  V K        F   F  SM  MG I VLTGN+GE+RK+C 
Sbjct  265   RGLFQSDSALLDDTETKAYVTKQATTRGSTFLTDFGVSMVNMGNIGVLTGNNGEIRKHCA  324

Query  1012  VPN  1020
               N
Sbjct  325   FVN  327



>ref|XP_010457608.1| PREDICTED: peroxidase 3-like [Camelina sativa]
Length=326

 Score =   332 bits (851),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 218/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPSAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  I+ IK  +EA+CPG+VSCADI+ALA+RD++ +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS +SEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNSSEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG+GDQDP+L+  YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   SNRLYNFTGRGDQDPALDSEYAANLKSRKCLSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_006447517.1| hypothetical protein CICLE_v10017908mg [Citrus clementina]
 ref|XP_006469708.1| PREDICTED: peroxidase 27-like [Citrus sinensis]
 gb|ESR60757.1| hypothetical protein CICLE_v10017908mg [Citrus clementina]
Length=328

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 208/300 (69%), Gaps = 4/300 (1%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY+K CP  E I R IT Q  S  P L A LLR+HFHDCF+RGCDGS+LL+ST +N
Sbjct  31    LKLGFYQKTCPDAEAITRKITHQHISRAPTLAAPLLRMHFHDCFIRGCDGSVLLNSTKNN  90

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A  NLS+ G++VID +K+A+E +CPGVVSCADI+AL  RD+VS   K   W VP 
Sbjct  91    QAEKDAFANLSLRGYQVIDAVKSALENKCPGVVSCADILALVTRDAVS-MIKGPFWDVPT  149

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR S ASE   +LP PF N + L Q+FA+KGL V DLV+LSG HTIG  HC+ F  
Sbjct  150   GRRDGRESVASET-RDLPPPFGNITLLKQKFAAKGLSVKDLVVLSGAHTIGTSHCSSFET  208

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+L+P+Y   L+ KC+  + T+ V+MDPGS + FD DY+ ++ ++ GL
Sbjct  209   RLYNFTGKGDTDPTLDPNYVVHLKRKCQPGDTTTLVKMDPGSFRTFDGDYYTLVAKRRGL  268

Query  847   FPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             F SDAALL D   +  V    +     F K FA+SM  MG I VLTG +GE+RK+C   N
Sbjct  269   FQSDAALLEDTETKSYVKLQANTYGSTFAKDFAESMVNMGKIGVLTGKAGEIRKHCAFVN  328



>ref|XP_009342252.1| PREDICTED: peroxidase 3 [Pyrus x bretschneideri]
Length=326

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 213/305 (70%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P L A L+RLHFHDCFVRGCD S+LL+ST+
Sbjct  23    AQLQLGFYAKNCPKAEKIVKDYVEEHIHNAPSLAAALIRLHFHDCFVRGCDASVLLNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A PNL++ GF+ ID IK+ +EA+CPG+VSCAD++ALAARDS+        W V
Sbjct  83    SNQAEKDAPPNLTLRGFDFIDRIKSRLEAQCPGIVSCADVIALAARDSI-VATGGPTWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG I++ +EAL+N+P P SNFS L + FA+ GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGVIARRAEALANIPPPTSNFSNLQRIFANVGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GDQDP+LN  YA  L+  KCK   D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNFTGVGDQDPALNTQYAANLKANKCKTPTDNTTIVEMDPGSVRTFDLSYYTLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL T       +++++      F+  F KSMEKMG   V TG++GE+RK C
Sbjct  262   RRGLFQSDAALTTSSTTYNHINQLLKGSLQNFYDKFGKSMEKMGRANVKTGSAGEIRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVVNS  326



>ref|XP_008224769.1| PREDICTED: peroxidase 27 [Prunus mume]
Length=328

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 203/297 (68%), Gaps = 5/297 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L   FY K CP  E+IV+ + +Q  S+ P L A LLR+HFHDCFVRGC+GSILL+S+T N
Sbjct  30    LNVGFYAKSCPKAEDIVKKVIFQTISTTPSLAAPLLRMHFHDCFVRGCEGSILLNSST-N  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PNLS+ GF++ID+ K+A+E  CPGVVSCAD++A+ ARD VS       W+V  
Sbjct  89    QAEKDAVPNLSLRGFQIIDKAKSALEKACPGVVSCADVLAITARDVVS-ALNGAHWNVET  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  +EA  NL  P +N + L   FA KGL   DLV+LSGGHTIG  HC  FSN
Sbjct  148   GRRDGRVSNITEAFMNLLPPTANITILKAGFARKGLSAKDLVVLSGGHTIGTSHCTAFSN  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+L+P+Y   L+ KCK  +  + VEMDPGS + FD  YF ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPTLDPNYIARLKLKCKPNDQKTLVEMDPGSFKTFDQTYFTLVSKRRGL  267

Query  847   FPSDAALLTDYHARKIVDK---MVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             F SDAALL D   +  V      V +  FFK F  SM  MG I VLTGN+GE+RK C
Sbjct  268   FQSDAALLDDSETKAYVQSHAAAVGKSSFFKDFGVSMVNMGRIGVLTGNAGEIRKVC  324



>ref|XP_002889541.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65800.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=321

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 205/294 (70%), Gaps = 3/294 (1%)
 Frame = +1

Query  139   FYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNKAEK  318
             +Y+ +CP  E IVR +T Q  S  P L A LLR+HFHDCFVRGCDGS+LL  T  N AE+
Sbjct  31    YYQSKCPDAERIVRRVTEQYVSRKPSLAASLLRMHFHDCFVRGCDGSVLL-KTPKNDAER  89

Query  319   AAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMGRRD  498
              A PNL++ GFEV+D  K A+E +CP +VSCAD++AL ARD+V+   K   W VP+GRRD
Sbjct  90    NAIPNLTLRGFEVVDAAKTALEKKCPNLVSCADVLALVARDAVAV-IKGPWWPVPLGRRD  148

Query  499   GRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNRLYN  678
             GRIS+ ++AL NLPSPF++  TL + FA KGL   DLV+LSGGHTIG+  C L + R+YN
Sbjct  149   GRISKLTDALQNLPSPFADIKTLKKNFADKGLNAKDLVVLSGGHTIGISSCALVNTRIYN  208

Query  679   FTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPSD  858
             FTGKGD DPS+NPSY   L+ KC   +  S +EMDPGS++ FD  YF  + QK GLF SD
Sbjct  209   FTGKGDFDPSMNPSYVRALKKKCSPTDFKSVLEMDPGSAKKFDPHYFTAVAQKKGLFISD  268

Query  859   AALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             + LL D   +  V +  ++  F K F+ SM K+G +Q+LTG +GE+RK C  PN
Sbjct  269   STLLDDLETKLYV-QTANEVTFNKDFSDSMVKLGKVQILTGKNGEIRKRCAFPN  321



>ref|XP_004240142.1| PREDICTED: peroxidase 3-like [Solanum lycopersicum]
Length=327

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 217/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+++FY K CP  E+I+     +   + P L A L+R+HFHDCFVRGCD S+LL+ T+
Sbjct  21    AQLQQNFYAKSCPKAEKIILEYVHKHIPNAPSLAAALIRMHFHDCFVRGCDASVLLNFTS  80

Query  301   SN--KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             S+  + EK   PNL++ GF  ID+IK  IEAECPG+VSCADI++L ARDS+        W
Sbjct  81    SSGSQTEKVGIPNLTLRGFSFIDDIKKIIEAECPGIVSCADIISLVARDSIVV-IGGPFW  139

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDG IS ASE LS++PSPFSNFSTL   FA KGL + DLV+LSG HTIG+  C 
Sbjct  140   NVPTGRRDGTISIASETLSDIPSPFSNFSTLQNDFAKKGLDLKDLVLLSGAHTIGVSLCT  199

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FSNRLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGS + FD  Y+ +
Sbjct  200   SFSNRLYNFTGTFGTQDPSLDSEYAANLKANKCKSINDNTTIVEMDPGSFKTFDLSYYKL  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    ++ +D++V      F+  FA+SMEKMG I+V TG++GE+R
Sbjct  260   LLKRRGLFQSDAALTTSTTTKRYIDQLVAGSLKEFYVKFAQSMEKMGRIEVKTGSTGEIR  319

Query  1000  KNCRVPNS  1023
             K+C V NS
Sbjct  320   KHCAVVNS  327



>ref|XP_006372959.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|ERP50756.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
Length=321

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 217/304 (71%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY   CP  E+IV+    Q   + P L A L+R+HFHDCFVRGCD S+LL++T+
Sbjct  19    AQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDASVLLNTTS  78

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
               + EKAA PNL++ GF+ ID +K  +EAECPG+VSCADI+ L ARDS+        W V
Sbjct  79    GEQPEKAATPNLTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSI-VATGGPFWRV  137

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++SEALSN+PSP  NF+TL   FA++GL + DLV+LSG HTIG+ HC  F
Sbjct  138   PTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTIGIAHCQSF  197

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GD+DP+L+  YA  L+  KC++++D T+ VEMDPGS + FD  Y+ +L +
Sbjct  198   SNRLYNFTGTGDEDPALDSEYAANLKARKCRSISDNTTIVEMDPGSRKTFDLSYYKLLLK  257

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKS-FAKSMEKMGAIQVLTGNSGEVRKNCR  1011
             + GLF SDAAL T+ +   ++ +++     F+S F+KSMEKMG I+V TG++GE+R+ C 
Sbjct  258   RRGLFQSDAALTTNSNTLSMIRQILQGSIDFRSEFSKSMEKMGRIRVKTGSNGEIRRQCA  317

