BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29268_g1_i1 len=1677 path=[1655:0-1676]

Length=1677
                                                                      Score     E

ref|XP_004230770.1|  PREDICTED: U-box domain-containing protein 2...    616   0.0      
ref|XP_006346399.1|  PREDICTED: U-box domain-containing protein 2...    613   0.0      
ref|XP_011092561.1|  PREDICTED: U-box domain-containing protein 2...    602   0.0      
ref|XP_009627648.1|  PREDICTED: U-box domain-containing protein 2...    590   0.0      
ref|XP_011088242.1|  PREDICTED: U-box domain-containing protein 2...    584   0.0      
ref|XP_010107920.1|  U-box domain-containing protein 26                 583   0.0      
gb|EPS57772.1|  hypothetical protein M569_17045                         580   0.0      
gb|KDP32265.1|  hypothetical protein JCGZ_14786                         569   0.0      
ref|XP_009792112.1|  PREDICTED: U-box domain-containing protein 2...    569   0.0      
ref|XP_007042451.1|  Plant U-box 26                                     568   0.0      
emb|CDO97189.1|  unnamed protein product                                565   0.0      
ref|XP_010263503.1|  PREDICTED: U-box domain-containing protein 2...    560   0.0      
ref|XP_002285110.1|  PREDICTED: U-box domain-containing protein 26      555   0.0      Vitis vinifera
ref|XP_010270217.1|  PREDICTED: U-box domain-containing protein 2...    554   0.0      
emb|CAN74163.1|  hypothetical protein VITISV_026443                     555   0.0      Vitis vinifera
ref|XP_011000686.1|  PREDICTED: U-box domain-containing protein 2...    548   0.0      
gb|ABK93469.1|  unknown                                                 546   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002313124.2|  U-box domain-containing family protein             545   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004309747.1|  PREDICTED: U-box domain-containing protein 2...    542   0.0      
ref|XP_011005992.1|  PREDICTED: U-box domain-containing protein 2...    541   0.0      
ref|XP_002306161.2|  hypothetical protein POPTR_0004s14720g             538   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007199948.1|  hypothetical protein PRUPE_ppa006352mg             537   0.0      
ref|XP_003529402.1|  PREDICTED: U-box domain-containing protein 2...    533   0.0      
ref|XP_006583889.1|  PREDICTED: U-box domain-containing protein 2...    532   0.0      
ref|XP_003518699.1|  PREDICTED: U-box domain-containing protein 2...    530   0.0      
ref|XP_004140703.1|  PREDICTED: U-box domain-containing protein 2...    526   7e-180   
ref|XP_008456137.1|  PREDICTED: U-box domain-containing protein 2...    525   2e-179   
ref|XP_008373128.1|  PREDICTED: U-box domain-containing protein 2...    523   9e-179   
ref|XP_007153588.1|  hypothetical protein PHAVU_003G048200g             521   4e-178   
gb|EPS67592.1|  hypothetical protein M569_07183                         521   7e-178   
ref|XP_010690605.1|  PREDICTED: U-box domain-containing protein 26      520   1e-177   
ref|XP_006487052.1|  PREDICTED: U-box domain-containing protein 2...    516   6e-176   
ref|XP_006422990.1|  hypothetical protein CICLE_v10028522mg             515   9e-176   
ref|XP_004505237.1|  PREDICTED: U-box domain-containing protein 2...    513   4e-175   
gb|AES90137.2|  plant U-box protein                                     503   5e-171   
ref|XP_003607940.1|  U-box domain-containing protein                    501   1e-169   
ref|XP_010538612.1|  PREDICTED: U-box domain-containing protein 2...    495   2e-167   
ref|XP_002518745.1|  Spotted leaf protein, putative                     485   8e-164   Ricinus communis
emb|CDY50158.1|  BnaA01g26180D                                          474   9e-160   
emb|CDX99233.1|  BnaC05g33480D                                          473   2e-159   
ref|XP_009341339.1|  PREDICTED: U-box domain-containing protein 26      472   3e-159   
emb|CDX92328.1|  BnaA05g20790D                                          471   2e-158   
ref|XP_009145797.1|  PREDICTED: U-box domain-containing protein 25      471   2e-158   
emb|CDY16513.1|  BnaA08g02540D                                          471   3e-158   
ref|XP_009111906.1|  PREDICTED: U-box domain-containing protein 2...    470   4e-158   
gb|ABV89622.1|  U-box domain-containing protein                         469   7e-158   Brassica rapa
ref|XP_009107285.1|  PREDICTED: U-box domain-containing protein 26      471   1e-157   
emb|CDX95458.1|  BnaC01g33500D                                          468   3e-157   
gb|EYU37659.1|  hypothetical protein MIMGU_mgv1a019070mg                464   3e-157   
ref|XP_006393215.1|  hypothetical protein EUTSA_v10011515mg             465   4e-156   
emb|CDY59286.1|  BnaCnng34640D                                          462   1e-154   
gb|KFK39278.1|  hypothetical protein AALP_AA3G223600                    456   2e-152   
ref|XP_002894216.1|  U-box domain-containing protein                    455   4e-152   
ref|XP_006406505.1|  hypothetical protein EUTSA_v10022190mg             454   9e-152   
ref|XP_010500528.1|  PREDICTED: U-box domain-containing protein 2...    453   2e-151   
ref|NP_175400.1|  U-box domain-containing protein 26                    453   2e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461826.1|  PREDICTED: U-box domain-containing protein 26      452   4e-151   
ref|XP_006306175.1|  hypothetical protein CARUB_v10011740mg             451   2e-150   
gb|KFK35978.1|  hypothetical protein AALP_AA4G062500                    449   1e-149   
dbj|BAC42960.1|  unknown protein                                        448   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236490.1|  PREDICTED: U-box domain-containing protein 2...    447   9e-149   
ref|NP_566632.1|  U-box domain-containing protein 25                    441   8e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299353.1|  hypothetical protein CARUB_v10015518mg             442   8e-147   
dbj|BAF01749.1|  hypothetical protein                                   436   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466083.1|  PREDICTED: U-box domain-containing protein 25      432   3e-143   
ref|XP_010507691.1|  PREDICTED: U-box domain-containing protein 2...    429   7e-142   
ref|XP_006847114.1|  hypothetical protein AMTR_s00017p00223570          422   2e-139   
ref|XP_010468287.1|  PREDICTED: U-box domain-containing protein 2...    419   3e-138   
ref|XP_002885309.1|  hypothetical protein ARALYDRAFT_479456             400   6e-131   
ref|XP_009416906.1|  PREDICTED: U-box domain-containing protein 26      368   4e-118   
ref|XP_008784183.1|  PREDICTED: U-box domain-containing protein 2...    363   1e-116   
ref|XP_010912457.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    342   4e-108   
ref|XP_009406118.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    341   9e-108   
ref|XP_009403520.1|  PREDICTED: U-box domain-containing protein 2...    341   1e-107   
ref|XP_004952703.1|  PREDICTED: U-box domain-containing protein 2...    335   1e-105   
ref|XP_010481065.1|  PREDICTED: U-box domain-containing protein 2...    327   3e-103   
dbj|BAJ97989.1|  predicted protein                                      325   1e-101   
gb|EMT28323.1|  U-box domain-containing protein 25                      321   5e-100   
ref|XP_010489938.1|  PREDICTED: U-box domain-containing protein 2...    317   7e-100   
gb|EMS66308.1|  U-box domain-containing protein 25                      320   1e-99    
ref|XP_002453962.1|  hypothetical protein SORBIDRAFT_04g022280          310   4e-96    Sorghum bicolor [broomcorn]
ref|XP_003575105.1|  PREDICTED: U-box domain-containing protein 2...    303   2e-93    
gb|AFW71736.1|  ubiquitin-protein ligase                                303   4e-93    
ref|NP_001148065.1|  ubiquitin-protein ligase                           301   1e-92    Zea mays [maize]
dbj|BAD16187.1|  putative immediate-early fungal elicitor protein...    297   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047085.2|  Os02g0548700                                       296   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002974135.1|  ubiquitin-protein ligase, PUB26                    271   3e-81    
ref|XP_002968838.1|  ubiquitin-protein ligase, PUB26                    270   1e-80    
ref|XP_008680442.1|  PREDICTED: U-box domain-containing protein 2...    265   4e-79    
gb|KHN43058.1|  U-box domain-containing protein 25                      257   2e-77    
emb|CBI32390.3|  unnamed protein product                                246   1e-71    
ref|XP_002991371.1|  hypothetical protein SELMODRAFT_133552             224   3e-63    
ref|XP_002988236.1|  hypothetical protein SELMODRAFT_44944              221   4e-62    
ref|XP_001764309.1|  predicted protein                                  220   2e-61    
ref|XP_010068460.1|  PREDICTED: U-box domain-containing protein 2...    208   9e-60    
ref|XP_009380073.1|  PREDICTED: U-box domain-containing protein 2...    215   1e-59    
gb|AFW62582.1|  hypothetical protein ZEAMMB73_679873                    209   4e-59    
ref|XP_004142305.1|  PREDICTED: U-box domain-containing protein 2...    206   3e-56    
ref|XP_009403145.1|  PREDICTED: U-box domain-containing protein 2...    206   3e-56    
ref|XP_006826592.1|  hypothetical protein AMTR_s00138p00053700          204   1e-55    
ref|XP_008465536.1|  PREDICTED: U-box domain-containing protein 2...    204   2e-55    
ref|XP_009382986.1|  PREDICTED: U-box domain-containing protein 2...    198   4e-53    
ref|XP_003564002.1|  PREDICTED: U-box domain-containing protein 21      196   2e-52    
ref|XP_001783217.1|  predicted protein                                  194   2e-52    
ref|XP_009370082.1|  PREDICTED: U-box domain-containing protein 21      195   3e-52    
ref|XP_009404142.1|  PREDICTED: U-box domain-containing protein 2...    195   4e-52    
ref|XP_010906325.1|  PREDICTED: U-box domain-containing protein 2...    195   5e-52    
ref|XP_008795339.1|  PREDICTED: U-box domain-containing protein 21      194   9e-52    
ref|XP_004985053.1|  PREDICTED: U-box domain-containing protein 2...    194   1e-51    
gb|AGT17408.1|  hypothetical protein SHCRBa_230_N09_R_300               193   3e-51    
ref|XP_009770354.1|  PREDICTED: U-box domain-containing protein 2...    192   5e-51    
ref|XP_008780992.1|  PREDICTED: U-box domain-containing protein 2...    191   9e-51    
ref|XP_009600234.1|  PREDICTED: U-box domain-containing protein 2...    190   2e-50    
ref|NP_001049509.1|  Os03g0240600                                       190   4e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010102878.1|  U-box domain-containing protein 20                 190   4e-50    
ref|XP_009390871.1|  PREDICTED: U-box domain-containing protein 2...    189   5e-50    
ref|XP_009419493.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    189   5e-50    
ref|XP_010925800.1|  PREDICTED: U-box domain-containing protein 2...    189   6e-50    
ref|XP_004145841.1|  PREDICTED: U-box domain-containing protein 2...    189   9e-50    
ref|XP_008798516.1|  PREDICTED: U-box domain-containing protein 2...    189   9e-50    
ref|XP_010105562.1|  U-box domain-containing protein 20                 189   1e-49    
ref|XP_004236923.1|  PREDICTED: U-box domain-containing protein 2...    188   2e-49    
ref|XP_006355051.1|  PREDICTED: U-box domain-containing protein 2...    187   2e-49    
ref|XP_009378957.1|  PREDICTED: U-box domain-containing protein 2...    187   3e-49    
ref|XP_008784119.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    186   5e-49    
ref|XP_004503116.1|  PREDICTED: U-box domain-containing protein 2...    186   6e-49    
ref|XP_001776109.1|  predicted protein                                  186   6e-49    
ref|XP_004172231.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    186   7e-49    
gb|ACF88418.1|  unknown                                                 185   1e-48    Zea mays [maize]
ref|XP_010932523.1|  PREDICTED: U-box domain-containing protein 2...    185   2e-48    
ref|XP_009410070.1|  PREDICTED: U-box domain-containing protein 2...    185   2e-48    
ref|NP_001152389.1|  immediate-early fungal elicitor protein CMPG1      184   4e-48    Zea mays [maize]
gb|AIV00617.1|  U-box domain-containing protein                         184   5e-48    
ref|XP_010271201.1|  PREDICTED: U-box domain-containing protein 2...    184   5e-48    
ref|XP_009415614.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    183   7e-48    
ref|XP_008812599.1|  PREDICTED: U-box domain-containing protein 2...    183   7e-48    
ref|XP_003631249.1|  PREDICTED: U-box domain-containing protein 2...    183   7e-48    
emb|CDP01660.1|  unnamed protein product                                183   8e-48    
ref|XP_002275500.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    182   8e-48    Vitis vinifera
ref|XP_009781197.1|  PREDICTED: U-box domain-containing protein 2...    183   9e-48    
gb|AAK69401.1|AF274564_1  immediate-early fungal elicitor protein...    183   1e-47    Petroselinum crispum
ref|XP_003616222.1|  U-box domain-containing protein                    182   1e-47    
gb|AAP03884.1|  Avr9/Cf-9 rapidly elicited protein 74                   182   2e-47    Nicotiana tabacum [American tobacco]
ref|XP_002533776.1|  ubiquitin-protein ligase, putative                 182   2e-47    Ricinus communis
ref|XP_007036951.1|  ARM repeat superfamily protein                     182   2e-47    
ref|XP_010091753.1|  U-box domain-containing protein 21                 182   3e-47    
ref|XP_009379827.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    181   3e-47    
ref|XP_009592688.1|  PREDICTED: U-box domain-containing protein 2...    181   3e-47    
ref|XP_007215376.1|  hypothetical protein PRUPE_ppa005711mg             181   4e-47    
ref|NP_001147860.1|  immediate-early fungal elicitor protein CMPG1      181   4e-47    Zea mays [maize]
ref|XP_008457035.1|  PREDICTED: U-box domain-containing protein 2...    181   5e-47    
ref|XP_010043987.1|  PREDICTED: U-box domain-containing protein 2...    181   5e-47    
gb|ADI46214.1|  CMPG1b                                                  181   6e-47    
gb|ADI46213.1|  CMPG1a                                                  180   9e-47    
ref|XP_004490855.1|  PREDICTED: U-box domain-containing protein 2...    180   9e-47    
ref|XP_002298264.1|  hypothetical protein POPTR_0001s22370g             179   1e-46    Populus trichocarpa [western balsam poplar]
dbj|BAJ91241.1|  predicted protein                                      180   1e-46    
ref|XP_010247286.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    179   1e-46    
ref|XP_011021423.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    179   1e-46    
ref|XP_007163365.1|  hypothetical protein PHAVU_001G228500g             180   1e-46    
ref|XP_010936891.1|  PREDICTED: U-box domain-containing protein 2...    179   2e-46    
ref|XP_007141935.1|  hypothetical protein PHAVU_008G238500g             179   2e-46    
ref|XP_008799715.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    178   4e-46    
ref|XP_006448117.1|  hypothetical protein CICLE_v10015253mg             177   8e-46    
gb|AFW73318.1|  immediate-early fungal elicitor protein CMPG1           178   8e-46    
ref|XP_002976407.1|  hypothetical protein SELMODRAFT_104879             177   9e-46    
ref|XP_004953855.1|  PREDICTED: U-box domain-containing protein 2...    178   9e-46    
dbj|BAK07065.1|  predicted protein                                      177   1e-45    
ref|XP_002987240.1|  hypothetical protein SELMODRAFT_125560             177   1e-45    
ref|XP_008343072.1|  PREDICTED: U-box domain-containing protein 2...    177   1e-45    
ref|XP_003558390.1|  PREDICTED: U-box domain-containing protein 2...    177   1e-45    
ref|XP_003544976.1|  PREDICTED: U-box domain-containing protein 2...    177   1e-45    
ref|XP_006410763.1|  hypothetical protein EUTSA_v10016730mg             176   1e-45    
ref|XP_010558593.1|  PREDICTED: U-box domain-containing protein 21      177   2e-45    
ref|XP_010911941.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    176   2e-45    
ref|XP_010024158.1|  PREDICTED: U-box domain-containing protein 2...    168   2e-45    
emb|CAK18856.1|  putative fungal elicitor protein CMPG1                 165   3e-45    Phillyrea latifolia
ref|XP_006469284.1|  PREDICTED: U-box domain-containing protein 2...    176   3e-45    
ref|XP_008244313.1|  PREDICTED: U-box domain-containing protein 2...    176   3e-45    
gb|KDO46582.1|  hypothetical protein CISIN_1g040073mg                   175   3e-45    
ref|XP_010911942.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    176   3e-45    
ref|XP_010912561.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    175   3e-45    
ref|XP_008350837.1|  PREDICTED: U-box domain-containing protein 2...    176   3e-45    
ref|XP_007015662.1|  U-box domain-containing protein 23                 175   5e-45    
emb|CAN66286.1|  hypothetical protein VITISV_011184                     174   5e-45    Vitis vinifera
ref|XP_002262704.2|  PREDICTED: U-box domain-containing protein 2...    174   5e-45    Vitis vinifera
gb|AEF30545.1|  CMPG                                                    175   7e-45    
ref|XP_008230336.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    174   7e-45    
ref|XP_007207682.1|  hypothetical protein PRUPE_ppa023672mg             174   7e-45    
ref|XP_008449598.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    174   9e-45    
ref|XP_002862799.1|  hypothetical protein ARALYDRAFT_920258             169   9e-45    
ref|XP_008381777.1|  PREDICTED: U-box domain-containing protein 2...    174   1e-44    
ref|XP_006387887.1|  hypothetical protein POPTR_0497s00200g             174   1e-44    
ref|XP_006424086.1|  hypothetical protein CICLE_v10028557mg             174   1e-44    
ref|XP_002513723.1|  ubiquitin-protein ligase, putative                 174   1e-44    Ricinus communis
gb|KFK36486.1|  hypothetical protein AALP_AA4G130900                    174   1e-44    
ref|XP_006847226.1|  hypothetical protein AMTR_s00017p00257160          173   1e-44    
ref|XP_002527537.1|  Spotted leaf protein, putative                     173   2e-44    Ricinus communis
ref|XP_009415651.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    173   2e-44    
emb|CDY32070.1|  BnaC04g44960D                                          173   2e-44    
ref|XP_006378430.1|  hypothetical protein POPTR_0010s11370g             174   2e-44    
ref|XP_006494889.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    173   2e-44    
ref|XP_004288606.1|  PREDICTED: U-box domain-containing protein 2...    174   2e-44    
ref|XP_009141534.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    173   2e-44    
ref|XP_009351577.1|  PREDICTED: U-box domain-containing protein 2...    173   2e-44    
ref|XP_006647860.1|  PREDICTED: U-box domain-containing protein 2...    173   3e-44    
ref|XP_004140266.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    172   3e-44    
dbj|BAD16037.1|  putative immediate-early fungal elicitor protein...    173   3e-44    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048059.2|  Os02g0738200                                       173   3e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912070.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    172   4e-44    
ref|XP_009133058.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       172   4e-44    
emb|CDX84587.1|  BnaA03g16430D                                          172   5e-44    
emb|CDY59599.1|  BnaCnng35300D                                          172   5e-44    
ref|XP_011024493.1|  PREDICTED: U-box domain-containing protein 2...    172   5e-44    
ref|XP_009408289.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    172   5e-44    
ref|XP_010931056.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    172   6e-44    
ref|XP_007152651.1|  hypothetical protein PHAVU_004G147500g             172   8e-44    
ref|XP_010541793.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    172   9e-44    
ref|XP_010665787.1|  PREDICTED: U-box domain-containing protein 2...    172   1e-43    
ref|XP_004494254.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    171   1e-43    
ref|XP_003600684.1|  U-box domain-containing protein                    171   1e-43    
ref|XP_003537115.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    171   1e-43    
ref|XP_003533316.1|  PREDICTED: U-box domain-containing protein 2...    171   2e-43    
gb|KHN08793.1|  U-box domain-containing protein 21                      171   2e-43    
ref|XP_010279125.1|  PREDICTED: U-box domain-containing protein 2...    171   2e-43    
gb|KDP34438.1|  hypothetical protein JCGZ_12798                         169   2e-43    
ref|XP_010106989.1|  E3 ubiquitin-protein ligase                        170   3e-43    
ref|XP_003530079.1|  PREDICTED: U-box domain-containing protein 2...    170   4e-43    
ref|XP_006295808.1|  hypothetical protein CARUB_v10024934mg             169   4e-43    
gb|KHN25100.1|  U-box domain-containing protein 21                      170   4e-43    
ref|XP_003522485.1|  PREDICTED: U-box domain-containing protein 2...    169   4e-43    
ref|NP_181137.2|  E3 ubiquitin-protein ligase PUB23                     169   5e-43    Arabidopsis thaliana [mouse-ear cress]
gb|KHN48421.1|  E3 ubiquitin-protein ligase PUB23                       169   5e-43    
gb|AAD21464.1|  unknown protein                                         169   5e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003518177.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    169   5e-43    
ref|XP_007145787.1|  hypothetical protein PHAVU_007G267700g             169   5e-43    
ref|XP_011021738.1|  PREDICTED: U-box domain-containing protein 2...    169   9e-43    
ref|XP_009143630.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    168   1e-42    
ref|XP_011090297.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    168   1e-42    
ref|XP_002267438.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    168   1e-42    Vitis vinifera
ref|XP_002524056.1|  Spotted leaf protein, putative                     168   1e-42    Ricinus communis
ref|XP_010260460.1|  PREDICTED: U-box domain-containing protein 2...    168   1e-42    
ref|XP_004297410.1|  PREDICTED: U-box domain-containing protein 2...    169   1e-42    
gb|KHN43656.1|  U-box domain-containing protein 20                      168   1e-42    
gb|ACU18165.1|  unknown                                                 168   2e-42    Glycine max [soybeans]
emb|CDX79645.1|  BnaC03g19810D                                          167   2e-42    
