BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29282_g1_i1 len=1091 path=[1069:0-1090]

Length=1091
                                                                      Score     E

ref|XP_009773633.1|  PREDICTED: uncharacterized protein LOC104223835    358   9e-120   
ref|XP_009600934.1|  PREDICTED: uncharacterized protein LOC104096284    354   5e-118   
ref|XP_004247632.1|  PREDICTED: uncharacterized protein LOC101265478    350   3e-116   
ref|XP_006362179.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    349   4e-116   
ref|XP_011080626.1|  PREDICTED: uncharacterized protein LOC105163833    319   8e-105   
emb|CDP06895.1|  unnamed protein product                                317   6e-104   
ref|XP_010244596.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    313   2e-102   
gb|EYU46045.1|  hypothetical protein MIMGU_mgv1a013330mg                313   3e-102   
gb|KDP45668.1|  hypothetical protein JCGZ_17275                         311   9e-102   
ref|XP_008354213.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    308   3e-100   
ref|XP_008238394.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    307   8e-100   
ref|XP_008359040.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    307   9e-100   
ref|XP_004500401.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    305   1e-99    
ref|XP_009374416.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    306   2e-99    
ref|XP_009355285.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    305   4e-99    
ref|XP_008788045.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    303   1e-98    
ref|XP_003553172.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    303   1e-98    
ref|XP_003600578.1|  NAD(P)H-quinone oxidoreductase subunit N           303   2e-98    
ref|XP_006590280.1|  PREDICTED: uncharacterized protein LOC100777...    303   4e-98    
ref|XP_004294851.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    302   4e-98    
gb|ACU23851.1|  unknown                                                 302   6e-98    Glycine max [soybeans]
ref|XP_002275876.3|  PREDICTED: uncharacterized protein LOC100248423    300   1e-97    Vitis vinifera
ref|XP_010675306.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    300   4e-97    
emb|CBI15789.3|  unnamed protein product                                298   5e-97    
ref|NP_001242714.1|  uncharacterized protein LOC100777422               297   1e-96    
gb|ABK96682.1|  unknown                                                 298   2e-96    Populus trichocarpa x Populus deltoides
ref|XP_011008501.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    298   3e-96    
ref|XP_002319440.2|  hypothetical protein POPTR_0013s15650g             297   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_009384340.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    293   1e-94    
ref|XP_007146918.1|  hypothetical protein PHAVU_006G081700g             293   1e-94    
ref|XP_007205891.1|  hypothetical protein PRUPE_ppa011332mg             292   4e-94    
ref|XP_006432036.1|  hypothetical protein CICLE_v10002429mg             292   4e-94    
ref|XP_010094944.1|  NAD(P)H-quinone oxidoreductase subunit N           292   4e-94    
ref|XP_002532930.1|  conserved hypothetical protein                     291   1e-93    Ricinus communis
ref|XP_010931408.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    289   4e-93    
ref|XP_010547389.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    289   4e-93    
ref|XP_007017113.1|  NAD(P)H-quinone oxidoreductase subunit N           288   2e-92    
gb|KFK27356.1|  nad h-quinone oxidoreductase subunit n                  286   5e-92    
ref|XP_004139925.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    286   6e-92    
ref|XP_008456262.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    286   7e-92    
emb|CDY58568.1|  BnaC03g12480D                                          285   2e-91    
ref|XP_009132071.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    285   2e-91    
emb|CDX88664.1|  BnaA03g09850D                                          284   2e-91    
dbj|BAJ97096.1|  predicted protein                                      284   3e-91    
ref|XP_006401112.1|  hypothetical protein EUTSA_v10014691mg             283   5e-91    
ref|XP_002866255.1|  hypothetical protein ARALYDRAFT_495935             283   9e-91    
ref|XP_006281105.1|  hypothetical protein CARUB_v10027135mg             281   3e-90    
emb|CDM85445.1|  unnamed protein product                                281   5e-90    
ref|XP_003564780.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    281   7e-90    
ref|XP_006842609.1|  hypothetical protein AMTR_s00077p00172700          280   7e-90    
ref|NP_200634.1|  NADH dehydrogenase-like complex N                     280   8e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483397.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    280   1e-89    
ref|XP_010443544.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    280   2e-89    
ref|XP_010453389.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    279   3e-89    
ref|NP_001131237.1|  uncharacterized protein LOC100192546               281   4e-89    Zea mays [maize]
ref|XP_008672070.1|  PREDICTED: uncharacterized protein LOC100192...    279   4e-89    
ref|XP_006645131.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    278   5e-89    
ref|XP_010032946.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    278   1e-88    
ref|XP_004970778.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    277   2e-88    
ref|NP_001045009.1|  Os01g0882500                                       277   2e-88    Oryza sativa Japonica Group [Japonica rice]
gb|KDO54943.1|  hypothetical protein CISIN_1g027724mg                   275   1e-87    
ref|XP_002458868.1|  hypothetical protein SORBIDRAFT_03g041820          275   2e-87    Sorghum bicolor [broomcorn]
dbj|BAD82572.1|  hypothetical protein                                   278   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970779.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    255   8e-80    
emb|CCI55382.1|  NDH subunit NdhN                                       247   4e-76    
ref|XP_002970331.1|  hypothetical protein SELMODRAFT_441171             230   2e-69    
ref|XP_001756927.1|  predicted protein                                  224   2e-68    
ref|XP_002968095.1|  hypothetical protein SELMODRAFT_68704              222   8e-68    
ref|XP_006401110.1|  hypothetical protein EUTSA_v10014691mg             208   2e-62    
ref|NP_001119457.1|  NADH dehydrogenase-like complex N                  207   5e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009379133.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    204   1e-61    
gb|KCW52451.1|  hypothetical protein EUGRSUZ_J01847                     204   4e-60    
ref|XP_004970777.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    202   2e-59    
ref|XP_006432035.1|  hypothetical protein CICLE_v10002429mg             199   1e-58    
ref|XP_001771719.1|  predicted protein                                  172   8e-49    
ref|WP_006618174.1|  NAD(P)H-quinone oxidoreductase subunit N           146   2e-38    
ref|WP_015162691.1|  NADH-quinone oxidoreductase cyanobacterial s...    145   2e-38    
ref|WP_039714892.1|  NAD(P)H-quinone oxidoreductase                     145   2e-38    
gb|EMS58808.1|  NAD(P)H-quinone oxidoreductase subunit N                144   3e-38    
gb|EMT16212.1|  hypothetical protein F775_24410                         142   5e-38    
ref|WP_015152303.1|  hypothetical protein                               144   8e-38    
ref|XP_006371686.1|  hypothetical protein POPTR_0019s15340g             144   1e-37    
ref|WP_015141062.1|  NADH-quinone oxidoreductase cyanobacterial s...    142   4e-37    
ref|WP_009634257.1|  NADH-quinone oxidoreductase cyanobacterial s...    142   5e-37    
ref|WP_006620451.1|  NAD(P)H-quinone oxidoreductase subunit N           142   8e-37    
ref|WP_006669642.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    141   8e-37    
ref|WP_015169571.1|  NADH-quinone oxidoreductase cyanobacterial s...    140   1e-36    
ref|WP_015186031.1|  NADH-quinone oxidoreductase cyanobacterial s...    140   1e-36    
ref|WP_015187443.1|  NAD(P)H-quinone oxidoreductase subunit N           141   1e-36    
ref|WP_008190716.1|  NAD(P)H-quinone oxidoreductase subunit N           141   2e-36    
ref|WP_019492007.1|  NAD(P)H-quinone oxidoreductase subunit N           140   2e-36    
ref|WP_038080263.1|  NAD(P)H-quinone oxidoreductase                     140   2e-36    
ref|WP_026722092.1|  NAD(P)H-quinone oxidoreductase                     140   2e-36    
ref|WP_016859449.1|  NAD(P)H-quinone oxidoreductase subunit N           140   2e-36    
ref|WP_017748868.1|  NAD(P)H-quinone oxidoreductase subunit N           140   2e-36    
ref|WP_009629601.1|  NAD(P)H-quinone oxidoreductase subunit N           139   4e-36    
ref|WP_015144603.1|  NADH-quinone oxidoreductase cyanobacterial s...    139   4e-36    
ref|WP_015113432.1|  NAD(P)H-quinone oxidoreductase subunit N           139   5e-36    
ref|WP_012626089.1|  NAD(P)H-quinone oxidoreductase subunit N           139   5e-36    
ref|WP_015148969.1|  NADH-quinone oxidoreductase cyanobacterial s...    139   6e-36    
ref|WP_017310496.1|  NAD(P)H-quinone oxidoreductase subunit N           139   7e-36    
ref|WP_015231102.1|  NADH-quinone oxidoreductase cyanobacterial s...    139   7e-36    
ref|WP_012594139.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    139   8e-36    
ref|WP_009767999.1|  NADH-quinone oxidoreductase subunit NdhN           138   1e-35    
ref|WP_017721174.1|  NAD(P)H-quinone oxidoreductase subunit N           138   1e-35    
ref|WP_016868091.1|  NAD(P)H-quinone oxidoreductase subunit N           137   2e-35    
ref|WP_015178703.1|  NAD(P)H-quinone oxidoreductase subunit N           137   3e-35    
gb|KDO54945.1|  hypothetical protein CISIN_1g027724mg                   136   3e-35    
ref|WP_015200883.1|  NAD(P)H-quinone oxidoreductase subunit N           137   4e-35    
ref|WP_006635002.1|  NAD(P)H-quinone oxidoreductase subunit N           137   4e-35    
ref|WP_026786906.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase       137   4e-35    
ref|WP_018400630.1|  NAD(P)H-quinone oxidoreductase subunit N           137   4e-35    
ref|WP_016877803.1|  NAD(P)H-quinone oxidoreductase subunit N           136   5e-35    
ref|WP_009782751.1|  NAD(P)H-quinone oxidoreductase subunit N           136   6e-35    
ref|WP_015165961.1|  NAD(P)H-quinone oxidoreductase subunit N           136   7e-35    
ref|WP_007357053.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    136   7e-35    
ref|WP_017321345.1|  NAD(P)H-quinone oxidoreductase subunit N           136   7e-35    
ref|WP_011612523.1|  NAD(P)H-quinone oxidoreductase subunit N           136   7e-35    
ref|WP_017651192.1|  NAD(P)H-quinone oxidoreductase subunit N           136   8e-35    
ref|XP_006401111.1|  hypothetical protein EUTSA_v10014691mg             135   8e-35    
ref|WP_015208473.1|  NADH-quinone oxidoreductase cyanobacterial s...    136   9e-35    
ref|WP_015124201.1|  NADH-quinone oxidoreductase cyanobacterial s...    135   1e-34    
ref|WP_015203301.1|  NAD(P)H-quinone oxidoreductase subunit N           135   1e-34    
ref|WP_006196746.1|  NAD(P)H-quinone oxidoreductase subunit N           135   1e-34    
ref|WP_019501141.1|  hypothetical protein                               135   1e-34    
ref|WP_017297648.1|  hypothetical protein                               135   1e-34    
ref|WP_035156580.1|  NAD(P)H-quinone oxidoreductase                     135   2e-34    
ref|WP_011244174.1|  NAD(P)H-quinone oxidoreductase subunit N           135   2e-34    
ref|WP_016952990.1|  NAD(P)H-quinone oxidoreductase subunit N           135   2e-34    
ref|WP_017713404.1|  hypothetical protein                               135   2e-34    
ref|WP_015215910.1|  NAD(P)H-quinone oxidoreductase subunit N           135   2e-34    
ref|WP_026732545.1|  NAD(P)H-quinone oxidoreductase                     134   3e-34    
ref|WP_015223836.1|  hypothetical protein                               134   3e-34    
ref|WP_027844122.1|  NAD(P)H-quinone oxidoreductase                     134   4e-34    
ref|WP_021832141.1|  Putative subunit of NAD(P)H:quinone oxidored...    134   5e-34    
ref|WP_039724676.1|  NAD(P)H-quinone oxidoreductase                     134   5e-34    
ref|WP_015195234.1|  NAD(P)H-quinone oxidoreductase subunit N           134   6e-34    
ref|WP_008312973.1|  NADH-quinone oxidoreductase cyanobacterial s...    134   6e-34    
ref|WP_015129764.1|  NAD(P)H-quinone oxidoreductase subunit N           134   6e-34    
ref|WP_028085262.1|  NAD(P)H-quinone oxidoreductase                     134   7e-34    
ref|WP_036485254.1|  NAD(P)H-quinone oxidoreductase                     133   8e-34    
ref|WP_007303657.1|  NAD(P)H-quinone oxidoreductase subunit N           133   1e-33    
ref|WP_023069620.1|  NAD(P)H-quinone oxidoreductase subunit N           133   1e-33    
ref|WP_035991925.1|  NAD(P)H-quinone oxidoreductase                     132   1e-33    
ref|WP_024544425.1|  NAD(P)H-quinone oxidoreductase                     132   1e-33    
ref|WP_039754655.1|  NAD(P)H-quinone oxidoreductase                     132   2e-33    
ref|WP_009455505.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    132   2e-33    
ref|WP_006529920.1|  NADH-quinone oxidoreductase cyanobacterial s...    132   3e-33    
ref|WP_017314758.1|  NAD(P)H-quinone oxidoreductase subunit N           132   3e-33    
ref|WP_036002436.1|  NAD(P)H-quinone oxidoreductase                     132   3e-33    
ref|WP_006457216.1|  NAD(P)H-quinone oxidoreductase subunit N           131   4e-33    
ref|WP_024969975.1|  NAD(P)H-quinone oxidoreductase                     131   4e-33    
ref|WP_015170847.1|  NADH dehydrogenase I subunit N                     131   4e-33    
ref|WP_006106404.1|  NAD(P)H-quinone oxidoreductase subunit N           131   4e-33    
ref|WP_015956845.1|  NAD(P)H-quinone oxidoreductase subunit N           131   4e-33    
ref|WP_008199720.1|  NAD(P)H-quinone oxidoreductase subunit N           131   5e-33    
ref|WP_012953748.1|  NAD(P)H-quinone oxidoreductase subunit N           131   5e-33    
ref|WP_002747620.1|  NAD(P)H-quinone oxidoreductase subunit N           131   5e-33    
ref|WP_002735370.1|  NAD(P)H-quinone oxidoreductase subunit N           131   5e-33    
ref|WP_010998354.1|  NAD(P)H-quinone oxidoreductase subunit N           130   1e-32    
ref|WP_012410726.1|  NAD(P)H-quinone oxidoreductase subunit N           130   1e-32    
ref|WP_015134196.1|  NAD(P)H-quinone oxidoreductase subunit N           130   1e-32    
ref|WP_027402108.1|  NAD(P)H-quinone oxidoreductase                     130   1e-32    
ref|WP_030006246.1|  NAD(P)H-quinone oxidoreductase                     130   2e-32    
ref|WP_022605547.1|  NADH-quinone oxidoreductase cyanobacterial s...    130   2e-32    
ref|WP_009545435.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    129   2e-32    
ref|WP_039204347.1|  NAD(P)H-quinone oxidoreductase                     129   2e-32    
ref|WP_029635526.1|  NAD(P)H-quinone oxidoreductase [                   129   3e-32    
ref|WP_012306766.1|  NAD(P)H-quinone oxidoreductase subunit N           129   3e-32    
ref|WP_011317561.1|  NAD(P)H-quinone oxidoreductase subunit N           129   3e-32    
ref|WP_013323829.1|  NAD(P)H-quinone oxidoreductase subunit N           129   3e-32    
ref|WP_017303343.1|  NAD(P)H-quinone oxidoreductase subunit N           129   3e-32    
ref|WP_015227125.1|  NADH dehydrogenase I subunit N                     129   4e-32    
ref|WP_015079214.1|  NADH dehydrogenase I subunit N                     129   5e-32    
ref|WP_011056972.1|  NAD(P)H-quinone oxidoreductase subunit N           128   6e-32    
ref|WP_037217700.1|  NAD(P)H-quinone oxidoreductase                     128   1e-31    
ref|WP_012162191.1|  NAD(P)H-quinone oxidoreductase subunit N           127   1e-31    
ref|WP_024123974.1|  proton-translocating NADH-quinone dehydrogen...    127   1e-31    
ref|WP_010475916.1|  NAD(P)H-quinone oxidoreductase subunit N           127   1e-31    
ref|WP_015118714.1|  NADH-quinone oxidoreductase cyanobacterial s...    127   2e-31    
ref|WP_013191468.1|  NAD(P)H-quinone oxidoreductase subunit N           127   2e-31    
ref|WP_006508335.1|  NADH-quinone oxidoreductase cyanobacterial s...    126   3e-31    
ref|WP_017293731.1|  NAD(P)H-quinone oxidoreductase subunit N           126   3e-31    
ref|WP_008276508.1|  NAD(P)H-quinone oxidoreductase subunit N           126   4e-31    
dbj|BAP17164.1|  NADH dehydrogenase subunit N                           126   4e-31    
ref|WP_008231113.1|  Putative subunit of NAD(P)H:quinone oxidored...    126   5e-31    
ref|WP_023071165.1|  nad h-quinone oxidoreductase subunit n             125   7e-31    
ref|WP_019508881.1|  hypothetical protein                               125   9e-31    
ref|WP_008231769.1|  Putative subunit of NAD(P)H:quinone oxidored...    125   9e-31    
ref|WP_010872770.1|  NAD(P)H-quinone oxidoreductase subunit N           125   1e-30    
gb|KFF41962.1|  NADH-quinone oxidoreductase cyanobacterial subunit N    125   1e-30    
ref|WP_015219217.1|  NAD(P)H-quinone oxidoreductase subunit N           124   2e-30    
gb|AIE74752.1|  Putative subunit of NAD(P)H:quinone oxidoreductase      124   3e-30    
ref|WP_017659028.1|  hypothetical protein                               123   4e-30    
ref|WP_006276953.1|  NAD(P)H-quinone oxidoreductase subunit N           122   7e-30    
ref|XP_007220075.1|  hypothetical protein PRUPE_ppa024689mg             120   1e-29    
ref|WP_036532315.1|  NAD(P)H-quinone oxidoreductase                     122   2e-29    
ref|WP_006515916.1|  NADH-quinone oxidoreductase subunit NdhN           119   1e-28    
ref|WP_023172980.1|  NADH dehydrogenase I subunit N                     119   1e-28    
ref|WP_011143759.1|  NAD(P)H-quinone oxidoreductase subunit N           119   2e-28    
ref|WP_017328247.1|  hypothetical protein                               111   7e-26    
ref|WP_011434182.1|  NAD(P)H-quinone oxidoreductase subunit N           109   3e-25    
ref|WP_006173357.1|  NAD(P)H-quinone oxidoreductase subunit N           107   3e-24    
ref|WP_011429907.1|  NAD(P)H-quinone oxidoreductase subunit N           106   4e-24    
ref|WP_032516075.1|  NAD(P)H-quinone oxidoreductase                     106   6e-24    
ref|WP_025946467.1|  NAD(P)H-quinone oxidoreductase                     106   7e-24    
ref|WP_025960625.1|  NAD(P)H-quinone oxidoreductase                     106   8e-24    
ref|WP_025782570.1|  NAD(P)H-quinone oxidoreductase                     105   8e-24    
ref|WP_011821038.1|  NAD(P)H-quinone oxidoreductase subunit N           105   9e-24    
ref|WP_025960088.1|  NAD(P)H-quinone oxidoreductase                     105   1e-23    
ref|WP_032520054.1|  NAD(P)H-quinone oxidoreductase                     105   1e-23    
ref|WP_025937655.1|  NAD(P)H-quinone oxidoreductase                     105   1e-23    
ref|WP_025947016.1|  NAD(P)H-quinone oxidoreductase                     105   1e-23    
ref|WP_025952930.1|  NAD(P)H-quinone oxidoreductase                     105   1e-23    
ref|WP_011819171.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    105   2e-23    
ref|WP_002807100.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...    105   2e-23    
ref|WP_025927703.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase       105   2e-23    
ref|WP_025915160.1|  NAD(P)H-quinone oxidoreductase                     104   2e-23    
ref|WP_025965040.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase       104   2e-23    
ref|WP_025956996.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase       104   2e-23    
ref|WP_025934044.1|  NAD(P)H-quinone oxidoreductase                     104   3e-23    
ref|WP_025939943.1|  NAD(P)H-quinone oxidoreductase                     104   3e-23    
ref|WP_025938713.1|  NAD(P)H-quinone oxidoreductase                     104   3e-23    
ref|WP_025893594.1|  NAD(P)H-quinone oxidoreductase                     104   4e-23    
ref|WP_011377193.1|  NAD(P)H-quinone oxidoreductase subunit N           104   4e-23    
ref|WP_025980675.1|  NAD(P)H-quinone oxidoreductase                     104   4e-23    
ref|WP_025953317.1|  NAD(P)H-quinone oxidoreductase                     103   4e-23    
ref|WP_025923893.1|  NAD(P)H-quinone oxidoreductase                     103   7e-23    
ref|WP_025974120.1|  NAD(P)H-quinone oxidoreductase                     103   7e-23    
ref|WP_025922644.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase       103   1e-22    
ref|WP_011863661.1|  NAD(P)H-quinone oxidoreductase subunit N           102   1e-22    
ref|WP_011824515.1|  NAD(P)H-quinone oxidoreductase subunit N           102   1e-22    
ref|WP_011133187.1|  NAD(P)H-quinone oxidoreductase subunit N           102   1e-22    
ref|WP_032526277.1|  NAD(P)H-quinone oxidoreductase                     102   2e-22    
ref|WP_025930948.1|  NAD(P)H-quinone oxidoreductase                     102   2e-22    
ref|WP_011295474.1|  NAD(P)H-quinone oxidoreductase subunit N           102   2e-22    
ref|WP_032513745.1|  NAD(P)H-quinone oxidoreductase                     101   2e-22    
ref|WP_036904547.1|  NAD(P)H-quinone oxidoreductase                     101   3e-22    
ref|WP_032517886.1|  NAD(P)H-quinone oxidoreductase                     101   3e-22    
ref|WP_035830866.1|  NAD(P)H-quinone oxidoreductase                     101   4e-22    
ref|WP_011128924.1|  NAD(P)H-quinone oxidoreductase subunit N           101   4e-22    
ref|WP_038543152.1|  NAD(P)H-quinone oxidoreductase                     100   6e-22    
ref|WP_032521980.1|  NAD(P)H-quinone oxidoreductase                     100   1e-21    
ref|WP_011618400.1|  NAD(P)H-quinone oxidoreductase subunit N         99.0    3e-21    
ref|WP_037988730.1|  NAD(P)H-quinone oxidoreductase                   98.6    3e-21    
ref|WP_006910056.1|  NAD(P)H-quinone oxidoreductase subunit N         98.6    3e-21    
gb|EAU70213.1|  NADH dehydrogenase I subunit N                        98.6    4e-21    Synechococcus sp. BL107
ref|WP_028953638.1|  NAD(P)H-quinone oxidoreductase                   98.2    4e-21    
ref|WP_011360712.1|  NAD(P)H-quinone oxidoreductase subunit N         97.8    6e-21    
gb|AII46930.1|  NAD(P)H-quinone oxidoreductase subunit N              97.4    7e-21    
ref|WP_038654363.1|  NAD(P)H-quinone oxidoreductase                   97.4    7e-21    
gb|KGG13583.1|  putative subunit of NAD(P)H:quinone oxidoreductase    97.1    1e-20    
ref|WP_010311677.1|  NAD(P)H-quinone oxidoreductase subunit N         97.1    1e-20    
ref|WP_036900672.1|  NAD(P)H-quinone oxidoreductase                   96.7    1e-20    
ref|WP_010314930.1|  NAD(P)H-quinone oxidoreductase subunit N         96.7    2e-20    
ref|WP_011936529.1|  NAD(P)H-quinone oxidoreductase subunit N         95.5    4e-20    
ref|WP_015109399.1|  NADH-quinone oxidoreductase cyanobacterial s...  94.4    9e-20    
ref|WP_006854829.1|  NAD(P)H-quinone oxidoreductase subunit N         94.4    1e-19    
ref|WP_038551161.1|  NAD(P)H-quinone oxidoreductase                   94.0    2e-19    
ref|WP_036919370.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase     93.6    2e-19    
gb|KGG14675.1|  putative subunit of NAD(P)H:quinone oxidoreductase    93.6    2e-19    
ref|WP_011363390.1|  NAD(P)H-quinone oxidoreductase subunit N         93.2    3e-19    
gb|AHF62790.1|  NADH dehydrogenase I subunit N                        92.8    4e-19    
ref|WP_012196230.1|  NAD(P)H-quinone oxidoreductase subunit N         92.4    6e-19    
ref|WP_019476970.1|  NAD(P)H-quinone oxidoreductase subunit N         92.0    7e-19    
ref|WP_036922426.1|  NAD(P)H-quinone oxidoreductase                   92.0    8e-19    
ref|WP_019474312.1|  NAD(P)H-quinone oxidoreductase subunit N         91.3    1e-18    
ref|WP_011932349.1|  NAD(P)H-quinone oxidoreductase subunit N         91.3    1e-18    
ref|WP_019477863.1|  NAD(P)H-quinone oxidoreductase subunit N         91.3    2e-18    
ref|WP_011131098.1|  NAD(P)H-quinone oxidoreductase subunit N         90.9    2e-18    
ref|WP_007100615.1|  NAD(P)H-quinone oxidoreductase subunit N         90.9    2e-18    
ref|WP_036899710.1|  NAD(P)H-quinone oxidoreductase                   90.5    2e-18    
ref|WP_036912635.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase     90.5    2e-18    
ref|WP_011826904.1|  NAD(P)H-quinone oxidoreductase subunit N         90.5    2e-18    
ref|WP_006042202.1|  NAD(P)H-quinone oxidoreductase subunit N         90.1    3e-18    
ref|WP_011125862.1|  MULTISPECIES: NAD(P)H-quinone oxidoreductase...  90.1    3e-18    
gb|KGG21170.1|  putative subunit of NAD(P)H:quinone oxidoreductase    90.1    4e-18    
ref|WP_007099889.1|  NAD(P)H-quinone oxidoreductase subunit N         87.4    3e-17    
ref|WP_025934563.1|  NAD(P)H-quinone oxidoreductase                   86.7    4e-17    
ref|YP_002049238.1|  hypothetical protein PCC_0598                    82.8    1e-15    
ref|WP_025943059.1|  NAD(P)H-quinone oxidoreductase                   73.2    2e-12    
ref|WP_025895068.1|  NAD(P)H-quinone oxidoreductase                   72.8    2e-12    
ref|WP_025958600.1|  NAD(P)H-quinone oxidoreductase                   72.0    4e-12    
ref|WP_009344509.1|  NADH dehydrogenase I subunit N                   68.2    1e-10    
ref|WP_025958035.1|  NAD(P)H-quinone oxidoreductase                   62.0    2e-08    
ref|WP_025943438.1|  hypothetical protein                             48.9    4e-04    



>ref|XP_009773633.1| PREDICTED: uncharacterized protein LOC104223835 [Nicotiana sylvestris]
Length=246

 Score =   358 bits (920),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 196/241 (81%), Gaps = 10/241 (4%)
 Frame = +2

Query  98   MATP-STLSSALPRRFLTNNAAPTRRR---IASLEDQPCSSSACYSG-----GFRKKQLV  250
            MAT  STLS A   RFL  N    R R     S E+QPCSSSACY G     G +K+++ 
Sbjct  1    MATAASTLSYAFSSRFLIKNNGSFRHRPNVTLSTEEQPCSSSACYQGAILSYGLQKQRVQ  60

Query  251  AITAGKWGWMGRQQR-KTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHE  427
              +  K   M R  R K A VRC++ +EDFIGGDL+  DLG+WLSDVEEHKALAIY PHE
Sbjct  61   LNSTSKTMTMRRLGRQKKAVVRCNIELEDFIGGDLIKLDLGQWLSDVEEHKALAIYSPHE  120

Query  428  GGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDY  607
            GGYEGRY TRL+YQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDY
Sbjct  121  GGYEGRYLTRLKYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDY  180

Query  608  RLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEI  787
            RLSLLPP+AKGLVVWIIEAKVLSKAELQFLALLP+LRPKV+VIAECGNWRKFMWKPLKEI
Sbjct  181  RLSLLPPNAKGLVVWIIEAKVLSKAELQFLALLPSLRPKVKVIAECGNWRKFMWKPLKEI  240

Query  788  A  790
            A
Sbjct  241  A  241



>ref|XP_009600934.1| PREDICTED: uncharacterized protein LOC104096284 [Nicotiana tomentosiformis]
Length=251

 Score =   354 bits (909),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 198/247 (80%), Gaps = 17/247 (7%)
 Frame = +2

Query  98   MATP-STLSSALPR--RFLTNNAAPTRRR---IASLEDQPCSSSACYSG-----GFRKKQ  244
            MAT  STLS A     RFL  N   +R R     S E+QPCSSSACY G     G +K++
Sbjct  1    MATAASTLSYAFSSSSRFLIKNNGYSRHRPNVTLSTEEQPCSSSACYQGALLSYGLQKQR  60

Query  245  LVAITAGKWGWMGR-----QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALA  409
            +      K   M R     +Q+KT  VRCS+ +EDFIGGDL+  DLG+WLSDVEEHKALA
Sbjct  61   VQINCTSKTMTMRRLRSVGRQKKTV-VRCSIELEDFIGGDLIKLDLGQWLSDVEEHKALA  119

Query  410  IYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYF  589
            IY PHEGGYEGRY TRL+YQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYF
Sbjct  120  IYSPHEGGYEGRYLTRLKYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYF  179

Query  590  PPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMW  769
            PPEVDYRLSLLPP+AKGLVVWIIEAKVLSKAELQFLALLPTLRPKV+VIAECGNWRKFMW
Sbjct  180  PPEVDYRLSLLPPNAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVKVIAECGNWRKFMW  239

Query  770  KPLKEIA  790
            KPLKEIA
Sbjct  240  KPLKEIA  246



>ref|XP_004247632.1| PREDICTED: uncharacterized protein LOC101265478 [Solanum lycopersicum]
Length=253

 Score =   350 bits (897),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 194/235 (83%), Gaps = 15/235 (6%)
 Frame = +2