Query  1012  VPNS  1023
             + NS
Sbjct  318   LVNS  321



>ref|XP_006372960.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|ABK93506.1| unknown [Populus trichocarpa]
 gb|ERP50757.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|AHL39191.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 217/304 (71%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY   CP  E+IV+    Q   + P L A L+R+HFHDCFVRGCD S+LL++T+
Sbjct  23    AQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDASVLLNTTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
               + EKAA PNL++ GF+ ID +K  +EAECPG+VSCADI+ L ARDS+        W V
Sbjct  83    GEQPEKAATPNLTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSI-VATGGPFWRV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++SEALSN+PSP  NF+TL   FA++GL + DLV+LSG HTIG+ HC  F
Sbjct  142   PTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTIGIAHCQSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GD+DP+L+  YA  L+  KC++++D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNFTGTGDEDPALDSEYAANLKARKCRSISDNTTIVEMDPGSRKTFDLSYYKLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKS-FAKSMEKMGAIQVLTGNSGEVRKNCR  1011
             + GLF SDAAL T+ +   ++ +++     F+S F+KSMEKMG I+V TG++GE+R+ C 
Sbjct  262   RRGLFQSDAALTTNSNTLSMIRQILQGSIDFRSEFSKSMEKMGRIRVKTGSNGEIRRQCA  321

Query  1012  VPNS  1023
             + NS
Sbjct  322   LVNS  325



>ref|XP_006356924.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=327

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 214/308 (69%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+++FY K CP  E+I+     +   + P L A L+R+HFHDCFVRGCD S+LL+  S
Sbjct  21    AQLQQNFYAKSCPKAEKIILDYVHKHIPNAPSLAAALIRMHFHDCFVRGCDASVLLNFTS  80

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK   PNL++ GF  ID +K  IE ECPGVVSCADIVAL ARDSV        W
Sbjct  81    STGNQTEKFGIPNLTLRGFSFIDNVKKIIEDECPGVVSCADIVALVARDSVVVT-GGPSW  139

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             SVP GRRDGRIS ASE L+++P+P SNFSTL   FA KGL + DLV+LSG HTIG+ HC+
Sbjct  140   SVPTGRRDGRISNASETLTDIPAPTSNFSTLQNDFAKKGLDLKDLVLLSGAHTIGVSHCS  199

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGS + FD  Y+ +
Sbjct  200   SFSTRLYNFTGTFGTQDPSLDSEYATNLKANKCKSINDNTTIVEMDPGSFRTFDLSYYKL  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  +D++V      F+  FA+SMEKMG I+V TG+ GE+R
Sbjct  260   LLKRRGLFQSDAALTTSTTTKSYIDQLVAGSLKEFYAEFAQSMEKMGRIEVKTGSDGEIR  319

Query  1000  KNCRVPNS  1023
             K+C V NS
Sbjct  320   KHCAVVNS  327



>gb|KFK42864.1| hypothetical protein AALP_AA1G049000 [Arabis alpina]
Length=326

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/305 (53%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQTNFYANTCPNAEKIVQDYVSNHISNAPSLAASLLRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ + PNL++ GF  ID IKA +EA+CPG+VSCAD++ALA+RD+V +      WSV
Sbjct  84    GN-AERDSTPNLTLRGFGFIDAIKAVLEAQCPGIVSCADVIALASRDAVVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS+ASEAL+N+P P SN + L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISKASEALANIPPPTSNITNLQTLFANQGLNLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+G QDP+L+  YA  L++ KC  LND T+ VEMDPGS   FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGGQDPALDSEYAANLKSRKCPRLNDNTTIVEMDPGSRTTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINQILKGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>gb|AES67274.2| peroxidase family protein [Medicago truncatula]
Length=326

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 216/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + LE  FY K CP  E+IV +   +   + P L A L+R+HFHDCFVRGCD S+LL+ST 
Sbjct  24    AQLELGFYTKSCPKAEQIVANFVHEHIRNAPSLAAALIRMHFHDCFVRGCDASVLLNST-  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             + +AEK A PNL+V GF+ ID IK+ +EAECPGVVSCADI+AL+ARDS++       W V
Sbjct  83    NQQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCADIIALSARDSIAAT-GGPYWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG +S   EA  N+P+PFSNF+TL   FA++GL + DLV+LSG HTIG+  C  F
Sbjct  142   PTGRRDGVVSNLLEANQNIPAPFSNFTTLQTLFANQGLDMKDLVLLSGAHTIGISLCTSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTGKGDQDPSL+  YA  L+T KCKN+ND T+ VE+DPGS   FD  Y+  + +
Sbjct  202   SNRLYNFTGKGDQDPSLDSEYAKNLKTFKCKNINDNTTIVELDPGSRNTFDLGYYSQVVK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+ALLT+   + +V + +      F+  FAKS+EKMG I+V TG+ G +RK+C
Sbjct  262   RRGLFESDSALLTNSVTKALVTQFLQGSLENFYAEFAKSIEKMGQIKVKTGSQGVIRKHC  321

Query  1009  RVPNS  1023
              + N+
Sbjct  322   ALVNN  326



>ref|XP_003597023.1| Peroxidase [Medicago truncatula]
Length=350

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 216/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + LE  FY K CP  E+IV +   +   + P L A L+R+HFHDCFVRGCD S+LL+ST 
Sbjct  48    AQLELGFYTKSCPKAEQIVANFVHEHIRNAPSLAAALIRMHFHDCFVRGCDASVLLNST-  106

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             + +AEK A PNL+V GF+ ID IK+ +EAECPGVVSCADI+AL+ARDS++       W V
Sbjct  107   NQQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCADIIALSARDSIAAT-GGPYWKV  165

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG +S   EA  N+P+PFSNF+TL   FA++GL + DLV+LSG HTIG+  C  F
Sbjct  166   PTGRRDGVVSNLLEANQNIPAPFSNFTTLQTLFANQGLDMKDLVLLSGAHTIGISLCTSF  225

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTGKGDQDPSL+  YA  L+T KCKN+ND T+ VE+DPGS   FD  Y+  + +
Sbjct  226   SNRLYNFTGKGDQDPSLDSEYAKNLKTFKCKNINDNTTIVELDPGSRNTFDLGYYSQVVK  285

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+ALLT+   + +V + +      F+  FAKS+EKMG I+V TG+ G +RK+C
Sbjct  286   RRGLFESDSALLTNSVTKALVTQFLQGSLENFYAEFAKSIEKMGQIKVKTGSQGVIRKHC  345

Query  1009  RVPNS  1023
              + N+
Sbjct  346   ALVNN  350



>ref|XP_007213025.1| hypothetical protein PRUPE_ppa023088mg [Prunus persica]
 gb|EMJ14224.1| hypothetical protein PRUPE_ppa023088mg [Prunus persica]
Length=328

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 203/297 (68%), Gaps = 5/297 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L   FY K CP  E+IV+ + +Q  S+ P L A LLR+HFHDCFVRGC+GSILL+S+T N
Sbjct  30    LNVGFYAKSCPKAEDIVKKVIFQTISTTPSLAAPLLRMHFHDCFVRGCEGSILLNSST-N  88

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEK A PNLS+ GF++ID+ K+A+E  CPGVVSCAD++A+ ARD VS       W+V  
Sbjct  89    QAEKDAIPNLSLRGFQIIDKAKSALEKACPGVVSCADVLAITARDVVS-ALNGAHWNVET  147

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDGR+S  +EA  NL  P +N + L   FA KGL   DLV+LSGGHTIG  HC  FSN
Sbjct  148   GRRDGRVSNITEAFMNLLPPTANITILKAGFARKGLSAKDLVVLSGGHTIGTSHCTAFSN  207

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RLYNFTGKGD DP+L+P+Y   L+ KCK  +  + VEMDPGS + FD  YF ++ ++ GL
Sbjct  208   RLYNFTGKGDTDPTLDPNYIARLKLKCKPNDQKTLVEMDPGSFKTFDQTYFTLVSKRRGL  267

Query  847   FPSDAALLTDYHARKIVDK---MVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             F SDAALL D   +  V      V +  FFK F  SM  MG I VLTGN+GE+RK C
Sbjct  268   FQSDAALLDDSETKAYVQSHVAAVGKSSFFKDFGVSMVNMGRIGVLTGNAGEIRKVC  324



>emb|CDP20342.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 218/307 (71%), Gaps = 10/307 (3%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS-  303
             L+ +FY K CP  EEIV+    +   + P L A L+R+HFHDCFVRGCD SILL+ST+S 
Sbjct  25    LQLNFYAKTCPKAEEIVQDYVHEHIPNAPSLAATLIRMHFHDCFVRGCDASILLNSTSSS  84

Query  304   -NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N+ EKAA PN +V GF+ ID +K+ +EAECPGVVSCADI+AL ARDS+        W V
Sbjct  85    GNQTEKAATPNRTVRGFDFIDRVKSLLEAECPGVVSCADIIALVARDSIVVT-GGPYWRV  143

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS ASEAL+N+P P SNFS+L   F++KGL + DLV+LSG HTIG+ HC+ F
Sbjct  144   PTGRRDGLISNASEALANIPRPTSNFSSLQTNFSNKGLDLKDLVLLSGAHTIGIAHCSAF  203

Query  661   SNRLYNFTG-KGDQDPSLNPSYADMLRT-KCKNLNDTSP-VEMDPGSSQDFDTDYFVILK  831
             S+RLYNF+G  G+QDPSL+  YA  L+  KCK +NDT+  VEMDPGS + FD  Y+ +L 
Sbjct  204   SSRLYNFSGILGNQDPSLDSEYAANLKAKKCKTINDTTTIVEMDPGSFRTFDLSYYRLLL  263

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVD---QDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAAL T       +++++    QD F+K FA SMEKMG I V TG+SGE+RK
Sbjct  264   KRRGLFQSDAALTTSSTTLSYINELLQGSRQD-FYKEFALSMEKMGRIDVKTGSSGEIRK  322

Query  1003  NCRVPNS  1023
             +C   NS
Sbjct  323   HCAFVNS  329



>ref|XP_004240143.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=322

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 213/306 (70%), Gaps = 4/306 (1%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD  291
             C A  L+  +Y+K CP  E IV+ IT    S  P L A LLR+HFHDCFVRGCDGS+LL+
Sbjct  18    CNAQGLKLGYYQKTCPGAEAIVQKITSHYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLN  77