ref|XP_009348934.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    167   2e-42    
ref|NP_001238594.1|  syringolide-induced protein 13-1-1                 168   2e-42    
ref|XP_011085881.1|  PREDICTED: U-box domain-containing protein 21      168   2e-42    
ref|XP_002323382.1|  U-box domain-containing family protein             167   3e-42    Populus trichocarpa [western balsam poplar]
ref|XP_007160559.1|  hypothetical protein PHAVU_002G331800g             167   3e-42    
ref|XP_009399190.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    167   3e-42    
ref|XP_010651653.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    166   4e-42    
ref|XP_007204425.1|  hypothetical protein PRUPE_ppa1027169mg            166   4e-42    
ref|XP_003538386.1|  PREDICTED: U-box domain-containing protein 2...    167   4e-42    
emb|CDX78096.1|  BnaA09g32910D                                          166   5e-42    
ref|XP_009627928.1|  PREDICTED: U-box domain-containing protein 21      167   5e-42    
ref|XP_002881419.1|  hypothetical protein ARALYDRAFT_482563             166   6e-42    
ref|XP_011038250.1|  PREDICTED: U-box domain-containing protein 2...    167   6e-42    
ref|NP_001234240.1|  Avr9/Cf-9 rapidly elicited protein                 167   6e-42    
gb|EYU38686.1|  hypothetical protein MIMGU_mgv1a020011mg                166   7e-42    
gb|KEH24248.1|  E3 ubiquitin-protein ligase PUB23-like protein          166   7e-42    
ref|XP_002265439.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    166   7e-42    Vitis vinifera
gb|KDP25823.1|  hypothetical protein JCGZ_22545                         166   8e-42    
ref|XP_010247277.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    165   1e-41    
ref|XP_011042586.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       165   1e-41    
ref|XP_008442921.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    165   1e-41    
ref|XP_003526867.1|  PREDICTED: U-box domain-containing protein 2...    165   1e-41    
ref|XP_004502944.1|  PREDICTED: U-box domain-containing protein 2...    165   1e-41    
ref|XP_011006317.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    165   1e-41    
ref|XP_007027990.1|  Plant U-box 23                                     165   2e-41    
ref|XP_006374249.1|  hypothetical protein POPTR_0015s05380g             165   2e-41    
gb|EEE57772.1|  hypothetical protein OsJ_08312                          165   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775881.1|  predicted protein                                  165   2e-41    
gb|KDP38159.1|  hypothetical protein JCGZ_04802                         165   2e-41    
ref|XP_006372525.1|  U-box domain-containing family protein             165   2e-41    
gb|EAZ00358.1|  hypothetical protein OsI_22374                          165   2e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_002318308.2|  hypothetical protein POPTR_0012s03960g             165   2e-41    Populus trichocarpa [western balsam poplar]
emb|CAN80214.1|  hypothetical protein VITISV_017908                     165   2e-41    Vitis vinifera
ref|XP_010509533.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    164   2e-41    
ref|NP_001057289.1|  Os06g0248500                                       165   3e-41    
ref|XP_004291671.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    164   3e-41    
ref|XP_011003764.1|  PREDICTED: U-box domain-containing protein 2...    165   3e-41    
gb|KHN43695.1|  E3 ubiquitin-protein ligase PUB22                       164   3e-41    
ref|XP_010516800.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    164   3e-41    
ref|XP_002524055.1|  Spotted leaf protein, putative                     164   3e-41    
ref|XP_009115945.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       164   3e-41    
gb|ABK95813.1|  unknown                                                 164   3e-41    
ref|XP_010505120.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       164   3e-41    
ref|XP_006379784.1|  hypothetical protein POPTR_0008s13700g             164   3e-41    
gb|KCW62268.1|  hypothetical protein EUGRSUZ_H04930                     154   4e-41    
ref|XP_009789261.1|  PREDICTED: U-box domain-containing protein 2...    164   4e-41    
ref|XP_010090504.1|  E3 ubiquitin-protein ligase                        163   4e-41    
ref|XP_008375014.1|  PREDICTED: U-box domain-containing protein 2...    164   4e-41    
ref|XP_010927379.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    164   5e-41    
gb|KCW57799.1|  hypothetical protein EUGRSUZ_H00556                     164   5e-41    
emb|CDX84168.1|  BnaC04g09300D                                          163   6e-41    
ref|XP_004299506.1|  PREDICTED: U-box domain-containing protein 2...    164   6e-41    
ref|XP_006854618.1|  hypothetical protein AMTR_s00030p00159240          163   6e-41    
gb|ABK25393.1|  unknown                                                 163   6e-41    
ref|XP_004136517.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    163   6e-41    
ref|XP_009337706.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    163   7e-41    
ref|XP_009368334.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    163   7e-41    
gb|KHN24150.1|  U-box domain-containing protein 20                      163   8e-41    
gb|EYU30866.1|  hypothetical protein MIMGU_mgv1a026315mg                164   8e-41    
ref|XP_007209132.1|  hypothetical protein PRUPE_ppa005659mg             164   8e-41    
gb|ADI46216.1|  CMPG1a                                                  163   9e-41    
ref|XP_008365622.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    162   1e-40    
emb|CDP15556.1|  unnamed protein product                                162   1e-40    
ref|XP_008391980.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    162   1e-40    
ref|XP_011046430.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    162   1e-40    
ref|XP_009360045.1|  PREDICTED: U-box domain-containing protein 2...    163   1e-40    
ref|XP_011078792.1|  PREDICTED: U-box domain-containing protein 2...    161   1e-40    
emb|CDX95337.1|  BnaC04g28210D                                          162   1e-40    
ref|XP_011022933.1|  PREDICTED: U-box domain-containing protein 2...    162   2e-40    
emb|CDP10593.1|  unnamed protein product                                162   2e-40    
ref|XP_006403803.1|  hypothetical protein EUTSA_v10010389mg             162   2e-40    
ref|XP_008367613.1|  PREDICTED: U-box domain-containing protein 2...    162   2e-40    
gb|KDP37425.1|  hypothetical protein JCGZ_07952                         162   2e-40    
ref|XP_010069442.1|  PREDICTED: U-box domain-containing protein 2...    162   2e-40    
ref|XP_006481860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    161   3e-40    
ref|XP_010062299.1|  PREDICTED: U-box domain-containing protein 2...    162   3e-40    
ref|XP_002533474.1|  E3 ubiquitin ligase PUB14, putative                161   4e-40    
ref|XP_006362641.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    160   4e-40    
ref|XP_008799744.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    160   4e-40    
ref|XP_011099937.1|  PREDICTED: U-box domain-containing protein 2...    161   5e-40    
ref|XP_007150019.1|  hypothetical protein PHAVU_005G119100g             160   5e-40    
ref|XP_006430056.1|  hypothetical protein CICLE_v10011847mg             160   6e-40    
ref|XP_009136678.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    160   7e-40    
ref|XP_010931057.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    160   7e-40    
ref|XP_011089213.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    160   7e-40    
ref|XP_010551422.1|  PREDICTED: U-box domain-containing protein 21      160   8e-40    
ref|XP_009803459.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    160   8e-40    
ref|XP_009343248.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       160   8e-40    
gb|KFK34491.1|  hypothetical protein AALP_AA5G152500                    160   1e-39    
ref|XP_007027987.1|  Plant U-box 24                                     159   1e-39    
ref|XP_009356001.1|  PREDICTED: U-box domain-containing protein 2...    160   1e-39    
ref|XP_010051664.1|  PREDICTED: uncharacterized protein LOC104440434    160   2e-39    
ref|XP_009383562.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    159   2e-39    
ref|XP_006364055.1|  PREDICTED: U-box domain-containing protein 2...    159   2e-39    
ref|XP_010426860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       159   2e-39    
ref|XP_011047794.1|  PREDICTED: U-box domain-containing protein 2...    159   2e-39    
ref|XP_011094237.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    158   3e-39    
ref|XP_008240411.1|  PREDICTED: U-box domain-containing protein 2...    159   3e-39    
gb|KDO51673.1|  hypothetical protein CISIN_1g015728mg                   158   3e-39    
ref|XP_006432191.1|  hypothetical protein CICLE_v10001406mg             158   3e-39    
ref|XP_011043911.1|  PREDICTED: U-box domain-containing protein 21      159   3e-39    
ref|XP_010515711.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    159   3e-39    
ref|XP_006465012.1|  PREDICTED: U-box domain-containing protein 2...    158   4e-39    
ref|XP_007224745.1|  hypothetical protein PRUPE_ppa024359mg             159   4e-39    
ref|XP_009593988.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    157   5e-39    
gb|EPS57434.1|  hypothetical protein M569_17384                         157   6e-39    
ref|XP_003602626.1|  U-box domain-containing protein                    157   6e-39    
emb|CDY23218.1|  BnaA04g05410D                                          157   6e-39    
ref|XP_010526330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22       157   9e-39    
ref|XP_007203251.1|  hypothetical protein PRUPE_ppa019526mg             156   1e-38    
ref|XP_006286021.1|  hypothetical protein CARUB_v10007551mg             157   2e-38    
gb|KDP33049.1|  hypothetical protein JCGZ_13635                         156   2e-38    
gb|KDO70622.1|  hypothetical protein CISIN_1g041408mg                   156   2e-38    
ref|XP_008241067.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    155   2e-38    
ref|XP_010038928.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    155   2e-38    
ref|XP_004251095.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    155   2e-38    
ref|XP_006362850.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    155   4e-38    
ref|XP_010036593.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       155   4e-38    
ref|XP_008220933.1|  PREDICTED: U-box domain-containing protein 2...    155   4e-38    
ref|XP_010024549.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    154   5e-38    
ref|XP_002305224.1|  U-box domain-containing family protein             155   6e-38    
ref|XP_002308324.2|  hypothetical protein POPTR_0006s21920g             154   7e-38    
ref|XP_003575089.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       154   7e-38    
ref|XP_009140157.1|  PREDICTED: U-box domain-containing protein 2...    154   1e-37    
ref|XP_010685444.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23       154   1e-37    
ref|XP_008793948.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    153   1e-37    
gb|KHN39481.1|  U-box domain-containing protein 20                      153   1e-37    
ref|XP_002323383.1|  U-box domain-containing family protein             153   2e-37    
ref|XP_008460887.1|  PREDICTED: U-box domain-containing protein 2...    153   2e-37    
ref|XP_008241066.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       153   2e-37    
ref|XP_004303406.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    153   2e-37    
ref|XP_003531998.1|  PREDICTED: U-box domain-containing protein 2...    152   2e-37    
ref|XP_007162975.1|  hypothetical protein PHAVU_001G196000g             153   2e-37    
ref|NP_198565.1|  U-box domain-containing protein 21                    153   2e-37    
ref|XP_011077807.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    152   2e-37    
ref|XP_009383555.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    152   3e-37    
ref|XP_002299771.2|  hypothetical protein POPTR_0001s22390g             152   3e-37    
gb|EYU30497.1|  hypothetical protein MIMGU_mgv1a007556mg                152   3e-37    
ref|XP_010685445.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    153   4e-37    
gb|ACJ84268.1|  unknown                                                 150   5e-37    
ref|XP_009139452.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    152   5e-37    
gb|KHN36501.1|  E3 ubiquitin-protein ligase PUB23                       151   5e-37    
ref|XP_002447815.1|  hypothetical protein SORBIDRAFT_06g016280          151   6e-37    
ref|XP_003543414.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    151   6e-37    
ref|XP_007045491.1|  ARM repeat superfamily protein, putative           152   6e-37    
gb|EEE58669.1|  hypothetical protein OsJ_10087                          151   8e-37    
ref|XP_011046429.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       151   9e-37    
ref|XP_010553861.1|  PREDICTED: U-box domain-containing protein 2...    151   9e-37    
ref|XP_010059046.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    151   9e-37    
ref|XP_010024581.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    150   1e-36    
ref|XP_004497654.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    151   1e-36    
ref|XP_007150020.1|  hypothetical protein PHAVU_005G119200g             151   1e-36    
ref|XP_002877862.1|  U-box domain-containing protein                    151   1e-36    
dbj|BAJ97280.1|  predicted protein                                      150   1e-36    
emb|CAN82979.1|  hypothetical protein VITISV_023329                     149   1e-36    
ref|XP_004975598.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    151   1e-36    
gb|ADI46217.1|  CMPG1b                                                  151   2e-36    
ref|XP_010440861.1|  PREDICTED: U-box domain-containing protein 2...    150   2e-36    
dbj|BAJ93921.1|  predicted protein                                      150   2e-36    
ref|XP_006378980.1|  hypothetical protein POPTR_0009s021501g            147   2e-36    
gb|EAZ15153.1|  hypothetical protein OsJ_30569                          151   2e-36    
ref|XP_010024590.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    150   2e-36    
ref|XP_006348455.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    150   2e-36    
ref|XP_010677540.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    150   2e-36    
ref|XP_008379758.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    150   2e-36    
gb|EMT16670.1|  U-box domain-containing protein 23                      150   2e-36    
ref|XP_006494890.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    150   2e-36    
dbj|BAK00297.1|  predicted protein                                      150   3e-36    
gb|KCW87327.1|  hypothetical protein EUGRSUZ_B03814                     150   3e-36    
ref|XP_010090837.1|  U-box domain-containing protein 25                 149   3e-36    
ref|XP_007015663.1|  Plant U-box 24, putative                           149   3e-36    
emb|CAH68357.1|  H0723C07.7                                             149   4e-36    
ref|XP_008645759.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    149   4e-36    
ref|XP_010045173.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    149   4e-36    
ref|XP_004959995.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    149   5e-36    
ref|XP_010450507.1|  PREDICTED: U-box domain-containing protein 2...    149   7e-36    
ref|NP_001054324.1|  Os04g0686000                                       148   7e-36    
gb|KEH41883.1|  E3 ubiquitin-protein ligase PUB23-like protein          148   1e-35    
gb|EMT15255.1|  U-box domain-containing protein 22                      148   1e-35    
ref|XP_011021424.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    147   1e-35    
ref|XP_006348456.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    147   1e-35    
gb|EMS67443.1|  E3 ubiquitin-protein ligase PUB22                       148   1e-35    
ref|XP_003517356.1|  PREDICTED: U-box domain-containing protein 3...    148   2e-35    
emb|CDY27655.1|  BnaUnng00050D                                          148   2e-35    
ref|XP_009586788.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    147   2e-35    
emb|CDP20283.1|  unnamed protein product                                148   2e-35    
ref|XP_004228461.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    147   2e-35    
ref|XP_002868523.1|  U-box domain-containing protein                    147   2e-35    
emb|CBI24432.3|  unnamed protein product                                146   3e-35    
ref|XP_004511816.1|  PREDICTED: U-box domain-containing protein 3...    147   3e-35    
ref|XP_004952676.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    147   3e-35    
ref|XP_004228871.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    146   3e-35    
ref|XP_002453950.1|  hypothetical protein SORBIDRAFT_04g022070          146   4e-35    
ref|XP_003554464.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    146   4e-35    
ref|XP_002453951.1|  hypothetical protein SORBIDRAFT_04g022080          146   4e-35    
ref|XP_007145788.1|  hypothetical protein PHAVU_007G267800g             146   4e-35    
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 1...    149   5e-35    
dbj|BAJ90807.1|  predicted protein                                      146   5e-35    
gb|KEH41882.1|  E3 ubiquitin-protein ligase PUB23-like protein          146   5e-35    
ref|XP_008441961.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    145   8e-35    
ref|XP_008351505.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    145   9e-35    
ref|XP_008391979.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24       145   1e-34    
ref|XP_003540288.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    145   1e-34    
ref|XP_004984736.1|  PREDICTED: protein spotted leaf 11-like isof...    147   1e-34    
ref|XP_010528570.1|  PREDICTED: U-box domain-containing protein 21      145   1e-34    
gb|KHN36500.1|  E3 ubiquitin-protein ligase PUB23                       145   1e-34    
ref|XP_004147551.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    144   1e-34    
ref|XP_003543415.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    144   2e-34    
ref|XP_010036594.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    144   2e-34    
gb|KGN53961.1|  hypothetical protein Csa_4G194780                       144   2e-34    
gb|KHN13011.1|  U-box domain-containing protein 30                      145   2e-34    
ref|XP_002887012.1|  hypothetical protein ARALYDRAFT_894250             144   2e-34    
gb|KEH41885.1|  E3 ubiquitin-protein ligase PUB23-like protein          144   2e-34    
gb|AFW85163.1|  hypothetical protein ZEAMMB73_111784                    144   2e-34    
ref|XP_006362629.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    144   3e-34    
ref|XP_003554468.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...    144   3e-34    
emb|CDP04681.1|  unnamed protein product                                143   3e-34    
ref|XP_004163666.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    143   3e-34    
ref|XP_003539260.2|  PREDICTED: U-box domain-containing protein 3...    145   4e-34    
ref|XP_010273225.1|  PREDICTED: U-box domain-containing protein 30      144   4e-34    
gb|KHN10042.1|  E3 ubiquitin-protein ligase PUB24                       143   4e-34    
ref|NP_564866.1|  ubiquitin-protein ligase CMPG1                        144   4e-34    
gb|ACU20925.1|  unknown                                                 143   5e-34    
ref|XP_003540819.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    143   5e-34    
gb|AFK36951.1|  unknown                                                 137   5e-34    
ref|XP_008659061.1|  PREDICTED: U-box domain-containing protein 2...    144   6e-34    
gb|ABA59556.1|  U-box protein                                           142   6e-34    
ref|XP_007132499.1|  hypothetical protein PHAVU_011G099300g             142   8e-34    
ref|XP_003596890.1|  U-box domain-containing protein                    142   8e-34    
gb|KHN17980.1|  E3 ubiquitin-protein ligase PUB23                       142   9e-34    
gb|AAM64969.1|  unknown                                                 142   9e-34    
gb|KDP36106.1|  hypothetical protein JCGZ_08750                         142   9e-34    
emb|CDX99694.1|  BnaC04g34510D                                          142   9e-34    
gb|EAY86187.1|  hypothetical protein OsI_07564                          142   1e-33    
gb|EAZ23391.1|  hypothetical protein OsJ_07085                          133   1e-33    
gb|AFK36543.1|  unknown                                                 139   1e-33    
gb|KCW72083.1|  hypothetical protein EUGRSUZ_E00528                     133   1e-33    
ref|XP_004303404.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    142   1e-33    
ref|XP_007207476.1|  hypothetical protein PRUPE_ppa006455mg             142   1e-33    
ref|XP_008230326.1|  PREDICTED: E3 ubiquitin-protein ligase PUB24...    141   1e-33    
ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13      144   2e-33    
ref|XP_010415159.1|  PREDICTED: U-box domain-containing protein 2...    142   2e-33    
ref|XP_002465578.1|  hypothetical protein SORBIDRAFT_01g041450          142   2e-33    
gb|EYU36030.1|  hypothetical protein MIMGU_mgv1a025656mg                141   2e-33    
gb|EPS68981.1|  hypothetical protein M569_05787                         144   2e-33    
gb|EYU28510.1|  hypothetical protein MIMGU_mgv1a007216mg                141   2e-33    
ref|XP_006466465.1|  PREDICTED: U-box domain-containing protein 3...    142   2e-33    
ref|XP_006426094.1|  hypothetical protein CICLE_v10025589mg             142   2e-33    
gb|KDO78935.1|  hypothetical protein CISIN_1g041252mg                   141   3e-33    
ref|XP_009793570.1|  PREDICTED: U-box domain-containing protein 2...    140   3e-33    
ref|XP_008647602.1|  PREDICTED: uncharacterized protein LOC100502...    144   3e-33    
ref|XP_002267145.2|  PREDICTED: U-box domain-containing protein 30      141   4e-33    
tpg|DAA44667.1|  TPA: putative ARM repeat-containing protein cont...    144   4e-33    
ref|XP_009760074.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...    140   5e-33    