Query  134  RRFL-TNNAAPTRRR-IASLEDQPCSSSACYSGGFR----KKQLV-------AITAGKWG  274
            RRFL T+N +  RRR   S EDQPCSSSACY G  +    ++Q V       A+   +  
Sbjct  19   RRFLITSNGSSCRRRPNISTEDQPCSSSACYQGAVQSYGLQRQRVQLNGISKAVRTRRLD  78

Query  275  WMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFT  454
             +GRQ  K   +RC++ ++DFIGGDL+  DLG+WLSDVEEHKA+AIY PHEGGYEGRY T
Sbjct  79   SVGRQ--KKGAIRCNIELQDFIGGDLIKPDLGQWLSDVEEHKAIAIYSPHEGGYEGRYLT  136

Query  455  RLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA  634
            RL+YQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA
Sbjct  137  RLKYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA  196

Query  635  KGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
            KGLVVWIIEAKVLSKAELQFLALLPTLRP VRVIAECGNWRKFMWKPLKEIA+ S
Sbjct  197  KGLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFMWKPLKEIADLS  251



>ref|XP_006362179.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Solanum tuberosum]
Length=256

 Score =   349 bits (896),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/232 (75%), Positives = 194/232 (84%), Gaps = 15/232 (6%)
 Frame = +2

Query  134  RRFL-TNNAAPTRRR-IASLEDQPCSSSACYSGGFR----KKQLV-------AITAGKWG  274
            RRFL T+N +  RRR  +S EDQPCSSSACY G  +    +KQ V       A+   + G
Sbjct  22   RRFLITSNGSSCRRRPNSSTEDQPCSSSACYQGAVQSYGLQKQRVQLNSLSKAMRMRRLG  81

Query  275  WMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFT  454
             +GRQ  K   +RC++ ++DFIGGDL+  DLG+WLSDVEEHKA+AIY PHEGGYEGRY T
Sbjct  82   SVGRQ--KKGAIRCNIELQDFIGGDLIKPDLGQWLSDVEEHKAIAIYSPHEGGYEGRYLT  139

Query  455  RLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA  634
            RL+YQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPD+
Sbjct  140  RLKYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDS  199

Query  635  KGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            KGLVVWIIEAKVLSKAELQFLALLPTLRP VRVIAECGNWRKF+WKPLKEIA
Sbjct  200  KGLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFVWKPLKEIA  251



>ref|XP_011080626.1| PREDICTED: uncharacterized protein LOC105163833 [Sesamum indicum]
Length=216

 Score =   319 bits (817),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +2

Query  296  KTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGY  475
            K +  RCSV +EDFIGGDLV FDLG+WLSDVEEHKALAIY PHEGGYEGRY  RLRYQGY
Sbjct  43   KKSITRCSVSLEDFIGGDLVKFDLGQWLSDVEEHKALAIYSPHEGGYEGRYLNRLRYQGY  102

Query  476  HFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWI  655
            HFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWI
Sbjct  103  HFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWI  162

Query  656  IEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            IEAKVLSKAELQFLA+LP+LRP+VRVIAECGNWRKF+W PLKEIA
Sbjct  163  IEAKVLSKAELQFLAILPSLRPRVRVIAECGNWRKFIWTPLKEIA  207



>emb|CDP06895.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   317 bits (812),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 161/173 (93%), Gaps = 1/173 (1%)
 Frame = +2

Query  272  GWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYF  451
            G  G   RKT +V C+V +EDFIGGDL+ FDLG+WLSDVEEHKALAIYPPHEGGYEGRY 
Sbjct  43   GGGGGHCRKT-NVACNVSLEDFIGGDLLKFDLGQWLSDVEEHKALAIYPPHEGGYEGRYL  101

Query  452  TRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPD  631
             RLRYQGY+FLDL+ARGLGDPETTLTKFHPVCP HVGKQPIARWYFPPEVDYRLSLLPP+
Sbjct  102  NRLRYQGYYFLDLTARGLGDPETTLTKFHPVCPPHVGKQPIARWYFPPEVDYRLSLLPPN  161

Query  632  AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            AKGLVVWIIEAKVLSKAELQFLALLPTLRP+VRVIAECGNWRKFMWKPLKEIA
Sbjct  162  AKGLVVWIIEAKVLSKAELQFLALLPTLRPRVRVIAECGNWRKFMWKPLKEIA  214



>ref|XP_010244596.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Nelumbo nucifera]
Length=203

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 157/165 (95%), Gaps = 2/165 (1%)
 Frame = +2

Query  296  KTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGY  475
            + A VRC  GIEDFIGGDLV FDLG+WLSDVEEHKALAIY PHEGGYEGRY TRLRYQGY
Sbjct  31   RMASVRC--GIEDFIGGDLVRFDLGRWLSDVEEHKALAIYTPHEGGYEGRYLTRLRYQGY  88

Query  476  HFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWI  655
            +FLDLSARGLGDPETTLTK HPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA+GLV+WI
Sbjct  89   YFLDLSARGLGDPETTLTKIHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDARGLVLWI  148

Query  656  IEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            IEAKVLSK+ELQFLALLP+LRPKV+VIAECGNWR+FMWKPLKEIA
Sbjct  149  IEAKVLSKSELQFLALLPSLRPKVKVIAECGNWRRFMWKPLKEIA  193



>gb|EYU46045.1| hypothetical protein MIMGU_mgv1a013330mg [Erythranthe guttata]
Length=223

 Score =   313 bits (802),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +2

Query  296  KTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGY  475
            + + ++C   IEDFIGGDL+ FDLG+WLSDVEEHK+LAIYPPHEGGYEGRY  RLRY+GY
Sbjct  47   RKSVIKCGRSIEDFIGGDLLRFDLGQWLSDVEEHKSLAIYPPHEGGYEGRYLNRLRYKGY  106

Query  476  HFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWI  655
            HFLD+SARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVW+
Sbjct  107  HFLDISARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWV  166

Query  656  IEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            IEAKVLSKAELQFLA+LP+LRP+VRVIAECGNWRKFMWKPLKEIA
Sbjct  167  IEAKVLSKAELQFLAILPSLRPRVRVIAECGNWRKFMWKPLKEIA  211



>gb|KDP45668.1| hypothetical protein JCGZ_17275 [Jatropha curcas]
Length=223

 Score =   311 bits (798),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = +2

Query  239  KQLVAITAGKWGWMGRQQRKTADVRCS-VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIY  415
            K+ + +  G   W  R +     V+CS +GIEDFIGGDL+ FDLG+WLSDVEEHKALAIY
Sbjct  29   KRNIMLPTGGEAWTTRGRTGIRVVKCSGIGIEDFIGGDLLKFDLGRWLSDVEEHKALAIY  88

Query  416  PPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPP  595
             PHEGGYEGRY  RLRYQGY+FLDLSARGLGDPETTLTK HPVCPAH+GKQPIARWYFPP
Sbjct  89   SPHEGGYEGRYLNRLRYQGYYFLDLSARGLGDPETTLTKIHPVCPAHLGKQPIARWYFPP  148

Query  596  EVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKP  775
            EVDYRL+ LPPDAKGLVVWIIEAKVLSKAELQFLALLP+LRPKVRVIAECGNWRKF+WKP
Sbjct  149  EVDYRLAALPPDAKGLVVWIIEAKVLSKAELQFLALLPSLRPKVRVIAECGNWRKFVWKP  208

Query  776  LKEIA  790
            LKEIA
Sbjct  209  LKEIA  213



>ref|XP_008354213.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Malus domestica]
Length=231

 Score =   308 bits (788),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = +2

Query  227  GFRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKAL  406
            G R   L+   +G  G  G+  ++   +RC  GIEDFIGGDLV FDLG+WLSDVEEHKAL
Sbjct  38   GNRSMMLLMGLSGGHG-NGKASKRAGIIRCGRGIEDFIGGDLVRFDLGRWLSDVEEHKAL  96

Query  407  AIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWY  586
            A+Y PHEGGYEGRY  RL YQGY+FLDLSARGLGDPETTLTK HPVCP H+GKQPI+RWY
Sbjct  97   AVYSPHEGGYEGRYLNRLTYQGYYFLDLSARGLGDPETTLTKVHPVCPPHLGKQPISRWY  156

Query  587  FPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFM  766
            FPPEVDYRL+ LPP AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKF+
Sbjct  157  FPPEVDYRLAALPPKAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFV  216

Query  767  WKPLKEIA  790
            WKPLKEI+
Sbjct  217  WKPLKEIS  224



>ref|XP_008238394.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Prunus mume]
Length=230

 Score =   307 bits (786),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 165/199 (83%), Gaps = 1/199 (1%)
 Frame = +2

Query  197  PCSSSACYSGGFRKKQLVAITAGKWGWMGRQQRKTADVRCS-VGIEDFIGGDLVWFDLGK  373
            P  +S   +   +  + + +  G  G  G+  ++   +RCS   IEDFIGGDLV FDLG+
Sbjct  25   PPRNSCSINNELKGHRNMMLMMGLSGRHGKASKRVGMIRCSGRSIEDFIGGDLVRFDLGR  84

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            WLSDVEEHKALA+Y PHEGGYEGRY  RLRYQGY+FLDLSARGLGDPETTLTK HPVCP 
Sbjct  85   WLSDVEEHKALAVYSPHEGGYEGRYLNRLRYQGYYFLDLSARGLGDPETTLTKVHPVCPP  144

Query  554  HVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
            H+GKQPI+RWYFPPEVDYRL+ LPP AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV
Sbjct  145  HLGKQPISRWYFPPEVDYRLAALPPKAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  204

Query  734  IAECGNWRKFMWKPLKEIA  790
            IAECGNWRKF+WKPLKEI+
Sbjct  205  IAECGNWRKFVWKPLKEIS  223



>ref|XP_008359040.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Malus domestica]
Length=231

 Score =   307 bits (786),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  227  GFRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKAL  406
            G R   L+    G  G  G+  ++   +RC  GIEDFIGGDLV FDLG+WLSDVEEHKAL
Sbjct  38   GNRSMVLMVGLCGGHG-NGKASKRAGMIRCGRGIEDFIGGDLVRFDLGRWLSDVEEHKAL  96

Query  407  AIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWY  586
            A+Y PHEGGYEGRY  RL YQGY+FLDLSARGLGDPETTLTK HPVCP H+GKQPI+RWY
Sbjct  97   AVYSPHEGGYEGRYLNRLTYQGYYFLDLSARGLGDPETTLTKVHPVCPPHLGKQPISRWY  156

Query  587  FPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFM  766
            FPPEVDYRL+ LPP AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKF+
Sbjct  157  FPPEVDYRLAALPPKAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFV  216

Query  767  WKPLKEIA  790
            WKPLKEI+
Sbjct  217  WKPLKEIS  224



>ref|XP_004500401.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N-like [Cicer 
arietinum]
Length=203

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  293  RKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQG  472
            R    VRCS+GI DFIGGDLV FD+G+WLSDVE+HKALAIY PHEGGYEGRY +RL+ QG
Sbjct  30   RSKRVVRCSLGIGDFIGGDLVKFDIGRWLSDVEQHKALAIYTPHEGGYEGRYLSRLQRQG  89

Query  473  YHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVW  652
            Y+FLDLSARGLGDPETTLTK HPVCPAH+GKQPIARWYFPPEVDYRL  LPP+AKGLVVW
Sbjct  90   YYFLDLSARGLGDPETTLTKVHPVCPAHLGKQPIARWYFPPEVDYRLEALPPNAKGLVVW  149

Query  653  IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPL EIA
Sbjct  150  IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLSEIA  195



>ref|XP_009374416.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Pyrus x bretschneideri]
Length=231

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  227  GFRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKAL  406
            G R   L+    G  G  G+  ++   +RC  GIEDFIGGDLV FDLG+WLSDVEEHKAL
Sbjct  38   GNRSMVLMVGLCGGHG-SGKASKRAGMIRCGRGIEDFIGGDLVRFDLGRWLSDVEEHKAL  96

Query  407  AIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWY  586
            A+Y PHEGGYEGRY  RL YQGY+FLDLSARGLGDPETTLTK HPVCP H+GKQPI+RWY
Sbjct  97   AVYSPHEGGYEGRYLNRLTYQGYYFLDLSARGLGDPETTLTKVHPVCPPHLGKQPISRWY  156

Query  587  FPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFM  766
            FPPEVDYRL+ LPP AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKF+
Sbjct  157  FPPEVDYRLAALPPKAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFV  216

Query  767  WKPLKEIA  790
            WKPLKEI+
Sbjct  217  WKPLKEIS  224



>ref|XP_009355285.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Pyrus x bretschneideri]
Length=231

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  281  GRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRL  460
            G+  ++   +RC  GIEDFIGGDLV FDLG+WLSD+EEHKALA+Y PHEGGYEGRY  RL
Sbjct  55   GKGSKRAGMIRCGRGIEDFIGGDLVRFDLGRWLSDMEEHKALAVYSPHEGGYEGRYLNRL  114

Query  461  RYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKG  640
             YQGY+FLDLSARGLGDPETTLTK HPVCP H+GKQPI+RWYFPPEVDYRL+ LPP AKG
Sbjct  115  TYQGYYFLDLSARGLGDPETTLTKVHPVCPPHLGKQPISRWYFPPEVDYRLAALPPKAKG  174

Query  641  LVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            LVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKF+WKPLKEI+
Sbjct  175  LVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFVWKPLKEIS  224



>ref|XP_008788045.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Phoenix dactylifera]
Length=205

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 158/171 (92%), Gaps = 3/171 (2%)
 Frame = +2

Query  281  GRQQRKTA-DVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
            GR+QR+TA  VRC  G+ DFIGGD V  DLG++L DVE+HKALAIYPPHEGGYEGRY TR
Sbjct  21   GRRQRRTAATVRC--GLADFIGGDFVRPDLGRFLEDVEKHKALAIYPPHEGGYEGRYLTR  78

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            LRYQGY FLDLSARGLGDPETTLTK HPVCP H+G+QPIARWYFPPEVDYRLSLLPP+AK
Sbjct  79   LRYQGYRFLDLSARGLGDPETTLTKIHPVCPPHLGRQPIARWYFPPEVDYRLSLLPPNAK  138

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            GLVVWIIEAKVLSKAELQFLALLP+LRPKVRVIAECGNWRKF+WKPL+EIA
Sbjct  139  GLVVWIIEAKVLSKAELQFLALLPSLRPKVRVIAECGNWRKFVWKPLREIA  189



>ref|XP_003553172.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Glycine max]
 gb|KHN18637.1| NAD(P)H-quinone oxidoreductase subunit N [Glycine soja]
Length=229

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 175/231 (76%), Gaps = 10/231 (4%)
 Frame = +2

Query  98   MATPSTLSSALPRRFLTNNAAPTRRRIASLEDQPCSSSACYSGGFRKKQLVAITAGKWGW  277
            M++ ++L    P  F  NN   T++       Q    ++  S      +++    G+ G 
Sbjct  1    MSSTASLGYGAPTCF--NNVHHTKK-------QQAMRNSFLSNKHNSVRVMKGWRGRHGN  51

Query  278  MGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
                 ++   V+C  G+ DFIGGDL+ FDLG+WLSDVEEHKALAIYPPHEGGYEGRY +R
Sbjct  52   TNNTSKRVGIVQCR-GLGDFIGGDLIKFDLGRWLSDVEEHKALAIYPPHEGGYEGRYLSR  110

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L+ QGY+FLDL+ARGLGDPETTLTK HPVCP HVGKQPIARWYFPPEVDYRL  LPP+AK
Sbjct  111  LKRQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYRLEALPPNAK  170

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            GLVVWIIEAKVLSKAELQFLALLPTLRP VRVIAECGNWRKFMWKPLKEIA
Sbjct  171  GLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFMWKPLKEIA  221



>ref|XP_003600578.1| NAD(P)H-quinone oxidoreductase subunit N [Medicago truncatula]
 gb|AES70829.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Medicago 
truncatula]
Length=224

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 157/178 (88%), Gaps = 5/178 (3%)
 Frame = +2

Query  272  GWMGRQ---QRKTADVRCS--VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGY  436
            GW G+Q    R    V+CS  +G+ DFIGGDLV FD+G+WLSDVEEHKALAIY PHEGGY
Sbjct  39   GWRGKQCNSNRSKRVVKCSSGIGLGDFIGGDLVKFDIGRWLSDVEEHKALAIYTPHEGGY  98

Query  437  EGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLS  616
            EGRY +RL+ QGY+FLDL+ARGLGDPETTLTK HPVCPAH+GKQPIARWYFPPEVDYRL 
Sbjct  99   EGRYLSRLQRQGYYFLDLTARGLGDPETTLTKVHPVCPAHLGKQPIARWYFPPEVDYRLE  158

Query  617  LLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
             LPP+AKGLVVWIIEAKVLSKAELQFLALLPTLRP VRVIAECGNWRKFMWKPL EIA
Sbjct  159  ALPPNAKGLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFMWKPLNEIA  216



>ref|XP_006590280.1| PREDICTED: uncharacterized protein LOC100777422 isoform X1 [Glycine 
max]
 gb|KHN24707.1| NAD(P)H-quinone oxidoreductase subunit N [Glycine soja]
Length=228

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 156/180 (87%), Gaps = 8/180 (4%)
 Frame = +2

Query  272  GWMGRQ-------QRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEG  430
            GW GR        +R    V+C  G+ DFIGGDL+ FDLG+WLSDVEEHKALAIYPPHEG
Sbjct  42   GWRGRHGNNCNTSKRVVGVVQCR-GLGDFIGGDLIKFDLGRWLSDVEEHKALAIYPPHEG  100

Query  431  GYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYR  610
            GYEGRY +RL+ QGY+FLDL+ARGLGDPETTLTK HPVCP HVGKQPIARWYFPPEVDYR
Sbjct  101  GYEGRYLSRLKRQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYR  160

Query  611  LSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            L  LPP+AKGLVVWIIEAKVLSKAELQFLALLPTLRP VRVIAECGNWRKFMWKPLKEIA
Sbjct  161  LEALPPNAKGLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFMWKPLKEIA  220



>ref|XP_004294851.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N-like [Fragaria 
vesca subsp. vesca]
Length=223

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 166/207 (80%), Gaps = 10/207 (5%)
 Frame = +2

Query  179  ASLEDQPCSSSACYSG--GFRKKQLVAITAGKWGWMGRQQRKTADVRCS-VGIEDFIGGD  349
            A+L+ Q    + C     G R  +L+       G  G+   K+  + C+   I DFIGGD
Sbjct  17   ANLQHQQPRRNNCMVNMAGNRNMRLM-------GGYGKASNKSGIITCAGRDISDFIGGD  69

Query  350  LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLT  529
            LV FDLG+WLSDVEEHKALA+Y PHEGGYEGRY  RL YQGY+FLDLSARGLGDPETTLT
Sbjct  70   LVRFDLGQWLSDVEEHKALAVYSPHEGGYEGRYLNRLTYQGYYFLDLSARGLGDPETTLT  129

Query  530  KFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            K HPVCPAH+GKQPIARWYFPPEVDYRL+ LPP AKGLVVWIIEAKVLSKAELQFLALLP
Sbjct  130  KVHPVCPAHLGKQPIARWYFPPEVDYRLAALPPKAKGLVVWIIEAKVLSKAELQFLALLP  189

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEIA  790
            TLRPKVRVIAECGNWR+FMWKPLKEI+
Sbjct  190  TLRPKVRVIAECGNWRRFMWKPLKEIS  216



>gb|ACU23851.1| unknown [Glycine max]
Length=229

 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 174/231 (75%), Gaps = 10/231 (4%)
 Frame = +2

Query  98   MATPSTLSSALPRRFLTNNAAPTRRRIASLEDQPCSSSACYSGGFRKKQLVAITAGKWGW  277
            M++ ++L    P  F  NN   T++       Q    ++  S      +++    G+ G 
Sbjct  1    MSSTASLGYGAPTCF--NNVHHTKK-------QQAMRNSFLSNKHNSVRVMKGWRGRHGN  51

Query  278  MGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
                 ++   V+C  G+ DFIGGDL+ FDLG+WLSDVEEHKALAIYPPHEGGYEGRY +R
Sbjct  52   TNNTSKRVGIVQCR-GLGDFIGGDLIKFDLGRWLSDVEEHKALAIYPPHEGGYEGRYLSR  110

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L+ QGY+FLDL+ARGLGDPETTLTK HPVCP HVGKQPIARWYFPPEVDYRL  LPP+AK
Sbjct  111  LKRQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYRLEALPPNAK  170

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            GLVVWIIEAKVLSKAELQFLALLPTLRP VRVI ECGNWRKFMWKPLKEIA
Sbjct  171  GLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIVECGNWRKFMWKPLKEIA  221



>ref|XP_002275876.3| PREDICTED: uncharacterized protein LOC100248423 [Vitis vinifera]
Length=216

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 6/167 (4%)
 Frame = +2

Query  308  VRCSVGIE------DFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQ  469
            VRCS G        D +GGDLV  DLG+WLSDVEEHKALAIY PHEGGYEGRY  RLRYQ
Sbjct  42   VRCSGGGGGGIGIGDLVGGDLVKLDLGRWLSDVEEHKALAIYSPHEGGYEGRYLNRLRYQ  101

Query  470  GYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVV  649
            GY+FLDLSARGLGDPETTLT+ HPVCPAHVGKQPIARWYFPPEVDYRLSLLPP+AKGLVV
Sbjct  102  GYYFLDLSARGLGDPETTLTEIHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPNAKGLVV  161

Query  650  WIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            WIIEAKVLSK+ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  162  WIIEAKVLSKSELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  208



>ref|XP_010675306.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Beta vulgaris subsp. vulgaris]
Length=227

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 156/176 (89%), Gaps = 3/176 (2%)
 Frame = +2

Query  272  GWMGRQQRKTADV-RCS--VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEG  442
            G   R QR+  +V RCS  +GI+DFIGGDL+ FDLG WLSDVEEHK+LAIY PHEGGYEG
Sbjct  44   GSRNRVQRRARNVIRCSSGIGIKDFIGGDLLKFDLGTWLSDVEEHKSLAIYVPHEGGYEG  103

Query  443  RYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLL  622
            RY  RLRYQGYHFLD+SARGLGDPE TLTK HPVCP H+GKQPIARW+FPPE+DYRL  L
Sbjct  104  RYLNRLRYQGYHFLDISARGLGDPEATLTKVHPVCPPHLGKQPIARWWFPPEIDYRLEAL  163

Query  623  PPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            P DAKGLVVW+IEAKVLSK+ELQFLALLP+LRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  164  PSDAKGLVVWVIEAKVLSKSELQFLALLPSLRPKVRVIAECGNWRKFMWKPLKEIA  219



>emb|CBI15789.3| unnamed protein product [Vitis vinifera]
Length=187

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 6/167 (4%)
 Frame = +2

Query  308  VRCSVGIE------DFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQ  469
            VRCS G        D +GGDLV  DLG+WLSDVEEHKALAIY PHEGGYEGRY  RLRYQ
Sbjct  13   VRCSGGGGGGIGIGDLVGGDLVKLDLGRWLSDVEEHKALAIYSPHEGGYEGRYLNRLRYQ  72

Query  470  GYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVV  649
            GY+FLDLSARGLGDPETTLT+ HPVCPAHVGKQPIARWYFPPEVDYRLSLLPP+AKGLVV
Sbjct  73   GYYFLDLSARGLGDPETTLTEIHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPNAKGLVV  132

Query  650  WIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            WIIEAKVLSK+ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  133  WIIEAKVLSKSELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  179



>ref|NP_001242714.1| uncharacterized protein LOC100777422 [Glycine max]
 gb|ACU20242.1| unknown [Glycine max]
Length=192

 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 156/180 (87%), Gaps = 8/180 (4%)
 Frame = +2

Query  272  GWMGRQ-------QRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEG  430
            GW GR        +R    V+C  G+ DFIGGDL+ FDLG+WLSDVEEHKALAIYPPHEG
Sbjct  6    GWRGRHGNNCNTSKRVVGVVQCR-GLGDFIGGDLIKFDLGRWLSDVEEHKALAIYPPHEG  64

Query  431  GYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYR  610
            GYEGRY +RL+ QGY+FLDL+ARGLGDPETTLTK HPVCP HVGKQPIARWYFPPEVDYR
Sbjct  65   GYEGRYLSRLKRQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYR  124

Query  611  LSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            L  LPP+AKGLVVWIIEAKVLSKAELQFLALLPTLRP VRVIAECG+WRKFMWKPLKEIA
Sbjct  125  LEALPPNAKGLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGDWRKFMWKPLKEIA  184



>gb|ABK96682.1| unknown [Populus trichocarpa x Populus deltoides]
Length=231

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = +2

Query  158  APTRRRIASLEDQPCSSSACYSGGFRKKQLVAITAGKWGWMGRQQRKTADVRCS-VGIED  334
            AP    +   + + CS       G R   L+           R+      V+CS +G+ D
Sbjct  13   APASINLHHKQQRSCSPRISVMVGNRNVMLLQGFIYNNNVSKRRPTAGLVVKCSGIGLGD  72

Query  335  FIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDP  514
            FIGGDLV FD+G+WLSDVEEHKALAIYPPHEGGYEGRY  RL  QGY+FLDLSARGLGDP
Sbjct  73   FIGGDLVKFDIGQWLSDVEEHKALAIYPPHEGGYEGRYLNRLIRQGYYFLDLSARGLGDP  132

Query  515  ETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQF  694
            ETTLTK HPVCPAH+GKQPIARWYFPPEVD+RL  LPP+AKGLVVWIIEAKVLSKAELQF
Sbjct  133  ETTLTKVHPVCPAHLGKQPIARWYFPPEVDFRLEHLPPNAKGLVVWIIEAKVLSKAELQF  192

Query  695  LALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            LALLPTLRP VRV+AECGNWRKF+WKPLKEIA
Sbjct  193  LALLPTLRPNVRVVAECGNWRKFVWKPLKEIA  224



>ref|XP_011008501.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Populus euphratica]
Length=231

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 156/171 (91%), Gaps = 3/171 (2%)
 Frame = +2

Query  287  QQRKTAD--VRCS-VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
            ++R TA   V+CS +G+ DFIGGDLV FD+G+WLSDVEEHKALAIYPPHEGGYEGRY  R
Sbjct  54   KRRPTAGLVVKCSGIGLGDFIGGDLVKFDIGQWLSDVEEHKALAIYPPHEGGYEGRYLNR  113

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L  QGY+FLDLSARGLGDPETTLTK HPVCPAH+GKQPIARWYFPPEVD+RL  LPP+AK
Sbjct  114  LIRQGYYFLDLSARGLGDPETTLTKVHPVCPAHLGKQPIARWYFPPEVDFRLEHLPPNAK  173

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            GLVVWIIEAKVLSKAELQFLALLPTLRP VRV+AECGNWRKF+WKPLKEIA
Sbjct  174  GLVVWIIEAKVLSKAELQFLALLPTLRPNVRVVAECGNWRKFVWKPLKEIA  224



>ref|XP_002319440.2| hypothetical protein POPTR_0013s15650g [Populus trichocarpa]
 gb|EEE95363.2| hypothetical protein POPTR_0013s15650g [Populus trichocarpa]
Length=231

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = +2

Query  158  APTRRRIASLEDQPCSSSACYSGGFRKKQLVAITAGKWGWMGRQQRKTADVRCS-VGIED  334
            AP    +   + + CS       G R   L+           R+      V+CS +G+ D
Sbjct  13   APASINLHHKQQRSCSPRISVMVGNRNVMLLQGFIYNNNVSKRRPTAGLVVKCSGIGLGD  72

Query  335  FIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDP  514
            FIGGDLV FD+G+WLSDVEEHKALAIYPPHEGGYEGRY  RL  QGY+FLDLSARGLGDP
Sbjct  73   FIGGDLVKFDIGQWLSDVEEHKALAIYPPHEGGYEGRYLNRLIRQGYYFLDLSARGLGDP  132

Query  515  ETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQF  694
            ETTLTK HPVCPAH+GKQPIARWYFPPEVD+RL  LPP++KGLVVWIIEAKVLSKAELQF
Sbjct  133  ETTLTKVHPVCPAHLGKQPIARWYFPPEVDFRLEHLPPNSKGLVVWIIEAKVLSKAELQF  192

Query  695  LALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            LALLPTLRP VRV+AECGNWRKF+WKPLKEIA
Sbjct  193  LALLPTLRPNVRVVAECGNWRKFVWKPLKEIA  224



>ref|XP_009384340.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Musa acuminata subsp. malaccensis]
Length=204

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = +2

Query  281  GRQQRKTA--DVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFT  454
            GR+ R+ A   VRC  G+ D IGGDLV  DLG+WL DVE+HKALA+Y PHEGGYEGRY  
Sbjct  20   GRRSRRAAVGGVRC--GLADLIGGDLVRPDLGRWLQDVEKHKALAVYSPHEGGYEGRYLN  77

Query  455  RLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA  634
            RLRYQGY FLDL+ARGLGDPE+TLTK HPVCP H+GKQPIARWYFPPEVDYRLSLLPPDA
Sbjct  78   RLRYQGYRFLDLTARGLGDPESTLTKIHPVCPPHLGKQPIARWYFPPEVDYRLSLLPPDA  137

Query  635  KGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            KGLV+W+IEAKVLSKAELQFLALLPTLRPKV+VIAECGNWRKF+W+PL+EIA
Sbjct  138  KGLVLWVIEAKVLSKAELQFLALLPTLRPKVKVIAECGNWRKFVWRPLREIA  189



>ref|XP_007146918.1| hypothetical protein PHAVU_006G081700g [Phaseolus vulgaris]
 gb|ESW18912.1| hypothetical protein PHAVU_006G081700g [Phaseolus vulgaris]
Length=227

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 150/177 (85%), Gaps = 4/177 (2%)
 Frame = +2

Query  272  GWMGRQQRKTADVRCSV----GIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYE  439
            GW G+        R  V    G+ DF+GGDLVW D+ +WLSDVEEHKALAIYPPHEGGYE
Sbjct  43   GWRGKDGYSNTSKRVGVVQCRGLGDFVGGDLVWLDIDRWLSDVEEHKALAIYPPHEGGYE  102

Query  440  GRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSL  619
            GRY +RL  QGY+FLDLSARGLGDPETTLTK HPV P HVGKQPIARWY+PPEVDYRL  
Sbjct  103  GRYLSRLIRQGYYFLDLSARGLGDPETTLTKIHPVYPPHVGKQPIARWYYPPEVDYRLEA  162