Query  292   STTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKM  471
             ST +N AE  A PN S+ GF+VI+  K+ +E +CP VVSCADI+AL ARD++S   K   
Sbjct  78    STKNNPAEIDAFPNQSLRGFQVIEAAKSELEQKCPDVVSCADILALVARDAISL-IKGPY  136

Query  472   WSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHC  651
             W+VP+GRRDG++S   EAL NLP PF+N +TL  +F+S GL   DLV+LSGGHTIG  HC
Sbjct  137   WNVPLGRRDGKVSIMLEALFNLPPPFANITTLKAQFSSVGLNAKDLVVLSGGHTIGNSHC  196

Query  652   NLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDT-SPVEMDPGSSQDFDTDYFVIL  828
             + F++R+YNFTGKGD DP+++ +Y   L++KC + ND  + VEMDPGS + FD  Y+ ++
Sbjct  197   SSFTSRIYNFTGKGDSDPTMDANYVARLKSKCTSNNDVKTIVEMDPGSFKTFDGSYYSLV  256

Query  829   KQKMGLFPSDAALLTDYHARKIV--DKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              ++ GLF SDAALL D   +  V    M     FFK FA+SMEKMG I VLTG +GE+RK
Sbjct  257   AKRRGLFQSDAALLDDNETKAYVKLQAMSHGSTFFKDFAESMEKMGRISVLTGKAGEIRK  316

Query  1003  NCRVPN  1020
             +C   N
Sbjct  317   HCSFIN  322



>ref|XP_009352323.1| PREDICTED: peroxidase 24-like [Pyrus x bretschneideri]
Length=331

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 204/301 (68%), Gaps = 5/301 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L   FY K CP +E IVR+ITW   + N  +  KLLR+H+HDCFVRGCD S+LLDS + N
Sbjct  33    LSPVFYDKSCPQIERIVRNITWSMVAENSTMAPKLLRMHYHDCFVRGCDASLLLDSISGN  92

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
              AEK A  N ++ G+EVIDEIK  +E ECPG+VSCADI+AL ARD+VSYQF + MW V  
Sbjct  93    PAEKEAIQNSNIRGYEVIDEIKTRLEEECPGIVSCADILALVARDAVSYQFGRPMWQVLT  152

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GR+DGR+S +SEA  NLPS  +NF+TL Q+F   GL + DLV LSG HTIG+ HC +F  
Sbjct  153   GRKDGRVSLSSEASINLPSAGANFTTLNQQFIGLGLNIIDLVALSGAHTIGVAHCAVFQR  212

Query  667   RLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGL  846
             RL N TGKGD DP+L+P Y + LRT+C   N    V +D  SS  FD+ YF  L+Q  GL
Sbjct  213   RL-NVTGKGDIDPTLDPEYGEFLRTQCT--NPGVAVALDANSSASFDSHYFAGLRQNKGL  269

Query  847   FPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLT--GNSGEVRKNCRVPN  1020
               SDAALLTD  +  IV +      F   F  SM+KMG+I V+T   + GE+RKNCRV N
Sbjct  270   LRSDAALLTDRRSSHIVRRFEKFPVFMTYFGNSMKKMGSIGVITREEDGGEIRKNCRVVN  329

Query  1021  S  1023
             +
Sbjct  330   A  330



>emb|CDY10038.1| BnaC08g44130D [Brassica napus]
Length=332

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 218/297 (73%), Gaps = 8/297 (3%)
 Frame = +1

Query  139   FYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNK-AE  315
             +Y+ +CP VE IVR +T+Q  S+NP L A LLR+HFHDCFV+GCDGSIL+  T+ NK AE
Sbjct  41    YYRSKCPQVEYIVRRVTYQYVSANPTLAAALLRMHFHDCFVKGCDGSILI--TSPNKDAE  98

Query  316   KAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMGRR  495
             + A PNLS+ GFEV++ +K+AIE+ECPGVVSCAD++AL ARD+V    +   W VP+GRR
Sbjct  99    RDAPPNLSLKGFEVVNAVKSAIESECPGVVSCADVLALVARDAV-LVIRGPWWPVPLGRR  157

Query  496   DGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNRLY  675
             DGRIS+ SEA  NLPSPF+N +TL + F+ KGL   DLV+LSG HTIG+  C L S R+Y
Sbjct  158   DGRISKISEA--NLPSPFANVATLKKNFSDKGLNTKDLVVLSGAHTIGVSSCGLISKRIY  215

Query  676   NFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPS  855
             NFTG+GD DP+++P+Y   L+ +C+  + T+ V+MDPGS   FD+ YF  + +K GLF S
Sbjct  216   NFTGRGDFDPAMDPNYVMQLKKRCQPTDVTTIVDMDPGSVNIFDSHYFDTVAEKKGLFIS  275

Query  856   DAALLTDYHARKIVDKMV-DQDFFF-KSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
             D+ALL D+  +  + K V    F F + F++SM K+G++Q+LTGN GE+R+ C + N
Sbjct  276   DSALLNDWETKFYIQKQVYTHGFTFNRDFSESMVKLGSVQILTGNQGEIRRRCDLVN  332



>ref|XP_011037007.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=325

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 218/304 (72%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY   CP  E+IV+    Q   + P L A L+R+HFHDCFVRGCD S+LL++T+
Sbjct  23    AQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDASVLLNTTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
               + E+AA PNL++ GF+ ID +K  +EAECPG+VSCADI+ L ARDS+        W V
Sbjct  83    GEQPERAATPNLTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSI-VATGGPYWRV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++SEALSN+PSP  NF+TL   FA++GL + DLV+LSG HTIG+ HC  F
Sbjct  142   PTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTIGIAHCQSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GD+DP+L+  YA  L+  KCK+++D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNFTGIGDEDPALDSEYAANLKARKCKSISDNTTIVEMDPGSRKTFDLSYYKLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKS-FAKSMEKMGAIQVLTGNSGEVRKNCR  1011
             + GLF SDAAL T+ +   ++ ++++    F+S F+KSMEKMG I+V TG++GE+R+ C 
Sbjct  262   RRGLFQSDAALTTNPNTLSMIRQLLEGSLDFRSEFSKSMEKMGRIRVKTGSNGEIRRQCA  321

Query  1012  VPNS  1023
             + NS
Sbjct  322   LVNS  325



>ref|XP_010540729.1| PREDICTED: peroxidase 39 [Tarenaya hassleriana]
Length=371

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 215/305 (70%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   + P L A L+R+HFHDCFVRGCD SIL+++T+
Sbjct  68    AELKMGFYHKTCPNAEKIVQDFVNEHIHNAPSLAAALIRMHFHDCFVRGCDASILINATS  127

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             +N+  EK + PNL+V GF+ ID +K+ +E ECPGVVSCAD++ LA RDS+        W+
Sbjct  128   NNRQVEKVSPPNLTVRGFDFIDRVKSLLEKECPGVVSCADVITLATRDSIVAT-GGPFWN  186

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS A+E+L+N+P PF NFSTL +RFA +GL V DLV+LSG HTIG+ HC  
Sbjct  187   VPTGRRDGRISNAAESLNNIPPPFGNFSTLRKRFADQGLDVKDLVLLSGAHTIGVSHCTS  246

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YA  LR+ KC++ +D  + VEMDPGS + FD  Y+ +L 
Sbjct  247   FSNRLFNFTGVGDQDPSLDSEYAANLRSRKCRSPSDNMTKVEMDPGSRKSFDLSYYNLLL  306

Query  832   QKMGLFPSDAALLTDYHARKIVDKMV--DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             ++ GLF SD AL TD  A  +V ++V    D FF  FAKSMEKMG I V TG+ GE+R+ 
Sbjct  307   KRRGLFESDNALTTDSTALALVRRLVAGSMDEFFAEFAKSMEKMGRIGVKTGSDGEIRRY  366

Query  1006  CRVPN  1020
             C   N
Sbjct  367   CAFVN  371



>ref|XP_002443277.1| hypothetical protein SORBIDRAFT_08g016840 [Sorghum bicolor]
 gb|EES17115.1| hypothetical protein SORBIDRAFT_08g016840 [Sorghum bicolor]
Length=352

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 216/312 (69%), Gaps = 8/312 (3%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQ-LPAKLLRLHFHDCFVRGCDGSILL  288
             C+ + L+ HFY++ CP  E +VR I   R +++P  LPAKLLRL FHDCFVRGCD S+LL
Sbjct  38    CDGAALKAHFYRRSCPAAEAVVRDIVVARVAADPAALPAKLLRLFFHDCFVRGCDASVLL  97

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST  N AEK AAPN S+ GF+VID  KA +EA CPG VSCADIVALAARD+VS Q  + 
Sbjct  98    DSTAGNTAEKDAAPNGSLGGFDVIDTAKAVLEAICPGTVSCADIVALAARDAVSLQLGRD  157

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V +GRRDG +S+ASEAL+++PSP  NF+TL  RF SKGL V DLVILSG HTIG+ H
Sbjct  158   LWDVQLGRRDGVVSRASEALADIPSPSDNFTTLEARFGSKGLDVKDLVILSGAHTIGVAH  217

Query  649   CNLFSNRLYNF-TGKGDQDPSLNPSYADMLRTKC-----KNLNDTSPVEMDPGS-SQDFD  807
             CN F++RL  F +     DP+LN +YA  LR++C      + N+ + V MDPGS +  FD
Sbjct  218   CNTFASRLSGFGSSNSGADPTLNAAYAAQLRSRCGPAPVASSNNVTAVTMDPGSPAGRFD  277

Query  808   TDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNS  987
               Y+V LK   GLF SDAALL D  A  ++ ++  + +F + F  ++ KMG + V TG  
Sbjct  278   AHYYVNLKLGRGLFASDAALLADRRAAAMIHRLTRKGYFLQEFRNAVRKMGRVGVRTGGR  337