>ref|XP_004230770.1| PREDICTED: U-box domain-containing protein 26-like [Solanum lycopersicum]
Length=415

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/416 (84%), Positives = 389/416 (94%), Gaps = 1/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MPASLDPLDVG +QIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPASLDPLDVG-VQIPYHFRCPISLELMRDPVTVCTGQTYDRQSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP LV+SLL+QA++ S+H+N
Sbjct  60    APLSDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPSLVRSLLNQAAAQSNHMN  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SR++ALRRLRGLARDS+KNRSVISANNAR++LL+IVFS MDS++SEL HE+L+ILSMF L
Sbjct  120   SRVAALRRLRGLARDSEKNRSVISANNAREILLAIVFSRMDSDASELHHESLAILSMFPL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE ECVFVASD  RVGYLV++L HPSIDVRVNSAALIE+VVAG +SPE R+QISNAD++F
Sbjct  180   SEPECVFVASDPGRVGYLVAMLFHPSIDVRVNSAALIETVVAGMRSPEFRAQISNADDVF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G+VGILN+P  +PRALK+G+KALFALCLVKQHRQ+AV AGAVEALI+RLQ  EKCD ER
Sbjct  240   EGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQRAVSAGAVEALIDRLQDFEKCDAER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELL RIPSGCAA A+HALTVPLLVKIILKIS+RATEYAAGALLSLCS+SEQAQ++
Sbjct  300   ALATIELLSRIPSGCAALASHALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQKE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AVAAGVL QLLLLVQS CTERAKRKAQMLLK LRDCWP+DSI N+DDFA SDVV F
Sbjct  360   AVAAGVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANTDDFACSDVVPF  415