Query  620  LPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            LPP+AKGLVVWI+EAKVLSKAELQFLALLPTLRP VRVIAECGNWRKFMWKPLKEIA
Sbjct  163  LPPNAKGLVVWILEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFMWKPLKEIA  219



>ref|XP_007205891.1| hypothetical protein PRUPE_ppa011332mg [Prunus persica]
 gb|EMJ07090.1| hypothetical protein PRUPE_ppa011332mg [Prunus persica]
Length=215

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  197  PCSSSACYSGGFRKKQLVAITAGKWGWMGRQQRKTADVRCS-VGIEDFIGGDLVWFDLGK  373
            P  +S   +   +  + + +  G  G  G+  ++   +RCS   IEDFIGGDLV FDLG+
Sbjct  25   PPRNSCTINNELKGNRNMMLMMGLSGRHGKASKRVGMIRCSGRSIEDFIGGDLVKFDLGR  84

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            WLSDVEEHKALA+Y PHEGGYEGRY  RLRYQGY+FLDLSARGLGDPETTLTK HPVCP 
Sbjct  85   WLSDVEEHKALAVYSPHEGGYEGRYLNRLRYQGYYFLDLSARGLGDPETTLTKVHPVCPP  144

Query  554  HVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
            H+GKQPI+RWYFPPEVDYRL+ LPP AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV
Sbjct  145  HLGKQPISRWYFPPEVDYRLAALPPKAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  204

Query  734  IAECGNWRKF  763
            IAECGNWRKF
Sbjct  205  IAECGNWRKF  214



>ref|XP_006432036.1| hypothetical protein CICLE_v10002429mg [Citrus clementina]
 ref|XP_006464967.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Citrus sinensis]
 gb|ESR45276.1| hypothetical protein CICLE_v10002429mg [Citrus clementina]
 gb|KDO54942.1| hypothetical protein CISIN_1g027724mg [Citrus sinensis]
Length=219

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 152/174 (87%), Gaps = 4/174 (2%)
 Frame = +2

Query  281  GRQQRKTADVRCS----VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRY  448
            G+  ++     CS    + I DFIGGDL+  DLG+WLSDVE+HKA+AIY PHEGGYEGRY
Sbjct  38   GKASKRVGVTNCSGNSGIEIGDFIGGDLLKPDLGRWLSDVEKHKAIAIYTPHEGGYEGRY  97

Query  449  FTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPP  628
              RLRY GY+FLDLSARGLGDPETTLTK +PVCPAHVGKQPIARWYFPPEVDYRL+ LPP
Sbjct  98   LNRLRYLGYYFLDLSARGLGDPETTLTKVYPVCPAHVGKQPIARWYFPPEVDYRLAALPP  157

Query  629  DAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
             AKGLVVWIIEAKVLSK+ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  158  SAKGLVVWIIEAKVLSKSELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  211



>ref|XP_010094944.1| NAD(P)H-quinone oxidoreductase subunit N [Morus notabilis]
 gb|EXB57587.1| NAD(P)H-quinone oxidoreductase subunit N [Morus notabilis]
Length=224

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  308  VRCSV-GIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFL  484
            VRC+   I DFIG DL+ FDLGKWLSDVEEHKALAIY PHEGGYEGRY  RL YQGY+FL
Sbjct  55   VRCNAREIGDFIGADLLRFDLGKWLSDVEEHKALAIYSPHEGGYEGRYLNRLIYQGYYFL  114

Query  485  DLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEA  664
            DLSARGLGD ETTLTK HPVCPAH+GKQPIARWYFPPEVDYRL  LPP+A GLV+WIIEA
Sbjct  115  DLSARGLGDLETTLTKIHPVCPAHLGKQPIARWYFPPEVDYRLEALPPNAIGLVIWIIEA  174

Query  665  KVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            KVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMW+PLKEIA
Sbjct  175  KVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWRPLKEIA  216



>ref|XP_002532930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29457.1| conserved hypothetical protein [Ricinus communis]
Length=226

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 162/204 (79%), Gaps = 4/204 (2%)
 Frame = +2

Query  182  SLEDQPCSSSACYSGGFRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGD-LVW  358
            +L+ Q  +S +  +    KK L  +  G       ++R    VRCS        G  LV 
Sbjct  17   NLQQQNSTSYSMVARMTGKKNLKLLGLGT---SKSKKRAVGVVRCSGIGIGDFIGGDLVK  73

Query  359  FDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFH  538
            FDL +WLSDVEEHKALAIY PHEGGYEGRYFTRLRYQGY+FLDL+ARGLGDPETTLTK H
Sbjct  74   FDLEQWLSDVEEHKALAIYTPHEGGYEGRYFTRLRYQGYYFLDLTARGLGDPETTLTKIH  133

Query  539  PVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
            PVCPAHVGKQPIARWYFPPEVDYRL+ LPPDAKGLVVWIIEAKVLSKAELQFLALLP+LR
Sbjct  134  PVCPAHVGKQPIARWYFPPEVDYRLAALPPDAKGLVVWIIEAKVLSKAELQFLALLPSLR  193

Query  719  PKVRVIAECGNWRKFMWKPLKEIA  790
            PKVRVIAECGNWRK MWKPLKEIA
Sbjct  194  PKVRVIAECGNWRKVMWKPLKEIA  217



>ref|XP_010931408.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Elaeis guineensis]
Length=204

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 2/161 (1%)
 Frame = +2

Query  308  VRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLD  487
            VRC  G+ D IGGD +  DLG++  DVE+HKALAIYPPHEGGYEGRY TRLRYQGY FLD
Sbjct  30   VRC--GLTDLIGGDFIRPDLGRFQEDVEKHKALAIYPPHEGGYEGRYLTRLRYQGYRFLD  87

Query  488  LSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAK  667
            LSARGLGDPETTLTK HPVCP H+G+QPIARWYFPPEVDYRLSLLPP+AKGLVVWIIEAK
Sbjct  88   LSARGLGDPETTLTKIHPVCPPHLGRQPIARWYFPPEVDYRLSLLPPNAKGLVVWIIEAK  147

Query  668  VLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            VLSKAELQFLALLP+LRPKVRVIAECGNWRKF+WKPL+EIA
Sbjct  148  VLSKAELQFLALLPSLRPKVRVIAECGNWRKFLWKPLREIA  188



>ref|XP_010547389.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Tarenaya hassleriana]
Length=214

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 2/161 (1%)
 Frame = +2

Query  308  VRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLD  487
            VRC +G  DFIGGDLV  D+G+WL+DVEEHKA+AIY PHEGGYEGRY  RLRYQGY+FLD
Sbjct  50   VRCEIG--DFIGGDLVKLDIGRWLADVEEHKAIAIYTPHEGGYEGRYLNRLRYQGYYFLD  107

Query  488  LSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAK  667
            LSARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRL+ LPPDAKGLVVW+IEAK
Sbjct  108  LSARGLGDPETTLLKPYPVCPAHLGKQPIARWYYPPEVDYRLAALPPDAKGLVVWVIEAK  167

Query  668  VLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            VLSK+ELQFLALLP+LRP VRVIAECGNWRKFMWKPLKEIA
Sbjct  168  VLSKSELQFLALLPSLRPNVRVIAECGNWRKFMWKPLKEIA  208



>ref|XP_007017113.1| NAD(P)H-quinone oxidoreductase subunit N [Theobroma cacao]
 gb|EOY34732.1| NAD(P)H-quinone oxidoreductase subunit N [Theobroma cacao]
Length=220

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  350  LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLT  529
            L+ FDLG+WLSDVEEHKALAIY PHEGGYEGRY  RLRYQGY+FLDLSARGLGDPETTLT
Sbjct  66   LLRFDLGRWLSDVEEHKALAIYSPHEGGYEGRYLNRLRYQGYYFLDLSARGLGDPETTLT  125

Query  530  KFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            K HPVCPAHVGKQPIARWYFPPEVDYRL  LPPDAKGLVVWIIEAKVLSK+ELQFLALLP
Sbjct  126  KIHPVCPAHVGKQPIARWYFPPEVDYRLEALPPDAKGLVVWIIEAKVLSKSELQFLALLP  185

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEIA  790
            TLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  186  TLRPKVRVIAECGNWRKFMWKPLKEIA  212



>gb|KFK27356.1| nad h-quinone oxidoreductase subunit n [Arabis alpina]
Length=208

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  230  FRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALA  409
            F   Q+   T   +    R++ +   VRCS  I DFIGGDLV  D+G+WL+DVEEHKA+A
Sbjct  16   FEVTQVKKSTFSPFSVSTRRKIRNIGVRCSRSISDFIGGDLVKPDIGRWLADVEEHKAIA  75

Query  410  IYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYF  589
            IY PHEGGYEGRY  RL+ +GY+FLD+SARGLGDPETTL   +PVCPAH+GKQPIARWY+
Sbjct  76   IYTPHEGGYEGRYLNRLKNEGYYFLDISARGLGDPETTLLNAYPVCPAHLGKQPIARWYY  135

Query  590  PPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMW  769
            PPEVDYRLS LPP AKGLVVW++EAKVLSK+ELQFLALLP+LRP VRVIAECGNWRKFMW
Sbjct  136  PPEVDYRLSALPPSAKGLVVWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFMW  195

Query  770  KPLKEIAE  793
            KPL EIA 
Sbjct  196  KPLAEIAN  203



>ref|XP_004139925.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N-like [Cucumis 
sativus]
 ref|XP_004154560.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N-like [Cucumis 
sativus]
 gb|KGN46772.1| hypothetical protein Csa_6G133810 [Cucumis sativus]
Length=215

 Score =   286 bits (732),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  296  KTADVRCSVGIEDFIGGD-LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQG  472
            + A VRC         G  L+ FDLG+WLSDVEEHKALAIY PHEGGYEGRY  RLRYQG
Sbjct  48   RAATVRCEGIGIGDFIGGDLLKFDLGQWLSDVEEHKALAIYSPHEGGYEGRYLNRLRYQG  107

Query  473  YHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVW  652
            Y+FLDLSARGLGDPETTLTK HPVCPAH+GKQPIARWYFPPEVDYRL+ LPP+AKGLVVW
Sbjct  108  YYFLDLSARGLGDPETTLTKIHPVCPAHLGKQPIARWYFPPEVDYRLAALPPNAKGLVVW  167

Query  653  IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  168  IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  213



>ref|XP_008456262.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Cucumis melo]
Length=215

 Score =   286 bits (732),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  296  KTADVRCSVGIEDFIGGD-LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQG  472
            + A VRC         G  L+ FDLG+WLSDVEEHKALAIY PHEGGYEGRY  RLRYQG
Sbjct  48   RAATVRCEGIGIGDFIGGDLLKFDLGQWLSDVEEHKALAIYSPHEGGYEGRYLNRLRYQG  107

Query  473  YHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVW  652
            Y+FLDLSARGLGDPETTLTK HPVCPAH+GKQPIARWYFPPEVDYRL+ LPP+AKGLVVW
Sbjct  108  YYFLDLSARGLGDPETTLTKIHPVCPAHLGKQPIARWYFPPEVDYRLAALPPNAKGLVVW  167

Query  653  IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  168  IIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  213



>emb|CDY58568.1| BnaC03g12480D [Brassica napus]
Length=208

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  MGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
            + R++R+++ VRCS  + DFIGGDLV  D+G+WL DVE+HKA+AIY PHEGGYEGRY  R
Sbjct  34   ITRRKRRSSGVRCS--LVDFIGGDLVKPDIGRWLEDVEKHKAIAIYTPHEGGYEGRYLNR  91

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L+ QGY+FLD+SARGLGDPETTL   +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AK
Sbjct  92   LKEQGYYFLDISARGLGDPETTLLNPYPVCPAHLGKQPIARWYYPPEVDYRLSALPPSAK  151

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            GLVVWIIEAKVLSK+ELQFLALLP+LRP VRV+AECGNWRKFMWKPL EIAE
Sbjct  152  GLVVWIIEAKVLSKSELQFLALLPSLRPNVRVVAECGNWRKFMWKPLAEIAE  203



>ref|XP_009132071.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Brassica rapa]
Length=208

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  MGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
            + R++R+++ VRCS  + DFIGGDLV  D+G+WL DVE+HKA+AIY PHEGGYEGRY  R
Sbjct  34   ITRRKRRSSGVRCS--LVDFIGGDLVKPDIGRWLEDVEKHKAIAIYTPHEGGYEGRYLNR  91

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L+ QGY+FLD+SARGLGDPETTL   +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AK
Sbjct  92   LKEQGYYFLDISARGLGDPETTLLNPYPVCPAHLGKQPIARWYYPPEVDYRLSALPPSAK  151

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            GLVVWIIEAKVLSK+ELQFLALLP+LRP VRV+AECGNWRKFMWKPL EIAE
Sbjct  152  GLVVWIIEAKVLSKSELQFLALLPSLRPNVRVVAECGNWRKFMWKPLAEIAE  203



>emb|CDX88664.1| BnaA03g09850D [Brassica napus]
Length=208

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  MGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
            + R++R+++ VRCS  + DFIGGDLV  D+G+WL DVE+HKA+AIY PHEGGYEGRY  R
Sbjct  34   ITRRKRRSSGVRCS--LVDFIGGDLVKPDIGRWLEDVEKHKAIAIYTPHEGGYEGRYLNR  91

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L+ QGY+FLD+SARGLGDPETTL   +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AK
Sbjct  92   LKEQGYYFLDISARGLGDPETTLLNPYPVCPAHLGKQPIARWYYPPEVDYRLSALPPSAK  151

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            GLVVWIIEAKVLSK+ELQFLALLP+LRP VRV+AECGNWRKFMWKPL EIAE
Sbjct  152  GLVVWIIEAKVLSKSELQFLALLPSLRPNVRVVAECGNWRKFMWKPLAEIAE  203



>dbj|BAJ97096.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=208

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = +2

Query  272  GWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYF  451
            G  G  +  T  VR   G+ DF+GGDLV  DLG+WL DVE+HKALAIYPPHEGGYEGRY 
Sbjct  26   GRRGAGRPSTVSVRAGGGLMDFVGGDLVKPDLGRWLDDVEKHKALAIYPPHEGGYEGRYL  85

Query  452  TRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPD  631
             RLRYQGY+FLDLSARGLGDPE+TLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PD
Sbjct  86   NRLRYQGYYFLDLSARGLGDPESTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPD  145

Query  632  AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            AKGL+VW+ EAKVLSKAELQFLA+LP LRPKVRVIAECGNWRKF+WKPLK+I+
Sbjct  146  AKGLIVWVYEAKVLSKAELQFLAMLPDLRPKVRVIAECGNWRKFIWKPLKQIS  198



>ref|XP_006401112.1| hypothetical protein EUTSA_v10014691mg [Eutrema salsugineum]
 gb|ESQ42565.1| hypothetical protein EUTSA_v10014691mg [Eutrema salsugineum]
Length=207

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = +2

Query  230  FRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALA  409
            F   Q+ + T   +    R++R++  VRC   I DFIGGDLV  D+G+WL DVE HKA+A
Sbjct  16   FEASQVKSKTFRPFSVNTRKERRSKGVRCR-SISDFIGGDLVKLDIGRWLEDVEGHKAIA  74

Query  410  IYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYF  589
            IY PHEGGYEGRY  RL+ QGY+FLD+SARGLGDPETTL   +PVCPAH+GKQPIARWY+
Sbjct  75   IYTPHEGGYEGRYLNRLKSQGYYFLDISARGLGDPETTLLNPYPVCPAHLGKQPIARWYY  134

Query  590  PPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMW  769
            PPEVDYRLS LPP+AKGLVVW++EAKVLSK+ELQFLALLP+LRP VRVIAECGNWRKFMW
Sbjct  135  PPEVDYRLSALPPNAKGLVVWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFMW  194

Query  770  KPLKEIAE  793
            KPL EIA 
Sbjct  195  KPLAEIAN  202



>ref|XP_002866255.1| hypothetical protein ARALYDRAFT_495935 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42514.1| hypothetical protein ARALYDRAFT_495935 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   283 bits (724),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +2

Query  230  FRKKQLVAI-TAGKWGWMGRQQRKTAD-VRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKA  403
            F   Q+  I T G +    R +R+ +D VRCS  I D+IGGDLV  D+G+WL DVEEHKA
Sbjct  16   FEASQVKKIKTVGPFFVKTRSKRRRSDGVRCS-SIADYIGGDLVKPDIGQWLQDVEEHKA  74

Query  404  LAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARW  583
            +AIY PHEGGYEGRY  RL+ QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARW
Sbjct  75   IAIYAPHEGGYEGRYLNRLKMQGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARW  134

Query  584  YFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKF  763
            Y+PPEVDYRLS LPP AKGLVVW++EAKVLSKAELQFLALLP+LRP VRVIAECGNWRKF
Sbjct  135  YYPPEVDYRLSALPPSAKGLVVWVLEAKVLSKAELQFLALLPSLRPNVRVIAECGNWRKF  194

Query  764  MWKPLKEIAE  793
            +WKPL EIA 
Sbjct  195  VWKPLAEIAN  204



>ref|XP_006281105.1| hypothetical protein CARUB_v10027135mg [Capsella rubella]
 gb|EOA14003.1| hypothetical protein CARUB_v10027135mg [Capsella rubella]
Length=209

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
            ++R++  VRCS  I D+IGGDLV  D+G+WL DVEEHKA+AIY PHEGGYEGRY  RL+ 
Sbjct  37   KRRRSNGVRCS-SIVDYIGGDLVKPDIGRWLQDVEEHKAIAIYTPHEGGYEGRYLNRLKM  95

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AKGLV
Sbjct  96   QGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLSALPPSAKGLV  155

Query  647  VWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            VW++EAKVLSKAELQFLALLP+LRP VRVIAECGNWRKF+W+PL EIA 
Sbjct  156  VWVLEAKVLSKAELQFLALLPSLRPNVRVIAECGNWRKFVWRPLAEIAN  204



>emb|CDM85445.1| unnamed protein product [Triticum aestivum]
Length=208

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +2

Query  272  GWMGRQQRKTADVRCSVG-IEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRY  448
            G  G  +  T  VR   G + DF+GGDLV  DLG+WL DVEEHKALAIYPPHEGGYEGRY
Sbjct  25   GRRGAGRPSTVSVRAGGGGLMDFVGGDLVKPDLGRWLDDVEEHKALAIYPPHEGGYEGRY  84

Query  449  FTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPP  628
              RLRYQGY+FLDLSARGLGDPE+TLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL P
Sbjct  85   LNRLRYQGYYFLDLSARGLGDPESTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHP  144

Query  629  DAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            DAKGL+VW+ EAKVLSKAELQFLA+LP LRPKVRVIAECGNWRKF+WKPLK+I+
Sbjct  145  DAKGLIVWVYEAKVLSKAELQFLAMLPDLRPKVRVIAECGNWRKFIWKPLKQIS  198



>ref|XP_003564780.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Brachypodium distachyon]
Length=210

 Score =   281 bits (718),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  326  IEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGL  505
            + DF+GGDLV  DLG+WL DVE+HKALAIYPPHEGGYEGRY  RLRYQGY+FLDLSARGL
Sbjct  46   LMDFVGGDLVKPDLGRWLEDVEKHKALAIYPPHEGGYEGRYLNRLRYQGYYFLDLSARGL  105

Query  506  GDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAE  685
            GDPE+TLTK HPVCP  +G+QPIARWYFPPEVDYRLSLL PDAKGLVVW++EAKVLSKAE
Sbjct  106  GDPESTLTKIHPVCPPSLGRQPIARWYFPPEVDYRLSLLHPDAKGLVVWVLEAKVLSKAE  165

Query  686  LQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            LQFLA+LP LRPKVRVIAECGNWRKF+WKPLK+I+
Sbjct  166  LQFLAMLPDLRPKVRVIAECGNWRKFIWKPLKQIS  200



>ref|XP_006842609.1| hypothetical protein AMTR_s00077p00172700 [Amborella trichopoda]
 gb|ERN04284.1| hypothetical protein AMTR_s00077p00172700 [Amborella trichopoda]
Length=195

 Score =   280 bits (716),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
            Q +  + ++C  G++DFIGGDLV  DLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY
Sbjct  36   QTKLRSRIKC--GLQDFIGGDLVKPDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  93

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLDLSARGLGDPETTLTK HPVCPAH+G+QPIARWYFPPEVDYRLSLLPP+AKGLV
Sbjct  94   QGYYFLDLSARGLGDPETTLTKIHPVCPAHLGRQPIARWYFPPEVDYRLSLLPPNAKGLV  153

Query  647  VWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGN  751
            VWI+EAKVLSKAELQFLALLP+LRPKV+VIAECGN
Sbjct  154  VWIMEAKVLSKAELQFLALLPSLRPKVKVIAECGN  188



>ref|NP_200634.1| NADH dehydrogenase-like complex N [Arabidopsis thaliana]
 dbj|BAA96917.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL85990.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45047.1| unknown protein [Arabidopsis thaliana]
 gb|AED97025.1| NADH dehydrogenase-like complex N [Arabidopsis thaliana]
Length=209

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
            ++R++  V+CS  I D+IGGDLV  D+G+WL DVEEHKA+AIY PHEGGYEGRY  RL+ 
Sbjct  37   KRRRSTGVKCS-SIADYIGGDLVKPDIGQWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKM  95

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRL+ LPP AKGLV
Sbjct  96   QGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLAALPPSAKGLV  155

Query  647  VWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            VW++EAKVLSK+ELQFLALLP+LRP VRVIAECGNWRKF+WKPL EIA 
Sbjct  156  VWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIAN  204



>ref|XP_010483397.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Camelina sativa]
Length=209

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
             +R++  VRCS  I D+IGGDLV  D+G+WL DVEEHKA+AIY PHEGGYEGRY  RL+ 
Sbjct  37   NRRRSNGVRCS-SIADYIGGDLVKPDIGRWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKM  95

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AKGLV
Sbjct  96   QGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLSALPPGAKGLV  155

Query  647  VWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            +W++EAKVLSK+ELQFLALLP+LRP VRVIAECGNWRKF+WKPL EIA 
Sbjct  156  LWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIAN  204



>ref|XP_010443544.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Camelina sativa]
Length=209

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
            ++R++  VRCS  I D+IGGDLV  D+G+WL DVEEHKA+AIY PHEGGYEGRY  RL+ 
Sbjct  37   KRRRSNGVRCS-SIVDYIGGDLVKPDIGRWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKM  95

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AKGLV
Sbjct  96   QGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLSALPPGAKGLV  155

Query  647  VWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            +W++EAKVLSK+ELQFLALLP+LRP VRVIAECGNWRKF+WKPL EIA 
Sbjct  156  LWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIAN  204



>ref|XP_010453389.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Camelina sativa]
 ref|XP_010453413.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Camelina sativa]
Length=209

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
            ++R++  VRCS  I D+IGGDLV  D+G+WL DVEEHKA+AIY PHEGGYEGRY  RL+ 
Sbjct  37   KRRRSNGVRCS-SIVDYIGGDLVKPDIGRWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKM  95

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRLS LPP AKGLV
Sbjct  96   QGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLSALPPGAKGLV  155

Query  647  VWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAE  793
            +W++EAKVLSK+ELQFLALLP+LRP VRVIAECGNWRKF+WKPL EIA 
Sbjct  156  LWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIAN  204



>ref|NP_001131237.1| uncharacterized protein LOC100192546 [Zea mays]
 gb|ACF79562.1| unknown [Zea mays]
 tpg|DAA56513.1| TPA: NADH dehydrogenase I subunit N [Zea mays]
Length=272

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  332  DFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGD  511
            DF+GGDLV  DLGKWL DVE+HKALAIYPPHEGGYEGRY  RLRYQGY+FLDLSARGLGD
Sbjct  110  DFVGGDLVRPDLGKWLDDVEKHKALAIYPPHEGGYEGRYLNRLRYQGYYFLDLSARGLGD  169

Query  512  PETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQ  691
            PETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVWIIEAKVLSKAELQ
Sbjct  170  PETTLTKVHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWIIEAKVLSKAELQ  229

Query  692  FLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            FLA+LP +RPKVRVIAECGNWR F+WKPLK+IA
Sbjct  230  FLAMLPDIRPKVRVIAECGNWRSFVWKPLKQIA  262



>ref|XP_008672070.1| PREDICTED: uncharacterized protein LOC100192546 isoform X1 [Zea 
mays]
 ref|XP_008672071.1| PREDICTED: uncharacterized protein LOC100192546 isoform X1 [Zea 
mays]
 ref|XP_008672072.1| PREDICTED: uncharacterized protein LOC100192546 isoform X1 [Zea 
mays]
 gb|ACF82771.1| unknown [Zea mays]
 gb|ACG27527.1| NADH dehydrogenase I subunit N [Zea mays]
 gb|ACG36911.1| NADH dehydrogenase I subunit N [Zea mays]
 gb|ACN31301.1| unknown [Zea mays]
 gb|ACR35359.1| unknown [Zea mays]
 tpg|DAA56514.1| TPA: NADH dehydrogenase I subunit N isoform 1 [Zea mays]
 tpg|DAA56515.1| TPA: NADH dehydrogenase I subunit N isoform 2 [Zea mays]
Length=208

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  332  DFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGD  511
            DF+GGDLV  DLGKWL DVE+HKALAIYPPHEGGYEGRY  RLRYQGY+FLDLSARGLGD
Sbjct  46   DFVGGDLVRPDLGKWLDDVEKHKALAIYPPHEGGYEGRYLNRLRYQGYYFLDLSARGLGD  105

Query  512  PETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQ  691
            PETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVWIIEAKVLSKAELQ
Sbjct  106  PETTLTKVHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWIIEAKVLSKAELQ  165

Query  692  FLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            FLA+LP +RPKVRVIAECGNWR F+WKPLK+IA
Sbjct  166  FLAMLPDIRPKVRVIAECGNWRSFVWKPLKQIA  198



>ref|XP_006645131.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like [Oryza brachyantha]
Length=212

 Score =   278 bits (712),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = +2

Query  278  MGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTR  457
            +G  +  TA  R   G+ DF+GGDLV  DLG+WL DVE+HK+LAIYPPHEGGYEGRY +R
Sbjct  34   VGTGRPSTAAARA--GLRDFVGGDLVRPDLGRWLEDVEKHKSLAIYPPHEGGYEGRYLSR  91

Query  458  LRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAK  637
            L YQGY+FLDLSARGLGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAK
Sbjct  92   LSYQGYYFLDLSARGLGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAK  151

Query  638  GLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            GLVV ++EAKVLSKAELQFLA+LP +RPKVRVIAECGNWRKF+WKPLK+IA
Sbjct  152  GLVVCVMEAKVLSKAELQFLAILPDIRPKVRVIAECGNWRKFVWKPLKQIA  202



>ref|XP_010032946.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore [Eucalyptus grandis]
 gb|KCW52450.1| hypothetical protein EUGRSUZ_J01847 [Eucalyptus grandis]
Length=227

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = +2

Query  281  GRQQRKTA--DVRCSVGIEDFIGGD-LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYF  451
            GR  R++    VRCS        G  L+  DLG+WLSDVEEHKALAIY PHEGGYEGRY 
Sbjct  47   GRPSRRSGVGPVRCSGIGIGDFIGGDLLKPDLGRWLSDVEEHKALAIYTPHEGGYEGRYL  106

Query  452  TRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPD  631
             RL+YQGY+FLDL+ARGLGDPETTLTK HPVCP HVGKQPIARWYFPPEVDYRL+ LPPD
Sbjct  107  ARLKYQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYRLAALPPD  166

Query  632  AKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            AKGLVVWIIEAKVLSK+ELQFLALLPTLRPKVRVIAECGNWRK MWKPLKEIA
Sbjct  167  AKGLVVWIIEAKVLSKSELQFLALLPTLRPKVRVIAECGNWRKVMWKPLKEIA  219



>ref|XP_004970778.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like isoform X2 [Setaria italica]
Length=210

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +2

Query  299  TADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYH  478
            T  VR +  + DF+GGDLV  D+ +WL DVE+HKALAIYPPHEGGYEGRY   LRYQGY+
Sbjct  39   TVSVRST--LWDFVGGDLVKPDMARWLDDVEKHKALAIYPPHEGGYEGRYLNNLRYQGYY  96

Query  479  FLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWII  658
            FLDL+ARGLGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVW+I
Sbjct  97   FLDLTARGLGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWVI  156

Query  659  EAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            EAKVLSKAELQFLA+LP LRPKVRVIAECGNWRKF+WKPLK+IA
Sbjct  157  EAKVLSKAELQFLAMLPDLRPKVRVIAECGNWRKFIWKPLKQIA  200



>ref|NP_001045009.1| Os01g0882500 [Oryza sativa Japonica Group]
 dbj|BAF06923.1| Os01g0882500 [Oryza sativa Japonica Group]
 gb|EAY76726.1| hypothetical protein OsI_04681 [Oryza sativa Indica Group]
 gb|EAZ14389.1| hypothetical protein OsJ_04309 [Oryza sativa Japonica Group]
Length=211

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  323  GIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARG  502
            G+ DF+GGDLV  D+G+WL DVE+HK+LAIYPPHEGGYEGRY +RL YQGY+FLDLSARG
Sbjct  46   GLWDFVGGDLVKPDMGRWLDDVEKHKSLAIYPPHEGGYEGRYLSRLSYQGYYFLDLSARG  105

Query  503  LGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKA  682
            LGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVW++EAKVLSKA
Sbjct  106  LGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWVMEAKVLSKA  165

Query  683  ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            ELQFLA+LP +RPKVRVIAECGNWRKF+WKPLK+IA
Sbjct  166  ELQFLAILPDIRPKVRVIAECGNWRKFVWKPLKQIA  201



>gb|KDO54943.1| hypothetical protein CISIN_1g027724mg [Citrus sinensis]
Length=214

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 147/174 (84%), Gaps = 9/174 (5%)
 Frame = +2

Query  281  GRQQRKTADVRCS----VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRY  448
            G+  ++     CS    + I DFIGGDL+  DLG+WLSDVE+HKA+AIY PHEGGYEGRY
Sbjct  38   GKASKRVGVTNCSGNSGIEIGDFIGGDLLKPDLGRWLSDVEKHKAIAIYTPHEGGYEGRY  97