Query  988   GEVRKNCRVPNS  1023
             GE+R+NCR  NS
Sbjct  338   GEIRRNCRAVNS  349



>gb|KGN63270.1| hypothetical protein Csa_2G421020 [Cucumis sativus]
Length=328

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 210/304 (69%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP+ E+IV     Q   + P L A  +R+HFHDCFVRGCD S+L++ST+
Sbjct  26    AQLKLGFYAKSCPHAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINSTS  85

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             +N+AE+ +APN ++ GF+ ID +K+ +E ECPGVVSCAD+++L ARD++        W V
Sbjct  86    NNQAERDSAPNQTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTI-VATGGPYWEV  144

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++ EAL+N+P PF N STL + F+++GL + DLV+LSG HTIG+ HC  F
Sbjct  145   PTGRRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGAHTIGIAHCQSF  204

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             SNRLYNFTG GDQDPSL+P YA  L+  KC+     + VEMDPGS   FD  Y+ +L ++
Sbjct  205   SNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLLLKR  264

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAAL TD     +V K+V+     FF  FA SMEKMG I+V TG  GE+R+ C 
Sbjct  265   RGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRRRCG  324

Query  1012  VPNS  1023
             V NS
Sbjct  325   VVNS  328



>ref|XP_002280274.1| PREDICTED: peroxidase 3 [Vitis vinifera]
Length=326

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 215/304 (71%), Gaps = 5/304 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY + CP  E+IV     +   + P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  23    ADLKLGFYGESCPKAEKIVLDYVKKHIPNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK   PNL++ GF+ I+ +K+ +EAECPG+VSCADI+AL ARDS+        W+V
Sbjct  83    SNQAEKDGTPNLTLRGFDFIERVKSVVEAECPGIVSCADILALVARDSIVVT-GGPFWNV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS +SEA+S++P P +NF+TL   FA+KGL ++DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGLISNSSEAVSDIPRPVNNFTTLQTLFANKGLDLNDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GD+DP+L+  YA  L+  KCK   D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNFTGVGDEDPALDSEYAANLKARKCKVATDNTTIVEMDPGSFRTFDLSYYTLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL T+   +  + +++      F   FAKSMEKMG I+V TG +GEVRK C
Sbjct  262   RRGLFESDAALTTNSGTKAFITQILQGPLSSFLAEFAKSMEKMGRIEVKTGTAGEVRKQC  321

Query  1009  RVPN  1020
              V N
Sbjct  322   AVIN  325



>gb|ACN31458.1| unknown [Zea mays]
Length=351

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 215/313 (69%), Gaps = 10/313 (3%)
 Frame = +1

Query  112   CEASHLEKHFYKKECPYVEEIVRSITWQRTSSNP-QLPAKLLRLHFHDCFVRGCDGSILL  288
             C  + L+ HFY+  CP  E +VR I   R +++P +LPAKLLRL FHDCFVRGCD S+L+
Sbjct  39    CHGALLKAHFYRHSCPAAEAVVRDIVLARVAADPAKLPAKLLRLFFHDCFVRGCDASVLI  98

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST  N AEK AAPN S+ GF+VID +KA +EA CPG VSCADIVALAARD+VS+QF + 
Sbjct  99    DSTPGNTAEKDAAPNGSLGGFDVIDTVKAVLEAVCPGTVSCADIVALAARDAVSFQFGRD  158

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
             +W V +GRRDG +S+ASEAL+NLPSP +NFSTL   F+SKGL V DLVILSG HTIG+ H
Sbjct  159   LWDVQLGRRDGVVSRASEALANLPSPSNNFSTLEAIFSSKGLDVKDLVILSGAHTIGVAH  218

Query  649   CNLFSNRLYNFT---GKGDQDPSLNPSYADMLRTKC-----KNLNDTSPVEMDPGSSQDF  804
             CN F+ RL   T     G  DP+LN +YA  LR +C      + N+ + V MDPGS   F
Sbjct  219   CNTFAARLSGSTTSASGGGADPALNAAYAAQLRARCGPASTASSNNVTAVPMDPGSPARF  278

Query  805   DTDYFVILKQKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGN  984
             D  Y+V LK   GLF SDAALL D  A  ++ ++  Q +F   F  ++ KMG + V TG 
Sbjct  279   DAHYYVNLKLGRGLFASDAALLADRRAAGMIHRLTRQGYFLHEFQSAVRKMGRVGVRTGA  338

Query  985   S-GEVRKNCRVPN  1020
             + GE+R+NCR  N
Sbjct  339   ARGEIRRNCRAVN  351



>ref|XP_004151878.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
 ref|XP_004158555.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
Length=326

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 210/304 (69%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP+ E+IV     Q   + P L A  +R+HFHDCFVRGCD S+L++ST+
Sbjct  24    AQLKLGFYAKSCPHAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             +N+AE+ +APN ++ GF+ ID +K+ +E ECPGVVSCAD+++L ARD++        W V
Sbjct  84    NNQAERDSAPNQTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTI-VATGGPYWEV  142

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++ EAL+N+P PF N STL + F+++GL + DLV+LSG HTIG+ HC  F
Sbjct  143   PTGRRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGAHTIGIAHCQSF  202

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             SNRLYNFTG GDQDPSL+P YA  L+  KC+     + VEMDPGS   FD  Y+ +L ++
Sbjct  203   SNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLLLKR  262

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAAL TD     +V K+V+     FF  FA SMEKMG I+V TG  GE+R+ C 
Sbjct  263   RGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRRRCG  322

Query  1012  VPNS  1023
             V NS
Sbjct  323   VVNS  326



>ref|XP_009589067.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=331

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 214/308 (69%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRLHFHDCFVRGCDGS+LL+  S
Sbjct  25    AQLQLNFYAKSCPKAEKIIQDYVQKHIPNAPSLAAALLRLHFHDCFVRGCDGSVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PN ++ GF  ID +K  +EAECPGVVSCADIVAL ARDS+        W
Sbjct  85    STKNQTEKVAVPNQTLRGFSFIDGVKKIVEAECPGVVSCADIVALVARDSLVVT-GAPFW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDG IS ASEA  N+P P SNFS+L   FASKGL + DLV+L+G HTIG+ HC+
Sbjct  144   NVPTGRRDGTISNASEASENIPPPTSNFSSLQTSFASKGLDLKDLVLLTGAHTIGISHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGS + FD  YF +
Sbjct  204   SFSTRLYNFTGVLGTQDPSLDSEYAANLKVKKCKSINDNTTIVEMDPGSFRTFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++++V      F+  FA++MEKMG I++ TG++GE+R
Sbjct  264   LLKRRGLFQSDAALTTSATTKLYINQLVQGSLKQFYAEFAQAMEKMGRIEIKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C V NS
Sbjct  324   KQCAVVNS  331



>gb|AFY26878.1| basic peroxidase swpb7 [Ipomoea batatas]
Length=328

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 218/308 (71%), Gaps = 9/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E++++    Q   + P L A LLR+HFHDCFVRGCD S+LL+  S
Sbjct  23    AQLQMNFYAKSCPKAEKLIQDYVRQHIPNAPSLSATLLRMHFHDCFVRGCDASVLLNFTS  82

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
              T N+ EK A PN+S+ GF+ ID +K+ +E ECPGVVSCADIVAL ARDSV        W
Sbjct  83    ATGNQTEKVAPPNVSLRGFDFIDRVKSVVEKECPGVVSCADIVALVARDSV-VTIGGPFW  141

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDGRIS ASEA S +P+P SNF+ L + F ++GL + DLV+LSG HTIG+ HC+
Sbjct  142   NVPTGRRDGRISIASEATS-IPAPTSNFTNLQRLFGNQGLDLTDLVLLSGAHTIGVSHCS  200

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLNDTSP-VEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  LRT KC+++NDT+  VEMDPGS + FD  Y+ +
Sbjct  201   PFSXRLYNFTGVFGTQDPSLDSEYATNLRTRKCRSVNDTTTIVEMDPGSFRTFDLSYYKL  260

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             + ++ GLF SDAALLT+  AR +V+++       F   FA SMEKMG IQV TG++GE+R
Sbjct  261   VLKRRGLFQSDAALLTNPTARSLVNQLAGGSLASFNAQFATSMEKMGRIQVKTGSAGEIR  320

Query  1000  KNCRVPNS  1023
             +NC V NS
Sbjct  321   RNCAVVNS  328



>ref|XP_006582342.1| PREDICTED: peroxidase 3-like [Glycine max]
Length=325

 Score =   330 bits (845),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/304 (54%), Positives = 208/304 (68%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+I+     +   + P L A L+R+HFHDCFV GCDGS+L++ST 
Sbjct  23    AQLQLGFYAKSCPKAEKIILKYVVEHIRNAPSLAAALIRMHFHDCFVNGCDGSVLVNSTQ  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N+AEK + PNL++ GF  ID IK+ +EAECPGVVSCADI+AL ARDSV +      W+V
Sbjct  83    GNQAEKDSPPNLTLRGFGFIDTIKSVVEAECPGVVSCADILALTARDSV-HSIGGPYWNV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS+A EAL +LP+PF N +TL+  F + GL V+DLV+LSG  TIG+ HC+  
Sbjct  142   PTGRRDGVISKAEEALLSLPAPFHNLTTLLTLFGNVGLDVNDLVLLSGAQTIGVSHCSSI  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             + RLYNFTGKGD DP+L+  YA  L+T KCKN+ND T+ +EMDPGS   FD  YF  + +
Sbjct  202   ATRLYNFTGKGDTDPTLDNEYAKNLKTFKCKNINDNTTLIEMDPGSRNTFDLGYFKQVVK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQ-DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
             + GLF SDAALL     R I+ + +     FF  FAKSMEKMG I V TG  GE+RK C 
Sbjct  262   RRGLFQSDAALLESSTTRAIIARQLQSTQGFFAEFAKSMEKMGRINVKTGTEGEIRKQCA  321