>ref|XP_006346399.1| PREDICTED: U-box domain-containing protein 26-like [Solanum tuberosum]
Length=415

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/416 (84%), Positives = 386/416 (93%), Gaps = 1/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SLDPLDVG +QIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWVATGN TCPVTR
Sbjct  1     MPGSLDPLDVG-VQIPYHFRCPISLELMRDPVTVCTGQTYDRQSIESWVATGNITCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP LV+SLL+QA++ S+H+N
Sbjct  60    APLSDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPSLVRSLLNQAAAQSNHMN  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SR++ALRRLRGLARDSDKNRSVISANNAR++LL+IVFS MDS+SSEL HE+L+ILSMF L
Sbjct  120   SRVAALRRLRGLARDSDKNRSVISANNAREILLAIVFSRMDSDSSELNHESLAILSMFPL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE ECVFVASD +RV YLV++L HPSIDVRVNSAALIE VVAG +S ELR+QISNAD++F
Sbjct  180   SEPECVFVASDPERVSYLVAMLFHPSIDVRVNSAALIEIVVAGMRSSELRAQISNADDVF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G+VGILN+P  +PRALK+G+KALFALCLVKQHRQ+AV AGAVEALI+RLQ  EKCD ER
Sbjct  240   EGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQRAVTAGAVEALIDRLQDFEKCDAER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELL RIPSGCAA A+HALTVPLLVKIILKIS+RATEYAAGALLSLCS+SEQAQ++
Sbjct  300   ALATIELLSRIPSGCAALASHALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQKE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AVAAGVL QLLLLVQS CTERAKRKAQMLLK LRDCWP+DSI NSDDFA SDVV F
Sbjct  360   AVAAGVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANSDDFACSDVVPF  415



>ref|XP_011092561.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/416 (82%), Positives = 380/416 (91%), Gaps = 1/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MPASL+PLDVG +QIPYHFRCPISLELMRDPVTVCTGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPASLEPLDVG-VQIPYHFRCPISLELMRDPVTVCTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPADPGLV++LL+QASS S   +
Sbjct  60    VPLTDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPADPGLVRTLLAQASSGSGSYS  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              R+SALRRLRGLARDSDKNRSVI+ANNAR+VLLSI FS++ S SS+L HEAL++LSMF L
Sbjct  120   MRVSALRRLRGLARDSDKNRSVIAANNAREVLLSIAFSDVGSESSDLNHEALAVLSMFAL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE EC+FVAS+ +RVGYLV LL H S+D+RVNSAA+IE+VVAG +S ELR+QIS+AD +F
Sbjct  180   SEPECLFVASESERVGYLVKLLFHSSVDIRVNSAAVIETVVAGIRSSELRAQISSADGVF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GIVGILN+P  +PRALK+G+KALFALCLVKQHR KAV AGAVEALI+RL   EKCD+ER
Sbjct  240   EGIVGILNYPLVYPRALKIGIKALFALCLVKQHRHKAVAAGAVEALIDRLPEFEKCDSER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIPSGCAAF +HALTVPLLVKIILKISDRATEYAAGALLSLCS+SE+AQ D
Sbjct  300   ALATVELLCRIPSGCAAFESHALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQAD  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AVAAGVLTQLLLLVQS CTERAKRKAQMLLKLLRD WP DSI  SDDFA SDVV F
Sbjct  360   AVAAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPRDSIARSDDFAGSDVVPF  415



>ref|XP_009627648.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
tomentosiformis]
Length=417

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/417 (82%), Positives = 380/417 (91%), Gaps = 2/417 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             +P SLDPLDVG +QIPY+FRCPISLELM+DPVTVCTGQTYDR SIESWVATGN+TCPVTR
Sbjct  2     LPGSLDPLDVG-VQIPYYFRCPISLELMQDPVTVCTGQTYDRQSIESWVATGNSTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             +PL+DF+LI NHTLRRLIQ+WCVANRAFGVERIPTPKQPADP LV+SLL+QA++ S+HL 
Sbjct  61    SPLSDFSLISNHTLRRLIQDWCVANRAFGVERIPTPKQPADPVLVRSLLNQAAAESNHLK  120

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLRGLARDSDKNRSVISANNAR++LLSIVF  MDS+SSEL HE+L+ILSMF L
Sbjct  121   SRLSALRRLRGLARDSDKNRSVISANNAREILLSIVFFRMDSDSSELNHESLAILSMFPL  180

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE EC FVASD DRV YLVSLL HPSIDVRVNSAALIE VVAG +S ELR+QISN D++F
Sbjct  181   SEGECFFVASDPDRVSYLVSLLFHPSIDVRVNSAALIEVVVAGIRSSELRAQISNIDDVF  240

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G+VGILN+P  +PRALK+G+KALFALCLVKQHRQKAV AGAVEALI+RLQ  EKCD ER
Sbjct  241   EGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDAER  300

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELL RIPSGCAA A+HALTVPLLVK ILK+S+RATEYAAGALLSLC +SEQAQ++
Sbjct  301   ALATIELLARIPSGCAALASHALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQKE  360

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDD-FARSDVVQF  1474
             AVAAGVLTQLLLLVQS CT+RAKRKAQMLLK LRDCWP++S  NSDD FA SDVV F
Sbjct  361   AVAAGVLTQLLLLVQSDCTDRAKRKAQMLLKQLRDCWPEESTANSDDYFAYSDVVPF  417



>ref|XP_011088242.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/416 (80%), Positives = 377/416 (91%), Gaps = 1/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G +QIPYHFRCPISLELM DPVTVCTGQTYDR+SIE+WVATGNTTCPVTR
Sbjct  1     MPGSLEPLDIG-VQIPYHFRCPISLELMSDPVTVCTGQTYDRSSIEAWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQ+WCVANR+FG+ERIPTPKQPADP LV++LL+QASS S   +
Sbjct  60    VPLTDFTLIPNHTLRRLIQDWCVANRSFGIERIPTPKQPADPMLVRTLLNQASSGSGPFS  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              R+SALRRLRGLARDSDKNRSVI+ANNAR++LLSIVF+++ S  SEL  E+L+ILSMF L
Sbjct  120   FRVSALRRLRGLARDSDKNRSVIAANNAREILLSIVFADVSSEPSELNLESLAILSMFTL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE EC++VASD DRV YLV+LL H SIDVRVNSAA+IE VVAG +SPELR QIS+AD +F
Sbjct  180   SEPECLYVASDADRVRYLVNLLFHSSIDVRVNSAAMIEIVVAGIRSPELRVQISSADGVF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GIVGILN+P  + RALK+G+KALFALCLVKQHRQKAV AGAVEALI++L   EKCD ER
Sbjct  240   EGIVGILNYPLLYSRALKIGIKALFALCLVKQHRQKAVAAGAVEALIDKLAEFEKCDAER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIPSGCAAFA+HALTVPLLVKIILKISDRATEYAAGALLSLCS+SE+AQ++
Sbjct  300   ALATVELLCRIPSGCAAFASHALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQQE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AVAAGVLTQLLLLVQS CTERAKRKAQMLLKLLR+ WP DS+ NSDD+A SDVV F
Sbjct  360   AVAAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRNSWPHDSLANSDDYAGSDVVPF  415



>ref|XP_010107920.1| U-box domain-containing protein 26 [Morus notabilis]
 gb|EXC17320.1| U-box domain-containing protein 26 [Morus notabilis]
Length=416

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/414 (78%), Positives = 366/414 (88%), Gaps = 1/414 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPADP +V+SLL+QASS S+   
Sbjct  60    APLTDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPADPAMVRSLLTQASSESTPAP  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +RLSALRRLRGLARDSDKNRSVIS+ N+R+VLL IVF+   S+SSEL+ EAL++  MF  
Sbjct  120   TRLSALRRLRGLARDSDKNRSVISSLNSREVLLDIVFAGASSDSSELSREALAVAVMFPF  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE EC  VAS+ DRV YL  LL H SIDVRVNSAA+IE VVAGT++PELRSQISN DEIF
Sbjct  180   SEIECAAVASEPDRVAYLTRLLFHSSIDVRVNSAAMIEIVVAGTRTPELRSQISNVDEIF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G++ IL  P  +PRALK+G+KALFA+CLVKQ R KA+ AGA E LI+RL   EKCD ER
Sbjct  240   EGVIEILRSPIAYPRALKVGIKALFAMCLVKQTRHKAIAAGAAEILIDRLADFEKCDAER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIP+GC+A AAHALTVPLLVKIILKISDRATEYAAGAL+SLCS+SEQ+QR+
Sbjct  300   ALATVELLCRIPAGCSALAAHALTVPLLVKIILKISDRATEYAAGALVSLCSASEQSQRE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAG+LTQLLLLVQS CT+RAKRKAQ+LLKLLRD WP+DSI NSDDFA S+VV
Sbjct  360   AVAAGILTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSIRNSDDFACSEVV  413



>gb|EPS57772.1| hypothetical protein M569_17045 [Genlisea aurea]
Length=414

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/414 (78%), Positives = 368/414 (89%), Gaps = 1/414 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+ LDVG IQIPYHFRCPISLELMRDPVTVCTGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPGSLESLDVG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQ+WCVAN +FGVERIPTPKQPADP LVQSLL++ASS S +L 
Sbjct  60    TPLTDFTLIPNHTLRRLIQDWCVANHSFGVERIPTPKQPADPILVQSLLNRASSGSGNLL  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SR+SALRRLRGLARDS+KNRSVI+ANN RQV +S++F+ + S  SEL  E+L ILSMF L
Sbjct  120   SRVSALRRLRGLARDSEKNRSVIAANNGRQVFISLLFAGVGSEPSELNLESLGILSMFSL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E EC+++ASDLDRV YLV+LL H SIDVRVNSAA++E  VAG +SPELR++IS+ D +F
Sbjct  180   LEQECLYIASDLDRVRYLVNLLFHSSIDVRVNSAAVVEVTVAGIRSPELRARISSLDGVF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GIVGILN+P  +P ALK+G+KALFALCL KQHR +AV AGAVE+LI+RL   EKCD ER
Sbjct  240   RGIVGILNYPLAYPHALKIGIKALFALCLAKQHRHRAVSAGAVESLIDRLAEFEKCDAER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCR+P GCAAFA+HALTVPLLVKIILKISDRATEYAAGALLSLCS+SEQ+Q +
Sbjct  300   ALATVELLCRVPDGCAAFASHALTVPLLVKIILKISDRATEYAAGALLSLCSASEQSQGE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQL+LLVQS CTERAKRKAQMLLKLLR+ WP +S+ NSDDFA SDVV
Sbjct  360   AVAAGVLTQLILLVQSDCTERAKRKAQMLLKLLRNSWPLESMCNSDDFAGSDVV  413



>gb|KDP32265.1| hypothetical protein JCGZ_14786 [Jatropha curcas]
Length=416

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/417 (76%), Positives = 371/417 (89%), Gaps = 2/417 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MPASL+PLD+  +Q+PYHFRCPISLELMRDPVTV TGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPASLEPLDLS-VQVPYHFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPA+P LV+SLL+QASS S+   
Sbjct  60    VPLTDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPAEPSLVRSLLNQASSESNLYQ  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSN-MDSNSSELTHEALSILSMFQ  763
             SRLSALRRLRGLARDSDKNRSVIS++NAR+V +++VF+N  DSNSS+L HEAL++L MF 
Sbjct  120   SRLSALRRLRGLARDSDKNRSVISSHNAREVFINLVFANCTDSNSSDLNHEALALLIMFP  179

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             LSE++CV +ASD  R+ YLV+LL H SI+VRVNSAALIE VVAGTKS +LR+QIS+ DEI
Sbjct  180   LSESDCVCIASDSGRINYLVNLLFHISIEVRVNSAALIEIVVAGTKSSDLRAQISSVDEI  239

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
             F+G++ +L +P ++PRALK+G+KALFALCLVKQ R KAV AGA + LI+RL   +KCD E
Sbjct  240   FEGVIEMLKNPISYPRALKIGIKALFALCLVKQTRHKAVSAGAADILIDRLADFDKCDAE  299

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALAT+ELLCR+P+GC AFA HALTVPLLVK ILKISDRATEYAAGALL+LC+SSEQ+QR
Sbjct  300   RALATIELLCRVPTGCTAFAGHALTVPLLVKKILKISDRATEYAAGALLALCTSSEQSQR  359

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             +AV+AG+LTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DS  NSDDF  S+VV F
Sbjct  360   EAVSAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSSANSDDFICSEVVPF  416



>ref|XP_009792112.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
sylvestris]
Length=415

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/417 (82%), Positives = 380/417 (91%), Gaps = 3/417 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SLDPLDVG +QIPY+FRCPISLELM+DPVTVCTGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSLDPLDVG-VQIPYYFRCPISLELMQDPVTVCTGQTYDRQSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DF+LI NHTLRRLIQ+WCVANRAFGVERIPTPKQPADP LV+SLL+QA++ S+HL 
Sbjct  60    APLSDFSLISNHTLRRLIQDWCVANRAFGVERIPTPKQPADPVLVRSLLNQAAAESNHLK  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSAL+RLRGLARDSDKNRSVISANNAR++LLSIVF  MDS+SSEL HE+L++LS+F L
Sbjct  120   SRLSALKRLRGLARDSDKNRSVISANNAREILLSIVFYRMDSDSSELNHESLALLSLFPL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE EC FVASD DRV YLVSLL HPSIDVRVNSAALIE VVAG +S ELR+QIS+ D++F
Sbjct  180   SEGECFFVASDPDRVSYLVSLLFHPSIDVRVNSAALIEVVVAGIRS-ELRAQISSIDDVF  238

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G+VGILN+P  +PRALK+G+KALFALCLVKQHRQKAV AGAVEALI+RLQ  EKCD ER
Sbjct  239   EGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDAER  298