Query  449  FTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPP  628
              RLRY GY+FLDLSARGLGDPETTLTK +PVCP     QPIARWYFPPEVDYRL+ LPP
Sbjct  98   LNRLRYLGYYFLDLSARGLGDPETTLTKVYPVCP-----QPIARWYFPPEVDYRLAALPP  152

Query  629  DAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
             AKGLVVWIIEAKVLSK+ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  153  SAKGLVVWIIEAKVLSKSELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  206



>ref|XP_002458868.1| hypothetical protein SORBIDRAFT_03g041820 [Sorghum bicolor]
 gb|EES03988.1| hypothetical protein SORBIDRAFT_03g041820 [Sorghum bicolor]
Length=209

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  308  VRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLD  487
            V     + DF+GGDLV  DLGKWL DVE+HKALAIYPPHEGGYEGRY  RLRYQGY+FLD
Sbjct  39   VSVRSSLLDFVGGDLVRPDLGKWLDDVEKHKALAIYPPHEGGYEGRYLNRLRYQGYYFLD  98

Query  488  LSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAK  667
            LSARGLGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVWI EAK
Sbjct  99   LSARGLGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWIHEAK  158

Query  668  VLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            VLSKAELQFLA+LP +RPKVRV+AE GNWR F+WKPLK+IA
Sbjct  159  VLSKAELQFLAMLPDIRPKVRVLAEVGNWRSFVWKPLKQIA  199



>dbj|BAD82572.1| hypothetical protein [Oryza sativa Japonica Group]
Length=455

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  323  GIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARG  502
            G+ DF+GGDLV  D+G+WL DVE+HK+LAIYPPHEGGYEGRY +RL YQGY+FLDLSARG
Sbjct  290  GLWDFVGGDLVKPDMGRWLDDVEKHKSLAIYPPHEGGYEGRYLSRLSYQGYYFLDLSARG  349

Query  503  LGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKA  682
            LGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVW++EAKVLSKA
Sbjct  350  LGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWVMEAKVLSKA  409

Query  683  ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            ELQFLA+LP +RPKVRVIAECGNWRKF+WKPLK+IA
Sbjct  410  ELQFLAILPDIRPKVRVIAECGNWRKFVWKPLKQIA  445



>ref|XP_004970779.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like isoform X3 [Setaria italica]
Length=217

 Score =   255 bits (652),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 6/164 (4%)
 Frame = +2

Query  299  TADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYH  478
            T  VR +  + DF+GGDLV  D+ +WL DVE+HKALAIYPPHEGGYEGRY   LRYQGY+
Sbjct  39   TVSVRST--LWDFVGGDLVKPDMARWLDDVEKHKALAIYPPHEGGYEGRYLNNLRYQGYY  96

Query  479  FLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWII  658
            FLDL+ARGLGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVW+I
Sbjct  97   FLDLTARGLGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWVI  156

Query  659  EAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            EAKVLSKAELQFLA+LP LRPKVRVIAECGNW    ++P + I+
Sbjct  157  EAKVLSKAELQFLAMLPDLRPKVRVIAECGNW----YEPYRHIS  196



>emb|CCI55382.1| NDH subunit NdhN [Marchantia polymorpha]
Length=270

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +2

Query  308  VRCSV--GIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHF  481
            VR +V  G+ D+IGGDL+ FDL KW SDVEE  ++ IY P EGGYEGRY TRLR +GYH 
Sbjct  70   VRTTVEAGLGDYIGGDLLGFDLDKWSSDVEEFGSIGIYSPPEGGYEGRYATRLRREGYHI  129

Query  482  LDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIE  661
            L+L+ARGLGDPE  LTK H V P H+GKQ IARWY PPEVDYRLSLLP D KGLVVW+IE
Sbjct  130  LNLTARGLGDPEAYLTKIHGVRPPHLGKQAIARWYMPPEVDYRLSLLPKDCKGLVVWMIE  189

Query  662  AKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
             KVLSK ELQFLALLP LRPKV+VIAECG WR F WKPLKEIA
Sbjct  190  CKVLSKTELQFLALLPALRPKVKVIAECGPWRSFRWKPLKEIA  232



>ref|XP_002970331.1| hypothetical protein SELMODRAFT_441171 [Selaginella moellendorffii]
 gb|EFJ28461.1| hypothetical protein SELMODRAFT_441171 [Selaginella moellendorffii]
Length=267

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  311  RCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDL  490
            R    I D+IGGDL+ FD GK+  DVE+  ++AIYPP EGGYEGRY  +L+ +GYH + +
Sbjct  55   RVVCDISDYIGGDLLRFDRGKFYKDVEKFGSIAIYPPPEGGYEGRYANKLQMEGYHIMAM  114

Query  491  SARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKV  670
            SA+GLGD E+ LTK H V P H+GKQ I+ WYFPPE+DYRLS+LP D KGLV+W++E +V
Sbjct  115  SAKGLGDLESYLTKVHGVRPPHLGKQAISVWYFPPEIDYRLSMLPEDCKGLVLWLLECEV  174

Query  671  LSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
            LSKAELQFL LLP LRPKVRVIAECG WRKF+W PLK IA  S
Sbjct  175  LSKAELQFLTLLPALRPKVRVIAECGGWRKFVWTPLKNIAGTS  217



>ref|XP_001756927.1| predicted protein [Physcomitrella patens]
 gb|EDQ78158.1| predicted protein [Physcomitrella patens]
Length=180

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +2

Query  290  QRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQ  469
            QR+   V C  G+ DFIGGDL+  DL +W+ DVE++ ++A+Y P EGGYEGRY TRL+ +
Sbjct  1    QRRPLQVVCG-GLGDFIGGDLLGLDLDQWVGDVEKYGSIAVYAPAEGGYEGRYSTRLKSE  59

Query  470  GYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVV  649
            GYHF+++SARGLGDPE  LTK H V PAH+GKQ IARWYFPPEVDYRLSLLP + KGLV+
Sbjct  60   GYHFMNISARGLGDPEAYLTKVHGVRPAHLGKQTIARWYFPPEVDYRLSLLPKNCKGLVL  119

Query  650  WIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            W++EAKVLSK+ELQFLALLP +RP V+VIAECG WR F W+PLK+ A
Sbjct  120  WVLEAKVLSKSELQFLALLPAIRPNVKVIAECGTWRSFKWRPLKDAA  166



>ref|XP_002968095.1| hypothetical protein SELMODRAFT_68704, partial [Selaginella moellendorffii]
 gb|EFJ30349.1| hypothetical protein SELMODRAFT_68704, partial [Selaginella moellendorffii]
Length=155

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  326  IEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGL  505
            I D+IGGDL+ FD GK+  DVE+  ++AIYPP EGGYEGRY  +L+ +GYH + +SA+GL
Sbjct  1    ISDYIGGDLLRFDRGKFYKDVEKFGSIAIYPPPEGGYEGRYANKLQMEGYHIMAMSAKGL  60

Query  506  GDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAE  685
            GD E+ LTK H V P H+GKQ I+ WYFPPE+DYRLS+LP D KGLV+W++E +VLSKAE
Sbjct  61   GDLESYLTKVHGVRPPHLGKQAISVWYFPPEIDYRLSMLPEDCKGLVLWLLECEVLSKAE  120

Query  686  LQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            LQFL LLP LRPKVRVIAECG WRKF+W PLK IA
Sbjct  121  LQFLTLLPALRPKVRVIAECGGWRKFVWTPLKNIA  155



>ref|XP_006401110.1| hypothetical protein EUTSA_v10014691mg [Eutrema salsugineum]
 gb|ESQ42563.1| hypothetical protein EUTSA_v10014691mg [Eutrema salsugineum]
Length=161

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = +2

Query  230  FRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALA  409
            F   Q+ + T   +    R++R++  VRC   I DFIGGDLV  D+G+WL DVE HKA+A
Sbjct  16   FEASQVKSKTFRPFSVNTRKERRSKGVRCR-SISDFIGGDLVKLDIGRWLEDVEGHKAIA  74

Query  410  IYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYF  589
            IY PHEGGYEGRY  RL+ QGY+FLD+SARGLGDPETTL   +PVCPAH+GKQPIARWY+
Sbjct  75   IYTPHEGGYEGRYLNRLKSQGYYFLDISARGLGDPETTLLNPYPVCPAHLGKQPIARWYY  134

Query  590  PPEVDYRLSLLPPDAKGLVVWIIEAKV  670
            PPEVDYRLS LPP+AKGLVVW++EAKV
Sbjct  135  PPEVDYRLSALPPNAKGLVVWVLEAKV  161



>ref|NP_001119457.1| NADH dehydrogenase-like complex N [Arabidopsis thaliana]
 dbj|BAH56820.1| AT5G58260 [Arabidopsis thaliana]
 gb|AED97026.1| NADH dehydrogenase-like complex N [Arabidopsis thaliana]
Length=163

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = +2

Query  287  QQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRY  466
            ++R++  V+CS  I D+IGGDLV  D+G+WL DVEEHKA+AIY PHEGGYEGRY  RL+ 
Sbjct  37   KRRRSTGVKCS-SIADYIGGDLVKPDIGQWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKM  95

Query  467  QGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLV  646
            QGY+FLD+SARGLGDPETTL K +PVCPAH+GKQPIARWY+PPEVDYRL+ LPP AKGLV
Sbjct  96   QGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLAALPPSAKGLV  155

Query  647  VWIIEAKV  670
            VW++EAKV
Sbjct  156  VWVLEAKV  163



>ref|XP_009379133.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like, partial [Pyrus x bretschneideri]
Length=114

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  470  GYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVV  649
            GY+FLDLSARGLGDPETTLTK HPVCP H+GKQPI+RWYFPPEVDYRL+ LPP AKGLVV
Sbjct  1    GYYFLDLSARGLGDPETTLTKVHPVCPPHLGKQPISRWYFPPEVDYRLAALPPKAKGLVV  60

Query  650  WIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
            WIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKF+WKPLKEI+
Sbjct  61   WIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFVWKPLKEIS  107



>gb|KCW52451.1| hypothetical protein EUGRSUZ_J01847 [Eucalyptus grandis]
Length=198

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = +2

Query  281  GRQQRKTA--DVRCSVGIEDFIGGD-LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYF  451
            GR  R++    VRCS        G  L+  DLG+WLSDVEEHKALAIY PHEGGYEGRY 
Sbjct  47   GRPSRRSGVGPVRCSGIGIGDFIGGDLLKPDLGRWLSDVEEHKALAIYTPHEGGYEGRYL  106

Query  452  TRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPD  631
             RL+YQGY+FLDL+ARGLGDPETTLTK HPVCP HVGKQPIARWYFPPEVDYRL+ LPPD
Sbjct  107  ARLKYQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYRLAALPPD  166

Query  632  AKGLVVWIIEAKVLSKAE  685
            AKGLVVWIIEAKV S+ E
Sbjct  167  AKGLVVWIIEAKVGSRRE  184



>ref|XP_004970777.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit N, organellar 
chromatophore-like isoform X1 [Setaria italica]
Length=216

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +2

Query  299  TADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYH  478
            T  VR +  + DF+GGDLV  D+ +WL DVE+HKALAIYPPHEGGYEGRY   LRYQGY+
Sbjct  39   TVSVRST--LWDFVGGDLVKPDMARWLDDVEKHKALAIYPPHEGGYEGRYLNNLRYQGYY  96

Query  479  FLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWII  658
            FLDL+ARGLGDPETTLTK HPVCP  +G+QP+ARWYFPPEVDYRLSLL PDAKGLVVW+I
Sbjct  97   FLDLTARGLGDPETTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLVVWVI  156

Query  659  EAKV  670
            EAKV
Sbjct  157  EAKV  160



>ref|XP_006432035.1| hypothetical protein CICLE_v10002429mg [Citrus clementina]
 gb|ESR45275.1| hypothetical protein CICLE_v10002429mg [Citrus clementina]
 gb|KDO54944.1| hypothetical protein CISIN_1g027724mg [Citrus sinensis]
Length=180

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 115/174 (66%), Gaps = 43/174 (25%)
 Frame = +2

Query  281  GRQQRKTADVRCS----VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRY  448
            G+  ++     CS    + I DFIGGDL+  DLG+WLSDVE+HKA+AIY PHEGGYEGRY
Sbjct  38   GKASKRVGVTNCSGNSGIEIGDFIGGDLLKPDLGRWLSDVEKHKAIAIYTPHEGGYEGRY  97

Query  449  FTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPP  628
              RLRY GY+FLDLSARGLGDPETTLTK +PVCP                          
Sbjct  98   LNRLRYLGYYFLDLSARGLGDPETTLTKVYPVCP--------------------------  131

Query  629  DAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  790
                         VLSK+ELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA
Sbjct  132  -------------VLSKSELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIA  172



>ref|XP_001771719.1| predicted protein [Physcomitrella patens]
 gb|EDQ63502.1| predicted protein [Physcomitrella patens]
Length=130

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHE----GGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPV  544
            + DVE++ ++ +Y P E      YEGR+ TRL+ + YHF+++SARGLGDPE  LTK H V
Sbjct  1    VEDVEKYGSIDVYAPAEVKVQTRYEGRHCTRLKGEEYHFMNISARGLGDPEAYLTKVHGV  60

Query  545  CPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPK  724
             P H+GKQ IARWYFPPE+DYRLSLLP + K LV W++EAKVLSK+ELQFLALLP +RP 
Sbjct  61   RPPHLGKQAIARWYFPPEIDYRLSLLPKNCKELVRWVVEAKVLSKSELQFLALLPAIRPN  120

Query  725  VRVIAECGNW  754
            V+VIAECG W
Sbjct  121  VKVIAECGTW  130



>ref|WP_006618174.1| NAD(P)H-quinone oxidoreductase subunit N [Arthrospira platensis]
 ref|YP_005069496.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI90958.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR56002.1| NAD(P)H-quinone oxidoreductase [Arthrospira platensis str. Paraca]
Length=158

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 94/146 (64%), Gaps = 7/146 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            GK + D+E   ALA+Y P EGG+EGRY  RLR  GY    LSARGLGD    L   H V 
Sbjct  8    GKLIRDLESEGALALYVPLEGGFEGRYRRRLRIAGYTTYSLSARGLGDLAAYLLGVHGVR  67

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            PAH+GK+           +Y PP V+Y+L  LPP++KGLV+WIIE ++LS  E+ FL+ L
Sbjct  68   PAHLGKKSSGNDAAVGDIYYIPPVVNYQLENLPPNSKGLVLWIIEGQILSSQEVDFLSRL  127

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P+L P+V++  E G  R+F WKPLK 
Sbjct  128  PSLEPRVKIAIEMGGDRQFSWKPLKN  153



>ref|WP_015162691.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Chamaesiphon 
minutus]
 ref|YP_007100143.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Chamaesiphon 
minutus PCC 6605]
 gb|AFY96616.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Chamaesiphon 
minutus PCC 6605]
Length=150

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  +L +Y P EGGYEGRY  RLR  GY  + LSARGLGD    LT  H V PA
Sbjct  10   FIRDLEQAGSLGVYVPLEGGYEGRYQRRLRATGYESMRLSARGLGDISAYLTGVHGVRPA  69

Query  554  HVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
            H+GK+ I  +Y PP +D  L+ L P +KGLV+W+I+ +VLSK EL +L  LPT+ P+V+V
Sbjct  70   HLGKKEIRTYYIPPMLDTFLNNLLPTSKGLVLWLIDGQVLSKQELAYLTQLPTIDPRVKV  129

Query  734  IAECGNWRKFMWKPLKEIAE  793
            + E G  R+F WK L +IA 
Sbjct  130  VIELGGDRQFSWKKLTDIAN  149



>ref|WP_039714892.1| NAD(P)H-quinone oxidoreductase [Scytonema millei]
 gb|KIF17327.1| NAD(P)H-quinone oxidoreductase [Scytonema millei VB511283]
Length=162

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K + D+E+H AL +Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT  H V P
Sbjct  9    KLIRDLEKHGALGVYAPLEGGFEGRYRRRLRATGYTTLNITARGLGDVSAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+ + +       +Y PP V Y L  LPP +KGLV+WIIE  +LS  E++FL  LP
Sbjct  69   PHLGKKSVGQGAAVGYVYYVPPIVSYNLEQLPPKSKGLVLWIIEGHILSNQEIEFLVNLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
            TL P+V+++ E G  R F W+PLK+
Sbjct  129  TLDPRVKIVLERGGERYFRWQPLKD  153



>gb|EMS58808.1| NAD(P)H-quinone oxidoreductase subunit N [Triticum urartu]
Length=110

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +2

Query  557  VGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVI  736
            +G+QP+ARWYFPPEVDYRLSLL PDAKGL+VW+ EAKVLSKAELQFLA+LP LRPKVRVI
Sbjct  23   LGRQPVARWYFPPEVDYRLSLLHPDAKGLIVWVYEAKVLSKAELQFLAMLPDLRPKVRVI  82

Query  737  AECGNWRKFMWKPLKEIA  790
            AECGNWRKF+WKPLK+I+
Sbjct  83   AECGNWRKFIWKPLKQIS  100



>gb|EMT16212.1| hypothetical protein F775_24410 [Aegilops tauschii]
Length=93

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +2

Query  557  VGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVI  736
            +G+QP+ARWYFPPEVDYRLSLL PDAKGL+VW+ EAKVLSKAELQFLA+LP LRPKVRVI
Sbjct  6    LGRQPVARWYFPPEVDYRLSLLHPDAKGLIVWVYEAKVLSKAELQFLAMLPDLRPKVRVI  65

Query  737  AECGNWRKFMWKPLKEIA  790
            AECGNWRKF+WKPLK+I+
Sbjct  66   AECGNWRKFIWKPLKQIS  83



>ref|WP_015152303.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007089621.1| hypothetical protein Chro_0197 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY85752.1| hypothetical protein Chro_0197 [Chroococcidiopsis thermalis PCC 
7203]
Length=162

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K + D+E+H AL +Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT  H V P
Sbjct  9    KLIRDLEKHGALGVYAPLEGGFEGRYRRRLRATGYTTLNITARGLGDVSAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+ + +       +Y PP V Y L  LPP +KGLV+WIIE  +LS  E++FL  LP
Sbjct  69   PHLGKKSVGQGAAVGYVYYLPPIVSYNLEQLPPKSKGLVLWIIEGHILSNQEIEFLVNLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
            +L P+V+++ E G  R F W+PL++
Sbjct  129  SLDPRVKIVIERGGERYFRWQPLRD  153



>ref|XP_006371686.1| hypothetical protein POPTR_0019s15340g, partial [Populus trichocarpa]
 gb|ERP49483.1| hypothetical protein POPTR_0019s15340g, partial [Populus trichocarpa]
Length=173

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 84/123 (68%), Gaps = 19/123 (15%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            DVEEHKA+AIY             RL  QGY  LDL+A GLGDPETTLT+ HPVCP    
Sbjct  70   DVEEHKAIAIY-----------LNRLIRQGYCILDLTACGLGDPETTLTEVHPVCPQ---  115

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVIAE  742
                    FPPEVD+R   LPP+AKGLVVWI EAKVLSK  LQFLALLPTLRP VRVIAE
Sbjct  116  -----GGLFPPEVDFRPEHLPPNAKGLVVWITEAKVLSKEGLQFLALLPTLRPNVRVIAE  170

Query  743  CGN  751
             GN
Sbjct  171  RGN  173



>ref|WP_015141062.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Nostoc 
sp. PCC 7524]
 ref|YP_007078249.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Nostoc 
sp. PCC 7524]
 gb|AFY50652.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Nostoc 
sp. PCC 7524]
Length=162

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 93/148 (63%), Gaps = 7/148 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  +L +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKFGSLGVYVPLEGGYEGRYRRRLRAAGYVTLHMTARGLGDVAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E++FL  LP+L
Sbjct  71   LGKKSTGSGAAVGDVYYLPPTVNYQLEQLPPKSKGLVLWIIEGHILSDQEVEFLTTLPSL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKEIAEQS  799
             PKV+V+ E G  R F W+PLK+    S
Sbjct  131  EPKVKVVVERGGDRSFRWRPLKDTFSTS  158



>ref|WP_009634257.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechocystis 
sp. PCC 7509]
Length=155

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 0/143 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            + + D+E+  AL +Y P EGGYEGRY  R+R  GY  L ++ARGLGD    LT  H V P
Sbjct  9    QLIRDLEKSGALGLYVPPEGGYEGRYQRRVRAAGYTTLLMTARGLGDLAAYLTGVHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            AH+GK+ I  +Y PP V+Y L  LPP +KGLV+W++E  +LS  E+++LA LP L P+V+
Sbjct  69   AHLGKKDIRVYYLPPIVNYHLENLPPKSKGLVLWMMEGHLLSNQEIEYLASLPQLEPRVK  128

Query  731  VIAECGNWRKFMWKPLKEIAEQS  799
            +  E G  R F W PLKE  E S
Sbjct  129  IAIERGGDRFFRWMPLKETLEAS  151



>ref|WP_006620451.1| NAD(P)H-quinone oxidoreductase subunit N [Arthrospira sp. PCC 
8005]
 emb|CCE15680.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD11726.1| NADH dehydrogenase I subunit N [Arthrospira platensis C1]
 emb|CDM94283.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=167

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 92/146 (63%), Gaps = 7/146 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            GK + D+E   ALA+Y P EGG+EGRY  RLR  GY    LSARGLGD    L   H V 
Sbjct  17   GKLIRDLESEGALALYVPLEGGFEGRYRRRLRIAGYTTYSLSARGLGDLAAYLLGVHGVR  76

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            P H+GK+           +Y PP V+Y+L  LPP++KGLV+WIIE  +LS  E+ FL+ L
Sbjct  77   PPHLGKKSSGNDAAVGDIYYLPPVVNYQLENLPPNSKGLVLWIIEGHILSSQEVDFLSRL  136

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P++ P+V++  E G  R+F WKPLK 
Sbjct  137  PSIEPRVKIAIEMGGDRQFSWKPLKN  162



>ref|WP_006669642.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Arthrospira]
 gb|EDZ93988.1| NADH dehydrogenase I subunit N [Arthrospira maxima CS-328]
Length=158

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 92/146 (63%), Gaps = 7/146 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            GK + D+E   ALA+Y P EGG+EGRY  RLR  GY    LSARGLGD    L   H V 
Sbjct  8    GKLIRDLESEGALALYVPLEGGFEGRYRRRLRIAGYTTYSLSARGLGDLAAYLLGVHGVR  67

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            P H+GK+           +Y PP V+Y+L  LPP++KGLV+WIIE  +LS  E+ FL+ L
Sbjct  68   PPHLGKKSSGNDAAVGDIYYLPPVVNYQLENLPPNSKGLVLWIIEGHILSSQEVDFLSRL  127

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P++ P+V++  E G  R+F WKPLK 
Sbjct  128  PSIEPRVKIAIEMGGDRQFSWKPLKN  153



>ref|WP_015169571.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechococcus 
sp. PCC 7502]
 ref|YP_007107055.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechococcus 
sp. PCC 7502]
 gb|AFY74920.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechococcus 
sp. PCC 7502]
Length=149

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K ++D+E   ALA+Y P EGGYEGRY  R+R  GY  L ++ARGLGD  + LT  H V P
Sbjct  8    KIVNDLEAAGALAMYVPPEGGYEGRYQRRVRNAGYDILSITARGLGDVSSFLTGVHGVRP  67

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            +H+GK+ I  ++ PP++ YRL+ LPP++KGLVVW+ E K L++ EL+ ++ +P     V+
Sbjct  68   SHLGKKAIVTYFLPPKIQYRLASLPPNSKGLVVWLGEGKFLTRQELEVISQIPAKFKNVK  127

Query  731  VIAECGNWRKFMWKPLKE  784
            V+ E G+ R+ +W PL +
Sbjct  128  VVIELGSAREVIWSPLVQ  145



>ref|WP_015186031.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Microcoleus 
sp. PCC 7113]
 ref|YP_007125309.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Microcoleus 
sp. PCC 7113]
 gb|AFZ21903.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Microcoleus 
sp. PCC 7113]
Length=155

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  +LAIY P EGG+EGRY  RLR  GY  L ++ARGLGD  T LT  H V P 
Sbjct  10   FIRNLEQSGSLAIYMPLEGGFEGRYRRRLRAAGYASLCMTARGLGDLSTYLTGVHGVRPP  69

Query  554  HVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
            H+GK+ I  +Y PP + Y+L  LPP +KGLV+W+IE  +LS  E+++L  LP   P+V+V
Sbjct  70   HLGKKDIRVYYLPPVLTYQLEHLPPKSKGLVLWLIEGNILSSQEVEYLITLPQQEPRVKV  129

Query  734  IAECGNWRKFMWKPLKE  784
              E G  R F WKPLK+
Sbjct  130  AVEMGGDRSFRWKPLKD  146



>ref|WP_015187443.1| NAD(P)H-quinone oxidoreductase subunit N [Gloeocapsa sp. PCC 
7428]
 ref|YP_007126727.1| NAD(P)H-quinone oxidoreductase subunit N [Gloeocapsa sp. PCC 
7428]
 gb|AFZ29567.1| NAD(P)H-quinone oxidoreductase subunit N [Gloeocapsa sp. PCC 
7428]
Length=162

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++ D+E+  AL +Y P EGG+EGRY  RLR  GY  L ++AR LGD    LTK H V P
Sbjct  9    KFIKDLEKSGALGVYVPLEGGFEGRYQRRLRAAGYTTLHITARSLGDVAAYLTKVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+ I R       +Y PP V+Y L  LPP +KGLV+W+IE  +LS  E+++LA LP
Sbjct  69   PHLGKKSIGRGAAVGNIYYAPPIVNYHLQQLPPKSKGLVLWMIEGHMLSNQEIEYLAKLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
            +L P+V+V+ E G  R F W PLK+
Sbjct  129  SLEPRVKVVLERGGDRYFRWTPLKD  153



>ref|WP_008190716.1| NAD(P)H-quinone oxidoreductase subunit N [Moorea producens]
 gb|EGJ28869.1| hypothetical protein LYNGBM3L_69440 [Moorea producens 3L]
 gb|AEE88234.1| hypothetical protein [Moorea producens 3L]
Length=164

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 95/144 (66%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  ALA+Y P EGG+EGRY  RLR  GY  + ++A+GLGDP   LT  H V P 
Sbjct  10   FIRALEKSGALAVYAPLEGGFEGRYQRRLRAAGYTTVSITAKGLGDPAAYLTGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ + +       +Y PP V+Y+LS L P++KGLV+WIIE  +LS  E+++L  LP 
Sbjct  70   HLGKKNMGKSAAVGDVYYLPPLVNYQLSALSPNSKGLVLWIIEGIILSSQEVEYLTTLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+V+VI E G  R F W+PLKE
Sbjct  130  QEPRVKVILEMGGDRAFRWQPLKE  153



>ref|WP_019492007.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix sp. PCC 7103]
Length=159

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 95/143 (66%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT+ H V P H
Sbjct  11   IRDLEKYGALGVYVPLEGGFEGRYRRRLRANGYATLNITARGLGDVAAYLTRIHGVRPPH  70

Query  557  VGKQPI-------ARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+         A +Y PP + Y++  LPP +KGLV+WIIE  +LS  E+++LA LP++
Sbjct  71   LGKKSTGSGAAVGAVYYIPPILSYQIEQLPPKSKGLVLWIIEGHILSDQEIEYLAALPSM  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             PKV+VI E G  R F W PL++
Sbjct  131  EPKVKVIIERGGDRSFRWTPLEK  153



>ref|WP_038080263.1| NAD(P)H-quinone oxidoreductase [Tolypothrix bouteillei]
 gb|KIE08732.1| NAD(P)H-quinone oxidoreductase [Tolypothrix bouteillei VB521301]
Length=158

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+H AL +Y P EGG+EGRY  RLR  GY  L+LSA+GLGD    LT+ H V P H
Sbjct  11   IRDLEKHGALGVYVPLEGGFEGRYRRRLRAAGYVALNLSAKGLGDVAAYLTRVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+  L  LPP +KGLV+WIIE  +LS  E++FLA LP++
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNSHLEQLPPKSKGLVLWIIEGNILSDQEVEFLATLPSI  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+VI E G  R F W PL++
Sbjct  131  EPRVKVIIERGGDRAFRWTPLQK  153



>ref|WP_026722092.1| NAD(P)H-quinone oxidoreductase [Fischerella sp. PCC 9431]
Length=158

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT  H V PAH
Sbjct  11   IRDLEKNGALGVYVPLEGGFEGRYRRRLRAAGYMTLNITARGLGDLAAYLTGVHGVRPAH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  EL++LA LP L
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNYQLEQLPPKSKGLVLWIIEGHILSDQELEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRTFRWMPLEK  153



>ref|WP_016859449.1| NAD(P)H-quinone oxidoreductase subunit N [Fischerella muscicola]
Length=158

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT  H V PAH
Sbjct  11   IRDLEKNGALGVYVPLEGGFEGRYRRRLRAAGYTTLNITARGLGDLAAYLTGVHGVRPAH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  EL++LA LP L
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNYQLEQLPPKSKGLVLWIIEGHILSDQELEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRAFRWMPLEK  153



>ref|WP_017748868.1| NAD(P)H-quinone oxidoreductase subunit N [Scytonema hofmanni]
Length=158

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+H AL +Y P EGG+EGRY  RLR  GY  L+L+A+GLGD    LTK H V P H
Sbjct  11   IRDLEKHGALGVYVPLEGGFEGRYRRRLRAAGYIALNLTAKGLGDVAAYLTKVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V  +L  LPP +KGLV+WIIE  VLS  E++FLA LP++
Sbjct  71   LGKKSTGSGAAVGYVYYLPPIVSSQLEQLPPKSKGLVLWIIEGSVLSDQEVEFLATLPSI  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+VI E G  R F W PL++
Sbjct  131  EPRVKVIIERGGDRAFRWMPLEK  153



>ref|WP_009629601.1| NAD(P)H-quinone oxidoreductase subunit N [Pseudanabaena biceps]
 gb|ELS30347.1| NAD(P)H-quinone oxidoreductase subunit N [Pseudanabaena biceps 
PCC 7429]
Length=149

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K + D+E+  ALA+  P EGGYEGRY  RL+  GY  L ++ARGLGD  + LT  H V P
Sbjct  8    KIVKDLEKAGALAMRVPPEGGYEGRYQLRLKNAGYEILFITARGLGDVNSYLTDVHGVRP  67