Query  1012  VPNS  1023
               NS
Sbjct  322   RVNS  325



>ref|XP_008341978.1| PREDICTED: peroxidase 3-like [Malus domestica]
 ref|XP_008362256.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Malus domestica]
Length=326

 Score =   330 bits (845),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 211/305 (69%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+    +   ++P L A L+RLHFHDCFVRGCD SILL+ST+
Sbjct  23    AQLQLGFYAKNCPNAEKIVKDYVEEHIHNSPSLAAALIRLHFHDCFVRGCDASILLNSTS  82

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             SN+AEK A PNL++ GF+ ID IK+ +EA+CPG+VSCAD +ALAARDS+        W V
Sbjct  83    SNQAEKDAPPNLTLRGFDFIDRIKSRLEAQCPGIVSCADTIALAARDSI-VATGGPTWKV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG I++ ++AL+N+P P SNFS L + FA+ GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGVIARRADALANIPPPTSNFSNLQRTFANTGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             SNRLYNFTG GDQDP+LN  YA  L+  KCK   D T+ VEMDPGS + FD  Y+ +L +
Sbjct  202   SNRLYNFTGVGDQDPALNTQYAANLKANKCKTPTDNTTIVEMDPGSVRTFDLSYYTLLLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL T       + +++      F+  F KSMEKMG     TG++GE+RK C
Sbjct  262   RRGLFQSDAALTTSSTTYNYIHQLLKGSLQNFYDEFGKSMEKMGRANXKTGSAGEIRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVVNS  326



>ref|XP_011079026.1| PREDICTED: peroxidase 3-like [Sesamum indicum]
Length=332

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 207/303 (68%), Gaps = 6/303 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST--T  300
             LE  FY + CP  E+IV         + P L A L+R+HFHDCFVRGCD S+LLD T  T
Sbjct  31    LEMDFYAESCPKAEQIVYDYVNHHIPNAPSLAASLIRMHFHDCFVRGCDASVLLDFTPAT  90

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N+ EK A PN +V GF+ I+ +K  +E ECPGVVSCADI+ L ARD++        W V
Sbjct  91    KNQTEKVATPNQTVRGFDFINRVKNLLEDECPGVVSCADIITLIARDAI-VAIGGPFWRV  149

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS ASEAL  +P+P S+FSTL   FA+KGL + DLV+LSG HTIG+ HC  F
Sbjct  150   PTGRRDGVISNASEALDQIPAPSSDFSTLYAHFANKGLNLKDLVLLSGAHTIGISHCPSF  209

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             +NRLYNFTG GD DPSL+  YA  L+  KCK++N T+ VEMDPGS + FD  Y+ ++ ++
Sbjct  210   ANRLYNFTGVGDGDPSLDSEYAANLKAKKCKSINSTTKVEMDPGSFRTFDLSYYTLVLKR  269

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALLTD   R I+ ++V      F++ FA SMEKMG I+V TG+ GE+RK+C 
Sbjct  270   RGLFESDAALLTDPRTRSIITQLVQGSIENFYQEFASSMEKMGKIEVKTGSFGEIRKHCA  329

Query  1012  VPN  1020
             V N
Sbjct  330   VVN  332



>ref|XP_009603962.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=331

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 213/308 (69%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    +   + P L A LLRLHFHDCFVRGCDGS+LL+  S
Sbjct  25    AQLQLNFYAKSCPKAEKIIQDYVQKHIPNAPSLAAALLRLHFHDCFVRGCDGSVLLNFTS  84

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PN ++ GF  ID +K  +EAECPGVVSCADIVAL ARDSV        W
Sbjct  85    STKNQTEKVAVPNQTLRGFSFIDGVKKIVEAECPGVVSCADIVALVARDSVVVT-GAPFW  143

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDG IS ASEA  N+P P SNFS+L   FASKGL + DLV+L+G HTIG+ HC+
Sbjct  144   NVPTGRRDGTISNASEASENIPPPTSNFSSLQTSFASKGLDLKDLVLLTGAHTIGISHCS  203

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGS + FD  YF +
Sbjct  204   SFSTRLYNFTGVLGTQDPSLDSEYAANLKVKKCKSINDNTTIVEMDPGSFRTFDLSYFKL  263

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  ++++V      F+  FA++MEKM  I+V TG++GE+R
Sbjct  264   LLKRRGLFQSDAALTTSATTKLYINQLVQGSLKQFYAEFAQAMEKMSRIEVKTGSAGEIR  323

Query  1000  KNCRVPNS  1023
             K C V NS
Sbjct  324   KQCAVVNS  331



>ref|XP_006356923.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=327

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 214/308 (69%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+++FY K CP  E+I+     +   + P L A L+R+HFHDCFVRGCD S+LL+  S
Sbjct  21    AQLQQNFYAKSCPKAEKIILEYVHKHIPNAPSLAAALIRMHFHDCFVRGCDASVLLNFTS  80

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK   PNL++ GF  ID +K  IE ECPGVVSCADIVAL ARDSV        W
Sbjct  81    STGNQTEKFGIPNLTLRGFSFIDNVKKIIEDECPGVVSCADIVALVARDSVVVT-GGPSW  139

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             SVP GRRDGRIS ASE L+++P+P SNFSTL   F+ KGL + DLV+LSG HTIG+ HC+
Sbjct  140   SVPTGRRDGRISNASETLTDIPAPTSNFSTLQNDFSRKGLDLKDLVLLSGAHTIGISHCS  199

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YA  L+  KCK++ND T+ VEMDPGS + FD  Y+ +
Sbjct  200   SFSTRLYNFTGTFGTQDPSLDSEYAANLKANKCKSINDNTTIVEMDPGSFRTFDLSYYKL  259

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL T    +  +D++V      F+  FA+SMEKMG I+V TG+ GE+R
Sbjct  260   LLKRRGLFQSDAALTTSTTTKSYIDQLVAGSLKEFYVEFAQSMEKMGRIEVKTGSDGEIR  319

Query  1000  KNCRVPNS  1023
             K+C V NS
Sbjct  320   KHCAVVNS  327



>ref|NP_172018.1| peroxidase 3 [Arabidopsis thaliana]
 sp|O23044.1|PER3_ARATH RecName: Full=Peroxidase 3; Short=Atperox P3; AltName: Full=ATPRC; 
AltName: Full=RCI3A; AltName: Full=Rare cold-inducible 
protein; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB71452.1| Strong similarity to Arabidopsis peroxidase ATPEROX7A (gb|X98321) 
[Arabidopsis thaliana]
 gb|AAB94661.1| peroxidase precursor [Arabidopsis thaliana]
 gb|AAO44083.1| At1g05260 [Arabidopsis thaliana]
 dbj|BAE99836.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE27815.1| peroxidase 3 [Arabidopsis thaliana]
Length=326

 Score =   329 bits (844),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANSCPNAEKIVQDFVSNHVSNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  ID IK+ +EA+CPG+VSCADI+ALA+RD+V +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS A+EAL+N+P P SN + L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+G QDP+L+  YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGGQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>gb|AAT72298.1| CBRCI35 [Capsella bursa-pastoris]
Length=326

 Score =   329 bits (844),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+ V+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANTCPNAEKTVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  ID IKA +EA+CPG+VSCADI+ALA+RD++ +      W+V
Sbjct  84    GN-AERDATPNLTVRGFGFIDAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WNV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS ASEAL+N+P P SNF+ L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+GDQDP+L+  YA  L++ KC + ND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGDQDPALDSEYAANLKSRKCPSPNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_009604384.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
 ref|XP_009604391.1| PREDICTED: peroxidase 3-like [Nicotiana tomentosiformis]
Length=329

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/308 (53%), Positives = 216/308 (70%), Gaps = 8/308 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--S  294
             + L+ +FY K CP  E+I++    ++    P   A +LR+HFHDCFVRGCDGS+LL+  S
Sbjct  23    AQLQLNFYAKSCPNAEKIIKDFVQKQVQKAPNTAAAILRMHFHDCFVRGCDGSVLLNFTS  82

Query  295   TTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMW  474
             +T N+ EK A PNL++ GF  ID +K  +EAECPGVVSCADI+AL ARD+V        W
Sbjct  83    STGNQTEKQANPNLTLRGFSFIDAVKRLVEAECPGVVSCADIIALVARDAVVVT-GGPFW  141

Query  475   SVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCN  654
             +VP GRRDGRIS  SEA +++P+P SNF+ L Q FA KGL ++DLV+LSG HTIG+ HC+
Sbjct  142   NVPTGRRDGRISNVSEANADIPAPTSNFTRLQQSFAKKGLDLNDLVLLSGAHTIGVSHCS  201

Query  655   LFSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVI  825
              FS RLYNFTG  G QDPSL+  YAD L++ KCK++ND T+ VEMDPGS + FD  Y+ +
Sbjct  202   SFSERLYNFTGTLGTQDPSLDSEYADNLKSRKCKSINDNTTIVEMDPGSFKTFDLSYYKL  261

Query  826   LKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVR  999
             L ++ GLF SDAAL      +  ++ +V+     F+  FAK+MEKMG ++V TG++GE+R
Sbjct  262   LLKRRGLFQSDAALTKRTTTKSFIEHLVEGSLKEFYSEFAKAMEKMGRVEVKTGSAGEIR  321

Query  1000  KNCRVPNS  1023
             K C   NS
Sbjct  322   KQCAFVNS  329



>ref|XP_010435105.1| PREDICTED: peroxidase 39 [Camelina sativa]
Length=326

 Score =   329 bits (844),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 218/306 (71%), Gaps = 8/306 (3%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV+ +  Q  ++ P L A L+R+HFHDCFV GCDGSIL+++T+
Sbjct  23    AQLKMGFYDKTCPTAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVLGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             SN+  EK A PNL+V GF+ ID++K+A+E++CPG+VSCADI+ LA RDS+        W+
Sbjct  83    SNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSI-VAIGGPTWN  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS  +EA  N+P PF NF+TL+  FA++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNFAEARDNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YAD L++ +C +L D T+ VEMDPGS   FD  YF ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMV---DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
             ++ GLF SDAAL  +  A   V +     +QD FF  F+KSMEKMG I V TG++GE+R+
Sbjct  262   KRRGLFESDAALTMNPAALAQVRRFAGGSEQD-FFSEFSKSMEKMGRIGVKTGSAGEIRR  320