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELL RIPSGCAA A+HALTVPLLVK ILK+S+RATEYAAGALLSLC +SEQAQ++
Sbjct  299   ALATIELLSRIPSGCAALASHALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQKE  358

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDD-FARSDVVQF  1474
             A AAGVLTQLLLLVQS CTERAKRKAQ+LLK LRDCWP+DSI NSDD FA SDVV F
Sbjct  359   AAAAGVLTQLLLLVQSDCTERAKRKAQLLLKQLRDCWPEDSIANSDDYFAYSDVVPF  415



>ref|XP_007042451.1| Plant U-box 26 [Theobroma cacao]
 gb|EOX98282.1| Plant U-box 26 [Theobroma cacao]
Length=416

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/416 (75%), Positives = 368/416 (88%), Gaps = 0/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP S +PLD+ G+Q+PYHFRCPISLELMRDPVTV TGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSREPLDLVGVQVPYHFRCPISLELMRDPVTVSTGQTYDRTSIESWVATGNTTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFT IPNHTLRRLIQ+WCVAN+AFG+ERIPTPKQPA+P +V+SLL+QASSVS+   
Sbjct  61    APLSDFTFIPNHTLRRLIQDWCVANQAFGIERIPTPKQPAEPTVVRSLLNQASSVSNPFQ  120

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRL+GLARDSDKNRSVIS++NAR++L++IVFS+  S SSEL  EAL++L MFQL
Sbjct  121   SRLSALRRLKGLARDSDKNRSVISSHNAREILINIVFSDTGSGSSELNQEALALLVMFQL  180

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E+EC  +ASD ++V YL  LL H SI+VRVNSA+LIE VVAGT+S +LR+QISN DEIF
Sbjct  181   TESECASIASDSNKVIYLSKLLFHSSIEVRVNSASLIEIVVAGTRSSDLRAQISNVDEIF  240

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G+  +L + +++PRALK+ ++ALFALCLVKQ R KAV AGA E LI+RL  L+KCD ER
Sbjct  241   EGVTDLLKNLNSYPRALKISIRALFALCLVKQTRHKAVQAGAAETLIDRLADLDKCDAER  300

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCRIPSGC+AFAAHALTVPLLVK ILKISDRATE++AGAL++LCS SEQ+QRD
Sbjct  301   ALATIELLCRIPSGCSAFAAHALTVPLLVKTILKISDRATEHSAGALVALCSESEQSQRD  360

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV+AG+LTQLLLLVQS CT+RAKRKAQ LLKLLRD WP+DSI NSDDFA S+VV F
Sbjct  361   AVSAGILTQLLLLVQSDCTDRAKRKAQTLLKLLRDSWPEDSIGNSDDFACSEVVPF  416



>emb|CDO97189.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/416 (80%), Positives = 374/416 (90%), Gaps = 4/416 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             M  SL+PLDVG +QIPY+FRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR
Sbjct  1     MRGSLEPLDVG-VQIPYYFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNHTLRRLIQ+WCVANR+FG+ERIPTPKQPADP LV+SLL QASS S+   
Sbjct  60    APLTDFTLIPNHTLRRLIQDWCVANRSFGIERIPTPKQPADPALVRSLLHQASSASALPA  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLR LARDSDKNR++ISANN  ++LLS+VF    S+S++L+HEAL++L++FQL
Sbjct  120   SRLSALRRLRALARDSDKNRALISANNVSELLLSVVFH---SDSADLSHEALALLALFQL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE +C  VASD DRV YLVSLLSH S+DVRVNSAA+IE  V+GT+SPELRSQ+SNA+ IF
Sbjct  177   SEPQCALVASDPDRVSYLVSLLSHSSVDVRVNSAAVIEMAVSGTRSPELRSQVSNAEGIF  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G++GILN+P  +PRA K+GVKALFALCLVKQHRQ+AV AGAV+AL++ L   EKCD ER
Sbjct  237   EGVIGILNYPLAYPRASKIGVKALFALCLVKQHRQRAVTAGAVDALVDGLADFEKCDAER  296

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIPSGC AF+AHALTVPLLVKIILKISDRATEYAAGALLSLCS+S+QAQRD
Sbjct  297   ALATVELLCRIPSGCEAFSAHALTVPLLVKIILKISDRATEYAAGALLSLCSASDQAQRD  356

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV AGVLTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DSI NSDDF  SDVV F
Sbjct  357   AVVAGVLTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSIGNSDDFGCSDVVAF  412



>ref|XP_010263503.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=416

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/417 (77%), Positives = 358/417 (86%), Gaps = 2/417 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLDV  +QIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDVA-VQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DF LIPNHTLRRLIQ+WCVANR+ GVERIPTPKQPADP LV+ LL QASS S+  +
Sbjct  60    APLSDFILIPNHTLRRLIQDWCVANRSLGVERIPTPKQPADPALVRDLLVQASSNSTPPH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSS-ELTHEALSILSMFQ  763
             SRLSALRRLRGLA+DSDKNRS+IS +N  +VLL IVF+  +SN + ELTHE+L++L MF 
Sbjct  120   SRLSALRRLRGLAKDSDKNRSLISTHNVPEVLLPIVFAGPESNENDELTHESLALLVMFP  179

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             L EA C FVAS+ DRV +L  LLSH  I+VRVN+AALIE VVAGT+S E R  I NAD +
Sbjct  180   LDEAHCEFVASETDRVAFLSFLLSHSCIEVRVNAAALIEMVVAGTRSLENRILIGNADGV  239

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
              +GI  ILNHP  +PRALK+G+KALFALCLVKQ+R  AV AGAVEALI++L   EKCD E
Sbjct  240   LEGITRILNHPLAYPRALKVGIKALFALCLVKQNRHMAVSAGAVEALIDKLADFEKCDAE  299

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALATVELLCRIP+G +AFA HALTVPLLVKIILKISDRATEYA GAL+SLCS+SEQ QR
Sbjct  300   RALATVELLCRIPAGRSAFAEHALTVPLLVKIILKISDRATEYATGALVSLCSASEQLQR  359

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             DAVAAGV+TQLLLLVQS CTERAKRKAQ+LLKLLRD WP+DSI NSDDFA SDV  F
Sbjct  360   DAVAAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSIANSDDFACSDVAPF  416



>ref|XP_002285110.1| PREDICTED: U-box domain-containing protein 26 [Vitis vinifera]
Length=415

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/416 (76%), Positives = 367/416 (88%), Gaps = 1/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLDVG +QIPYHFRCPISLELM DPVTV TGQTYDRASIE WV TGNTTCPVTR
Sbjct  1     MPGSLEPLDVG-VQIPYHFRCPISLELMCDPVTVSTGQTYDRASIEYWVGTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             + LTDFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPADP  V+SL +Q SS S+  +
Sbjct  60    SSLTDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPADPASVRSLQTQVSSQSNPSH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +RLSA++RLRGLARDSDKNRS+I ++N ++VLL ++FS+ + +S+EL HE+L++L MF L
Sbjct  120   TRLSAVKRLRGLARDSDKNRSIIGSHNVQEVLLPVIFSDSECDSAELKHESLALLVMFPL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE+EC FVAS  DRV +LVSLL H SI+VRVNSAALIE VVAGT+S +LR+QISN DEIF
Sbjct  180   SESECAFVASQPDRVAHLVSLLFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDEIF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GI GILN+P  +PRALK+G+KALFALCL KQ R KAV AGAV ALI+RL   EKCD ER
Sbjct  240   EGITGILNYPLAYPRALKVGIKALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDVER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCR+P+GCAAFAAHALTVPLLV+ ILK+SDRATEYAAGALLSLCS++EQ+QR+
Sbjct  300   ALATVELLCRVPAGCAAFAAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQRE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV+AGV+TQLLLLVQS CTERAKRKAQ+LLKLLRD WP+DS+VNSDDF  SDVV F
Sbjct  360   AVSAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  415



>ref|XP_010270217.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=428

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/417 (76%), Positives = 357/417 (86%), Gaps = 2/417 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD   +QIPYHFRCPISLELMRDPVTVCTGQTYDR+SIESWVATGNTTCPVTR
Sbjct  13    MPGSLEPLDTA-VQIPYHFRCPISLELMRDPVTVCTGQTYDRSSIESWVATGNTTCPVTR  71

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFTLIPNHTLRRLIQ+WCVANR+ G+ERIPTPKQPADP LV++LL+QA+S SS  +
Sbjct  72    APLSDFTLIPNHTLRRLIQDWCVANRSLGIERIPTPKQPADPALVRTLLAQAASNSSTSH  131

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFS-NMDSNSSELTHEALSILSMFQ  763
             SRLSALRRLRGLARDSDKNRSVISA+NA   LL IVF+ + +    ELTHE+L++L M  
Sbjct  132   SRLSALRRLRGLARDSDKNRSVISASNAPDTLLPIVFAADKEREPDELTHESLALLVMLP  191

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             L E++C  VAS  DRV +L SLLSH SI+VRVN+AALIE V AGT+S E R  I NAD +
Sbjct  192   LVESQCESVASQPDRVTFLASLLSHSSIEVRVNAAALIEIVAAGTRSVEHRILIGNADGV  251

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
              +GI  IL++P  +PRALK+G+KALFALCLVKQ R KAV AGAV+ALI+RL   EKCD E
Sbjct  252   MEGITRILSNPLAYPRALKVGIKALFALCLVKQSRHKAVSAGAVDALIDRLADFEKCDAE  311

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALATVELLCRIP GCAAFA HALTVPLLVKIILKISDRATEYAAGALLSLCS+S+Q QR
Sbjct  312   RALATVELLCRIPEGCAAFAEHALTVPLLVKIILKISDRATEYAAGALLSLCSASKQLQR  371

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             DAVAAGV+TQLLLLVQS CTERAKRKAQ+LLKLLRD WPDDSI NSDDF  SDV  F
Sbjct  372   DAVAAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPDDSIANSDDFGCSDVSPF  428



>emb|CAN74163.1| hypothetical protein VITISV_026443 [Vitis vinifera]
Length=476

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/416 (76%), Positives = 367/416 (88%), Gaps = 1/416 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLDVG +QIPYHFRCPISLELM DPVTV TGQTYDRASIE WV TGNTTCPVTR
Sbjct  62    MPGSLEPLDVG-VQIPYHFRCPISLELMCDPVTVSTGQTYDRASIEYWVGTGNTTCPVTR  120

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             + LTDFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPADP  V+SL +Q SS S+  +
Sbjct  121   SSLTDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPADPASVRSLQTQVSSQSNPSH  180

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +RLSA++RLRGLARDSDKNRS+I ++N ++VLL ++FS+ + +S+EL HE+L++L MF L
Sbjct  181   TRLSAVKRLRGLARDSDKNRSIIGSHNVQEVLLPVIFSDSECDSAELKHESLALLVMFPL  240

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE+EC FVAS  DRV +LVSLL H SI+VRVNSAALIE VVAGT+S +LR+QISN DEIF
Sbjct  241   SESECAFVASQPDRVAHLVSLLFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDEIF  300

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GI GILN+P  +PRALK+G+KALFALCL KQ R KAV AGAV ALI+RL   EKCD ER
Sbjct  301   EGITGILNYPLAYPRALKVGIKALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDVER  360

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCR+P+GCAAFAAHALTVPLLV+ ILK+SDRATEYAAGALLSLCS++EQ+QR+
Sbjct  361   ALATVELLCRVPAGCAAFAAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQRE  420

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV+AGV+TQLLLLVQS CTERAKRKAQ+LLKLLRD WP+DS+VNSDDF  SDVV F
Sbjct  421   AVSAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  476



>ref|XP_011000686.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Populus euphratica]
 ref|XP_011000695.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Populus euphratica]
Length=413

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/416 (75%), Positives = 366/416 (88%), Gaps = 3/416 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+  +QIPYHFRCPISLELMRDPVTV TGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLT-VQIPYHFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNHTLRRLIQ+WCVANRAFGVERIPTPKQPA+P LV+SLL+QA+S S+  +
Sbjct  60    APLTDFTLIPNHTLRRLIQDWCVANRAFGVERIPTPKQPAEPSLVRSLLNQAASASNPTH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLRGLARDSDKNRSVIS++N R+VL+++VFS+  S+    +HE+L+IL MF L
Sbjct  120   SRLSALRRLRGLARDSDKNRSVISSHNVREVLVNLVFSSSQSSDL--SHESLAILVMFPL  177

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E +CV ++S+ +R+GYL +LL H SI+VRVNSAALIE+V+AGT+SP+LR QISN + IF
Sbjct  178   TEFDCVGISSEPERIGYLANLLFHSSIEVRVNSAALIENVIAGTRSPDLRLQISNTEIIF  237

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             QG++ IL +P + PRALK+G+KALFALCLVKQ R KAV AGA E LI+RL   +KCD ER
Sbjct  238   QGVIEILKNPLSSPRALKVGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAER  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKISDRATEYAAGALL+LCS+SE +Q++
Sbjct  298   ALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKE  357

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV AG+LTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DS+ NSDDF  SDVV F
Sbjct  358   AVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSDVVPF  413



>gb|ABK93469.1| unknown [Populus trichocarpa]
Length=413

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/416 (74%), Positives = 365/416 (88%), Gaps = 3/416 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+  +QIPYHFRCPISLELM DPVTV TGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLT-VQIPYHFRCPISLELMCDPVTVSTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNHTLRRLIQ+WCVANRAFGVERIPTPKQPA+P LV+SLL+QA+S S+  +
Sbjct  60    APLTDFTLIPNHTLRRLIQDWCVANRAFGVERIPTPKQPAEPSLVRSLLNQAASASNPTH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLRGLARDSDKNRSVIS++N R+VL+++VFS   S SS+L+HE+L+IL +F L
Sbjct  120   SRLSALRRLRGLARDSDKNRSVISSHNVREVLVNLVFST--SQSSDLSHESLAILVLFPL  177

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E +CV ++S+ +R+ YL +LL H SI+VRVNSAALIE+V+AGT+S +LR QISN + IF
Sbjct  178   TEFDCVGISSEPERISYLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEIIF  237

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G++ IL +P + PRALK+G+KALFALCLVKQ R KAV AGA E LI+RL   +KCD ER
Sbjct  238   EGVIEILKNPLSSPRALKIGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAER  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKISDRATEYAAGALL+LCS+SE +Q++
Sbjct  298   ALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKE  357

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV AG+LTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DS+ NSDDF  S+VV F
Sbjct  358   AVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_002313124.2| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEE87079.2| U-box domain-containing family protein [Populus trichocarpa]
Length=413