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            +H+GK  I  ++ PP + +RL+ LP  +KGLVVW+IE K LSK EL+ L+ +P   P+V+
Sbjct  68   SHLGKTEIRTYFIPPAIQFRLNALPAKSKGLVVWLIEGKYLSKEELETLSQIPDRDPRVK  127

Query  731  VIAECGNWRKFMWKPLKE  784
            ++ E G+ R+  W+PLK+
Sbjct  128  IVIETGSDREVTWQPLKQ  145



>ref|WP_015144603.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Pleurocapsa 
minor]
 ref|YP_007081859.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Pleurocapsa 
sp. PCC 7327]
 gb|AFY78302.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Pleurocapsa 
sp. PCC 7327]
Length=158

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  AL +Y P EGG+EGRY  RLR  GY  L ++ARGLGD  T LT  H V P 
Sbjct  10   FIRDLEKSGALGVYVPLEGGFEGRYQRRLRAAGYVTLSITARGLGDVGTYLTGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I R       +Y PP   Y+L  LPP +KGLV+WIIE  +LS+AE+++LA LP 
Sbjct  70   HLGKKTIGREAAVGLIYYVPPIASYQLETLPPKSKGLVLWIIEGHILSRAEVEYLANLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+++++ E G  R F WKPL E
Sbjct  130  QDPRLKIVLERGGDRAFSWKPLLE  153



>ref|WP_015113432.1| NAD(P)H-quinone oxidoreductase subunit N [Nostoc sp. PCC 7107]
 ref|YP_007050368.1| NAD(P)H-quinone oxidoreductase subunit N [Nostoc sp. PCC 7107]
 gb|AFY43218.1| NAD(P)H-quinone oxidoreductase subunit N [Nostoc sp. PCC 7107]
Length=162

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 92/141 (65%), Gaps = 7/141 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL  Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKFGALGTYVPLEGGFEGRYRRRLRAAGYVTLNMTARGLGDVAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+  +        +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E++FLA LP+L
Sbjct  71   LGKKSTSSGAAVGSVYYLPPIVNYQLEQLPPKSKGLVLWIIEGHILSDQEVEFLAELPSL  130

Query  716  RPKVRVIAECGNWRKFMWKPL  778
             P+V+V+ E G  R F WKPL
Sbjct  131  EPRVKVVLERGGARAFNWKPL  151



>ref|WP_012626089.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanothece sp. PCC 
7425]
 ref|YP_002481349.1| NADH dehydrogenase subunit N [Cyanothece sp. PCC 7425]
 sp|B8HUU1.1|NDHN_CYAP4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Cyanothece sp. PCC 7425]
 gb|ACL42988.1| NADH dehydrogenase I subunit N, putative [Cyanothece sp. PCC 
7425]
Length=158

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 97/147 (66%), Gaps = 7/147 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E+  AL IY P EGG+EGRY  RLR  GY  L +SA GLGD  + LT+ H V P
Sbjct  9    QFIQDLEKSGALGIYVPSEGGFEGRYQRRLRAAGYSTLHISAPGLGDLPSYLTQVHGVRP  68

Query  551  AHVGKQP-------IARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK         +  ++ PP V+Y L  LPP A+GLV+W+I+ K LS+ EL +L++LP
Sbjct  69   PHLGKSTQGNTDWGVKTFFLPPLVNYHLENLPPKARGLVLWMIDGKRLSRQELAYLSILP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEIA  790
               PKV+++ E G  R+F W+PLKE+A
Sbjct  129  AQEPKVKIVIELGGDRQFRWQPLKEMA  155



>ref|WP_015148969.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Oscillatoria 
acuminata]
 ref|YP_007086249.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Oscillatoria 
acuminata PCC 6304]
 gb|AFY82329.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Oscillatoria 
acuminata PCC 6304]
Length=154

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 0/139 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++ D+E++ +LA+Y P EGG+EGRY  R+R  GY  ++LSARGLGD    LT  H V P
Sbjct  9    KFIRDLEQNGSLALYVPLEGGFEGRYQRRVRAAGYVTVNLSARGLGDLAAYLTGVHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
             H+GK+ I  ++ PP V  +L  LPP AKGLVVW+I+  VLS  EL +L  L  + P+V+
Sbjct  69   PHLGKKDIRTYFIPPIVSSQLEQLPPKAKGLVVWLIDGIVLSNQELSYLTELSKIEPRVK  128

Query  731  VIAECGNWRKFMWKPLKEI  787
            V+ E G  R   W PLK++
Sbjct  129  VVVEVGGDRTVTWNPLKDL  147



>ref|WP_017310496.1| NAD(P)H-quinone oxidoreductase subunit N [Fischerella sp. PCC 
9339]
Length=158

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  L+++ARGLGD    LT  H V PAH
Sbjct  11   IRDLEKNGALGVYAPLEGGFEGRYRRRLRAAGYTTLNITARGLGDLAAYLTGVHGVRPAH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNYQLEQLPPKSKGLVLWIIEGYILSDQEVEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRSFRWIPLEK  153



>ref|WP_015231102.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Dactylococcopsis 
salina]
 ref|YP_007173485.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Dactylococcopsis 
salina PCC 8305]
 gb|AFZ52128.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Dactylococcopsis 
salina PCC 8305]
Length=158

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 95/146 (65%), Gaps = 7/146 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++ D+E   ALA+Y P EGG+EGRY  RLR +GY  L L+A+GLGDP + L + H V P
Sbjct  9    KFIRDLETSGALAVYAPSEGGFEGRYQRRLRTKGYVTLHLTAKGLGDPASYLKRVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            AH+GK+ I +       ++ PP VD +L +LP + KGLV+W+IE  VLS+ EL +LA   
Sbjct  69   AHLGKKNIGQSAAVGDVYFLPPIVDSQLDILPENKKGLVLWLIEGFVLSRQELDYLAKFH  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
             + PKVRV+ E G  R F W+ L  +
Sbjct  129  EIEPKVRVVVELGGDRAFRWEKLSSL  154



>ref|WP_012594139.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Cyanothece]
 ref|YP_002371019.1| NADH dehydrogenase subunit N [Cyanothece sp. PCC 8801]
 ref|YP_003136582.1| hypothetical protein Cyan8802_0808 [Cyanothece sp. PCC 8802]
 sp|B7JYJ3.1|NDHN_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Cyanothece sp. PCC 8801]
 gb|ACK64863.1| NADH dehydrogenase I subunit N [Cyanothece sp. PCC 8801]
 gb|ACU99746.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=158

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  +LA+Y P EGG+EGRY  RLR  GYH   L+ARGLGD    L   H V P 
Sbjct  10   FIRALEKSGSLAVYAPLEGGFEGRYQRRLRTNGYHTFSLTARGLGDVSAYLMGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  LPP +KGLV+WI+E  +LS+ EL++LA LPT
Sbjct  70   HLGKKNIGQEAAVGPVYFVPPIAAYQLETLPPKSKGLVLWILEGFILSQTELEYLANLPT  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
            L P+++V+ E G  R F WKPL E+
Sbjct  130  LEPRLKVVIELGGERYFSWKPLPEV  154



>ref|WP_009767999.1| NADH-quinone oxidoreductase subunit NdhN [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68888.1| NADH-quinone oxidoreductase subunit NdhN [Oscillatoriales cyanobacterium 
JSC-12]
Length=158

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K + D+E H AL +Y P EGG+EGRY  R+R  GY  L LSARGLGD    LT  H V P
Sbjct  9    KLIRDLETHGALGLYVPLEGGFEGRYRRRIRAAGYESLSLSARGLGDVAAYLTGIHGVRP  68

Query  551  AHVGKQPIA-------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+          R++ PP V YRL  LP ++KGL++WIIE  +LS  E+++L+ LP
Sbjct  69   PHLGKKSTNNGAAVGYRYFIPPIVSYRLEQLPLNSKGLLLWIIEGNILSNQEIEYLSALP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
             + P++++  E G  R F W+PLK+
Sbjct  129  NVEPRLKLAVEMGGERYFRWEPLKQ  153



>ref|WP_017721174.1| NAD(P)H-quinone oxidoreductase subunit N [Oscillatoria sp. PCC 
10802]
Length=158

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 95/146 (65%), Gaps = 7/146 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            G+ + D+E++ AL +Y P EGGYEGRY  R+R  GY   +LSARGLGD    LT  H V 
Sbjct  8    GQLIRDLEKNGALGLYVPLEGGYEGRYQRRIRAAGYTTYNLSARGLGDLAAYLTGVHGVR  67

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            P H+GK+ ++        +Y PP ++ +L  LPP AKGLV+WIIE  +LS+ E+++L  L
Sbjct  68   PPHLGKKSLSTGAAVGYVYYIPPILNTQLDHLPPKAKGLVLWIIEGHILSRQEIEYLTAL  127

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P + P+V++  E G  R F WKPLK+
Sbjct  128  PQIEPRVKIAVEMGGERFFRWKPLKD  153



>ref|WP_016868091.1| NAD(P)H-quinone oxidoreductase subunit N [Fischerella muscicola]
Length=158

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  LD++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKNGALGVYVPLEGGFEGRYRRRLRAAGYITLDITARGLGDLAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNYQLEQLPPKSKGLVLWIIEGHILSDQEIEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRAFRWMPLEK  153



>ref|WP_015178703.1| NAD(P)H-quinone oxidoreductase subunit N [Oscillatoria nigro-viridis]
 ref|YP_007117897.1| NAD(P)H-quinone oxidoreductase subunit N [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ09481.1| NAD(P)H-quinone oxidoreductase subunit N [Oscillatoria nigro-viridis 
PCC 7112]
Length=158

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  +LA+Y P EGG+EGRY  RLR  GY    ++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKSGSLALYVPLEGGFEGRYLRRLRAAGYGAYTITARGLGDLAMYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP +  +L  LPP AKGLV+WIIE +VLS  E+++L +LPTL
Sbjct  71   LGKKTTGNEASVGYTYYVPPMLKTQLDNLPPKAKGLVLWIIEGQVLSSQEIEYLTVLPTL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V++  E G  R F WKPLK+
Sbjct  131  EPRVKIAVEMGGDRAFSWKPLKD  153



>gb|KDO54945.1| hypothetical protein CISIN_1g027724mg [Citrus sinensis]
Length=133

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 4/95 (4%)
 Frame = +2

Query  281  GRQQRKTADVRCS----VGIEDFIGGDLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRY  448
            G+  ++     CS    + I DFIGGDL+  DLG+WLSDVE+HKA+AIY PHEGGYEGRY
Sbjct  38   GKASKRVGVTNCSGNSGIEIGDFIGGDLLKPDLGRWLSDVEKHKAIAIYTPHEGGYEGRY  97

Query  449  FTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
              RLRY GY+FLDLSARGLGDPETTLTK +PVCP 
Sbjct  98   LNRLRYLGYYFLDLSARGLGDPETTLTKVYPVCPV  132



>ref|WP_015200883.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix parietina]
 ref|YP_007140246.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix sp. PCC 6303]
 gb|AFZ04274.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix sp. PCC 6303]
Length=164

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+H AL +Y P EGG EGRY  RLR  GY  ++L+ARGLGD    LT+ H V P 
Sbjct  10   FIRDLEKHGALGVYVPLEGGMEGRYRRRLRAYGYTAVNLTARGLGDVAAYLTRIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+           +Y PP + Y L  LPP +KGLV+WIIE  VLS  E++FL  LP+
Sbjct  70   HLGKKGTTAGAAVGDVYYIPPILTYHLENLPPKSKGLVLWIIEGYVLSDQEIEFLMALPS  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            + P+V+V+ E G  R F WKPL++
Sbjct  130  MEPRVKVVIERGGDRVFSWKPLEK  153



>ref|WP_006635002.1| NAD(P)H-quinone oxidoreductase subunit N [Microcoleus vaginatus]
 gb|EGK84847.1| NAD(P)H-quinone oxidoreductase subunit N [Microcoleus vaginatus 
FGP-2]
Length=158

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  +LA+Y P EGG+EGRY  RLR  GY    +SARGLGD    LT  H V P H
Sbjct  11   IRDLEKSGSLALYVPLEGGFEGRYLRRLRAAGYGAHTISARGLGDLAMYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           W+ PP +  +L  LPP AKGLV+WIIE  +LS  E+++L +LPTL
Sbjct  71   LGKKTTGNEAAVGYTWFVPPILQTQLDNLPPKAKGLVLWIIEGHILSNQEIEYLTVLPTL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V++  E G  R F WKPLK+
Sbjct  131  EPRVKIAVEMGGDRAFSWKPLKD  153



>ref|WP_026786906.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase [Planktothrix]
 gb|KEI65627.1| NADH dehydrogenase I subunit N [Planktothrix agardhii NIVA-CYA 
126/8]
Length=158

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K + D+E +KAL +Y P EGG+EGRY  RLR  GY   +LSARGLGD    LT  H V P
Sbjct  9    KLIRDLETYKALGMYVPLEGGFEGRYRRRLRANGYTTYNLSARGLGDLSAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            AH+GK+           +Y PP ++ +L  LPP +KGLV+WIIE  +LS  E+ FL  LP
Sbjct  69   AHLGKKSSGNEAAVGDVYYVPPILNTQLEQLPPKSKGLVLWIIEGHILSSQEITFLTQLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
               P+V+++ E G  R   W PLK++
Sbjct  129  QQEPRVKLVVEMGGARVVQWTPLKDV  154



>ref|WP_018400630.1| NAD(P)H-quinone oxidoreductase subunit N [filamentous cyanobacterium 
ESFC-1]
Length=158

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  AL  Y P EGG+EGRY  RLR  GY    LSARGLGD    LT+ H V PA
Sbjct  10   FIRDLEQSGALGTYAPLEGGFEGRYQRRLRTLGYDTFRLSARGLGDLAAYLTRVHGVRPA  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y++  LPP +KGLV+W+IE  VLS+ EL++LA L  
Sbjct  70   HLGKKNIGQDAMVGPVYFIPPVATYQIESLPPQSKGLVLWMIEGFVLSRQELEYLANLAK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
            + PK+++I E G  R F W+PL E+
Sbjct  130  VEPKLKIIVELGGDRAFRWQPLAEV  154



>ref|WP_016877803.1| NAD(P)H-quinone oxidoreductase subunit N [Chlorogloeopsis fritschii]
Length=158

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+H AL +Y P EGG+EGRY  RLR  GY  L ++A+GLGD    LT  H V P H
Sbjct  11   IRDLEKHGALGVYVPLEGGFEGRYRRRLRAAGYVTLHMTAKGLGDVSAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+  A        +Y PP V+Y+L  LPP +KGL++WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTANGAAVGYVYYVPPIVNYQLQQLPPKSKGLLLWIIEGHILSDEEVEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRAFRWMPLEK  153



>ref|WP_009782751.1| NAD(P)H-quinone oxidoreductase subunit N [Lyngbya sp. PCC 8106]
 gb|EAW38776.1| hypothetical protein L8106_15215 [Lyngbya sp. PCC 8106]
Length=158

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 92/147 (63%), Gaps = 7/147 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            GK++ D+E   ALA+Y P EGG EGRY  RLR  GY    LSARGLGD    LT  H V 
Sbjct  8    GKFIRDLETQGALALYVPLEGGMEGRYRRRLRAAGYTTYTLSARGLGDLSAYLTGVHGVR  67

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            P H+GK+           +Y PP ++Y+L  +P  +KGLV+W+IE  +LS  E++FL  L
Sbjct  68   PPHLGKKSSGNDAAVGNVYYVPPILNYQLEQIPAKSKGLVLWMIEGHILSSQEVEFLTQL  127

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKEI  787
            P+L P+V++  E G  R F ++PLKEI
Sbjct  128  PSLEPRVKIAIEMGGARYFRYQPLKEI  154



>ref|WP_015165961.1| NAD(P)H-quinone oxidoreductase subunit N [Pseudanabaena sp. PCC 
7367]
 ref|YP_007103433.1| NAD(P)H-quinone oxidoreductase subunit N [Pseudanabaena sp. PCC 
7367]
 gb|AFY71005.1| NAD(P)H-quinone oxidoreductase subunit N [Pseudanabaena sp. PCC 
7367]
Length=149

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 89/142 (63%), Gaps = 0/142 (0%)
 Frame = +2

Query  359  FDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFH  538
            F   K L D+E+  ALA+  P EGGYEGRY   L   GY  L +SARGLGD  + LT  H
Sbjct  4    FTSRKILKDLEKSSALAMSVPPEGGYEGRYRRLLEVSGYDILYISARGLGDISSFLTGVH  63

Query  539  PVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             V PAH+GK+ +  ++ PPE+ YRL  LP D+KGLVVW+IE K L K EL+ L  +    
Sbjct  64   GVRPAHLGKKDVRTYFIPPEISYRLQSLPKDSKGLVVWLIEGKYLDKQELRVLNQICQQD  123

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
            P+V+V+ E  + R   W+PL E
Sbjct  124  PRVKVVIEIASDRSVNWRPLSE  145



>ref|WP_007357053.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Kamptonema]
 emb|CBN57861.1| NAD(P)H-quinone oxidoreductase subunit N [ [[Oscillatoria] sp. 
PCC 6506]
Length=159

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K + D+E+  +LA+Y P EGG+EGRY  RLR   Y   +++ARGLGD    LT  H V P
Sbjct  9    KMIRDLEKSGSLAVYVPLEGGFEGRYQRRLRAASYSTHNITARGLGDLAAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+           +Y PP V+ +L  LPP AKGLV+WIIE  VLS+ E+++L +LP
Sbjct  69   PHLGKKTTGNEASVGYVYYLPPVVNTQLEHLPPKAKGLVLWIIEGFVLSRQEIEYLTVLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
            +L P+V+V+ E G  R F W PLK+
Sbjct  129  SLEPRVKVVVEMGGDRAFRWTPLKD  153



>ref|WP_017321345.1| NAD(P)H-quinone oxidoreductase subunit N [cyanobacterium PCC 
7702]
Length=158

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 94/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+H AL +Y P EGG+EGRY  RLR  GY  L +SARGLGD  + LTK H V P 
Sbjct  10   FIRDLEKHGALGVYVPLEGGFEGRYRRRLRAAGYVTLHMSARGLGDVASYLTKVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+  A        +Y PP V+Y+L  LPP +KGLV+W+IE  +L+  E+++L  LP 
Sbjct  70   HLGKKTTATSAAVGYVYYVPPIVNYQLEQLPPQSKGLVLWLIEGHILADEEVEYLVNLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L  +V+V+ E G  R F W PL++
Sbjct  130  LESQVKVVIERGGDRVFRWTPLEK  153



>ref|WP_011612523.1| NAD(P)H-quinone oxidoreductase subunit N [Trichodesmium erythraeum]
 ref|YP_722641.1| NADH dehydrogenase I subunit N [Trichodesmium erythraeum IMS101]
 sp|Q110A6.1|NDHN_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Trichodesmium erythraeum IMS101]
 gb|ABG52168.1| NADH dehydrogenase I subunit N [Trichodesmium erythraeum IMS101]
Length=158

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  +LA+YPP EGG+EGRY  RLR  GY    ++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKSGSLAVYPPLEGGFEGRYQRRLRASGYVSESITARGLGDLAMYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+ +         +Y PP V+Y+L  LPP AKGLV+WI+E ++LS  E+++L +LP  
Sbjct  71   LGKKTVGNGPAVGYVYYVPPIVNYKLEHLPPKAKGLVLWIMEGQILSSQEIEYLTVLPKS  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+VI E G  R F W PL+ 
Sbjct  131  EPRVKVIVEMGGDRFFRWTPLQN  153



>ref|WP_017651192.1| NAD(P)H-quinone oxidoreductase subunit N [Microchaete sp. PCC 
7126]
Length=158

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  +L +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT  H V P 
Sbjct  10   FIRELEKAGSLGVYVPLEGGYEGRYRRRLRATGYITLHITARGLGDVAAYLTGVHGVRPP  69

Query  554  HVGKQPI-------ARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+         A +Y PP V Y L  LPP +KGLV+WIIE  +LS+ EL++LA LP+
Sbjct  70   HLGKKTTGSGAAVGAVYYLPPIVGYNLEQLPPQSKGLVLWIIEGHILSQQELEYLATLPS  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F W PL++
Sbjct  130  LEPRVKVVIERGGDRIFRWAPLEK  153



>ref|XP_006401111.1| hypothetical protein EUTSA_v10014691mg [Eutrema salsugineum]
 gb|ESQ42564.1| hypothetical protein EUTSA_v10014691mg [Eutrema salsugineum]
Length=139

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  230  FRKKQLVAITAGKWGWMGRQQRKTADVRCSVGIEDFIGGDLVWFDLGKWLSDVEEHKALA  409
            F   Q+ + T   +    R++R++  VRC   I DFIGGDLV  D+G+WL DVE HKA+A
Sbjct  16   FEASQVKSKTFRPFSVNTRKERRSKGVRCR-SISDFIGGDLVKLDIGRWLEDVEGHKAIA  74

Query  410  IYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            IY PHEGGYEGRY  RL+ QGY+FLD+SARGLGDPETTL   +PVCP 
Sbjct  75   IYTPHEGGYEGRYLNRLKSQGYYFLDISARGLGDPETTLLNPYPVCPV  122



>ref|WP_015208473.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Cylindrospermum 
stagnale]
 ref|YP_007147901.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ25221.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Cylindrospermum 
stagnale PCC 7417]
Length=158

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT+ H V P H
Sbjct  11   IRDLEKFGALGVYVPLEGGYEGRYRRRLRAAGYANLHITARGLGDVAAYLTRVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP + Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGEVYYLPPILSYQLEQLPPKSKGLVLWIIEGHILSNQEVEYLATLPGL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRAFRWTPLEK  153



>ref|WP_015124201.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechococcus 
sp. PCC 6312]
 ref|YP_007061200.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechococcus 
sp. PCC 6312]
 gb|AFY60657.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Synechococcus 
sp. PCC 6312]
Length=151

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+++  ALA+Y P EGG+EGRY  RLR  GY  L LSA GLGD    LT+ H + P
Sbjct  9    QFVRDLDQAGALAMYVPPEGGFEGRYQRRLRTAGYPTLHLSAPGLGDLSAYLTQVHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            AH GK+ I  ++ PP V Y L  LPP AKGL +W+I+ K LS+ EL +L+LL    P+++
Sbjct  69   AHTGKENIRVYFRPPLVTYHLENLPPQAKGLALWLIDGKKLSRQELAYLSLLTQQEPRLK  128

Query  731  VIAECGNWRKFMWKPLKEIAE  793
            ++ E G  R+  W+PL  IA+
Sbjct  129  IVVEVGGAREVKWQPLSTIAQ  149



>ref|WP_015203301.1| NAD(P)H-quinone oxidoreductase subunit N [Crinalium epipsammum]
 ref|YP_007142697.1| NAD(P)H-quinone oxidoreductase subunit N [Crinalium epipsammum 
PCC 9333]
 gb|AFZ13187.1| NAD(P)H-quinone oxidoreductase subunit N [Crinalium epipsammum 
PCC 9333]
Length=151

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+++  A+ +Y P EGG+EGRY  RLR  GY    L ARGLGD    LT  H V P 
Sbjct  10   FIRDLQKSGAVGVYAPLEGGFEGRYQRRLRAAGYVTYRLEARGLGDLAMYLTGVHGVRPP  69

Query  554  HVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
            H+GK+ I  +Y PP V+ +L  LPP +KGLV+WI++ +VLS  E +FL  LP L PKV+V
Sbjct  70   HLGKKDIRVFYVPPIVNSQLEQLPPHSKGLVLWIVDGQVLSSQEREFLVNLPNLEPKVKV  129

Query  734  IAECGNWRKFMWKPLKE  784
            + E G  R F WKPL+ 
Sbjct  130  VLELGGDRVFSWKPLQN  146



>ref|WP_006196746.1| NAD(P)H-quinone oxidoreductase subunit N [Nodularia spumigena]
 gb|EAW45089.1| hypothetical protein N9414_02676 [Nodularia spumigena CCY9414]
 gb|AHJ30682.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Nodularia 
spumigena CCY9414]
Length=162

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  +L +Y P EGG+EGRY  RLR  GY  L ++ARGLGD    LT  H V P 
Sbjct  10   FIRDLEKFGSLGVYVPLEGGFEGRYRRRLRAAGYGNLHITARGLGDVAAYLTGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+           +Y PP V Y L  LPP +KGLV+WIIE ++L+  E++FL  LP+
Sbjct  70   HLGKKSTGSGAAVGYVYYIPPIVTYNLEQLPPKSKGLVLWIIEGQILADQEVEFLTTLPS  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
            L P+V+V+ E G  R F WK LK+    S
Sbjct  130  LEPRVKVVVERGGDRAFRWKSLKDTYSAS  158



>ref|WP_019501141.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=149

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+ +  ALA+  P EGGYEGRY  RLR  GY  L ++ARGLGD  + LT  H V P H
Sbjct  10   VKDLAKAGALAMRVPPEGGYEGRYQRRLRAAGYDVLSITARGLGDISSYLTGVHGVRPPH  69

Query  557  VGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVRVI  736
            +GK+ +  ++ PP++ YRLS LPP +KGLVVW+IE + LS+ EL+ L+  P    +V+++
Sbjct  70   LGKKAVQTYFLPPQIQYRLSSLPPKSKGLVVWLIEGRYLSRQELEVLSQFPDRDARVKIV  129

Query  737  AECGNWRKFMWKPLKEI  787
             E  + R+  W PLK++
Sbjct  130  IETASDREVSWSPLKQV  146



>ref|WP_017297648.1| hypothetical protein [Nodosilinea nodulosa]
Length=155

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E + A+A+  P EGG+EGRY  RL+  GY  ++L+ARGLGD  + LT  H V PA
Sbjct  10   FIKDLESNGAIAVRMPLEGGFEGRYERRLKATGYETMNLTARGLGDVSSYLTAIHGVRPA  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ +         ++ PP + YRL  + P AKG+V+W+IE  +LS+ EL +L  LPT
Sbjct  70   HLGKKSLGSGAAVGYTYFIPPLLTYRLESMAPGAKGMVLWLIEGHILSRQELAYLVSLPT  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIA  790
              P+V+V+ E G  R F W+PL  + 
Sbjct  130  TEPRVKVVVEMGGSRYFTWEPLANLV  155



>ref|WP_035156580.1| NAD(P)H-quinone oxidoreductase [Calothrix sp. 336/3]
 gb|KFB85359.1| NAD(P)H-quinone oxidoreductase [Calothrix sp. 336/3]
Length=158

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 95/144 (66%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+H A+ +Y P EGG+EGRY  RLR +GY    ++ RGLGD    LT  H V PA
Sbjct  10   FIRDLEKHGAVGVYVPLEGGFEGRYRRRLRAKGYTTYSITGRGLGDVAAYLTGVHGVRPA  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ +A        +Y PP VD  ++ LPP +KGLV+WIIE  +LS  E+++LA L  
Sbjct  70   HLGKRSVASGAAVGEVYYIPPIVDTLVAQLPPKSKGLVLWIIEGHILSDDEIEYLANLHK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            ++PKV+V+ E G  R F W+PL++
Sbjct  130  IQPKVKVVIERGGDRVFRWQPLEK  153



>ref|WP_011244174.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus elongatus]
 ref|YP_172574.1| hypothetical protein syc1864_c [Synechococcus elongatus PCC 6301]
 ref|YP_401251.1| NADH dehydrogenase I subunit N [Synechococcus elongatus PCC 7942]
 sp|Q5N0W6.1|NDHN_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus elongatus PCC 6301]
 sp|Q31L05.1|NDHN_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus elongatus PCC 7942]
 dbj|BAD80054.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB58264.1| NADH dehydrogenase I subunit N [Synechococcus elongatus PCC 7942]
 gb|AJD57265.1| NAD(P)H-quinone oxidoreductase [Synechococcus sp. UTEX 2973]
Length=158

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 89/150 (59%), Gaps = 7/150 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+L  +E+  ALA+Y P EGGYEGRY  RLR +GY  L  SARGLGDP   L   H V P
Sbjct  9    KFLRALEQEGALAVYAPLEGGYEGRYLRRLRSKGYSALTYSARGLGDPAQFLMDIHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GKQ I          Y  P V Y L  LP +AKGLV+W++E  VLS  EL +   LP
Sbjct  69   PHLGKQTIGNEAAVGRVEYVLPLVGYPLQNLPANAKGLVLWLLEGHVLSPQELSYFVTLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
               P+++V+ E G  R F W+PL  +AE +
Sbjct  129  QAEPRLKVVIEMGGDRGFSWQPLAAVAEAA  158



>ref|WP_016952990.1| NAD(P)H-quinone oxidoreductase subunit N [Anabaena sp. PCC 7108]
Length=158

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LTK H V P H
Sbjct  11   IRDLEKFGALGVYVPLEGGYEGRYRRRLRAAGYINLHITARGLGDVAAYLTKVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP + Y+L  LPP +KGL++WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGEVYYLPPIISYQLEQLPPKSKGLLLWIIEGHILSDQEVEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRSFRWTPLEK  153



>ref|WP_017713404.1| hypothetical protein [Prochlorothrix hollandica]
Length=158

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+L D+E    LA+Y P EGG+EGR+  RLR  GY  + LSARGLGDP   LT  H V P
Sbjct  9    KFLRDLETAGTLAVYAPLEGGFEGRFQRRLRSFGYQSISLSARGLGDPAMYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            AH+GK+ I          + PP + YRLS LPP +KG+V+W+IE +VLS  EL +   LP
Sbjct  69   AHLGKKTIGNGAAVGSVQFIPPILSYRLSSLPPKSKGVVLWLIEGQVLSPEELAYFVDLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
               P+++V+ E G    F W+PL ++
Sbjct  129  KRDPRIKVVLEMGGHHFFRWEPLSQV  154



>ref|WP_015215910.1| NAD(P)H-quinone oxidoreductase subunit N [Anabaena cylindrica]
 ref|YP_007158200.1| NAD(P)H-quinone oxidoreductase subunit N [Anabaena cylindrica 
PCC 7122]
 gb|AFZ59290.1| NAD(P)H-quinone oxidoreductase subunit N [Anabaena cylindrica 
PCC 7122]
Length=158