Query  1003  NCRVPN  1020
              C   N
Sbjct  321   TCAFVN  326



>gb|AAM61240.1| putative peroxidase [Arabidopsis thaliana]
Length=326

 Score =   329 bits (844),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY   CP  E+IV+       S+ P L A L+R+HFHDCFVRGCDGS+L++ST+
Sbjct  24    AQLQMNFYANSCPNAEKIVQDFVSNHVSNAPSLAAALIRMHFHDCFVRGCDGSVLINSTS  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N AE+ A PNL+V GF  ID IK+ +EA+CPG+VSCADI+ALA+RD+V +      WSV
Sbjct  84    GN-AERDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPN-WSV  141

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDGRIS A+EAL+N+P P SN + L   FA++GL + DLV+LSG HTIG+ HC+ F
Sbjct  142   PTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSF  201

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDT-SPVEMDPGSSQDFDTDYFVILKQ  834
             +NRLYNFTG+G QDP+L+  YA  L++ KC +LND  + VEMDPGS + FD  Y+ ++ +
Sbjct  202   TNRLYNFTGRGGQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLK  261

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SD+AL T+      +++++      FF  FAKSMEKMG I V TG++G VR+ C
Sbjct  262   RRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTGSAGVVRRQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|NP_192868.1| peroxidase 39 [Arabidopsis thaliana]
 sp|Q9SUT2.1|PER39_ARATH RecName: Full=Peroxidase 39; Short=Atperox P39; AltName: Full=ATP19a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB51413.1| peroxidase ATP19a [Arabidopsis thaliana]
 emb|CAB81230.1| peroxidase ATP19a [Arabidopsis thaliana]
 dbj|BAD95298.1| peroxidase ATP19a [Arabidopsis thaliana]
 gb|ABH04555.1| At4g11290 [Arabidopsis thaliana]
 gb|AEE82993.1| peroxidase 39 [Arabidopsis thaliana]
Length=326

 Score =   329 bits (844),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY + CPY E+IV+ +  Q  ++ P L A L+R+HFHDCFVRGCDGSIL+++T+
Sbjct  23    AQLKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             SN+  EK A PNL+V GF+ ID++K+A+E++CPG+VSCADI+ LA RDS+        W+
Sbjct  83    SNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSI-VAIGGPTWN  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS  +EA++N+P PF NF+TL+  F ++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YAD L++ +C ++ D T+ VEMDPGS   FD  Y+ ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMV--DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             ++ GLF SDAAL  +  A   V +     +  FF  F+ SMEKMG I V TG+ GE+R+ 
Sbjct  262   KRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRT  321

Query  1006  CRVPN  1020
             C   N
Sbjct  322   CAFVN  326



>ref|XP_003540317.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   329 bits (844),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 216/310 (70%), Gaps = 7/310 (2%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A   + L+  FY K CP  E+I+     +   + P L A L+R+HFHDCFVRGCDGS+LL
Sbjct  19    ASSHAQLQLGFYAKSCPKAEQIILKFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSVLL  78

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             +STT N+AEK A PNL+V GF+ ID IK+ +EAECPGVVSCADI+ LA+RDS+       
Sbjct  79    NSTT-NQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCADILTLASRDSI-VATGGP  136

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W VP GRRDG IS   EA +N+P+PF N +TL   FA++GL + DLV+LSG HTIG+ H
Sbjct  137   YWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLFANQGLDLKDLVLLSGAHTIGIAH  196

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLN--DTSPVEMDPGSSQDFDTDYF  819
             C+  SNRL+NFTGKGDQDPSL+  YA  L+T KCK+LN  +T+ +EMDPGS + FD  Y+
Sbjct  197   CSSLSNRLFNFTGKGDQDPSLDSEYAANLKTFKCKDLNKLNTTKIEMDPGSRKTFDLSYY  256

Query  820   VILKQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGE  993
               + ++ GLF SDAALLT+   +  + ++++     FF  FA S+EKMG I+V TG  GE
Sbjct  257   SHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVEKFFAEFATSIEKMGRIKVKTGTEGE  316

Query  994   VRKNCRVPNS  1023
             +RK+C   NS
Sbjct  317   IRKHCAFVNS  326



>ref|XP_006357953.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=331

 Score =   329 bits (844),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 214/307 (70%), Gaps = 8/307 (3%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLD--ST  297
              L+ +FY K CP  E+I++    ++  S P L A LLRLHFHDCFVRGCDGS+LL+  S+
Sbjct  26    QLQLNFYAKSCPQAEKIIQDYVQKQIPSAPSLAAALLRLHFHDCFVRGCDGSVLLNFTSS  85

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             T N+ EK A PN ++ GF  ID +K A+EAECPGVVSCADIVAL ARDSV        W 
Sbjct  86    TKNQTEKVAVPNQTLRGFSFIDGVKKALEAECPGVVSCADIVALVARDSVVVT-GGPYWK  144

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS ASEAL+N+P P S+ S+L   FASKGL + DLV+LSG HTIG+ HC  
Sbjct  145   VPTGRRDGRISNASEALANIPPPTSSVSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPS  204

Query  658   FSNRLYNFTGK-GDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVIL  828
             FS+RLYNFTG  G +DPSL+  YA  L+  KCK++ND T+ VEMDPGSS  FD  YF ++
Sbjct  205   FSSRLYNFTGVWGKKDPSLDTEYASNLKMKKCKSINDNTTIVEMDPGSSSKFDLSYFQLV  264

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRK  1002
              ++ GLF SDAAL T    +  ++++V      F+  F  +MEKMG I+V TG++GE+RK
Sbjct  265   LKRKGLFQSDAALTTSATTKSFINELVQGSLKQFYVEFGLAMEKMGKIEVKTGSAGEIRK  324

Query  1003  NCRVPNS  1023
             +C   N+
Sbjct  325   HCAAVNT  331



>emb|CAA67337.1| peroxidase [Arabidopsis thaliana]
Length=326

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY + CPY E+IV+ +  Q  ++ P L A L+R+HFHDCFVRGCDGSIL+++T+
Sbjct  23    AQLKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  301   SNK-AEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
             SN+  EK A PNL+V GF+ ID++K+A+E++CPG+VSCADI+ LA RDS+        W+
Sbjct  83    SNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSI-VAIGGPTWN  141

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             VP GRRDGRIS  +EA++N+P PF NF+TL+  F ++GL V DLV+LSG HTIG+ HC+ 
Sbjct  142   VPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILK  831
             FSNRL+NFTG GDQDPSL+  YAD L++ +C ++ D T+ VEMDPGS   FD  Y+ ++ 
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVL  261

Query  832   QKMGLFPSDAALLTDYHARKIVDKMV--DQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKN  1005
             ++ GLF SDAAL  +  A   V +     +  FF  F+ SMEKMG I V TG+ GE+R+ 
Sbjct  262   KRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRT  321

Query  1006  CRVPN  1020
             C   N
Sbjct  322   CAFVN  326



>ref|XP_009598812.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=327

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 206/297 (69%), Gaps = 4/297 (1%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
              L+  FY K+CP++E IV+ +     S  P L A LLR+HFHDCFVRGCDGS+LL+S T 
Sbjct  29    ELKVGFYHKKCPHLELIVKEVIDDVISRVPSLAAPLLRMHFHDCFVRGCDGSVLLNSPT-  87

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
              +AEK A PNLS+ G+++ID++K A+E  CPG+VSCADIVAL ARD V+   K   W V 
Sbjct  88    KQAEKDAIPNLSLRGYQIIDKVKTAVEKSCPGMVSCADIVALVARD-VTVAVKGPFWEVE  146

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDGR+S  +EAL NL  PF+N ++L Q F  KGL V DLV+LSG HTIGM HC+ F+
Sbjct  147   TGRRDGRVSNITEALFNLIPPFANITSLKQGFLQKGLSVKDLVVLSGSHTIGMSHCSSFN  206

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             NRLYNFTGKGD DPSL+P+Y   L+ KC   +  S VEMDPGS + FDT Y+ I+ ++ G
Sbjct  207   NRLYNFTGKGDADPSLDPNYIKRLKMKCSPTDQNSIVEMDPGSVRTFDTSYYNIVAKRRG  266

Query  844   LFPSDAALLTDYHARKIVDK--MVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             LF SD+ALL D   +  + +  +     FFK F +SM KMG IQVLTG  GE+R  C
Sbjct  267   LFTSDSALLDDKETKGYLKEQALNHGSTFFKDFGESMVKMGRIQVLTGTQGEIRNVC  323



>ref|XP_009787653.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=327

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 206/297 (69%), Gaps = 4/297 (1%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
              L+  FY K CP++E IV+ +     S  P L A LLR+HFHDCFVRGCDGS+LL+S T 
Sbjct  29    ELKVGFYHKNCPHLELIVKEVIDDVISRVPSLAAPLLRMHFHDCFVRGCDGSVLLNSPTK  88

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
              +AEK A PNLS+ GF++ID++K A+E  CPG+VSCADIVAL ARD V+   K   W V 
Sbjct  89    -QAEKNAIPNLSLRGFQIIDKVKTAVEKYCPGIVSCADIVALVARD-VTVAVKGPFWEVE  146

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDGR+S  +EAL NL  PF+N ++L Q F  +GL V DLV+LSG HTIG+ HC+ F+
Sbjct  147   TGRRDGRVSNITEALFNLIPPFANITSLKQGFLQRGLSVKDLVVLSGSHTIGISHCSSFN  206