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/416 (74%), Positives = 365/416 (88%), Gaps = 3/416 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+  +QIPYHFRCPISLELM DPVTV TGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPGTLEPLDLT-VQIPYHFRCPISLELMCDPVTVSTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNHTLRRLIQ+WCVANRAFGVERIPTPKQPA+P LV+SLL+QA+S S+  +
Sbjct  60    APLTDFTLIPNHTLRRLIQDWCVANRAFGVERIPTPKQPAEPSLVRSLLNQAASASNPTH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLRGLARDSDKNRSVIS++N R+VL+++VFS   S SS+L+HE+L+IL +F L
Sbjct  120   SRLSALRRLRGLARDSDKNRSVISSHNVREVLVNLVFST--SQSSDLSHESLAILVLFPL  177

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E +CV ++S+ +R+ YL +LL H SI+VRVNSAALIE+V+AGT+S +LR QISN + IF
Sbjct  178   TEFDCVGISSEPERISYLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEIIF  237

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G++ IL +P + PRALK+G+KALFALCLVKQ R KAV AGA E LI+RL   +KCD ER
Sbjct  238   EGVIEILKNPLSSPRALKIGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAER  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKISDRATEYAAGALL+LCS+SE +Q++
Sbjct  298   ALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKE  357

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV AG+LTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DS+ NSDDF  S+VV F
Sbjct  358   AVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_004309747.1| PREDICTED: U-box domain-containing protein 26-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/415 (74%), Positives = 356/415 (86%), Gaps = 2/415 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+ G+QIPYHFRCPISLELMRDPV + TGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLVGVQIPYHFRCPISLELMRDPVIISTGQTYDRHSIESWVATGNTTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               L DFTLIPNHTLRRLIQEWCVANR+FGVERIPTPKQPADP LV+SLLSQA S S+   
Sbjct  61    TQLADFTLIPNHTLRRLIQEWCVANRSFGVERIPTPKQPADPTLVRSLLSQAGSHSNPYP  120

Query  587   srlsalrrlrglardsDKNRSVISAN-NARQVLLSIVFSNMDSNSSELTHEALSILSMFQ  763
             SRL+ALRRLRGLARD DKNR++IS++ +AR++L++IVF +   +S EL  EAL++L M  
Sbjct  121   SRLAALRRLRGLARDLDKNRAIISSHISAREILVNIVFGDSGPDS-ELNREALALLVMLP  179

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             L+E++CV VASD DRVG+L  LL H S++VRVNSAALIE+++AG+++ ELR+QISN DEI
Sbjct  180   LAESDCVAVASDPDRVGFLARLLFHNSMEVRVNSAALIENLLAGSRTAELRAQISNVDEI  239

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
               G++ IL +P  HPRALK+G+KALFALCLVKQ R KAV AGA E LI  L   EKCD+E
Sbjct  240   HHGVIEILRNPIAHPRALKIGIKALFALCLVKQTRDKAVAAGAPETLINTLADFEKCDSE  299

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALAT+ELLCR+P GCAAFAAHALTVPLLVK ILKISDRATEYAAGALLSLCS SEQ+Q 
Sbjct  300   RALATIELLCRVPEGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSESEQSQN  359

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             DAVAAG++TQLLLLVQS CT+RAKRKAQ+LLKLLRD WP+DS+ NSDDF  SDVV
Sbjct  360   DAVAAGIMTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSDVV  414



>ref|XP_011005992.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=413

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/416 (75%), Positives = 363/416 (87%), Gaps = 3/416 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+  IQIPYHFRCPISLELMRDPVTV TGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPRSLEPLDLT-IQIPYHFRCPISLELMRDPVTVGTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A LTDFTLIPNHTLRRLIQ+WCVAN AFGVERIPTPKQPA+P LV+SLLSQA+S S+  +
Sbjct  60    ALLTDFTLIPNHTLRRLIQDWCVANSAFGVERIPTPKQPAEPSLVRSLLSQAASESNPTH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLRGLARDSDKNRS+IS++N R++L+++VFS+  S S EL+HE+L+IL MF L
Sbjct  120   SRLSALRRLRGLARDSDKNRSLISSHNVREILVNLVFSS--SQSLELSHESLAILVMFPL  177

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E +CV +ASD +R+  L +LL H SI+VRVNSAALIE+VVAGT+S +LR QISN + IF
Sbjct  178   TEFDCVAIASDPERISCLANLLFHSSIEVRVNSAALIENVVAGTRSSDLRLQISNREIIF  237

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G++ IL +P + PRALK+G+K LFALCL KQ R KAV AGA E LI+RL  L+KCD ER
Sbjct  238   EGVIDILKNPLSSPRALKIGIKGLFALCLGKQTRHKAVSAGAAETLIDRLADLDKCDAER  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKISDRATEYAAGALL+LCS+SEQ+Q++
Sbjct  298   ALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQKE  357

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV AG+LTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DS+ NSDDF  S+VV F
Sbjct  358   AVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSVGNSDDFVCSEVVPF  413



>ref|XP_002306161.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
 gb|EEE86672.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
Length=413

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/416 (74%), Positives = 362/416 (87%), Gaps = 3/416 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+  +QIPYHFRCPISLELM DPVTV TGQTYDR+SIESWVATGNTTCPVTR
Sbjct  1     MPRSLEPLDLT-VQIPYHFRCPISLELMCDPVTVNTGQTYDRSSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A LTDFTLIPNHTLRRLIQ+WCVANRAFGVERIPTPKQPA+P LV+SLLSQA+S S+  +
Sbjct  60    ALLTDFTLIPNHTLRRLIQDWCVANRAFGVERIPTPKQPAEPSLVRSLLSQAASESNPTH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSALRRLRGLARDSDKNRS+IS++N R++L+++VFS+  S S EL+HE+L+IL MF L
Sbjct  120   SRLSALRRLRGLARDSDKNRSLISSHNVREILVNLVFSS--SQSLELSHESLAILVMFPL  177

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E +CV +ASD +R+  L +LL H SI+VRVNSAALIE+V+AGT+S +LR QISN + IF
Sbjct  178   TEFDCVAIASDPERISCLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNMEIIF  237

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +G++ IL +P + PRALK+G+K LFALCLVKQ R KAV AGA E LI+RL  L+KCD ER
Sbjct  238   EGVIDILKNPLSSPRALKIGIKGLFALCLVKQTRHKAVSAGAAETLIDRLADLDKCDAER  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCRI  GCAAF AHALTVPLLVK ILKISDRATEYAAGALL+LCS+SEQ+Q++
Sbjct  298   ALATIELLCRIQVGCAAFVAHALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQKE  357

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             AV AG+LTQLLLLVQS CT+RAKRKAQMLLKLLRD WP+DS  NSDDF  S+VV F
Sbjct  358   AVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSAGNSDDFVCSEVVPF  413



>ref|XP_007199948.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
 gb|EMJ01147.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
Length=416

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/414 (74%), Positives = 359/414 (87%), Gaps = 1/414 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRPSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPADP  ++ LL+Q++S S+   
Sbjct  60    APLSDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPADPTHIRHLLTQSASNSNPYP  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +RLSALRRLRGLARD DKNRS IS+ N+R++L+ +VF++  S SSELTHEAL++L +F L
Sbjct  120   TRLSALRRLRGLARDLDKNRSTISSQNSREILVQLVFADTGSESSELTHEALALLVLFPL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E++C  VASD DRV YL  L+ H S++VRVNSAALIE+V+AG+++ ELR++ISN DEI 
Sbjct  180   PESDCAAVASDPDRVAYLAQLVQHSSMEVRVNSAALIENVLAGSRTAELRAEISNVDEIH  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             QG+V IL +P  +PRALK+G+KALFALCLVKQ R KAV AGA E LI  L   EKCD+ER
Sbjct  240   QGVVSILRNPIAYPRALKIGIKALFALCLVKQTRNKAVSAGAPETLINTLADFEKCDSER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCR+P GC AFAAHALTVPLLVK ILKISDRATEYAAGALLSLCS+SE++Q D
Sbjct  300   ALATIELLCRVPDGCTAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSASEKSQND  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLLVQS CT+RAKRKAQ+LLKLLRD WP+DS+ NSDDF  S++V
Sbjct  360   AVAAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELV  413



>ref|XP_003529402.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Glycine max]
Length=414

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/414 (75%), Positives = 358/414 (86%), Gaps = 4/414 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G + IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV+TGNTTCPVTR
Sbjct  1     MPGSLEPLDLG-VHIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVSTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A L+DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP LV+SLL+QASS S+  +
Sbjct  60    ATLSDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPALVRSLLNQASSDSAPAH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RLS+LRRLR LARDSDKNRS+I+++N  Q+LL IVF+N    S EL+HE+L++L MF L
Sbjct  120   LRLSSLRRLRQLARDSDKNRSLIASHNLLQILLPIVFNN---GSDELSHESLALLVMFPL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E+EC  +ASD  ++GYL  +L+H S DVRVNSAAL+E VV GT SPELR+++S+ DEI+
Sbjct  177   GESECASLASDSMKIGYLSRMLAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDEIY  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V +L  P +HPRALK+G+KALFALCLVK  RQKAV AGA   L++RL   EKCD ER
Sbjct  237   DGVVDLLRSPISHPRALKIGIKALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDAER  296

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIP+GCAAFAAHALTVP+LVKIILKIS+RATEYAAGALLSLCS SE+ QR+
Sbjct  297   ALATVELLCRIPAGCAAFAAHALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQRE  356

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLL+QS CTERAKRKAQMLLKLLRD WP DS+ NSDDFA S VV
Sbjct  357   AVAAGVLTQLLLLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV  410



>ref|XP_006583889.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Glycine max]
Length=444

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/414 (75%), Positives = 358/414 (86%), Gaps = 4/414 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G + IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV+TGNTTCPVTR
Sbjct  1     MPGSLEPLDLG-VHIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVSTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A L+DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP LV+SLL+QASS S+  +
Sbjct  60    ATLSDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPALVRSLLNQASSDSAPAH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RLS+LRRLR LARDSDKNRS+I+++N  Q+LL IVF+N    S EL+HE+L++L MF L
Sbjct  120   LRLSSLRRLRQLARDSDKNRSLIASHNLLQILLPIVFNN---GSDELSHESLALLVMFPL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E+EC  +ASD  ++GYL  +L+H S DVRVNSAAL+E VV GT SPELR+++S+ DEI+
Sbjct  177   GESECASLASDSMKIGYLSRMLAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDEIY  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V +L  P +HPRALK+G+KALFALCLVK  RQKAV AGA   L++RL   EKCD ER
Sbjct  237   DGVVDLLRSPISHPRALKIGIKALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDAER  296

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIP+GCAAFAAHALTVP+LVKIILKIS+RATEYAAGALLSLCS SE+ QR+
Sbjct  297   ALATVELLCRIPAGCAAFAAHALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQRE  356

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLL+QS CTERAKRKAQMLLKLLRD WP DS+ NSDDFA S VV
Sbjct  357   AVAAGVLTQLLLLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV  410



>ref|XP_003518699.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=415

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/415 (75%), Positives = 356/415 (86%), Gaps = 5/415 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G + IPYHFRCPISLELMRDPVTVCTGQTYDRASIE+WV+TGN+TCPVTR
Sbjct  1     MPGSLEPLDLG-VHIPYHFRCPISLELMRDPVTVCTGQTYDRASIEAWVSTGNSTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A LTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP LV+SLL+QASS S+  +
Sbjct  60    ATLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPALVRSLLNQASSGSAPAH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RLS++RRLR LARDSDKNRS+I+++N RQ+LL IVF+N    S EL +E+L++L MF L
Sbjct  120   LRLSSIRRLRQLARDSDKNRSLIASHNVRQILLPIVFNN---GSDELKNESLALLVMFPL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E+EC  +ASD  ++GYL  +L+H S DVRVNSAALIE VVAGT SPELR+++S+ DEI+
Sbjct  177   GESECASLASDSVKIGYLSRMLTHNSFDVRVNSAALIEIVVAGTHSPELRAEVSSVDEIY  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V +L  P +HPRALK+G+KALFALCLVK  RQKAV AG    L++RL   EKCD ER
Sbjct  237   DGVVDLLRSPISHPRALKIGIKALFALCLVKNTRQKAVDAGTPAVLVDRLADFEKCDAER  296

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIP+GC AFA HALTVP+LVKIILKISDRATEYAAGALLSLCS SE+ QR+
Sbjct  297   ALATVELLCRIPAGCEAFAGHALTVPMLVKIILKISDRATEYAAGALLSLCSESERCQRE  356

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV-NSDDFARSDVV  1468
             AVAAGVLTQLLLLVQS CTERAKRKAQMLLKLLRD WP DSI  NSDDFA S VV
Sbjct  357   AVAAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPQDSIGNNSDDFACSQVV  411



>ref|XP_004140703.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 ref|XP_004171341.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 gb|KGN57520.1| hypothetical protein Csa_3G203270 [Cucumis sativus]
Length=425

 Score =   526 bits (1355),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 296/415 (71%), Positives = 356/415 (86%), Gaps = 5/415 (1%)
 Frame = +2

Query  236   SLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPL  415
             ++ PLD+  + IPYHFRCPISLELMRDPVTV TGQTYDR+SIESWVATGNTTCPVTRAPL
Sbjct  8     AVQPLDLS-LHIPYHFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTTCPVTRAPL  66

Query  416   TDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl  595
             TDFTLIPNHTLRRLIQEWCVANR++GVERIPTPKQPA+P LV+SLL+QASS SS  + R+
Sbjct  67    TDFTLIPNHTLRRLIQEWCVANRSYGVERIPTPKQPAEPSLVRSLLAQASSRSSGSSLRI  126

Query  596   salrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSS----ELTHEALSILSMFQ  763
             SALRRL+GLARDSDKNRS+IS+ NAR++LL +VFSN+DS S     +L+ E+L++L M  
Sbjct  127   SALRRLKGLARDSDKNRSLISSLNAREILLDVVFSNLDSGSDSFSPDLSRESLALLVMLP  186

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             L+E+ECV VASD  R+GYL  LL   SI+ R+N+AALIE+V+AGT++ ELR+QI   DE+
Sbjct  187   LTESECVLVASDPQRIGYLSHLLFDSSIEDRINAAALIETVIAGTRASELRTQICGIDEL  246