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT+ H V P H
Sbjct  11   MRDLEKFGALGVYVPLEGGYEGRYRRRLRAAGYMNLHITARGLGDVAAYLTRVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP + Y+L  LPP +KGL++WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGEVYYLPPIISYQLEQLPPKSKGLLLWIIEGHILSNQEVEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRYFRWTPLEK  153



>ref|WP_026732545.1| NAD(P)H-quinone oxidoreductase [Fischerella sp. PCC 9605]
Length=158

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 92/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  L ++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKNGALGVYVPLEGGFEGRYRRRLRAAGYTSLHITARGLGDLAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNYQLEHLPPKSKGLVLWIIEGHILSDQEIEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRAFRWMPLEK  153



>ref|WP_015223836.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007166171.1| hypothetical protein Cyast_2579 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ48522.1| hypothetical protein Cyast_2579 [Cyanobacterium stanieri PCC 
7202]
Length=159

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  ALA++ P EGG+EGRY  RLR  GYH + +SARGLGD    L   H V PA
Sbjct  10   FIRDLEKTGALAVFTPPEGGFEGRYQRRLRTSGYHSISISARGLGDLSAYLMGVHGVRPA  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP    +L  LPP++KGLV+WIIE  VLS+ E ++LA L  
Sbjct  70   HLGKKNIGQEGSVGPIYFVPPIALSQLETLPPNSKGLVLWIIEGVVLSRQEKEYLANLSK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            + PK++V+ E G  R F W+PL E
Sbjct  130  IEPKIKVVLELGGERYFRWQPLTE  153



>ref|WP_027844122.1| NAD(P)H-quinone oxidoreductase [Mastigocoleus testarum]
Length=158

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 89/140 (64%), Gaps = 7/140 (5%)
 Frame = +2

Query  386  VEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVGK  565
            +E+H A  +Y P EGG+EGRY  RLR  GY  L+L+ARGLGD    LT  H V P H+GK
Sbjct  14   LEKHGAAGVYAPLEGGFEGRYRRRLRAAGYTTLNLTARGLGDVAAYLTGIHGVRPPHLGK  73

Query  566  QPIA-------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPK  724
            +          R+Y PP V+Y L  LPP +KGLV+WIIE  VL   E+++L  LP + P+
Sbjct  74   KSTGSGAAVGERYYLPPLVNYHLENLPPKSKGLVLWIIEGFVLDNQEIEYLTNLPKIEPR  133

Query  725  VRVIAECGNWRKFMWKPLKE  784
            V+V+ E G  R F W+PL++
Sbjct  134  VKVVVERGGDRYFRWQPLEK  153



>ref|WP_021832141.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Crocosphaera 
watsonii]
 emb|CCQ53667.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Crocosphaera 
watsonii WH 8502]
Length=158

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+   L +Y P EGGYEGRY  RLR  GY  L LSARGLGD    L   H V P 
Sbjct  10   FVRALEKSGTLGVYAPLEGGYEGRYQRRLRTNGYESLSLSARGLGDVGAYLMGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IA+       ++ PP   Y+L  L P +KGLV+WIIE  +LSKAEL++L  LP 
Sbjct  70   HLGKKDIAQDAAVGPVYFVPPIAAYQLESLSPRSKGLVLWIIEGYILSKAELEYLVSLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              P+++V+ E G  R F W+PL+EI
Sbjct  130  QEPRLKVVVELGGERYFRWQPLEEI  154



>ref|WP_039724676.1| NAD(P)H-quinone oxidoreductase [Lyngbya confervoides]
 gb|KIF20459.1| NAD(P)H-quinone oxidoreductase [Aphanocapsa montana BDHKU210001]
 gb|KIF42569.1| NAD(P)H-quinone oxidoreductase [Lyngbya confervoides BDU141951]
Length=157

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 93/148 (63%), Gaps = 8/148 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E   ALA+  P EGG+EGRY  RLR  GY  ++L+ +GLGD    LT  H V P
Sbjct  9    RFIKDLESAGALAVRAPLEGGFEGRYQRRLRAAGYECVNLTVKGLGDLSAYLTDIHGVRP  68

Query  551  AHVGKQPIA-------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            AH+GK+ I        R+Y PP + YR+  + P AKG+V+W+IE  +LS+ E+ +L  LP
Sbjct  69   AHLGKKTIGQSAAVGYRYYIPPIISYRMEGMSPKAKGMVLWLIEGNILSQQEIAYLTELP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPL-KEIA  790
               P V+V+ E G  R F W+PL KE+A
Sbjct  129  KTMPNVKVVLEMGGDRVFSWQPLEKELA  156



>ref|WP_015195234.1| NAD(P)H-quinone oxidoreductase subunit N [Stanieria cyanosphaera]
 ref|YP_007134546.1| NAD(P)H-quinone oxidoreductase subunit N [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ37580.1| NAD(P)H-quinone oxidoreductase subunit N [Stanieria cyanosphaera 
PCC 7437]
Length=158

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  AL +Y P EGG EGRY  RLR  GYH ++LSARGLGD +  L + H V P 
Sbjct  10   FIRALEKSGALGLYVPLEGGSEGRYQRRLRAAGYHTINLSARGLGDLDAYLMRVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       +Y PP   Y+L  LP ++KGLV+WI+E  +LS+ E+++L  LP 
Sbjct  70   HLGKKTIGQEAAVGHIYYVPPVASYQLEELPDNSKGLVLWIMEGNILSRQEIEYLINLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            + P+++V  E G  R F WKPL E
Sbjct  130  IEPRIKVALELGGERYFNWKPLSE  153



>ref|WP_008312973.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Leptolyngbya 
sp. PCC 6406]
Length=157

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++ D+E   ALA+  P EGG+EGRY  RLR  GY  L+L+ARGLGD    LT  H V P
Sbjct  9    KFVRDLEAAGALAVLAPLEGGFEGRYQRRLRAAGYETLNLTARGLGDLSAYLTDVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            AH+GK+ + +       ++ PP V YR+  L  +AKGLV+W++E  +LS+ EL +LA+LP
Sbjct  69   AHLGKKTVGQSAAVGHTYFVPPLVTYRMESLGANAKGLVLWLLEGHILSQQELGYLAMLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPL  778
               P+++V+ E G  R F W+PL
Sbjct  129  QQIPQLKVVLEVGGDRVFSWQPL  151



>ref|WP_015129764.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix sp. PCC 7507]
 ref|YP_007066791.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix sp. PCC 7507]
 gb|AFY33957.1| NAD(P)H-quinone oxidoreductase subunit N [Calothrix sp. PCC 7507]
Length=158

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  +L +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT  H V P 
Sbjct  10   FIRELEKVGSLGVYVPLEGGYEGRYRRRLRAAGYISLHITARGLGDVAAYLTGVHGVRPP  69

Query  554  HVGKQPI-------ARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+         A +Y PP + Y L  LPP +KGLV+WIIE  +LS  E+++LA LP+
Sbjct  70   HLGKKSTGSGAAVGAVYYLPPILTYNLEQLPPKSKGLVLWIIEGHILSNQEIEYLAALPS  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F W PL++
Sbjct  130  LEPRVKVVIERGGDRNFRWTPLEK  153



>ref|WP_028085262.1| NAD(P)H-quinone oxidoreductase [Dolichospermum circinale]
Length=158

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT+ H V P 
Sbjct  10   FIRNLEKFGALGVYVPLEGGYEGRYLRRLRAAGYVGLHITARGLGDVAAYLTQVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+           +Y PP +D  L+ LPP +KGLV+WIIE  +LS  E+++L  LP 
Sbjct  70   HLGKKSTGSGAAVGDVYYLPPILDSHLAQLPPKSKGLVLWIIEGHILSDQEVEYLMDLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F WKPL++
Sbjct  130  LEPRVKVVIERGGDRTFRWKPLEK  153



>ref|WP_036485254.1| NAD(P)H-quinone oxidoreductase [Myxosarcina sp. GI1]
Length=158

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 94/145 (65%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  AL++Y P EGG EGRY  RLR  GY  + L+ARGLGDP   LT+FH V P 
Sbjct  10   FIRALEQAGALSLYMPLEGGAEGRYQRRLRAYGYRTIALTARGLGDPAAYLTRFHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP  +Y L+ L  +AKGLV+WI+E +VLS+ EL++L  LP 
Sbjct  70   HLGKKDIGQGAAVGDIYFVPPIANYELANLAENAKGLVLWIMEGQVLSRQELEYLIDLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              P+++V+ E G  R   WKPL E+
Sbjct  130  QEPRIKVVLEMGGDRSVSWKPLAEV  154



>ref|WP_007303657.1| NAD(P)H-quinone oxidoreductase subunit N [Crocosphaera watsonii]
 gb|EAM53361.1| NADH dehydrogenase I subunit N [Crocosphaera watsonii WH 8501]
 gb|EHJ14736.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Crocosphaera 
watsonii WH 0003]
 emb|CCQ63928.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Crocosphaera 
watsonii WH 0401]
 emb|CCQ55523.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Crocosphaera 
watsonii WH 0005]
 emb|CCQ67623.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Crocosphaera 
watsonii WH 0402]
Length=158

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+   L +Y P EGGYEGRY  RLR  GY  L LSARGLGD    L   H V P 
Sbjct  10   FVRALEKSGTLGVYAPLEGGYEGRYQRRLRTNGYESLSLSARGLGDVGAYLMGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IA+       ++ PP   Y+L  L P +KGLV+WIIE  +LSKAEL++L  LP 
Sbjct  70   HLGKKDIAQDAAVGPVYFVPPIAAYQLESLSPRSKGLVLWIIEGYILSKAELEYLVSLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              P+++V+ E G  R F W+PL+E+
Sbjct  130  QEPRLKVVVELGGERYFRWQPLEEL  154



>ref|WP_023069620.1| NAD(P)H-quinone oxidoreductase subunit N [Lyngbya aestuarii]
 gb|ERT04107.1| NAD(P)H-quinone oxidoreductase subunit N [Lyngbya aestuarii BL 
J]
Length=158

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            GK++ D+E   ALA+Y P EGG EGRY  RLR  GY    LS RGLGD    LT  H V 
Sbjct  8    GKFIRDLETQGALALYIPLEGGMEGRYRRRLRAAGYTTYTLSVRGLGDLSAYLTGVHGVR  67

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            P H+GK+           +Y PP ++Y+L  +P  +KGLV+W+IE  +LS  E++FL  L
Sbjct  68   PPHLGKKSSGNDAAVGNVYYVPPILNYQLEQIPAKSKGLVLWMIEGHILSSQEVEFLTQL  127

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P+L P+V++  E G  R F ++PLKE
Sbjct  128  PSLEPRVKIAIEMGGERYFRYQPLKE  153



>ref|WP_035991925.1| NAD(P)H-quinone oxidoreductase [Leptolyngbya sp. KIOST-1]
Length=155

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 7/146 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E + A+A+  P EGG+EGRY  RL+ +GY  L L+ARGLGD  + LT  H V P 
Sbjct  10   FMKDLESNGAIAVRMPLEGGFEGRYERRLKARGYEILKLTARGLGDISSYLTAVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+  A        ++ PP + YRL  + P AKG+V+W+IE  +LS+ E+ +L  LPT
Sbjct  70   HLGKKNTASGAAVGYTYFVPPLLTYRLETMSPKAKGMVLWLIEGHILSRQEMAYLVSLPT  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIA  790
            + P+ +V+ E G  R F W+PL  + 
Sbjct  130  IEPRAKVVVEVGGDRSFSWEPLANLV  155



>ref|WP_024544425.1| NAD(P)H-quinone oxidoreductase [Synechococcus sp. NKBG15041c]
Length=157

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 93/146 (64%), Gaps = 8/146 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  VE+  A+A+Y P EGGYEGRY  RLR  GY  ++L+ARGLGD    LT++H V PA
Sbjct  10   FIRTVEKSGAVAVYAPLEGGYEGRYVRRLRCSGYTVVNLTARGLGDVTAYLTQYHGVRPA  69

Query  554  HVGKQPIA--------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            H+GK+ IA        R Y P    Y+L  LP  +KG+++WIIE  VLS+ E ++L  L 
Sbjct  70   HLGKKDIAGSGAMVGLRSYVPGIATYQLENLPQKSKGIILWIIEGFVLSRQEQEYLISLT  129

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
               P+V+VI E G  R+F +KPL ++
Sbjct  130  QENPQVKVIVEMGGDRQFSFKPLADL  155



>ref|WP_039754655.1| NAD(P)H-quinone oxidoreductase [Hassallia byssoidea]
 gb|KIF28313.1| NAD(P)H-quinone oxidoreductase [Hassallia byssoidea VB512170]
Length=158

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL +Y P EGG+EGRY  RLR  GY  L ++ARGLGD    LT  H + P H
Sbjct  11   IRDLEKFGALGVYVPLEGGFEGRYQRRLRAAGYACLHITARGLGDVAAYLTGVHGIRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP++
Sbjct  71   LGKKTTPNGAAVGYVYYVPPVVNYQLEQLPPKSKGLVLWIIEGHILSNQEVEYLAALPSI  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+VI E G  R F W PL++
Sbjct  131  EPRVKVIIERGGDRFFRWTPLEK  153



>ref|WP_009455505.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Fischerella]
 gb|EHC18111.1| NAD(P)H-quinone oxidoreductase subunit N [Fischerella sp. JSC-11]
Length=158

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 91/143 (64%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E++ AL +Y P EGG+EGRY  RLR  GY  L ++ARGLGD    LT  H V P H
Sbjct  11   IRDLEKNGALGVYVPLEGGFEGRYRRRLRAAGYITLHITARGLGDLAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V+Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGYVYYVPPIVNYQLEQLPPKSKGLVLWIIEGHILSDQEIEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W  L++
Sbjct  131  EPRVKVVIERGGDRAFRWMALEK  153



>ref|WP_006529920.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Gloeocapsa 
sp. PCC 73106]
 gb|ELR97231.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Gloeocapsa 
sp. PCC 73106]
Length=152

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 7/142 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  +LA+Y P EGG+EGRY  RLR  GY+ L ++ARGLGD    LT  H V PA
Sbjct  10   FIRSLEQSGSLAVYAPLEGGFEGRYQRRLRTAGYNTLQITARGLGDLSAYLTGIHGVRPA  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IA+       +Y P    Y+L+ LPP +KGLV+WIIE  VLS++E+Q+L  L T
Sbjct  70   HLGKKNIAQEGAVGPVYYVPGIASYQLTTLPPKSKGLVLWIIEGFVLSRSEIQYLINLTT  129

Query  713  LRPKVRVIAECGNWRKFMWKPL  778
              P+++++ E G  R F + PL
Sbjct  130  SEPRLKIVLELGGDRYFRFSPL  151



>ref|WP_017314758.1| NAD(P)H-quinone oxidoreductase subunit N [Mastigocladopsis repens]
Length=158

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  +L +Y P EGG+EGRY  RLR  GY  L ++A+GLGD    LT  H V P H
Sbjct  11   IRDLEKFGSLGVYVPLEGGFEGRYRRRLRAAGYVTLHMTAKGLGDVPAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V Y+L  LPP +KGLV+WIIE  +LS  E++FL  LP+L
Sbjct  71   LGKKSTGSGAAVGYVYYLPPIVSYQLEQLPPKSKGLVLWIIEGHILSDQEVEFLTTLPSL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRSFRWMPLQK  153



>ref|WP_036002436.1| NAD(P)H-quinone oxidoreductase [Leptolyngbya sp. JSC-1]
Length=158

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 87/145 (60%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E   AL +Y P EGG+EGRY  RLR  GY  L ++ARGLGD    L   H V P 
Sbjct  10   FIRSLEATGALGLYVPLEGGHEGRYQRRLRAAGYEILHITARGLGDLSAYLLGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+   R       ++ PP   Y+L  LPP AKGL +W++E  VLS+ ELQFL  LP 
Sbjct  70   HLGKKTTEREGAVGYRYFLPPAATYQLEQLPPKAKGLAIWMLEGTVLSQQELQFLVSLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              P+++V+ E G  R+F WKPL + 
Sbjct  130  QEPRIKVVVEMGGGREFSWKPLADF  154



>ref|WP_006457216.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. PCC 
7335]
 gb|EDX87406.1| hypothetical protein S7335_5116 [Synechococcus sp. PCC 7335]
Length=155

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 96/151 (64%), Gaps = 8/151 (5%)
 Frame = +2

Query  350  LVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLT  529
            L+ F+  K+ SD+E+  AL +  P EGG+EGRY  R+R  GY  + ++ARG+GD    L 
Sbjct  3    LIAFN--KFTSDLEKAGALGVRMPLEGGHEGRYRRRVRSAGYECVYMTARGMGDLSAFLL  60

Query  530  KFHPVCPAHVGKQPIA------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQ  691
              H V P H+GK+ +       R+Y PP V+YRL  + P +KGL++W+IE  +LS  E++
Sbjct  61   DVHGVRPPHLGKKNMDDSATGDRYYLPPVVNYRLQSISPKSKGLLLWLIEGHILSNQEIE  120

Query  692  FLALLPTLRPKVRVIAECGNWRKFMWKPLKE  784
            FL  LP+L P+V+V+ E G  R+  W PLKE
Sbjct  121  FLVALPSLEPRVKVVLEIGGERRMSWFPLKE  151



>ref|WP_024969975.1| NAD(P)H-quinone oxidoreductase [Microcystis aeruginosa]
Length=158

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E++ AL +Y P EGGYEGRY  RLR  GY+ L ++ARGLGD    LT  H V P 
Sbjct  10   FIRDLEQYGALGVYAPLEGGYEGRYQRRLRATGYNVLHITARGLGDLSAYLTGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I R       ++ PP   Y+L  LPP +KGLV+WIIE+ VLS  E Q+L  L  
Sbjct  70   HLGKKNIGREAAVGPVYFIPPIATYQLENLPPQSKGLVIWIIESFVLSSEEKQYLINLSQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+++ + E G  R F W+PL +
Sbjct  130  QEPRLKFVLELGGERYFRWQPLSK  153



>ref|WP_015170847.1| NADH dehydrogenase I subunit N [Geitlerinema sp. PCC 7407]
 ref|YP_007108331.1| NADH dehydrogenase I subunit N [Geitlerinema sp. PCC 7407]
 gb|AFY65279.1| NADH dehydrogenase I subunit N [Geitlerinema sp. PCC 7407]
Length=150

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 90/140 (64%), Gaps = 0/140 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ ++E+  AL +Y P EGG EGRY  R+R  GY  + L++RGLGDP + L   H V P
Sbjct  9    QFIKNLEQAGALGVYAPLEGGAEGRYRRRVRAAGYSMVQLTSRGLGDPASFLMGIHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
             H+GK+ I   Y  P ++Y L  LP + KGLV+W++E  VLS+ EL++L  L    PK++
Sbjct  69   PHLGKKEIRTQYILPLLEYHLEHLPANTKGLVLWLLEGTVLSRQELEYLISLTQQNPKLK  128

Query  731  VIAECGNWRKFMWKPLKEIA  790
            V+ E G  R F WK L+++A
Sbjct  129  VVVEMGGDRTFKWKSLQDVA  148



>ref|WP_006106404.1| NAD(P)H-quinone oxidoreductase subunit N [Coleofasciculus chthonoplastes]
 gb|EDX70749.1| hypothetical protein MC7420_5952 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=160

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+   LA+Y P EGG+EGRY  RLR  GY  + LSA+GLGDP   LT  H V P 
Sbjct  10   FIRDLEQSGTLALYAPLEGGFEGRYRRRLRAAGYTTISLSAKGLGDPAAYLTGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP + Y+L  LPP +KG+V+W+IE   LS+ EL++   LP 
Sbjct  70   HLGKKTIGKSAAVGEVYFIPPILTYQLETLPPKSKGMVLWLIEGSSLSRQELEYFIALPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
               +V+V  E G  R F W+PL+E
Sbjct  130  QEKRVKVAIEMGGDRYFRWQPLQE  153



>ref|WP_015956845.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanothece sp. PCC 
7424]
 ref|YP_002380131.1| NADH dehydrogenase I subunit N [Cyanothece sp. PCC 7424]
 sp|B7KEE5.1|NDHN_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Cyanothece sp. PCC 7424]
 gb|ACK73263.1| NADH dehydrogenase I subunit N [Cyanothece sp. PCC 7424]
Length=158

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  AL +Y P EGG+EGRY  RLR  GY   +L+ARGLGD  + LT  H V P 
Sbjct  10   FIRALEKSGALGVYVPLEGGFEGRYQRRLRANGYTPYNLTARGLGDLSSYLTGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  LPP +KGLV+WIIE  +LS+AE+++L  LP 
Sbjct  70   HLGKKNIGQDAAVGPVYFVPPIATYQLETLPPKSKGLVLWIIEGMILSRAEIEYLTYLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+++++ E G  R F W+PL++
Sbjct  130  QEPRLKIVVEMGGERYFRWQPLEQ  153



>ref|WP_008199720.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis sp. T1-4]
 emb|CCI31697.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis sp. T1-4]
Length=158

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E++ AL +Y P EGGYEGRY  RLR  GY+ L ++ARGLGD    LT  H V P 
Sbjct  10   FIRDLEQYGALGVYAPLEGGYEGRYQRRLRATGYNVLHITARGLGDLSAYLTGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I R       ++ PP   Y+L  LPP +KGLV+WIIE+ VLS  E Q+L  L  
Sbjct  70   HLGKKNIGREAAVGPVYFIPPIATYQLENLPPKSKGLVIWIIESFVLSSEEKQYLISLSQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+++ + E G  R F W+PL +
Sbjct  130  QEPRLKFVLELGGERYFRWQPLSK  153



>ref|WP_012953748.1| NAD(P)H-quinone oxidoreductase subunit N [Candidatus Atelocyanobacterium 
thalassa]
 ref|YP_003421441.1| hypothetical protein UCYN_03420 [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95083.1| hypothetical protein UCYN_03420 [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=158

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 92/147 (63%), Gaps = 7/147 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  AL I+ P EGG EGRY  RLR  GY    L+A+GLGD E  LTK H V   
Sbjct  10   FIRDLEKSGALGIFTPLEGGSEGRYQRRLRLNGYDSFSLTAKGLGDIEAYLTKVHGVSVP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  L P +KGL++WIIE  VLS+ EL++L  LP 
Sbjct  70   HLGKKNIGQEAAVGPIYFVPPVATYKLDNLSPKSKGLILWIIEGHVLSRDELEYLTNLPH  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAE  793
              P+++V+ E G  R F W+ L++IA+
Sbjct  130  QEPRIKVVVELGGERYFRWESLEKIAQ  156



>ref|WP_002747620.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa]
 ref|YP_001660282.1| NADH dehydrogenase I subunit N [Microcystis aeruginosa NIES-843]
 sp|B0JY52.1|NDHN_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Microcystis aeruginosa NIES-843]
 emb|CAO89256.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 dbj|BAG05090.1| NADH dehydrogenase I subunit N [Microcystis aeruginosa NIES-843]
 emb|CCI03875.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9443]
 emb|CCI16887.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9807]
 emb|CCI23762.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9808]
 emb|CCI22461.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9809]
 emb|CCI38678.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9701]
 gb|ELS45749.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21870.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
SPC777]
 dbj|GAL92675.1| putative subunit of NAD(P)H:quinone oxidoreductase [Microcystis 
aeruginosa NIES-44]
Length=158

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E++ AL +Y P EGGYEGRY  RLR  GY+ L ++ARGLGD    LT  H V P 
Sbjct  10   FIRDLEQYGALGVYAPLEGGYEGRYQRRLRATGYNVLHITARGLGDLSAYLTGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I R       ++ PP   Y+L  LPP +KGLV+WIIE+ VLS  E Q+L  L  
Sbjct  70   HLGKKNIGREAAVGPVYFIPPIATYQLENLPPKSKGLVIWIIESFVLSSEEKQYLINLSQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+++ + E G  R F W+PL +
Sbjct  130  QEPRLKFVLELGGERYFRWQPLSK  153



>ref|WP_002735370.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa]
 emb|CCH93159.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9432]
 emb|CCH97239.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9717]
 emb|CCI06533.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 7941]
 emb|CCI14801.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
PCC 9806]
 gb|ELP53366.1| NAD(P)H-quinone oxidoreductase subunit N [Microcystis aeruginosa 
TAIHU98]
Length=158

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E++ AL +Y P EGGYEGRY  RLR  GY+ L ++ARGLGD    LT  H V P 
Sbjct  10   FIRDLEQYGALGVYAPLEGGYEGRYQRRLRATGYNVLHITARGLGDLSAYLTGIHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I R       ++ PP   Y+L  LPP +KGLV+WIIE+ VLS  E Q+L  L  
Sbjct  70   HLGKKNIGREAAVGPVYFIPPIATYQLENLPPKSKGLVIWIIESFVLSSEEKQYLINLSQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              P+++ + E G  R F W+PL +
Sbjct  130  QEPRLKFVLELGGERYFRWQPLSK  153



>ref|WP_010998354.1| NAD(P)H-quinone oxidoreductase subunit N [Nostoc sp. PCC 7120]
 ref|NP_488256.1| hypothetical protein alr4216 [Nostoc sp. PCC 7120]
 sp|Q8YPH8.1|NDHN_NOSS1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Nostoc sp. PCC 7120]
 dbj|BAB75915.1| alr4216 [Nostoc sp. PCC 7120]
Length=162

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  ++ +Y P EGG+EGRY  RLR  GY  L  +ARGLGD    LT  H V P H
Sbjct  11   IRDLEKFGSVGVYVPLEGGFEGRYRRRLRAAGYTTLQFTARGLGDVAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V  +L  LPP +KGLV+WIIE  +LS  E++FL  LP+L
Sbjct  71   LGKKSSGNGAAVGNVYYLPPIVGSQLEHLPPKSKGLVLWIIEGHILSDQEVEFLTSLPSL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKEIAEQS  799
             P+V+V+ E G  R F WK LK+    S
Sbjct  131  EPRVKVVVERGGDRTFRWKALKDTFSAS  158



>ref|WP_012410726.1| NAD(P)H-quinone oxidoreductase subunit N [Nostoc punctiforme]
 ref|YP_001867707.1| NADH dehydrogenase I subunit N [Nostoc punctiforme PCC 73102]
 sp|B2ITQ6.1|NDHN_NOSP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Nostoc punctiforme PCC 73102]
 gb|ACC82764.1| NADH dehydrogenase I subunit N [Nostoc punctiforme PCC 73102]
Length=158

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL +Y P EGGYEGRY  RLR  GY  L ++A+GLGD    LT+ H V P H
Sbjct  11   IRDLEKFGALGVYVPLEGGYEGRYQRRLRAAGYTTLHITAKGLGDVAAYLTRIHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP +D  L  LPP +KGLV+WIIE  +LS  EL++L  LP L
Sbjct  71   LGKKSTGSGAAVGQVYYLPPILDSHLEQLPPKSKGLVLWIIEGHILSNEELEYLTNLPQL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W  L++
Sbjct  131  EPRVKVVIERGGDRAFRWTSLEK  153



>ref|WP_015134196.1| NAD(P)H-quinone oxidoreductase subunit N [Leptolyngbya sp. PCC 
7376]
 ref|YP_007071267.1| NAD(P)H-quinone oxidoreductase subunit N [Leptolyngbya sp. PCC 
7376]
 gb|AFY38433.1| NAD(P)H-quinone oxidoreductase subunit N [Leptolyngbya sp. PCC 
7376]
Length=157

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 90/145 (62%), Gaps = 8/145 (6%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  VE+  A+AIY P EGGYEGRY  RLR  GY  ++L+ARGLGD    LT +H V PA
Sbjct  10   FVRAVEKSGAVAIYAPLEGGYEGRYVRRLRCSGYKVVNLTARGLGDVAAYLTDYHGVRPA  69

Query  554  HVGKQPIA--------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            H+GK+ IA        R Y P    Y+L  +P  +KG+++WIIE  VLS+ E ++L  L 
Sbjct  70   HLGKKDIAGSGAMVGLRAYVPGIATYQLENIPAKSKGIILWIIEGYVLSRQEQEYLVTLT  129

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
               P+++V+ E G  R F +KPL E
Sbjct  130  RENPQIKVVIEMGGDRIFSFKPLAE  154



>ref|WP_027402108.1| NAD(P)H-quinone oxidoreductase [Aphanizomenon flos-aquae]
Length=158

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT+ H V P 
Sbjct  10   FIRNLEKFGALGVYVPLEGGYEGRYLRRLRAAGYVSLHITARGLGDVAAYLTQVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+  +        +Y PP +   L+ LPP +KGLV+WIIE  +LS  E+++L  LP 
Sbjct  70   HLGKRSNSSGAAVGDVYYLPPMISSHLAQLPPKSKGLVLWIIEGYILSDQEVEYLMNLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F W PL++
Sbjct  130  LEPRVKVVIERGGDRTFRWTPLEK  153



>ref|WP_030006246.1| NAD(P)H-quinone oxidoreductase [Synechococcus sp. NKBG042902]
Length=157

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 8/146 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  VE+  A+A+Y P EGG+EGRY  RLR  GY  ++L+ARGLGD    LT++H + P 
Sbjct  10   FIRTVEKSGAVAVYAPLEGGFEGRYMRRLRCSGYSVVNLTARGLGDVAAYLTQYHGIRPP  69

Query  554  HVGKQPIA--------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            H+GK+ IA        R+Y P    Y+L  LP  +KG+++WIIE  VLS+ E ++L  L 
Sbjct  70   HLGKKDIAGSGAAVGLRYYVPGIASYQLENLPQKSKGIILWIIEGFVLSRQEQEYLVSLA  129

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
               P+++V+ E G  R+F +KPL ++
Sbjct  130  QENPQIKVVVEMGGDRQFSFKPLADL  155



>ref|WP_022605547.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Rubidibacter 
lacunae]
 gb|ERN42214.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Rubidibacter 
lacunae KORDI 51-2]
Length=157

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E   ALAIY P EGG+EGRY  RLR QGY  L LSARGLGD  + LT  H V P 
Sbjct  10   FIRDLERANALAIYAPLEGGFEGRYQRRLRAQGYVSLSLSARGLGDLASYLTGTHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IAR       ++ PP   Y++  LP  AKGLV+W+IE  VLS+ E +++  L  
Sbjct  70   HLGKKNIAREAAVGDIYFVPPIAGYQIEALPSWAKGLVLWVIEGYVLSQQEREYIVRLTE  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIA  790
              P ++V+ E G  R F W+PL + A
Sbjct  130  SEPLIKVVLEMGGSRYFRWQPLADTA  155