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             NRLYNFTGKGD DPSL+P+Y   L+ KC   +  S VEMDPGS + FDT Y+ ++ ++ G
Sbjct  207   NRLYNFTGKGDTDPSLDPNYIKRLKMKCSPTDQNSIVEMDPGSVRTFDTSYYNLVAKRRG  266

Query  844   LFPSDAALLTDYHARKIVDK--MVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             LF SD+ALL D   +  + +  +     FFK F +SM KMG IQVLTG  GE+RK C
Sbjct  267   LFTSDSALLDDKETKGYLKEQALNHGSTFFKDFGESMVKMGRIQVLTGTQGEIRKVC  323



>ref|XP_006411127.1| hypothetical protein EUTSA_v10016858mg [Eutrema salsugineum]
 gb|ESQ52580.1| hypothetical protein EUTSA_v10016858mg [Eutrema salsugineum]
Length=357

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 204/305 (67%), Gaps = 7/305 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY K CP  E+IVR I W++  +NP L  KLLR+H+HDCFVRGCD S+LLDS    
Sbjct  53    LKMKFYHKTCPEAEDIVREIVWKKVKANPSLSPKLLRVHYHDCFVRGCDASLLLDSVAGK  112

Query  307   KA-EKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
              A EK A PNLS++GFE+IDEIK+ +E  CP  VSCADI+ LA RD+VSYQF + +W+V 
Sbjct  113   AASEKEARPNLSLSGFEIIDEIKSILEKRCPKTVSCADILTLATRDAVSYQFGRPLWNVF  172

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GR DG++S A+EA  +LPS  +NF++L++ FA   L V DLV LSG HTIG   C +F 
Sbjct  173   TGRVDGKVSLATEAARDLPSAGANFTSLLKLFAESDLDVVDLVALSGAHTIGTARCGVFG  232

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKN----LNDTSPVEMDPGSSQDFDTDYFVILK  831
              RL NFTGKGD DPSLN SYA  L++KC +    LN ++ V MDP  +  FD+ YF  L 
Sbjct  233   RRLLNFTGKGDTDPSLNSSYASFLKSKCSDKSLRLNSSAVVGMDPTGALSFDSGYFFSLL  292

Query  832   QKMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLT--GNSGEVRKN  1005
             Q  GLF SDAALLTD  A  I     D   F   F +SM KM +I+VLT     GE+R+N
Sbjct  293   QHKGLFTSDAALLTDRSAASIASAFQDSGSFLAQFGRSMIKMSSIKVLTLGDEGGEIRRN  352

Query  1006  CRVPN  1020
             CRV N
Sbjct  353   CRVVN  357



>ref|XP_006306557.1| hypothetical protein CARUB_v10012652mg [Capsella rubella]
 gb|EOA39455.1| hypothetical protein CARUB_v10012652mg [Capsella rubella]
Length=320

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 208/301 (69%), Gaps = 8/301 (3%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
             HL+  +YK  CP  E IVR +T Q  S  P L A LLR+HFHDCFVRGCDGSILL S  +
Sbjct  26    HLD--YYKHRCPDAEAIVRRVTVQYVSRKPSLAAGLLRMHFHDCFVRGCDGSILLKSL-N  82

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             N AE+ A PNLS+ G+EV+D  K+A+E +CPGVVSCAD+++L ARD+V        W VP
Sbjct  83    NDAERNAIPNLSLRGYEVVDAAKSALEKKCPGVVSCADVLSLVARDAV-LVINGPWWPVP  141

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
             +GRRDGRIS+ SEA  NLPSPF+  + L Q F  KGL   DLV+LSGGHTIG+ +C L +
Sbjct  142   LGRRDGRISRLSEA--NLPSPFAGIAALKQNFLVKGLNTKDLVVLSGGHTIGISNCGLIN  199

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMG  843
             +R+YNFTGKGD DPS+NPSY   L+ +CK  +  S VEMDPGS + FD+ YF I+ QK G
Sbjct  200   SRIYNFTGKGDFDPSMNPSYVRTLKKRCKPTDFRSSVEMDPGSVKKFDSHYFNIVAQKKG  259

Query  844   LFPSDAALLTDYHARKIVDKMVDQ--DFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVP  1017
             LF SD+ LL D   +  +++ V      F K F+ SM K+G +++LTG  GE+R+ C  P
Sbjct  260   LFTSDSTLLDDPETKSYIERQVATGGSSFAKDFSDSMVKLGLVEILTGKKGEIRRRCAFP  319

Query  1018  N  1020
             N
Sbjct  320   N  320



>emb|CDY49518.1| BnaC05g03300D [Brassica napus]
Length=326

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 221/305 (72%), Gaps = 8/305 (3%)
 Frame = +1

Query  124   HLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTS  303
              L+ +F+   CP  E+IV+       S+ P L A LLR+HFHDCFVRGCDGS+L++S + 
Sbjct  25    QLQMNFHANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSRSG  84

Query  304   NKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVP  483
             N AEK AAPNL+V GF  I+ IKA +EA+CPG+VSCADI+ALA+RD++ +      WSVP
Sbjct  85    N-AEKDAAPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPN-WSVP  142

Query  484   MGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFS  663
              GRRDGRIS ASEAL+N+P P SNF+ L  RFA++GL + DLV+LSG HTIG+ HC+ F+
Sbjct  143   TGRRDGRISNASEALANIPPPTSNFTNLQTRFANQGLDLKDLVLLSGAHTIGVSHCSSFT  202

Query  664   NRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQK  837
             NRLYNFTG+GD+DP+L+  YA  L++ K  +L D T+ VEMDPGS + FD  Y+ +L ++
Sbjct  203   NRLYNFTGRGDKDPALDSEYAANLKSRKYPSLKDNTTIVEMDPGSHKMFDLSYYQLLLKR  262

Query  838   MGLFPSDAALLTDYHARKIVDKMVD---QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
              GLF SD+AL T+      +++++    + FFF+ FAKSMEKMG I V TG++G VRK C
Sbjct  263   RGLFQSDSALTTNPTTLSNINQILKGSVEGFFFE-FAKSMEKMGRINVKTGSAGVVRKQC  321

Query  1009  RVPNS  1023
              V NS
Sbjct  322   SVANS  326



>ref|XP_008455840.1| PREDICTED: peroxidase 39-like [Cucumis melo]
Length=329

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 209/304 (69%), Gaps = 4/304 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+  FY K CP  E+IV     Q   + P L A  +R+HFHDCFVRGCD S+L++ST+
Sbjct  26    AQLKLGFYAKSCPKAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINSTS  85

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
             +N+AEK + PN ++ GF+ ID +K+ +E ECPGVVSCAD+++L ARD++        W V
Sbjct  86    NNQAEKDSQPNQTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTI-VATGGPYWEV  144

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS++SEAL+++P PF N STL + FA++GL + DLV+LSG HTIG+ HC  F
Sbjct  145   PTGRRDGVISRSSEALNDIPPPFGNLSTLQRLFANQGLDLKDLVLLSGAHTIGIAHCQSF  204

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
             SNRLYNFTG GDQDPSL+P YA  L+  KC+     + VEMDPGS   FD  Y+ +L ++
Sbjct  205   SNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLLLKR  264

Query  838   MGLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAAL TD     +V K+V+     FF  FA SMEKMG I+V TG  GE+R+ C 
Sbjct  265   RGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRRKCA  324

Query  1012  VPNS  1023
             V N+
Sbjct  325   VVNN  328



>ref|XP_002892275.1| hypothetical protein ARALYDRAFT_470522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68534.1| hypothetical protein ARALYDRAFT_470522 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 202/290 (70%), Gaps = 3/290 (1%)
 Frame = +1

Query  151   ECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSNKAEKAAAP  330
             +CP  E IVR +T Q  S  P L A LLR+HFHDCFVRGCDGS+LL  T  N AE+ A P
Sbjct  2     KCPDAERIVRRVTEQYVSRKPSLAASLLRMHFHDCFVRGCDGSVLL-KTPKNDAERNAIP  60

Query  331   NLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPMGRRDGRIS  510
             NL++ GFEV+D  K A+E +CP +VSCAD++AL ARD+V+   K   W VP+GRRDGRIS
Sbjct  61    NLTLRGFEVVDAAKTALEKKCPNLVSCADVLALVARDAVAV-IKGPWWPVPLGRRDGRIS  119

Query  511   QASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSNRLYNFTGK  690
             + ++AL NLPSPF++  TL + FA KGL   DLV+LSGGHTIG+  C L + R+YNFTGK
Sbjct  120   KLTDALQNLPSPFADIKTLKKNFADKGLNAKDLVVLSGGHTIGISSCALVNTRIYNFTGK  179

Query  691   GDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQKMGLFPSDAALL  870
             GD DPS+NPSY   L+ KC   +  S +EMDPGS++ FD  YF  + QK GLF SD+ LL
Sbjct  180   GDFDPSMNPSYVRALKKKCSPTDFKSVLEMDPGSAKKFDPHYFTAVAQKKGLFISDSTLL  239

Query  871   TDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRVPN  1020
              D   +  V +  ++  F K F+ SM K+G +Q+LTG +GE+RK C  PN
Sbjct  240   DDLETKLYV-QTANEVTFNKDFSDSMVKLGKVQILTGKNGEIRKRCAFPN  288



>ref|XP_010453647.1| PREDICTED: peroxidase 56-like [Camelina sativa]
Length=330

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 211/303 (70%), Gaps = 4/303 (1%)
 Frame = +1

Query  118   ASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDST  297
             A  L+  FY+K CP  E IV+   ++    +  L A LLR+ FHDCFVRGC+GS+LLD  
Sbjct  29    AQGLKVGFYEKSCPKAELIVKKSVFEAMKKDLTLGAPLLRMFFHDCFVRGCEGSLLLD-L  87