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
             F+G+V IL  P+ +PRALK+GVKALFALCLVKQ R KAV AGA E +I+R   LEK D E
Sbjct  247   FEGVVEILRDPTAYPRALKVGVKALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEKYDAE  306

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALAT+EL+CRIP+GC AFAAHALTVPLLVK+ILKISDRATE A GAL+SLCS+SE+ +R
Sbjct  307   RALATIELICRIPTGCDAFAAHALTVPLLVKVILKISDRATESAVGALVSLCSASEENRR  366

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             +AVAAG+LTQLLLLVQS CTER KRK+Q+LLKLLRD WP +S+ NSDD+A S++V
Sbjct  367   EAVAAGILTQLLLLVQSDCTERVKRKSQVLLKLLRDSWPQESVGNSDDYACSEIV  421



>ref|XP_008456137.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis melo]
Length=425

 Score =   525 bits (1352),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 294/415 (71%), Positives = 355/415 (86%), Gaps = 5/415 (1%)
 Frame = +2

Query  236   SLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPL  415
             ++ PLD+  + IPYHFRCPISLELMRDPVTV TGQTYDR+SIESWVATGNTTCPVTRAPL
Sbjct  8     AVQPLDLS-LHIPYHFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTTCPVTRAPL  66

Query  416   TDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl  595
             TDFTLIPNHTLRRLIQ+WCVANR++GVERIPTPKQPA+P LV+SLL QASS SS  + R+
Sbjct  67    TDFTLIPNHTLRRLIQDWCVANRSYGVERIPTPKQPAEPSLVRSLLGQASSRSSGSSLRI  126

Query  596   salrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSS----ELTHEALSILSMFQ  763
             SALRRL+GLARDSDKNRS+IS+ NAR++LL +VFSN+DS S     +L+ E+L++L M  
Sbjct  127   SALRRLKGLARDSDKNRSLISSLNAREILLDVVFSNLDSGSDSFSPDLSRESLALLVMLP  186

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             L+E+ECV VASD  R+GYL  LL   SI+VR+N+AALIE+V+AGT++ ELR+QI   DE+
Sbjct  187   LTESECVLVASDPQRIGYLSHLLFDSSIEVRINAAALIETVIAGTRASELRTQICGIDEL  246

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
             F+G+V IL  P+ +PRALK+GVKALFALCLVKQ R KAV AGA E +I+R   LEK D E
Sbjct  247   FEGVVEILRDPTAYPRALKVGVKALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEKYDAE  306

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALAT+EL+CR+P+GC AFAAHALTVPLLVK+ILKISDRATE A GAL+SLCS+SE+ +R
Sbjct  307   RALATIELICRVPTGCDAFAAHALTVPLLVKVILKISDRATESAVGALVSLCSASEENRR  366

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             +AVAAG+LTQLLLLVQS CTER KRK+Q+LLKLLRD WP +S+ NSDD+  S++V
Sbjct  367   EAVAAGILTQLLLLVQSDCTERVKRKSQVLLKLLRDSWPQESVGNSDDYGCSEIV  421



>ref|XP_008373128.1| PREDICTED: U-box domain-containing protein 26-like [Malus domestica]
Length=416

 Score =   523 bits (1347),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 305/414 (74%), Positives = 357/414 (86%), Gaps = 1/414 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR SIESWVATGN TCPVTR
Sbjct  1     MPGSLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRPSIESWVATGNITCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFTLIPNHTLRRLIQEWCVANR+FGVERIPTPKQPADP  ++ LL+Q++S S+   
Sbjct  60    APLSDFTLIPNHTLRRLIQEWCVANRSFGVERIPTPKQPADPTHIRHLLAQSASNSNPYP  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +R+SALRRLRGLARD DKNRS IS+ N+R++LL +VFS+ +S SSELTHEAL++L +F L
Sbjct  120   TRVSALRRLRGLARDLDKNRSTISSQNSREILLELVFSDTNSESSELTHEALALLVLFPL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E++C  VASD DRV YL  L+ HPS++VRVNSAALIE+V+AG+++ ELR+Q+SN DEI 
Sbjct  180   LESDCAAVASDPDRVAYLSHLVQHPSMEVRVNSAALIENVLAGSRTAELRAQVSNVDEIH  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V IL +P  +PRALK+GVKA+FALCLVK+ R KAV AGA E LI  L   EK D+ER
Sbjct  240   HGVVSILRNPJAYPRALKIGVKAVFALCLVKETRNKAVSAGAPETLINVLADFEKYDSER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCR+P GCAAFAAH LTVPLLVK ILKISDRATEYAAGALLSLCS+SE+ Q +
Sbjct  300   ALATIELLCRVPEGCAAFAAHGLTVPLLVKTILKISDRATEYAAGALLSLCSASEKNQNE  359

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLLVQS CTERAKRKAQ+LLKLLRD WP+DS+ NSDDF  S++V
Sbjct  360   AVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELV  413



>ref|XP_007153588.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
 gb|ESW25582.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
Length=413

 Score =   521 bits (1342),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 309/414 (75%), Positives = 347/414 (84%), Gaps = 5/414 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G + IPYHFRCPISLELMRDPVTVCTGQTYDR SI+SWV  GN TCPVTR
Sbjct  1     MPGSLEPLDLG-VHIPYHFRCPISLELMRDPVTVCTGQTYDRPSIDSWVTAGNITCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A LTDFTLIPNHTLRRLIQ+WCVANRAFGVERIPTPKQPADP LV+SLL+Q SS S+  +
Sbjct  60    ATLTDFTLIPNHTLRRLIQDWCVANRAFGVERIPTPKQPADPALVRSLLNQTSSDSAPTH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RLS+LRRLR LARDSDKNRS+IS++N RQ+LL IVF      +SEL HEAL++L +F L
Sbjct  120   LRLSSLRRLRQLARDSDKNRSLISSHNVRQILLPIVFHG----ASELNHEALALLVLFPL  175

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E+EC  +ASD ++V YL  LLSH S+DVRVNSAALIE VVAGT SPELR+ +S  DEI+
Sbjct  176   GESECAALASDSEKVNYLSRLLSHNSLDVRVNSAALIEIVVAGTHSPELRACVSEVDEIY  235

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V +L  P ++PRALK+G+KALFALCLVKQ R KAV AGA   L++RL   EKCD ER
Sbjct  236   DGVVDLLRSPISYPRALKIGIKALFALCLVKQTRHKAVAAGAPAVLVDRLADFEKCDAER  295

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIP+GC AFA HALTVP+LVKIILKIS RATEYAAGALLSLCS SE+ QR+
Sbjct  296   ALATVELLCRIPAGCEAFAGHALTVPMLVKIILKISHRATEYAAGALLSLCSESERCQRE  355

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AV AGVLTQLLLLVQS CTERAKRKAQMLLKLLRD WP D I NSDDFA S VV
Sbjct  356   AVTAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPQDCIGNSDDFACSQVV  409



>gb|EPS67592.1| hypothetical protein M569_07183, partial [Genlisea aurea]
Length=419

 Score =   521 bits (1341),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 284/409 (69%), Positives = 343/409 (84%), Gaps = 0/409 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+ LDV G++IPYHFRCPISLELMRDPVTVCTGQTYDR+SIESW+ TGNTTCP TR
Sbjct  10    MPGSLEQLDVAGVEIPYHFRCPISLELMRDPVTVCTGQTYDRSSIESWIVTGNTTCPATR  69

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               LTD  LIPNHTLRRLIQ+WCVAN A GVERIPTPKQPA+P L+++LL++ASS S+   
Sbjct  70    TRLTDLALIPNHTLRRLIQDWCVANHASGVERIPTPKQPAEPVLIRNLLNRASSGSASFC  129

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SR+SA+RRLRGLARDS+KNRS I++++ R+V +S++F+++ S  SEL  E+L+I+SM  L
Sbjct  130   SRISAVRRLRGLARDSEKNRSAIASSDGRRVFVSLLFADVSSEPSELNLESLAIISMLGL  189

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE +C+++ASDLDRV YLV+LLSH SIDVR+NSAA IE +VAG +S +LR+QI + D +F
Sbjct  190   SEQDCLYLASDLDRVKYLVNLLSHSSIDVRINSAAAIEMIVAGVRSSDLRAQIGSLDGVF  249

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GIVGILN+P  +P ALK+G+KALFALCL KQHR  AV AGA  ++I RL   EKC+ E+
Sbjct  250   EGIVGILNYPLANPHALKIGIKALFALCLAKQHRHVAVSAGAAGSIINRLAEFEKCEAEK  309

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCRIP G AAFA+H LT+PLLVKIILKISDRATEYA+GALLSLC+ S+Q Q +
Sbjct  310   ALATVELLCRIPDGRAAFASHPLTIPLLVKIILKISDRATEYASGALLSLCTMSDQTQAE  369

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
             AVAAGVL QL+LLVQS CTERAKRKAQMLLKLLR+ WP D     DDF 
Sbjct  370   AVAAGVLNQLILLVQSDCTERAKRKAQMLLKLLRNSWPQDDFEYHDDFG  418



>ref|XP_010690605.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score =   520 bits (1340),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 307/416 (74%), Positives = 359/416 (86%), Gaps = 4/416 (1%)
 Frame = +2

Query  239   LDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLT  418
             L+PL+  GIQIPY+FRCPISLELMRDPVTVCTGQTYDR SIESWVATGNTTCPVTRA L+
Sbjct  12    LEPLEAAGIQIPYYFRCPISLELMRDPVTVCTGQTYDRQSIESWVATGNTTCPVTRATLS  71

Query  419   DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrls  598
             DF+LIPNHTLRRLIQEWCV+NR+FGVERIPTPKQPADP +++SLL+QASSVS+ + +R++
Sbjct  72    DFSLIPNHTLRRLIQEWCVSNRSFGVERIPTPKQPADPSIIRSLLNQASSVSNLVQNRVN  131

Query  599   alrrlrglardsDKNRSVISANNARQVLLSIVFSNMD-SNSSELTHEALSILSMFQLSEA  775
             +LRRLRGLARDS+KNRSVIS  NAR V +SI+F + D S S+EL HE+L++L++F  S+ 
Sbjct  132   SLRRLRGLARDSEKNRSVISNLNARDVFVSILFDDSDESESAELKHESLALLAIFPPSDP  191

Query  776   ECVFVASDLDRVGYLVSLLSHPS-IDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
              C  + SD D+VGYLVSLL HPS ID+RVNSAALIES++AGTKSP+LRS I  ++EI+ G
Sbjct  192   NCSSIVSDPDKVGYLVSLLFHPSSIDIRVNSAALIESIIAGTKSPDLRSFICTSEEIYVG  251

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERAL  1132
             +V IL +P+  PRALK+GVK LFALCL KQHR KA+ AGAV ALI RL  L+KCD ERAL
Sbjct  252   VVSILTNPTPSPRALKIGVKTLFALCLSKQHRHKAISAGAVNALISRLTELDKCDCERAL  311

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAV  1312
             ATVELLCR+P GC++F +HALTVPLLVK ILK+SDRATEYAAGALLSL SSSE+ QR+AV
Sbjct  312   ATVELLCRVPQGCSSFGSHALTVPLLVKTILKVSDRATEYAAGALLSLASSSERLQREAV  371

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD-SIVN-SDDFARSDVVQF  1474
              AGVLTQLLLLVQS CTERAKRKAQMLLKLLRD WPD+ SI N SDDF  SD+V F
Sbjct  372   NAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDEKSIGNYSDDFYCSDIVPF  427



>ref|XP_006487052.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
 gb|KDO59728.1| hypothetical protein CISIN_1g014817mg [Citrus sinensis]
Length=418

 Score =   516 bits (1328),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 308/419 (74%), Positives = 361/419 (86%), Gaps = 4/419 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+  +QIPYHFRCPISLELM DPVTVCTGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLS-VQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             +PLTDFTLIPNHTLRRLIQ+WCVANR+FGV+RIPTPKQPA+P LV++LL+QASS S+   
Sbjct  60    SPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSESNTYG  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMD---SNSSELTHEALSILSM  757
             SRLSALRRLRGLARDSDKNRS+IS++N R +L  + F+N++   ++S EL HE+L++L M
Sbjct  120   SRLSALRRLRGLARDSDKNRSLISSHNVRAILSQVFFTNINVKTASSPELAHESLALLVM  179

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
             F L+E EC+ +ASD D++  L SLL H SI+VRVNSAALIE V+AG +S ELR+QISN D
Sbjct  180   FPLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLD  239

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD  1117
             EIF+G++ IL + S++PR LK+G+KALFALCLVKQ R KAV AGA E L++RL   +KCD
Sbjct  240   EIFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRYKAVAAGAAETLVDRLADFDKCD  299

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              ERALATVELLCRIP+GCA FA HALTVPLLVK ILKISDRATEYAAGAL +LCS+SE+ 
Sbjct  300   AERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERC  359

Query  1298  QRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             QRDAV+AGVLTQLLLLVQS CT+RAKRKAQ+LLKLLRD WP DSI NSDDFA S+VV F
Sbjct  360   QRDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>ref|XP_006422990.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
 gb|ESR36230.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
Length=418

 Score =   515 bits (1327),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 307/419 (73%), Positives = 359/419 (86%), Gaps = 4/419 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+  +QIPYHFRCPISLELM DPVTVCTGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSLEPLDLS-VQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             +PLTDFTLIPNHTLRRLIQ+WCVANR+FGV+RIPTPKQPA+P LV++LL+QASS S+   
Sbjct  60    SPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSESNTYG  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSN---SSELTHEALSILSM  757
             SR+SALRRLRGLARDSDKNR +IS++N R +L  + F+N++ N   S EL HE+L++L M
Sbjct  120   SRMSALRRLRGLARDSDKNRCLISSHNVRAILSQVFFTNINVNTASSPELAHESLALLVM  179

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
             F L+E EC+ +ASD D++  L SLL H SI+VRVNSAALIE V+AG +S ELR+QISN D
Sbjct  180   FPLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLD  239

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD  1117
             EIF+G++ IL + S++PR LK+G+KALFALCLVKQ R KAV AGA E L++RL   +KCD
Sbjct  240   EIFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRHKAVAAGAAETLVDRLADFDKCD  299

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              ERALATVELLCRIP+GCA FA HALTVPLLVK ILKISDRATEYAAGAL +LCS+SE+ 
Sbjct  300   AERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERC  359