>ref|WP_009545435.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Cyanothece]
 ref|YP_001804809.1| NADH dehydrogenase subunit N [Cyanothece sp. ATCC 51142]
 sp|B1WYX9.1|NDHN_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Cyanothece sp. ATCC 51142]
 gb|ACB52743.1| NADH dehydrogenase subunit N [Cyanothece sp. ATCC 51142]
Length=158

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  AL +Y P EGG+EGRY  RLR  GY  L L+ARGLGD    L   H V P 
Sbjct  10   FVRALEKSGALGVYAPLEGGFEGRYQRRLRTNGYDSLSLTARGLGDVSAYLMGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  L P +KGLV+WI+E  +LSKAEL++L  LP 
Sbjct  70   HLGKKNIGQGAAVGPIYFVPPIAAYQLESLSPQSKGLVLWILEGYILSKAELEYLVSLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              P+++V+ E G  R F W+PL+ +
Sbjct  130  QEPRIKVVVELGGERYFRWEPLENL  154



>ref|WP_039204347.1| NAD(P)H-quinone oxidoreductase [Aphanizomenon flos-aquae]
 gb|KHG39504.1| NAD(P)H-quinone oxidoreductase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=158

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    LT+ H V P 
Sbjct  10   FIRNLEKFGALGVYVPLEGGYEGRYLRRLRAAGYVGLHITARGLGDVAAYLTQVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+  +        +Y PP +   L+ LPP +KGLV+WIIE  +LS  E+++L  LP 
Sbjct  70   HLGKRSNSSGAAVGDVYYLPPMISSHLAQLPPKSKGLVLWIIEGYILSDQEVEYLMDLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F W PL++
Sbjct  130  LEPRVKVVIERGGDRTFRWTPLEK  153



>ref|WP_029635526.1| NAD(P)H-quinone oxidoreductase [[Scytonema hofmanni] UTEX B 1581]
Length=159

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+   L +Y P EGG+EGRY  RLR  GY  L ++ARGLGD    LT  H + P 
Sbjct  10   FIRDLEKFGTLGVYAPLEGGFEGRYQRRLRAAGYVTLHITARGLGDLAAYLTGVHGIRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+           +Y PP ++Y+L  LPP +KGLV+WIIE  +LS  E+++LA LP+
Sbjct  70   HLGKKTTPNGAAVGFVYYVPPIINYQLEHLPPKSKGLVLWIIEGHILSNQEVEYLASLPS  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            + P+V+V+ E G  R F W PL++
Sbjct  130  IDPRVKVVLERGGDRFFRWTPLEK  153



>ref|WP_012306766.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. PCC 
7002]
 ref|YP_001734399.1| hypothetical protein SYNPCC7002_A1143 [Synechococcus sp. PCC 
7002]
 sp|B1XK97.1|NDHN_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus sp. PCC 7002]
 gb|ACA99143.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=157

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 8/146 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  VE+  A+A+Y P EGG+EGRY  RLR  GY  ++L+ARGLGD    LT++H + P 
Sbjct  10   FIRTVEKSGAVAVYAPLEGGFEGRYVRRLRCSGYSVVNLTARGLGDVAAYLTQYHGIRPP  69

Query  554  HVGKQPIA--------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
            H+GK+ IA        R+Y P    Y+L  LP  +KG+++WIIE  VLS+ E ++L  L 
Sbjct  70   HLGKKDIAGSGAAVGLRYYVPGIASYQLENLPQKSKGIILWIIEGFVLSRQEQEYLVSLT  129

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
               P+++V+ E G  R+F +KPL ++
Sbjct  130  QDNPQIKVVVEMGGDRQFSFKPLADL  155



>ref|WP_011317561.1| NAD(P)H-quinone oxidoreductase subunit N [Anabaena variabilis]
 ref|YP_321209.1| NADH dehydrogenase I subunit N [Anabaena variabilis ATCC 29413]
 sp|Q3MFC2.1|NDHN_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Anabaena variabilis ATCC 29413]
 gb|ABA20314.1| NADH dehydrogenase I subunit N [Anabaena variabilis ATCC 29413]
Length=162

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  ++ +Y P EGG+EGRY  RLR  GY  L  +ARGLGD    LT  H V P H
Sbjct  11   IRDLEKFGSVGVYVPLEGGFEGRYRRRLRAAGYTTLQFTARGLGDVAAYLTGVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+           +Y PP V  +L  LPP +KGLV+WIIE  +LS  E++FL  LP L
Sbjct  71   LGKKSSGNGAAVGNVYYLPPIVGSQLEHLPPKSKGLVLWIIEGHILSDQEVEFLTDLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKEIAEQS  799
             P+V+V+ E G  R F WK LK+    S
Sbjct  131  EPRVKVVVERGGDRTFRWKALKDTFSAS  158



>ref|WP_013323829.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanothece sp. PCC 
7822]
 ref|YP_003889036.1| NADH dehydrogenase I subunit N [Cyanothece sp. PCC 7822]
 gb|ADN15761.1| NADH dehydrogenase I subunit N [Cyanothece sp. PCC 7822]
Length=158

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 95/149 (64%), Gaps = 7/149 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  AL +Y P EGG+EGRY  RLR  GY  ++++ARGLGD  + LT  H V P 
Sbjct  10   FIRALEKSGALGVYVPLEGGFEGRYQRRLRASGYTIVNITARGLGDVSSYLTGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  LPP +KGLV+WI+E  +LS+AE+++L  LP 
Sbjct  70   HLGKKNIGQEAAVGPVYFVPPIATYQLENLPPKSKGLVLWILEGVILSRAEIEYLTYLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
              P+++++ E G  R F + PL++  + +
Sbjct  130  QEPRIKIVVEMGGERYFRFSPLEQTVQAA  158



>ref|WP_017303343.1| NAD(P)H-quinone oxidoreductase subunit N [Spirulina subsalsa]
Length=158

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E++ AL +Y P EGG+EGRY  RLR  GY+ L L+ARGLGD    LT  H V P 
Sbjct  10   FIRDLEKYGALGVYAPLEGGFEGRYQRRLRATGYYSLHLTARGLGDVAAYLTGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IA+       +Y P     +L  LP  AKGLV+WIIE  +LS  E+++L  LP 
Sbjct  70   HLGKKNIAQSAAVGPVYYVPAIALSQLETLPSTAKGLVLWIIEGMILSNQEIEYLVNLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              P+++V+ E G  R F W+PL+++
Sbjct  130  QEPRLKVVLELGGERYFRWQPLQDV  154



>ref|WP_015227125.1| NADH dehydrogenase I subunit N [Halothece sp. PCC 7418]
 ref|YP_007169467.1| NADH dehydrogenase I subunit N [Halothece sp. PCC 7418]
 gb|AFZ45253.1| NADH dehydrogenase I subunit N [Halothece sp. PCC 7418]
Length=158

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++ D+EE  AL +Y P EGG+EGRY  RLR +GY  L LSA+GLGDP +     H V  
Sbjct  9    KFIRDLEESGALGVYAPLEGGFEGRYQRRLRTKGYVTLHLSAKGLGDPASYFKGIHGVRH  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+ I +       ++ PP VD +L +LP + KGLV+W+IE  V S+ EL +LA   
Sbjct  69   PHLGKKNIGQGAAVGDVYFLPPIVDSQLEILPENKKGLVLWLIEGFVFSRQELSYLAKFH  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKEI  787
             + P+V+V+ E G  R F W+ L  +
Sbjct  129  EIEPRVKVVVELGGDRAFRWEKLSSV  154



>ref|WP_015079214.1| NADH dehydrogenase I subunit N [Anabaena sp. 90]
 ref|YP_006995864.1| NADH dehydrogenase I subunit N [Anabaena sp. 90]
 gb|AFW94051.1| NADH dehydrogenase I subunit N [Anabaena sp. 90]
Length=158

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ ++E+  AL +Y P EGGYEGRY  RLR  GY  L ++ARGLGD    L + H V P 
Sbjct  10   FIRNLEKFGALGVYVPLEGGYEGRYLRRLRATGYVALHITARGLGDVAAYLMQVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+  +        +Y PP +   L+ LPP +KGLV+WIIE  +LS  E+++L  LP 
Sbjct  70   HLGKRSNSSGAAVGDVYYLPPMISSHLAQLPPKSKGLVLWIIEGNILSDQEVEYLMNLPK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F W PL++
Sbjct  130  LEPRVKVVIERGGDRIFRWTPLEK  153



>ref|WP_011056972.1| NAD(P)H-quinone oxidoreductase subunit N [Thermosynechococcus 
elongatus]
 ref|NP_681920.1| hypothetical protein tlr1130 [Thermosynechococcus elongatus BP-1]
 sp|Q8DJU2.1|NDHN_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Thermosynechococcus elongatus BP-1]
 dbj|BAC08682.1| tlr1130 [Thermosynechococcus elongatus BP-1]
Length=150

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E   ALA++ P EGG+EGRY  RLR +GY  L +SA GLGD    LT+ H + P
Sbjct  8    QFVKDLESAGALALFVPPEGGFEGRYQRRLRSKGYTTLPMSAPGLGDLAAYLTQEHGIRP  67

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            AH GK+ I  ++ PP V Y L  LPP+AKGLV+W+I+ K LSK E  +LA L    PK +
Sbjct  68   AHTGKEDIRVYFQPPLVTYHLENLPPNAKGLVLWLIDGKRLSKQEFAYLAQLTQTLPKFK  127

Query  731  VIAECGNWRKFMWKPLKE  784
            V+ E G  R   W+PL +
Sbjct  128  VVVEVGGDRVVRWEPLAD  145



>ref|WP_037217700.1| NAD(P)H-quinone oxidoreductase [Richelia intracellularis]
 emb|CDN11395.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Richelia 
intracellularis]
Length=159

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ ++++  AL +Y P EGGYEGRY  RLR  GYH L L+A+GLGD    LT  H V P
Sbjct  9    RFIRELDQFGALGVYAPLEGGYEGRYRRRLRAAGYHTLSLTAKGLGDIAAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+  +        +Y PP +  +L  L P +KGLV+WIIE  VL   E+ +L  L 
Sbjct  69   PHLGKKSTSNGAAVGSVYYVPPIITSQLEQLAPKSKGLVLWIIEGYVLDDQEIDYLVNLS  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
               P+V+V+ E G  R F WKPL+E
Sbjct  129  NAVPQVKVVVERGGDRAFKWKPLEE  153



>ref|WP_012162191.1| NAD(P)H-quinone oxidoreductase subunit N [Acaryochloris marina]
 ref|YP_001515986.1| NADH dehydrogenase I subunit N [Acaryochloris marina MBIC11017]
 sp|B0CA85.1|NDHN_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Acaryochloris marina MBIC11017]
 gb|ABW26672.1| NADH dehydrogenase I subunit N, putative [Acaryochloris marina 
MBIC11017]
Length=151

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++  +E+  A+ IY P EGG+EGRY  RLR  GY  L +SA G+GD  +  T  H V P
Sbjct  9    KFIRTIEQSGAVGIYVPSEGGFEGRYKRRLRATGYLTLFVSAPGMGDLASYFTDVHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
             H+GK  I  ++ PP V Y+L  LPP AKGL +W+ + K L+K EL +L+ +    P+++
Sbjct  69   PHLGKNQIRTYFLPPFVTYQLENLPPQAKGLALWLYDGKRLAKQELAYLSAITASEPRLK  128

Query  731  VIAECGNWRKFMWKPLKEI  787
            V+ E G  R F W+PL +I
Sbjct  129  VVVELGGARSFEWQPLSDI  147



>ref|WP_024123974.1| proton-translocating NADH-quinone dehydrogenase subunit N NdhN 
[Thermosynechococcus sp. NK55a]
 ref|YP_008899068.1| proton-translocating NADH-quinone dehydrogenase subunit N NdhN 
[Thermosynechococcus sp. NK55a]
 gb|AHB87555.1| proton-translocating NADH-quinone dehydrogenase subunit N NdhN 
[Thermosynechococcus sp. NK55a]
Length=150

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E   ALA++ P EGG+EGRY  RLR +GY  L +SA GLGD    LT+ H + P
Sbjct  8    QFVKDLESAGALALFVPPEGGFEGRYQRRLRSKGYTTLPMSAPGLGDLAAYLTQEHGIRP  67

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            AH GK+ I  ++ PP V Y L  LPP+AKGLV+W+I+ K LS+ E  +LA L    PK +
Sbjct  68   AHTGKEDIRVYFQPPLVTYHLQNLPPNAKGLVLWLIDGKRLSRQEFAYLAQLTQTLPKFK  127

Query  731  VIAECGNWRKFMWKPLKE  784
            V+ E G  R   W+PL +
Sbjct  128  VVVEVGGDRVVRWEPLAD  145



>ref|WP_010475916.1| NAD(P)H-quinone oxidoreductase subunit N [Acaryochloris sp. CCMEE 
5410]
Length=151

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++  +E+  A+ IY P EGG+EGRY  RLR  GY  L +SA G+GD  +  T  H V P
Sbjct  9    KFIRTIEQSGAVGIYVPSEGGFEGRYKRRLRATGYLTLFVSAPGMGDLASYFTDVHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
             H+GK  I  ++ PP V Y+L  LPP AKGL +W+ + K L+K EL +L+ +    P+++
Sbjct  69   PHLGKNQIRTYFLPPFVTYQLENLPPQAKGLALWLYDGKRLAKQELAYLSAITASEPRLK  128

Query  731  VIAECGNWRKFMWKPLKEI  787
            V+ E G  R F W+PL +I
Sbjct  129  VVVELGGARTFEWQPLSDI  147



>ref|WP_015118714.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Rivularia 
sp. PCC 7116]
 ref|YP_007055688.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Rivularia 
sp. PCC 7116]
 gb|AFY55141.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Rivularia 
sp. PCC 7116]
Length=159

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 92/146 (63%), Gaps = 7/146 (5%)
 Frame = +2

Query  368  GKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVC  547
            G ++  +E+  AL +Y P EGG+EGRY  RLR +GY+ L +SA+GLGD    LT  H V 
Sbjct  8    GGFIRKLEKFGALGVYVPLEGGFEGRYRRRLRAKGYNALCISAKGLGDVAAYLTGIHGVR  67

Query  548  PAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
            P H+GK+  +        +Y PP +  +L  LPP +KGLV+WII+  +L   EL++LA L
Sbjct  68   PPHLGKKSTSNGAAVGYVYYIPPIISTQLENLPPKSKGLVLWIIDGHILEDQELEYLANL  127

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P + P+V+V+ E G  R F + PL+E
Sbjct  128  PKIEPRVKVVIERGGDRTFRFMPLEE  153



>ref|WP_013191468.1| NAD(P)H-quinone oxidoreductase subunit N [Trichormus azollae]
 ref|YP_003721574.1| NADH dehydrogenase I subunit N ['Nostoc azollae' 0708]
 gb|ADI64451.1| NADH dehydrogenase I subunit N ['Nostoc azollae' 0708]
Length=158

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 88/143 (62%), Gaps = 7/143 (5%)
 Frame = +2

Query  377  LSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAH  556
            + D+E+  AL +Y P EGGYEGR+  RLR  GY  L ++ARGLGD    LT+ H V P H
Sbjct  11   IRDLEKFGALGVYVPLEGGYEGRHRRRLRAAGYISLHITARGLGDVAAYLTRVHGVRPPH  70

Query  557  VGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTL  715
            +GK+            Y PP +   L  LPP +KGL++WIIE  +LS  E+++LA LP L
Sbjct  71   LGKKSTGSGAAVGEVHYLPPMISSHLEQLPPKSKGLLLWIIEGHILSNQEVEYLANLPKL  130

Query  716  RPKVRVIAECGNWRKFMWKPLKE  784
             P+V+V+ E G  R F W PL++
Sbjct  131  EPRVKVVIERGGDRYFRWTPLEK  153



>ref|WP_006508335.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Xenococcus 
sp. PCC 7305]
 gb|ELS04564.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Xenococcus 
sp. PCC 7305]
Length=155

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 89/142 (63%), Gaps = 7/142 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+H AL +Y P EGG EGRY  R+R  GY  ++++ARGLGD    LT  H V P 
Sbjct  12   FIRDLEKHGALGLYVPLEGGIEGRYQRRVRAAGYQTINITARGLGDLPAYLTTVHGVRPP  71

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y LS LP ++KGLV+WIIE  +LS+ E ++L  LP 
Sbjct  72   HLGKKTIGQDAAVGQIYFVPPIATYELSTLPENSKGLVLWIIEGNILSRQEKEYLINLPK  131

Query  713  LRPKVRVIAECGNWRKFMWKPL  778
            + P+++V+ E G  R   W+ L
Sbjct  132  IEPRIKVVLEVGGDRYIHWEAL  153



>ref|WP_017293731.1| NAD(P)H-quinone oxidoreductase subunit N [Geminocystis herdmanii]
Length=159

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 87/145 (60%), Gaps = 7/145 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+   LA+Y P EGG+EGRY  RLR  GYH  +LSARGLGD    L   H V PA
Sbjct  10   FIKDLEKSNILAVYAPLEGGFEGRYQRRLRTSGYHTFNLSARGLGDLSAYLMGIHGVRPA  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP    +L  LP  +KGLV+WIIE  VLS  E ++L  L  
Sbjct  70   HLGKKNIGQEGAVGLTYFVPPIALSQLENLPSSSKGLVLWIIEGFVLSNQEKEYLISLTK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEI  787
              PK++++ E G  R F W+ L+ +
Sbjct  130  QEPKIKIVLELGGERYFRWQSLESV  154



>ref|WP_008276508.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanothece sp. CCY0110]
 gb|EAZ90434.1| hypothetical protein CY0110_28914 [Cyanothece sp. CCY0110]
Length=158

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 90/147 (61%), Gaps = 7/147 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E+  AL +Y P EGG+EGRY  RLR  GY  L L+ARGLGD    L   H V P 
Sbjct  10   FVRALEKSGALGVYAPLEGGFEGRYQRRLRTNGYESLSLTARGLGDVSAYLMGVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  L   +KGLV+WI+E  +LSKAEL++L  LP 
Sbjct  70   HLGKKNIGQNAAVGPIYFVPPIAAYQLESLSRQSKGLVLWILEGYILSKAELEYLVTLPQ  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAE  793
              P+++V+ E G  R F W+ L+++ E
Sbjct  130  QEPRIKVVVELGGERYFRWEALEKLIE  156



>dbj|BAP17164.1| NADH dehydrogenase subunit N [cyanobacterium endosymbiont of 
Epithemia turgida isolate EtSB Lake Yunoko]
Length=168

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 94/155 (61%), Gaps = 8/155 (5%)
 Frame = +2

Query  344  GDLVWFDLGKWL-SDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPET  520
            G L   + GK L   +E+  ALA+Y P EGG+EGRY  RLR  GY+ L L+A+GLGD   
Sbjct  9    GLLRALETGKELVRALEKSGALAVYAPLEGGFEGRYQRRLRANGYNSLSLTAKGLGDVSA  68

Query  521  TLTKFHPVCPAHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSK  679
             L   H V P H+GK+ I +       ++ PP   Y++  LP  +KGL++WI+E  +LSK
Sbjct  69   YLMGIHGVRPPHLGKKNIGQDAAVGSTYFVPPIAAYQVEHLPAKSKGLILWILEGHILSK  128

Query  680  AELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKE  784
             EL++LA LP +  +++VI E G  R F WK L +
Sbjct  129  TELEYLANLPFIERRIKVIVEMGGERYFCWKTLSD  163



>ref|WP_008231113.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Richelia 
intracellularis]
 emb|CCH66110.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Richelia 
intracellularis HM01]
Length=159

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 86/144 (60%), Gaps = 7/144 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
             ++ ++++  +L +Y P EGGYEGRY  RLR  GYH + L+A+GLGD    LT  H V P
Sbjct  9    NFIHNLKKFGSLGVYAPLEGGYEGRYCRRLRSAGYHTISLTAKGLGDIAAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+           +Y PP V  +L  LPP + GLV+WIIE  VL   E+ +L  LP
Sbjct  69   PHLGKKSTINGAAVGYVYYIPPIVTSQLEQLPPKSNGLVLWIIEGHVLDDQEIDYLVNLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLK  781
               P+VRV+ E G  R F W+PL+
Sbjct  129  NSEPRVRVVVERGGDRVFRWEPLE  152



>ref|WP_023071165.1| nad h-quinone oxidoreductase subunit n [Leptolyngbya sp. Heron 
Island J]
 gb|ESA38042.1| nad h-quinone oxidoreductase subunit n [Leptolyngbya sp. Heron 
Island J]
Length=157

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E + ALA+  P EGG+EGRY  R+R  GY  L ++ARGLGD    L   H V P
Sbjct  9    RFVRDLESNGALAVRVPLEGGFEGRYQRRMRAAGYESLHMTARGLGDLSAYLGDVHGVRP  68

Query  551  AHVGKQPIA------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
             H+GK+ +       R++ PP + YRL  + P  KG+V+W+IE  +LS  EL FLA L  
Sbjct  69   PHLGKKSMGQAAVGDRYFLPPVLGYRLEQIAPGMKGIVLWLIEGNILSSQELAFLAALCA  128

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
               +++V+ E G  R F W PLK+  + +
Sbjct  129  SDSRIKVVVELGGDRSFKWFPLKDAVQSA  157



>ref|WP_019508881.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=158

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 88/144 (61%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E++ AL +Y P EGG EGRY  RLR  GY  ++++ARGLGD    LT+ H V P 
Sbjct  10   FIRALEKNGALGLYMPLEGGSEGRYQRRLRAYGYQTINITARGLGDLAAYLTRVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I R       +Y PP   Y L  LP  AKGL +WIIE ++LS+ E+++L  L  
Sbjct  70   HLGKKTIGRDACVGDIYYVPPIATYELDTLPAKAKGLALWIIEGQILSRQEVEYLVDLTK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              PK++V+ E G  R   WKPL +
Sbjct  130  SEPKIKVVLELGGDRYVNWKPLAD  153



>ref|WP_008231769.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Richelia 
intracellularis]
 emb|CCH66371.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Richelia 
intracellularis HH01]
Length=159

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 86/144 (60%), Gaps = 7/144 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
             ++ ++++  +L +Y P EGGYEGRY  RLR  GYH + L+A+GLGD    LT  H V P
Sbjct  9    NFIHNLKKFGSLGVYAPLEGGYEGRYCRRLRSAGYHTISLTAKGLGDIAAYLTGVHGVRP  68

Query  551  AHVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+           +Y PP V  +L  LPP + GLV+WIIE  VL   E+ +L  LP
Sbjct  69   PHLGKKSNINSAAVGYVYYIPPIVTSQLEQLPPKSNGLVLWIIEGHVLDDQEIDYLVNLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLK  781
               P+VRV+ E G  R F W+PL+
Sbjct  129  NSEPRVRVVVERGGDRVFRWEPLE  152



>ref|WP_010872770.1| NAD(P)H-quinone oxidoreductase subunit N [Synechocystis sp. PCC 
6803]
 ref|NP_441465.1| hypothetical protein sll1262 [Synechocystis sp. PCC 6803]
 ref|YP_005383332.1| hypothetical protein SYNGTI_1570 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005386501.1| hypothetical protein SYNPCCP_1569 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005409208.1| hypothetical protein SYNPCCN_1569 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005651523.1| hypothetical protein SYNGTS_1570 [Synechocystis sp. PCC 6803]
 ref|YP_007451347.1| hypothetical protein MYO_115840 [Synechocystis sp. PCC 6803]
 sp|P74069.1|NDHN_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA18145.1| sll1262 [Synechocystis sp. PCC 6803]
 dbj|BAK50318.1| hypothetical protein SYNGTS_1570 [Synechocystis sp. PCC 6803]
 dbj|BAL29317.1| hypothetical protein SYNGTI_1570 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL32486.1| hypothetical protein SYNPCCN_1569 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35655.1| hypothetical protein SYNPCCP_1569 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM51895.1| hypothetical protein BEST7613_2964 [Bacillus subtilis BEST7613]
 gb|AGF51833.1| hypothetical protein MYO_115840 [Synechocystis sp. PCC 6803]
Length=161

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E   ALA+Y P EGGYEGRY  RLR  GY  + LSARGLGD E  L + H V PA
Sbjct  13   FIRALENDGALAVYAPLEGGYEGRYQRRLRANGYASISLSARGLGDVEAYLMQVHGVRPA  72

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IA+       ++  P   Y+L  LP  +KGLV+WI+E  +LS+ E+Q L  L  
Sbjct  73   HLGKKNIAQEGAVGPIYFAQPIAGYQLENLPAQSKGLVLWILEGYILSQTEIQDLISLTK  132

Query  713  LRPKVRVIAECGNWRKFMWKPL  778
              PK++V+ E G  R F W+PL
Sbjct  133  RVPKLKVVLEMGGDRVFRWQPL  154



>gb|KFF41962.1| NADH-quinone oxidoreductase cyanobacterial subunit N [Candidatus 
Atelocyanobacterium thalassa isolate SIO64986]
Length=158

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 88/149 (59%), Gaps = 7/149 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  AL I+ P EGG EGRY  RLR  GY     +A+GLGD E  LTK H V   
Sbjct  10   FIRDLEKSGALGIFTPLEGGSEGRYQRRLRLNGYESFSFTAKGLGDIEAYLTKVHGVSTP  69

Query  554  HVGKQPIARW-------YFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +        + PP   YRL  LP + KGL++WI+E  V S+ EL++L  LP 
Sbjct  70   HLGKKNIGQQAAVGPICFVPPIATYRLDNLPSECKGLILWIVEGHVFSRDELEYLINLPH  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
              P+++++ E G  R F W+ L++I   +
Sbjct  130  QEPRIKIVVELGGERYFRWESLEKIVHTA  158



>ref|WP_015219217.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanobacterium aponinum]
 ref|YP_007161532.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ53488.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanobacterium aponinum 
PCC 10605]
Length=155

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  ++A+Y P EGG+EGRY  RLR  GY   +LSARGLGD    L   H V P 
Sbjct  10   FIKDLEKAGSVAVYAPLEGGFEGRYQRRLRSYGYQTFNLSARGLGDLSAYLMNVHGVRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ I +       ++ PP   Y+L  LP  AKGLV+WIIE  VLS  E Q+L  L  
Sbjct  70   HLGKKNIGQEGAVGPTYFVPPIAGYQLENLPAKAKGLVLWIIEGFVLSNQEKQYLVDLTK  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
              PK++V+ E G  R F W+ L E
Sbjct  130  QEPKIKVVLELGGDRFFRWQSLSE  153



>gb|AIE74752.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Synechocystis 
sp. PCC 6714]
Length=161

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++  +E   ALA+Y P EGGYEGRY  RLR  GY  + LSARGLGD    L + H V PA
Sbjct  13   FIRALENAGALAVYAPLEGGYEGRYQRRLRAHGYSSISLSARGLGDVGAYLMEVHGVRPA  72

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+ IA+       ++  P   Y+L  LPP +KGLV+W++E  +LS+ E+Q L  L  
Sbjct  73   HLGKKNIAQEGAVGPIYFAQPMAGYQLDNLPPQSKGLVLWVLEGYILSQTEIQDLISLTK  132

Query  713  LRPKVRVIAECGNWRKFMWKPL  778
              P++++I E G  R F W+PL
Sbjct  133  REPRLKIILEMGGDRVFRWQPL  154



>ref|WP_017659028.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=157

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 90/147 (61%), Gaps = 10/147 (7%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+LSD+E+  AL  Y P EGG+EGRY  R R  GY  + L ARGLGD  + L   H V P
Sbjct  9    KFLSDLEQFGALGAYVPLEGGFEGRYQRRARAAGYTSISLCARGLGDLASYLMGVHGVRP  68

Query  551  AHVGKQ--------PIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
             H+GK+        PIA  Y PP V  +L  LP  +KGL++WI + +VLS+ EL++L  L
Sbjct  69   PHLGKKDFGDGAVGPIA--YVPPIVQTQLDTLPDRSKGLLLWIFDGRVLSRQELEYLTAL  126

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKEI  787
            P + P+V+V+ E G  R F W  L+++
Sbjct  127  PKIEPRVKVVVEVGGDRVFRWMSLEDV  153



>ref|WP_006276953.1| NAD(P)H-quinone oxidoreductase subunit N [Cylindrospermopsis 
raciborskii]
 gb|EFA70157.1| NADH dehydrogenase I subunit N [Cylindrospermopsis raciborskii 
CS-505]
Length=158

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 88/144 (61%), Gaps = 7/144 (5%)
 Frame = +2

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPA  553
            ++ D+E+  +L ++ P EGGYEGRY  RLR  GY  L ++ARGLGD    L   H + P 
Sbjct  10   FIRDLEKFGSLGVFVPLEGGYEGRYRRRLRAAGYVNLHITARGLGDVAAYLMGVHGIRPP  69

Query  554  HVGKQPIAR-------WYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
            H+GK+  +         Y PP +   L+ LPP++KGL++W+IE  +LS  E+++   LP 
Sbjct  70   HLGKKSTSNGAAVGEVQYLPPLISSHLAQLPPNSKGLLLWVIEGNILSDQEVEYFTNLPR  129

Query  713  LRPKVRVIAECGNWRKFMWKPLKE  784
            L P+V+V+ E G  R F W PL++
Sbjct  130  LEPRVKVVIERGGNRYFRWTPLEK  153



>ref|XP_007220075.1| hypothetical protein PRUPE_ppa024689mg, partial [Prunus persica]
 gb|EMJ21274.1| hypothetical protein PRUPE_ppa024689mg, partial [Prunus persica]
Length=119

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = +2

Query  197  PCSSSACYSGGFRKKQLVAITAGKWGWMGRQQRKTADVRCS-VGIEDFIGGDLVWFDLGK  373
            P  +S   +   +  + + +  G  G  G+  ++   +RCS   IEDFIGGDLV FDL +
Sbjct  5    PPRNSCTVNNEHKGNRNMMLMMGLSGRHGKASKRVGMIRCSGRSIEDFIGGDLVKFDLSR  64

Query  374  WLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARG  502
            WLSDVEEHKALA+Y PHEGGYE RY  RLRYQGY+FLDLSA G
Sbjct  65   WLSDVEEHKALAVYSPHEGGYESRYLNRLRYQGYYFLDLSAHG  107