Query  298   TSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWS  477
              + K EK A PNL + GFE+ID+ KAA+E ECPG+VSC+D++AL ARD++        W 
Sbjct  88    KNKKDEKNAIPNLFLRGFEIIDDAKAALEKECPGIVSCSDVLALVARDAM-VALNGPSWE  146

Query  478   VPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNL  657
             V  GRRDG +S  SEALSNLPSPF+N S+L+ +F SKGL   DLV+LSGGHTIG GHC  
Sbjct  147   VETGRRDGLVSNISEALSNLPSPFNNISSLITQFHSKGLNKKDLVVLSGGHTIGNGHCPQ  206

Query  658   FSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVILKQK  837
              +NRLYNFTGKGD DP+L+  YA  LR KCK  + T+ +EMDPGS + FD  YF ++ Q+
Sbjct  207   ITNRLYNFTGKGDSDPNLDTEYATSLRKKCKPTDTTTALEMDPGSFKTFDKSYFKLVSQR  266

Query  838   MGLFPSDAALLTDYHARK-IVDKM-VDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCR  1011
              GLF SDAALL +   +  ++++M  D+  FFK F  SM KMG I VLTG +G++RKNCR
Sbjct  267   RGLFQSDAALLDNQETKSYLLNQMKSDRSTFFKDFGVSMVKMGRIGVLTGKAGQIRKNCR  326

Query  1012  VPN  1020
             + N
Sbjct  327   MVN  329



>ref|XP_010267773.1| PREDICTED: peroxidase 3 [Nelumbo nucifera]
Length=325

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 210/303 (69%), Gaps = 5/303 (2%)
 Frame = +1

Query  127   LEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTTSN  306
             L+  FY + CP  E+IV     +   + P L A ++R+HFHDCFVRGCD SIL++ST+SN
Sbjct  24    LKIGFYDQSCPKAEKIVSDFVNKHIHNAPSLAATIIRMHFHDCFVRGCDASILINSTSSN  83

Query  307   KAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSVPM  486
             +AEKAA PN ++ GF  ID +K+ +EAECPGVVSCAD++AL ARDS+        W VP 
Sbjct  84    QAEKAAVPNQTLRGFGFIDSVKSLLEAECPGVVSCADVIALVARDSI-VATGGPSWKVPT  142

Query  487   GRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLFSN  666
             GRRDG IS ASEA S +P+P SNF+TL   FA+KGL + DLV+LSG HTIG+ HC  FSN
Sbjct  143   GRRDGVISNASEAQSQIPAPTSNFTTLQTLFANKGLDLKDLVLLSGAHTIGIAHCPSFSN  202

Query  667   RLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQKM  840
             RLYNFTG GDQDP+L+  YA  L+  KCK   D T+ VEMDPGS + FD  Y+ +L ++ 
Sbjct  203   RLYNFTGVGDQDPALDSEYAANLKAKKCKTSTDNTTIVEMDPGSFRTFDLSYYRLLLKRR  262

Query  841   GLFPSDAALLTDYHARKIVDKMVDQDF--FFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
             GLF SD+AL T+      ++++V      F+  FAKSMEKMG + V TG+SGE+RK C  
Sbjct  263   GLFQSDSALTTNSTTLSFINQLVQGTLENFYTEFAKSMEKMGQVDVKTGSSGEIRKQCWK  322

Query  1015  PNS  1023
              NS
Sbjct  323   VNS  325



>ref|XP_010271617.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=330

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 205/310 (66%), Gaps = 10/310 (3%)
 Frame = +1

Query  109   ACEASHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILL  288
             A +   L+  FY+K CP  E I+R+ T      +P L A LLR+ FHDCFVRGCDGS+LL
Sbjct  24    AVDGQSLQVGFYRKTCPPAEAIIRNTTTPYILEDPSLAAPLLRVQFHDCFVRGCDGSVLL  83

Query  289   DSTTSNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKK  468
             DST +N+ EKA+ PN S+ GF VID +KAA+E  CPGVVSCADI+AL  RD+V +  K  
Sbjct  84    DSTENNETEKASGPNQSLRGFHVIDAVKAAVEEACPGVVSCADILALVVRDAV-FMLKGP  142

Query  469   MWSVPMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGH  648
              W VP GRRDGR+S  SE   NLP P SN + L   F SKGL   DLV+LSG HTIG  H
Sbjct  143   FWEVPTGRRDGRVSIDSEITENLPPPSSNITRLKTSFKSKGLSTKDLVVLSGAHTIGRSH  202

Query  649   CNLFSNRLYNFTGKGDQDPSLNPSYADMLRTKCKNLNDTSPVEMDPGSSQDFDTDYFVIL  828
             C++FS+RLYNF+G+GD DPSL+P YA  L+ KCK  + T+ VE+DPGS + F+ DY+ ++
Sbjct  203   CSIFSDRLYNFSGRGDTDPSLDPKYAIKLKKKCKRGDVTTVVELDPGSFKTFNKDYYKVV  262

Query  829   KQKMGLFPSDAALLTDYHARKIVDKMVDQ------DFFFKSFAKSMEKMGAIQVLTGNSG  990
              +  G+F SDAALL D   R   D ++ Q        F K FA++M  +G I V+TG  G
Sbjct  263   AEGRGIFQSDAALLDDNETR---DYVISQAASAVSSTFLKDFAEAMINLGNIGVITGTEG  319

Query  991   EVRKNCRVPN  1020
             E+RK C   N
Sbjct  320   EIRKRCAFVN  329



>gb|KHG05441.1| Peroxidase 3 -like protein [Gossypium arboreum]
 gb|KHG30187.1| Peroxidase 3 -like protein [Gossypium arboreum]
Length=327

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 209/305 (69%), Gaps = 5/305 (2%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             + L+ +FY K CP  E+I+     +   + P L A  +R+HFHDCFVRGCDGS+LL+ST 
Sbjct  24    AQLQMNFYAKSCPKAEKIISDYVKEHIPNAPSLAASFIRMHFHDCFVRGCDGSVLLNSTN  83

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
                 EK A PN ++ GF+ ID +K+ +EAECPG+VSCADI+ L ARDS+        W V
Sbjct  84    GQSPEKNAVPNQTLRGFDFIDRLKSMVEAECPGIVSCADILTLVARDSI-VTVGGPFWQV  142

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
             P GRRDG IS  +EA +N+PSPFSNF+TL+  F ++GL  +DLV+LSG HTIG+ HC  F
Sbjct  143   PTGRRDGVISNVTEANNNIPSPFSNFTTLLTLFNNQGLDTNDLVLLSGAHTIGIAHCPAF  202

Query  661   SNRLYNFTGKGDQDPSLNPSYADMLRT-KCKNLND-TSPVEMDPGSSQDFDTDYFVILKQ  834
             S RLYN TG G  DP+L+  YA  L+T KC+  ND T+ VEMDPGS + FD  Y+ +L +
Sbjct  203   SRRLYNSTGPGGVDPTLDSEYAANLKTNKCRTPNDNTTIVEMDPGSRKTFDLSYYTLLTK  262

Query  835   KMGLFPSDAALLTDYHARKIVDKMVD--QDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNC  1008
             + GLF SDAAL TD  +  ++++++   Q FF+  FAKSMEKMG I V TG+ GE+RK C
Sbjct  263   RRGLFNSDAALTTDSTSLGLINQLLSSPQSFFYAQFAKSMEKMGRINVKTGSQGEIRKQC  322

Query  1009  RVPNS  1023
              + NS
Sbjct  323   ALVNS  327



>ref|XP_010523998.1| PREDICTED: peroxidase 3-like [Tarenaya hassleriana]
Length=348

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 216/302 (72%), Gaps = 2/302 (1%)
 Frame = +1

Query  121   SHLEKHFYKKECPYVEEIVRSITWQRTSSNPQLPAKLLRLHFHDCFVRGCDGSILLDSTT  300
             S L+K+FYK+ CP  E+++R+ITW+  +++P LPAKLLR+ FHDCFVRGCD S+L+ ST 
Sbjct  36    SGLKKYFYKESCPVAEDVIRNITWRSVAADPALPAKLLRMSFHDCFVRGCDASVLIRSTA  95

Query  301   SNKAEKAAAPNLSVAGFEVIDEIKAAIEAECPGVVSCADIVALAARDSVSYQFKKKMWSV  480
              N+AE  A PNL++ G +++DEIKA +E  C G+VSCADI+ LA   +V++QFK  +W V
Sbjct  96    ENEAEMEAEPNLTLGGTDLVDEIKAKLEQVCNGIVSCADIIPLATTYAVAFQFKMPIWEV  155

Query  481   PMGRRDGRISQASEALSNLPSPFSNFSTLVQRFASKGLGVHDLVILSGGHTIGMGHCNLF  660
               GRRDGRIS+  EA +N+PSP  NF  L++ F ++GL  HDLV+LSGGHTIG GHC LF
Sbjct  156   FTGRRDGRISKMEEANANIPSPSMNFHELLKSFEAQGLNKHDLVVLSGGHTIGEGHCFLF  215

Query  661   SNRLYNFTGK-GDQDPSLNPSYADMLRTKCK-NLNDTSPVEMDPGSSQDFDTDYFVILKQ  834
             ++RLYNF+G+ G+QDPSL+P YA  L+TKC  +  D + V +DP S   +D  YF  L Q
Sbjct  216   NDRLYNFSGRVGNQDPSLDPDYAKFLKTKCSPSPTDLTTVHLDPDSGFSYDNHYFTNLLQ  275

Query  835   KMGLFPSDAALLTDYHARKIVDKMVDQDFFFKSFAKSMEKMGAIQVLTGNSGEVRKNCRV  1014
               GLF SDAALLTD  A  IV  + D   F   FAK+M+K+ +I V TG+ GE+R++C  
Sbjct  276   NRGLFLSDAALLTDPEAFSIVQSLTDNWVFSIEFAKAMKKLTSINVETGDQGEIRQHCGF  335

Query  1015  PN  1020
              N
Sbjct  336   VN  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2833061748424