>ref|WP_036532315.1| NAD(P)H-quinone oxidoreductase [Neosynechococcus sphagnicola]
 gb|KGF73071.1| NAD(P)H-quinone oxidoreductase [Neosynechococcus sphagnicola 
sy1]
Length=159

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E+ +AL +Y P EGG+EGRY  RLR  GY  L L+ARGLGD    L   H + P
Sbjct  9    QFVQDLEKSQALGLYVPLEGGFEGRYRRRLRAAGYTTLVLTARGLGDLSMYLMGVHGIRP  68

Query  551  AHVGKQPI-------ARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLP  709
             H+GK+ I       AR++ PP V  +L  LPP AKG V+WIIE  VLS  EL+FL+LLP
Sbjct  69   PHLGKKDIGQGAAVGARYFAPPIVQQQLEHLPPTAKGFVLWIIEGFVLSNQELEFLSLLP  128

Query  710  TLRPKVRVIAECGNWRKFMWKPLKE  784
            TL P+VRV+ E G  R   W PLK 
Sbjct  129  TLEPRVRVVVEVGGDRTLRWLPLKN  153



>ref|WP_006515916.1| NADH-quinone oxidoreductase subunit NdhN [Leptolyngbya sp. PCC 
7375]
 gb|EKV01521.1| NADH-quinone oxidoreductase subunit NdhN [Leptolyngbya sp. PCC 
7375]
Length=157

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 87/149 (58%), Gaps = 6/149 (4%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            +++ D+E + ALA+  P EGG+EGRY  R+R  GY  L ++ARGLGD    L   H V P
Sbjct  9    RFVRDLESNGALAVQVPLEGGFEGRYQRRMRASGYESLHMTARGLGDLSAYLGDVHGVRP  68

Query  551  AHVGKQPIA------RWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPT  712
             H+GK+ +       R++ P  +DYRL  +    KG+++W+IE  +LS  EL FL  L  
Sbjct  69   PHLGKKSMGQAAVGDRYFVPAVLDYRLERMAKGMKGILLWLIEGHILSSQELAFLTTLCE  128

Query  713  LRPKVRVIAECGNWRKFMWKPLKEIAEQS  799
               +++V+ E G  R F W PLK+  + +
Sbjct  129  SDSRIKVVVELGGNRSFKWFPLKDAVKSA  157



>ref|WP_023172980.1| NADH dehydrogenase I subunit N [Gloeobacter kilaueensis]
 ref|YP_008711572.1| NADH dehydrogenase I subunit N [Gloeobacter kilaueensis JS1]
 gb|AGY57865.1| NADH dehydrogenase I subunit N [Gloeobacter kilaueensis JS1]
Length=159

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 88/138 (64%), Gaps = 0/138 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            ++++ VE+  ALA++ P EGG EG Y  RLR  GY    LSARGLGD    L + H V P
Sbjct  13   RFVAAVEKQGALALWFPPEGGLEGNYQRRLRGAGYRTQLLSARGLGDLSRFLLESHGVRP  72

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            AH+GK+    +  PPE+   +  LPP A+G V+W+IE KVLS AEL++L++LP    K++
Sbjct  73   AHLGKKEKRVFDLPPELAIYMDNLPPSARGFVLWLIEGKVLSLAELEYLSMLPAAVAKLK  132

Query  731  VIAECGNWRKFMWKPLKE  784
            ++ E G+ R   W PL E
Sbjct  133  IVIELGSDRGIRWLPLAE  150



>ref|WP_011143759.1| NAD(P)H-quinone oxidoreductase subunit N [Gloeobacter violaceus]
 ref|NP_926716.1| hypothetical protein gll3770 [Gloeobacter violaceus PCC 7421]
 sp|Q7NEV8.1|NDHN_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Gloeobacter violaceus PCC 7421]
 dbj|BAC91711.1| gll3770 [Gloeobacter violaceus PCC 7421]
Length=159

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 90/146 (62%), Gaps = 0/146 (0%)
 Frame = +2

Query  347  DLVWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTL  526
            +LV  +  ++++DVE+H ++A++ P EGG EG Y  RLR  GY    ++A+GLGD    L
Sbjct  5    NLVLDNGSRFVADVEKHSSIALWAPPEGGIEGNYQRRLRGIGYRTQIITAKGLGDISRFL  64

Query  527  TKFHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALL  706
             + H V PAH+GK+    +  PPE+   +  LP  AKG V+WIIE KVLS  EL+ L  L
Sbjct  65   LESHGVRPAHLGKKDKRVFTLPPELAIYMDTLPASAKGFVLWIIEGKVLSLFELESLVGL  124

Query  707  PTLRPKVRVIAECGNWRKFMWKPLKE  784
            P   PK++VI E G+     W PL++
Sbjct  125  PAAVPKLKVIVEVGSDYNIRWMPLEQ  150



>ref|WP_017328247.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=152

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 80/139 (58%), Gaps = 0/139 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++  +E    LA   P EGG EG Y  R+   GY  + +SARGLGD  +   + H VCP
Sbjct  9    KFVKALERAGVLAASVPPEGGSEGHYRRRVAGAGYQVVHMSARGLGDITSFFQQIHGVCP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            AH+GK  +  +YFPP ++     +PP  KGLV W+IE + LS+ EL  L  L    P+V+
Sbjct  69   AHLGKSNLRTYYFPPLIEQYRQAMPPQKKGLVFWLIEGQFLSRQELSCLQQLSRQEPQVK  128

Query  731  VIAECGNWRKFMWKPLKEI  787
             + E  + R F ++PL+ +
Sbjct  129  FVIEVESDRVFRYQPLENL  147



>ref|WP_011434182.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478820.1| hypothetical protein CYB_2627 [Synechococcus sp. JA-2-3B'a(2-13)]
 sp|Q2JIJ7.1|NDHN_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03557.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=147

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++  +E+  ALAIY   EGG EG Y  RLR  GY  + LS++G+GD  + LT+ H V P
Sbjct  9    KFVQQLEQAGALAIYVTPEGGSEGHYLRRLRGAGYEVVTLSSKGIGDLASYLTRIHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            A +GK     ++FP  ++   + LPP AKGLV W  E  V S+ EL +L  L      V+
Sbjct  69   ATLGKSERRTYFFPALIEQYRATLPPKAKGLVFWFYEGHVFSQQELSYLVKLSREDKGVK  128

Query  731  VIAECGNWRKFMWKPLK  781
             + E G  R   W+PL+
Sbjct  129  FVVELGRERSIRWQPLQ  145



>ref|WP_006173357.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. WH 
5701]
 gb|EAQ76737.1| hypothetical protein WH5701_05680 [Synechococcus sp. WH 5701]
Length=153

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 81/142 (57%), Gaps = 3/142 (2%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            ++  D+E+  ALA+Y P EGG E R   RLR  GY     SARGLGDPE  L + H V P
Sbjct  9    RFRQDLEKAGALALYAPLEGGAETRLLRRLRAAGYGAQITSARGLGDPEVFLFQSHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDY---RLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRP  721
             H+G   I R     EV     +L  L    K +V+W++EA+VLS AELQ L  L    P
Sbjct  69   PHLGHHSIGRGAAVGEVQRVMPQLGALLEGVKPMVLWLLEAQVLSSAELQSLCALTRREP  128

Query  722  KVRVIAECGNWRKFMWKPLKEI  787
            +++++AE G  R   W PL+++
Sbjct  129  RLKIVAELGGSRSLRWTPLEQM  150



>ref|WP_011429907.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. JA-3-3Ab]
 ref|YP_474487.1| hypothetical protein CYA_1028 [Synechococcus sp. JA-3-3Ab]
 sp|Q2JVL1.1|NDHN_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus sp. JA-3-3Ab]
 gb|ABC99224.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=147

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K++  +E+  ALAI+   EGG EG Y  RLR  GY  + LS++G+GD  + LT  H V P
Sbjct  9    KFVQQLEQCGALAIFVTPEGGSEGHYLRRLRGAGYEVVTLSSKGIGDLASYLTSSHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            A +GK     +++P  ++   + LPP AKGLV W  E  VLS+ EL +L  L      V+
Sbjct  69   ATLGKSQRRTYFYPSLIEQYRATLPPKAKGLVFWFYEGHVLSRQELSYLVKLSQEDKGVK  128

Query  731  VIAECGNWRKFMWKPLK  781
             + E G  R   W+PL+
Sbjct  129  FVVELGRERSIRWQPLQ  145



>ref|WP_032516075.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGG00554.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9314]
Length=158

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNRLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K++++ E G  RK  WKPL
Sbjct  129  NKLKIVVEMGGSRKLEWKPL  148



>ref|WP_025946467.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB241_528N17]
Length=158

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ SD++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHSDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025960625.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB245a_519E23]
Length=158

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ HK LAI+ P EGGYE R   R+R +G+     +ARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTHKCLAIFAPLEGGYETRLLRRMRAKGFKTFITAARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025782570.1| NAD(P)H-quinone oxidoreductase [Candidatus Synechococcus spongiarum]
Length=153

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 80/147 (54%), Gaps = 3/147 (2%)
 Frame = +2

Query  353  VWFDLGKWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTK  532
            +   + ++  D+E H A+A+  P EGG+E R   RLR  GY     SARGLGDPET L  
Sbjct  3    LLLGIRRFRKDLERHGAMAVTAPPEGGFETRLLRRLRAAGYAAQLCSARGLGDPETFLLG  62

Query  533  FHPVCPAHVGKQPIARWYFPPEVDYRLSLLPPDA---KGLVVWIIEAKVLSKAELQFLAL  703
             H V P H+G+Q I        V   L  L P     K +++W++EA+VLS+AEL     
Sbjct  63   LHGVRPPHLGRQSIGGTAAVGAVSMALPQLMPQLQTDKPVLLWLLEAQVLSRAELDTFVE  122

Query  704  LPTLRPKVRVIAECGNWRKFMWKPLKE  784
            LP   P +RV+ E G  R   W+PL E
Sbjct  123  LPRRYPGLRVVCEMGGSRTLRWQPLAE  149



>ref|WP_011821038.1| NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus marinus]
 ref|YP_001012055.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9515]
 sp|A2BYT7.1|NDHN_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. MIT 9515]
 gb|ABM72948.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9515]
Length=156

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 83/142 (58%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++++K LA++ P EGGYE R   R+R +G+     SARGLGDPE  L   H + P
Sbjct  9    KFHNDLKKNKCLAMFAPLEGGYETRLLRRMRAKGFKTYITSARGLGDPEVFLLNLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q I R     EV   +     L   + K  ++W++E +VLS++EL+ L  LPT  
Sbjct  69   PHLGHQSIGRNGALGEVQQVIPQASELFNENDKDKLLWLLEGQVLSQSELENLIKLPTAD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K++++ E G  RK  WK L +
Sbjct  129  NKLKIVVEMGGSRKLEWKSLND  150



>ref|WP_025960088.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB245a_519C7]
Length=158

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYEARLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_032520054.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGG08726.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. SB]
Length=158

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 82/142 (58%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K+ ++ E G  RK  WKPL +
Sbjct  129  NKLTIVVEMGGSRKLEWKPLSD  150



>ref|WP_025937655.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB245a_519O21]
Length=158

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLMEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025947016.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB241_528N20]
Length=158

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLSIVVEMGGSRKLEWKPL  148



>ref|WP_025952930.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB243_495P20]
Length=158

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLKWKPL  148



>ref|WP_011819171.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus]
 ref|YP_001010156.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
AS9601]
 sp|A2BTD8.1|NDHN_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. AS9601]
 gb|ABM71049.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
AS9601]
 gb|AIQ95924.1| Putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
sp. MIT 0604]
Length=158

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_002807100.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus]
 ref|YP_001485030.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9215]
 sp|A8G763.1|NDHN_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. MIT 9215]
 gb|ABV51444.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9215]
 gb|EEE40433.1| NADH dehydrogenase i subunit n [Prochlorococcus marinus str. 
MIT 9202]
Length=158

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025927703.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase [Prochlorococcus]
Length=158

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVVPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025915160.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB245a_520K10]
Length=158

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 82/142 (58%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H + P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPMAAELFNENDKNKLLWLLEGQVLSQSELESLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K+ ++ E G  RK  WKPL +
Sbjct  129  NKLTIVVEMGGSRKLEWKPLND  150



>ref|WP_025965040.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase [Prochlorococcus]
 gb|KGF85622.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. GP2]
Length=158

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVIEMGGSRKLEWKPL  148



>ref|WP_025956996.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase [Prochlorococcus]
Length=158

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTYKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025934044.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB243_498A3]
Length=158

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+  D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHKDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASGLFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025939943.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB245a_520B18]
Length=158

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     +   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASEIFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025938713.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB245a_519A13]
Length=158

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTYITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025893594.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB241_527N11]
Length=158

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTSITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_011377193.1| NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus marinus]
 ref|YP_398148.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9312]
 sp|Q318I3.1|NDHN_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. MIT 9312]
 gb|ABB50712.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9312]
 gb|KGG02301.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9311]
Length=158

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            ++ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    QFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLSIVVEMGGSRKLEWKPL  148



>ref|WP_025980675.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB243_498F21]
Length=158

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++  K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTSKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025953317.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB243_496G15]
Length=158

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 81/140 (58%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARG+GDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGIGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVVPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025923893.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB243_495L20]
Length=158

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRVKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VL ++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLCQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025974120.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB241_529B19]
Length=158

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+  D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHYDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_025922644.1| MULTISPECIES: NAD(P)H-quinone oxidoreductase [Prochlorococcus]
Length=158

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VL ++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLCQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTIVVEMGGSRKLEWKPL  148



>ref|WP_011863661.1| NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus marinus]
 ref|YP_001091974.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9301]
 sp|A3PF48.1|NDHN_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. MIT 9301]
 gb|ABO18373.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
MIT 9301]
Length=158

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WK L
Sbjct  129  NKLTIVVEMGGSRKLEWKSL  148



>ref|WP_011824515.1| NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus marinus]
 ref|YP_001015824.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
NATL1A]
 sp|A2C500.1|NDHN_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. NATL1A]
 gb|ABM76560.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
NATL1A]
Length=154

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 80/141 (57%), Gaps = 3/141 (2%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D+E    LAI  P EGG E R   RLR  GY     SARGLGDP   LT+ H + P
Sbjct  9    KFRTDLESFGCLAILSPLEGGAETRLLRRLRASGYQTQITSARGLGDPVVFLTQLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDY---RLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRP  721
             H+G Q + R     EV     +L+ L  + K LV+W++E +VLSK+EL  ++ L    P
Sbjct  69   PHLGHQNVGRNGALGEVQQVIPQLNELLVEDKPLVLWLLEGQVLSKSELLAISNLCQKEP  128

Query  722  KVRVIAECGNWRKFMWKPLKE  784
            +++++ E G  R   W+PL E
Sbjct  129  RIKIVIEMGGARSIKWQPLNE  149



>ref|WP_011133187.1| NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus marinus]
 ref|NP_893676.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 sp|Q7UZU6.1|NDHN_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 emb|CAE20018.1| conserved hypothetical protein [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gb|KGF86807.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. EQPAC1]
Length=156

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D+ ++K LA++ P EGGYE R   R+R +G+     SARGLGDPE  L K H + P
Sbjct  9    KFHNDLNKNKCLAMFAPLEGGYETRLLRRMRAKGFKTYITSARGLGDPEVFLLKLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q I R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSIGRNGALGEVQQVIPQASELFNENDKDKLLWLLEGQVLSQSELESLIKICTSD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K++++ E G  RK  WK L +
Sbjct  129  NKLKIVVEMGGSRKLEWKSLND  150



>ref|WP_032526277.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGF98169.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9302]
Length=158

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 81/142 (57%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H + P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + +     EV   +     L   + K  ++W++E +VLS++EL  L  + T  
Sbjct  69   PHLGHQSVGKNGALGEVQQVIPMASELFNENDKNKLLWLLEGQVLSQSELVSLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K+ ++ E G  RK  WKPL +
Sbjct  129  NKLTIVVEMGGSRKLEWKPLND  150



>ref|WP_025930948.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus sp. scB241_528O2]
Length=156

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFSPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNENDKDKLLWLLEGQVLSQSELESLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K++++ E G  RK  W+ L +
Sbjct  129  NKLKIVIEMGGSRKLEWRSLSD  150



>ref|WP_011295474.1| NAD(P)H-quinone oxidoreductase subunit N [Prochlorococcus marinus]
 ref|YP_292323.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
NATL2A]
 sp|Q46IQ8.1|NDHN_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Prochlorococcus marinus str. NATL2A]
 gb|AAZ58620.1| NADH dehydrogenase I subunit N [Prochlorococcus marinus str. 
NATL2A]
Length=154

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D+E    LAI  P EGG E R   RLR  GY     SARGLGDP   LT+ H + P
Sbjct  9    KFRTDLESFGCLAILSPLEGGAETRLLRRLRASGYQTQVTSARGLGDPVVFLTQLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDY---RLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRP  721
             H+G Q + R     EV     +L+ L  + K LV+W++E +VLSK+EL  +  L    P
Sbjct  69   PHLGHQNVGRNGALGEVQQVIPQLNELLVEDKPLVLWLLEGQVLSKSELLAINNLCQKEP  128

Query  722  KVRVIAECGNWRKFMWKPLKE  784
            +++++ E G  R   W+PL E
Sbjct  129  RIKIVIEMGGARSIKWQPLNE  149



>ref|WP_032513745.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGF91367.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9107]
 gb|KGF91771.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9116]
 gb|KGF93877.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9123]
Length=156

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    KFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +V+S++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQRVIPQASELFNENDKHKLLWLLEGQVMSQSELESLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K++++ E G  RK  WK L +
Sbjct  129  NKLKIVIEMGGSRKLEWKSLND  150



>ref|WP_036904547.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGG22001.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. PAC1]
Length=154

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D+E    LAI  P EGG E R   RLR  GY     SARGLGDP   LT+ H + P
Sbjct  9    KFRTDLESFGCLAILSPLEGGAETRLLRRLRASGYQTQITSARGLGDPVVFLTQLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDY---RLSLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRP  721
             H+G Q + R     EV     +L+ L  + K LV+W++E +VLSK+EL  +  L    P
Sbjct  69   PHLGHQNVGRNGALGEVQQVIPQLNELLVEEKPLVLWLLEGQVLSKSELLAIHNLCQKEP  128

Query  722  KVRVIAECGNWRKFMWKPLKE  784
            +++++ E G  R   W+PL E
Sbjct  129  RIKIVIEMGGARSIKWQPLNE  149



>ref|WP_032517886.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGG03132.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9321]
 gb|KGG06562.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9322]
 gb|KGG10258.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9401]
Length=158

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 81/142 (57%), Gaps = 4/142 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            ++ +D++ +K LAI+ P EGGYE R   R+R +G+     SARGLGDPE  L K H V P
Sbjct  9    QFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGVRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L   + K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQNVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELESLIEICTKD  128

Query  719  PKVRVIAECGNWRKFMWKPLKE  784
             K+ ++ E G  RK  WK L +
Sbjct  129  NKLTIVVEMGGSRKLEWKTLSD  150



>ref|WP_035830866.1| NAD(P)H-quinone oxidoreductase [Cyanobium sp. CACIAM 14]
 gb|KEF42304.1| NAD(P)H-quinone oxidoreductase [Cyanobium sp. CACIAM 14]
Length=153

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 3/139 (2%)
 Frame = +2

Query  380  SDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHV  559
            +++E   ALA++ P EGG E R   RLR  GY     SARGLGDPE  LT+ H V P H+
Sbjct  12   TELERCGALALFVPLEGGAETRLLRRLRAAGYRAHLTSARGLGDPEAYLTQLHGVRPPHL  71

Query  560  GKQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
            G Q + R     +V   + LL P   G   +++W++E +VLS +EL  L  L    P+++
Sbjct  72   GHQSVGRGAAVGDVQMVMPLLGPQLAGEGPVLLWLLEGQVLSASELAALCDLCRREPRLK  131

Query  731  VIAECGNWRKFMWKPLKEI  787
            V+ E G  R   W+PL ++
Sbjct  132  VVVEMGGARALRWQPLDQL  150



>ref|WP_011128924.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. WH 
8102]
 ref|NP_898157.1| hypothetical protein SYNW2066 [Synechococcus sp. WH 8102]
 sp|Q7U4K1.1|NDHN_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus sp. WH 8102]
 emb|CAE08581.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=153

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 5/139 (4%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E H  LA++ P EGG E R   RLR  GY     SARGLGDPE  LT+ H + P H+G
Sbjct  13   DLEAHGCLAVHAPLEGGAETRLLRRLRGAGYRTRLWSARGLGDPEVFLTQKHGIRPPHLG  72

Query  563  KQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
             Q + R     EV   +     LL  DA+ + +W++E +VLS++EL+ L  L +  P++R
Sbjct  73   HQSVGRGAAVGEVQEVVPQLGDLLDGDAQ-VALWLLEGQVLSQSELRSLCDLCSREPRLR  131

Query  731  VIAECGNWRKFMWKPLKEI  787
            +I E G  R   W+P+  +
Sbjct  132  IIVEMGGARSLRWQPMSGL  150



>ref|WP_038543152.1| NAD(P)H-quinone oxidoreductase [Synechococcus sp. KORDI-100]
 gb|AII42422.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. KORDI-100]
Length=153

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 3/141 (2%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E +  LA++ P EGG E R   RLR  GY    LSARGLGDPE  LT+ H + P H+G
Sbjct  13   DLEANGCLAVHAPLEGGAETRLLRRLRGAGYRTRILSARGLGDPEVFLTQKHGIRPPHLG  72

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
             Q + R     EV   + +L     G   + +W++E +VLS++EL  L  L    P++R+
Sbjct  73   HQSVGRGAAVGEVQQVVPMLGDLFDGDAPVALWLLEGQVLSRSELLSLCDLCRREPRLRI  132

Query  734  IAECGNWRKFMWKPLKEIAEQ  796
            + E G  R   W+P+ ++ E+
Sbjct  133  VVEMGGARSLRWQPMGDLLER  153



>ref|WP_032521980.1| NAD(P)H-quinone oxidoreductase [Prochlorococcus marinus]
 gb|KGF96035.1| putative subunit of NAD(P)H:quinone oxidoreductase [Prochlorococcus 
marinus str. MIT 9201]
Length=158

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 80/140 (57%), Gaps = 4/140 (3%)
 Frame = +2

Query  371  KWLSDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCP  550
            K+ +D++ +K LA++ P EGGYE R   R+R +G+     SARGLGDPE  L K H + P
Sbjct  9    KFHNDLKTNKCLAMFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFLLKLHGIRP  68

Query  551  AHVGKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLR  718
             H+G Q + R     EV   +     L     K  ++W++E +VLS++EL+ L  + T  
Sbjct  69   PHLGHQSVGRNGALGEVQQVIPQASELFNEYDKNKLLWLLEGQVLSQSELESLIEICTND  128

Query  719  PKVRVIAECGNWRKFMWKPL  778
             K+ ++ E G  RK  WKPL
Sbjct  129  NKLTMVVEMGGSRKLEWKPL  148



>ref|WP_011618400.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. CC9311]
 ref|YP_729668.1| hypothetical protein sync_0438 [Synechococcus sp. CC9311]
 sp|Q0ID04.1|NDHN_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus sp. CC9311]
 gb|ABI47819.1| Uncharacterized protein sync_0438 [Synechococcus sp. CC9311]
Length=153

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 3/138 (2%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            ++E    +A++ P EGG E R   RLR  GY     SARGLGDPE  L + H + P H+G
Sbjct  13   ELESAGCMAVFAPLEGGAETRLLRRLRGAGYRTQLSSARGLGDPEVFLFQKHGIRPPHLG  72

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
             Q + R     EV   + LL     G   +V+W++E +VLS++EL  L  L    P+++V
Sbjct  73   HQSVGRGAAVGEVQEVMPLLGESMLGTKPVVLWLLEGQVLSRSELSALCDLCRREPRLKV  132

Query  734  IAECGNWRKFMWKPLKEI  787
            + E G  R   W+PLKE+
Sbjct  133  VVEMGGARSLRWQPLKEL  150



>ref|WP_037988730.1| NAD(P)H-quinone oxidoreductase [Synechococcus sp. BL107]
Length=153

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 3/138 (2%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E +  LA++ P EGG E R   RLR  GY     SARGLGDPE  LT+ H + P H+G
Sbjct  13   DLEANGCLAVHAPLEGGAETRLLRRLRGAGYRTRMTSARGLGDPEVFLTQKHGIRPPHLG  72

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
               + R     EV   + L+    +G   + +WI+E +VLS++EL  L  L    P++R+
Sbjct  73   HNCVGRGAAVGEVQQVVPLIGDLLEGDDSVALWILEGQVLSRSELLSLCDLCKREPRLRI  132

Query  734  IAECGNWRKFMWKPLKEI  787
            I E G  R   W+P+K +
Sbjct  133  IVEMGGARSLRWQPMKAL  150



>ref|WP_006910056.1| NAD(P)H-quinone oxidoreductase subunit N [Cyanobium sp. PCC 7001]
 gb|EDY38157.1| NADH dehydrogenase i subunit n [Cyanobium sp. PCC 7001]
Length=154

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 78/140 (56%), Gaps = 5/140 (4%)
 Frame = +2

Query  380  SDVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHV  559
             D+E   ALA++ P EGG E R   RLR  GY     SARGLGDPE  L + H V P H+
Sbjct  12   QDLERAGALALFAPLEGGAETRLMRRLRAAGYRAQLTSARGLGDPEAFLLQLHGVRPPHL  71

Query  560  GKQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKV  727
            G Q + R     +V   +    SLL  D + +++W++E +VLS AEL  L  L    P++
Sbjct  72   GHQSVGRGAAVGDVHRVMPQLGSLLEGD-QPILLWLLEGQVLSTAELSSLVALTRREPRL  130

Query  728  RVIAECGNWRKFMWKPLKEI  787
            +++ E G  R   W+PL+ +
Sbjct  131  KIVVEMGGARALRWQPLEAL  150



>gb|EAU70213.1| NADH dehydrogenase I subunit N [Synechococcus sp. BL107]
Length=157

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 3/138 (2%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E +  LA++ P EGG E R   RLR  GY     SARGLGDPE  LT+ H + P H+G
Sbjct  17   DLEANGCLAVHAPLEGGAETRLLRRLRGAGYRTRMTSARGLGDPEVFLTQKHGIRPPHLG  76

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
               + R     EV   + L+    +G   + +WI+E +VLS++EL  L  L    P++R+
Sbjct  77   HNCVGRGAAVGEVQQVVPLIGDLLEGDDSVALWILEGQVLSRSELLSLCDLCKREPRLRI  136

Query  734  IAECGNWRKFMWKPLKEI  787
            I E G  R   W+P+K +
Sbjct  137  IVEMGGARSLRWQPMKAL  154



>ref|WP_028953638.1| NAD(P)H-quinone oxidoreductase [Synechococcus sp. CC9616]
Length=153

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E +  LA++ P EGG E R   RLR  GY    LSARGLGDPE  LT+ H + P H+G
Sbjct  13   DLEANGCLAVHAPLEGGAETRLLRRLRGSGYQTRILSARGLGDPEVFLTQKHGIRPPHLG  72

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
             Q + R     EV   + +L    +    + VW++E +VLS++EL  L  L    P++R+
Sbjct  73   HQSVGRGAAVGEVQQVVPMLGDLFETDLPVAVWLLEGQVLSRSELLSLCDLCRREPRLRI  132

Query  734  IAECGNWRKFMWKPLKEIAE  793
              E G  R   W+P++++ +
Sbjct  133  AVEMGGARSLRWQPMRDLLQ  152



>ref|WP_011360712.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. CC9902]
 ref|YP_377954.1| NADH dehydrogenase I subunit N [Synechococcus sp. CC9902]
 sp|Q3AUW5.1|NDHN_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit N; AltName: 
Full=NAD(P)H dehydrogenase I subunit N; Short=NDH-1 subunit 
N; Short=NDH-N [Synechococcus sp. CC9902]
 gb|ABB26911.1| NADH dehydrogenase I subunit N [Synechococcus sp. CC9902]
Length=157

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 76/138 (55%), Gaps = 3/138 (2%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E +  LA++ P EGG E R   RLR  GY     SARGLGDPE  LT+ H + P H+G
Sbjct  17   DLEANGCLAVHAPLEGGAETRLLRRLRGAGYRTRMTSARGLGDPEVFLTQKHGIRPPHLG  76

Query  563  KQPIARWYFPPEVDYRLSLLPPDAKG---LVVWIIEAKVLSKAELQFLALLPTLRPKVRV  733
               + R     EV   + L+     G   + +WI+E +VLS++EL  L  L    P++R+
Sbjct  77   HNCVGRGAAVGEVQQVVPLIGDLLDGDDSVALWILEGQVLSRSELLSLCDLCKREPRLRI  136

Query  734  IAECGNWRKFMWKPLKEI  787
            I E G  R   W+P+K +
Sbjct  137  IVEMGGARSLRWQPMKAL  154



>gb|AII46930.1| NAD(P)H-quinone oxidoreductase subunit N [Synechococcus sp. KORDI-49]
Length=153

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 5/139 (4%)
 Frame = +2

Query  383  DVEEHKALAIYPPHEGGYEGRYFTRLRYQGYHFLDLSARGLGDPETTLTKFHPVCPAHVG  562
            D+E    LA++ P EGG E R   RLR  GY     SARGLGDPE  LT+ H + P H+G
Sbjct  13   DLEASGCLAVHAPLEGGAETRLLRRLRGAGYRTRLSSARGLGDPEVFLTQKHGIRPPHLG  72

Query  563  KQPIARWYFPPEVDYRL----SLLPPDAKGLVVWIIEAKVLSKAELQFLALLPTLRPKVR  730
               + R     EV   +     LL  DA+ + +W++E +VLS++EL  L  L    P++R
Sbjct  73   HHSVGRGAAVGEVQEVVPQLGDLLDGDAQ-VALWLLEGQVLSRSELLSLCDLCRREPRLR  131

Query  731  VIAECGNWRKFMWKPLKEI  787
            ++ E G  R   W+P++E+
Sbjct  132  IVVEMGGARSLRWQPMREL  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592