Query  1298  QRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQF  1474
             QRDAV+AGVLTQLLLLVQS CT+RAKRKAQ+LLKLLRD WP DSI NSDDFA S+VV F
Sbjct  360   QRDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>ref|XP_004505237.1| PREDICTED: U-box domain-containing protein 26-like [Cicer arietinum]
Length=415

 Score =   513 bits (1322),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 302/414 (73%), Positives = 349/414 (84%), Gaps = 3/414 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             M  SL+PLD+G IQIPYHFRCPISLELMRDPVTV TGQTYDR SIESWV+TGNTTCPVTR
Sbjct  1     MRGSLEPLDLG-IQIPYHFRCPISLELMRDPVTVSTGQTYDRGSIESWVSTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A LTDFT IPNHTLRRLIQ+WCVANRAFGVERIPTPKQPAD  LV+SLL+Q+ S S+   
Sbjct  60    ANLTDFTFIPNHTLRRLIQDWCVANRAFGVERIPTPKQPADSSLVRSLLNQSCSHSAPTQ  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RL++LRRLR LARDS+ NRS+I+++N   +LL IVF ++ S+  EL HE+L++L +F L
Sbjct  120   LRLNSLRRLRSLARDSEYNRSLIASHNVCHILLPIVFDHIASD--ELKHESLALLVLFPL  177

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE+EC  +ASD D++ YL  LLSH S DVRVNSAALIE VVAGT SPE+R+Q+SN D I+
Sbjct  178   SESECTSLASDSDKINYLTRLLSHSSFDVRVNSAALIEFVVAGTHSPEIRAQVSNVDGIY  237

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V IL +P ++PRALK+G+KALFALCLVKQ R +AV AGA   L++RL   EKCD ER
Sbjct  238   DGVVEILKNPISYPRALKVGIKALFALCLVKQTRHRAVAAGAPVVLVDRLADFEKCDAER  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCR+P+G  AFA HALTVP+LVKIILKISDRATEYAAGALL+LCS SE+ QR+
Sbjct  298   ALATVELLCRVPAGITAFAGHALTVPMLVKIILKISDRATEYAAGALLALCSESERCQRE  357

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLLVQS CTERAKRKAQ+LLKLLRD WP DSI NSDDFA S VV
Sbjct  358   AVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSIGNSDDFACSQVV  411



>gb|AES90137.2| plant U-box protein [Medicago truncatula]
Length=410

 Score =   503 bits (1295),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 292/409 (71%), Positives = 342/409 (84%), Gaps = 4/409 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             M   L+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR SIESWV TGNTTCPVTR
Sbjct  1     MRGCLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRNSIESWVNTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               LTDFT IPNHTLRRLIQ+WCV+NRAFGV+RIPTPKQPAD  LV+SLL+Q SS S+   
Sbjct  60    TNLTDFTFIPNHTLRRLIQDWCVSNRAFGVQRIPTPKQPADAALVRSLLNQISSHSAPTQ  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RL++LRRLR L RDS+ NRS+IS+ N R ++L I+F+N      EL +E+L+++ +F L
Sbjct  120   LRLNSLRRLRSLTRDSEYNRSLISSLNVRNIILPILFNN---GLDELKNESLALIVLFPL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE+EC  +ASD D++ YL SLLSH S DVRVNSAALIE +VAGT SPE+R Q+SN D I+
Sbjct  177   SESECTSLASDSDKINYLTSLLSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDGIY  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V IL +P ++PRALK+G+KALFALCLVKQ R +AV AGA   LI+RL   EKCD ER
Sbjct  237   DGVVEILKNPISYPRALKIGIKALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDAER  296

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCR+P+GCA+FA HALTVP+LVKIILKISDRATEYAAGAL++LCS SE+ QR+
Sbjct  297   ALATVELLCRVPAGCASFAGHALTVPMLVKIILKISDRATEYAAGALMALCSESERCQRE  356

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
             AVAAGVLTQLLLLVQS CTERAKRKAQ+LLKLLRD WP DS+ NSDDFA
Sbjct  357   AVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSVGNSDDFA  405



>ref|XP_003607940.1| U-box domain-containing protein [Medicago truncatula]
Length=451

 Score =   501 bits (1290),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 291/409 (71%), Positives = 341/409 (83%), Gaps = 4/409 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             M   L+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR SIESWV TGNTTCPVTR
Sbjct  1     MRGCLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRNSIESWVNTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               LTDFT IPNHTLRRLIQ+WCV+NRAFGV+RIPTPKQPAD  LV+SLL+Q SS S+   
Sbjct  60    TNLTDFTFIPNHTLRRLIQDWCVSNRAFGVQRIPTPKQPADAALVRSLLNQISSHSAPTQ  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              RL++LRRLR L RDS+ NRS+IS+ N R ++L I+F+N      EL +E+L+++ +F L
Sbjct  120   LRLNSLRRLRSLTRDSEYNRSLISSLNVRNIILPILFNN---GLDELKNESLALIVLFPL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE+EC  +ASD D++ YL SLLSH S DVRVNSAALIE +VAGT SPE+R Q+SN D I+
Sbjct  177   SESECTSLASDSDKINYLTSLLSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDGIY  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V IL +P ++PRALK+G+KALFALCLVKQ R +AV AGA   LI+RL   EKCD ER
Sbjct  237   DGVVEILKNPISYPRALKIGIKALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDAER  296

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALATVELLCR+P+GCA+FA HALTVP+LVKIILKISDRATEYAAGAL++LCS SE+ QR+
Sbjct  297   ALATVELLCRVPAGCASFAGHALTVPMLVKIILKISDRATEYAAGALMALCSESERCQRE  356

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
             AVAAGVLTQLLLLVQS CTERAKRKAQ+LLKLLRD WP DS+ NSDDF 
Sbjct  357   AVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSVGNSDDFG  405



>ref|XP_010538612.1| PREDICTED: U-box domain-containing protein 26-like [Tarenaya 
hassleriana]
Length=434

 Score =   495 bits (1274),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 346/435 (80%), Gaps = 20/435 (5%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR+SIESWVA GNTTCPVTR
Sbjct  1     MPGNLEPLDIG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRSSIESWVAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNHTLRRLIQ+WCVANR+ GVERIPTPKQPADP  V+SLLSQAS+VS    
Sbjct  60    APLTDFTLIPNHTLRRLIQDWCVANRSNGVERIPTPKQPADPSSVRSLLSQASAVSGTHV  119

Query  587   srlsalrrlr---glardsDKNRSVISANNARQVLLSIVFSN----MDS--NSSELTHEA  739
             S  S    LR   GLARDS+KNR++I+A+NAR++L+ I+FS     +DS  +SSEL  E+
Sbjct  120   SVRSRAAALRRLRGLARDSEKNRALIAAHNAREILVGILFSGCGGGVDSGCDSSELVSES  179

Query  740   LSILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRS  919
             L +L MFQ++EAEC  +A+D +RVG +  LL   SI+VRVN+AA+IE V+ G+KS +L+ 
Sbjct  180   LGLLVMFQMTEAECASIAADPNRVGLMTQLLFDSSIEVRVNAAAMIEMVLTGSKSMDLKR  239

Query  920   QISNADEIFQGIVGILNHP-STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL  1096
              IS +  IF+G++ +L +P S+ PRALK+G+KALFALCLVK  R  A+ AGA   L++RL
Sbjct  240   LISGSGTIFEGVLDLLQNPISSFPRALKVGIKALFALCLVKHTRHLAISAGAPAVLVDRL  299

Query  1097  QY---------LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATE  1249
                         ++C TERALATVELLCRIP GC+AFA HALTVP+LVK IL++SDRATE
Sbjct  300   AAGLVDRIAADFDRCATERALATVELLCRIPVGCSAFAEHALTVPVLVKTILRVSDRATE  359

Query  1250  YaagallslcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDS  1429
             YAAGALL LCS++E  +R+A AAGV+TQLLLLVQS CTERAKRKAQMLLKLLRD WPDDS
Sbjct  360   YAAGALLGLCSAAEHCRREAAAAGVVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDS  419

Query  1430  IVNSDDFARSDVVQF  1474
             +  SD+F  S++  F
Sbjct  420   LGISDEFGLSEIAPF  434



>ref|XP_002518745.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF43670.1| Spotted leaf protein, putative [Ricinus communis]
Length=420

 Score =   485 bits (1248),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 330/377 (88%), Gaps = 5/377 (1%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+ LD+  +QIPYHFRCPISLELMRDPVTV TGQTYDRASIESWVATGN+TCPVTR
Sbjct  1     MPGSLESLDLS-VQIPYHFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNSTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQ+WCVANR+FG+ERIPTPKQPA+P LV+SLL+Q +SV++  +
Sbjct  60    LPLTDFTLIPNHTLRRLIQDWCVANRSFGIERIPTPKQPAEPSLVRSLLNQVTSVTNTAH  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             SRLSA+RRL+ LARDSDKNRS+IS++NA  +L++++FSN    SS+LTHEA+S++ MF L
Sbjct  120   SRLSAIRRLKSLARDSDKNRSLISSHNATNLLVNLLFSN---TSSDLTHEAMSLVVMFPL  176

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             +E+EC+ +AS+ +R+ +L +LL H SI++RVNSAALIE+V+AGTKS +LR+Q SN DEI 
Sbjct  177   TESECISIASNTERIIFLANLLFHSSIEIRVNSAALIETVIAGTKSSDLRAQFSNVDEIV  236

Query  947   QGIVGILNHP-STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
             +G++ +L  P S +PRALK+G+KALFALCLVKQ R KAV AGAVE LI+RL   +KCD E
Sbjct  237   EGVIELLKRPISNYPRALKIGIKALFALCLVKQTRHKAVSAGAVETLIDRLADFDKCDAE  296

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RALAT+ELLCR+P G A FA HALTVPLLVK ILKISDRATEYAAGALL+LC++SE++QR
Sbjct  297   RALATIELLCRVPEGVAEFAEHALTVPLLVKTILKISDRATEYAAGALLALCTASEKSQR  356

Query  1304  DAVAAGVLTQLLLLVQS  1354
             +AV+AG+LTQLLLLVQS
Sbjct  357   EAVSAGILTQLLLLVQS  373



>emb|CDY50158.1| BnaA01g26180D [Brassica napus]
Length=417

 Score =   474 bits (1221),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 278/424 (66%), Positives = 339/424 (80%), Gaps = 15/424 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP SL+PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TGN TTCPVT
Sbjct  1     MPRSLEPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGTH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDS+KNR +I+A+NA+++L+ I+FS+ D +SSEL  E+L++L 
Sbjct  120   VSSRSRAAALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVSESLALLV  178

Query  755   MFQLSEAE-CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             MF ++E + CV + SD  RV +L  LL   S++ RVN+AALIE  V G+K       +S+
Sbjct  179   MFPMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSS  233

Query  932   ADEIFQGIVGILNHP-STHPR-ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             ++ IF+G++ +L +P S++PR ALK+G+KALFALCL KQ R+ AV AGA E LI+RL   
Sbjct  234   SESIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKQTRRIAVSAGAPEILIDRLAAG  293

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
             L++CDTERALATVE+LCR P GCAAF  HALTVP+LVK IL++SDRATEYAAGALL+LC+
Sbjct  294   LDRCDTERALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCT  353

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAGV+ QLLL+VQS CTERAKRKAQ LLKLLRD WPD S  NSDDFA S+
Sbjct  354   AEERWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSE  413

Query  1463  VVQF  1474
             VV F
Sbjct  414   VVPF  417



>emb|CDX99233.1| BnaC05g33480D [Brassica napus]
Length=421

 Score =   473 bits (1218),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 272/425 (64%), Positives = 332/425 (78%), Gaps = 13/425 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVT  403
             MP SL+PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TG +TTCPVT
Sbjct  1     MPRSLEPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGTDTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+     
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAACGTH  119

Query  584   nsrlsalrrlrglard---sDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L      S+KNR +I+A+NA+++L+ I+FS+    S EL  EAL++L+
Sbjct  120   VSVRSRAAALRRLRAFARDSEKNRVLIAAHNAKEILIRILFSD---ESPELVSEALALLA  176

Query  755   MFQLSE-AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             MF ++E  +C  + SD  RVG+L  LL   SI+ RVN+AALIE VV G+K+ +++  +  
Sbjct  177   MFPMTEPGQCESIISDAGRVGFLTRLLFDSSIETRVNAAALIEMVVTGSKTADIKGTVLT  236

Query  932   ADEIFQGIVGILNHP---STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY  1102
             ++ IF+G++ +L +P   S+  RALK+GVKALFALCL K  R+ AV +GA E LI+RL  
Sbjct  237   SECIFEGVIDLLRNPTVTSSPRRALKIGVKALFALCLAKNTRRIAVSSGAPEILIDRLAA  296

Query  1103  -LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
              L++CD ERALATVELLCR   GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC
Sbjct  297   GLDRCDAERALATVELLCRTAEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALC  356

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARS  1459
             ++ E+ + +AVAAGV+ QLLL+VQS CTERAKRKAQ LLKLLRD WPD S  NSDDFA S
Sbjct  357   TAEERWRDEAVAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACS  416

Query  1460  DVVQF  1474
             +VV F
Sbjct  417   EVVPF  421



>ref|XP_009341339.1| PREDICTED: U-box domain-containing protein 26 [Pyrus x bretschneideri]
Length=395

 Score =   472 bits (1215),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 280/414 (68%), Positives = 338/414 (82%), Gaps = 22/414 (5%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR SIESWVATGN TCPVTR
Sbjct  1     MPGSLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRPSIESWVATGNITCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL++                     +FGVERIPTPKQPADP  ++ LL+Q++S S+   
Sbjct  60    APLSE---------------------SFGVERIPTPKQPADPTHIRHLLAQSASNSNPYP  98

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +R+SALRRLRGLARD DKNRS IS+ N+R++LL +VFS+ +S SSELTHEAL++L +F L
Sbjct  99    TRVSALRRLRGLARDLDKNRSTISSQNSREILLELVFSDTNSESSELTHEALALLVLFPL  158

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E++C  VASD DR+ YL  L+ HPS++V+VNSAALIE+V+AG+++ ELR+Q+SN DEI 
Sbjct  159   PESDCAAVASDPDRIAYLSHLVQHPSMEVQVNSAALIENVLAGSRTAELRAQVSNVDEIH  218

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              G+V IL +P  +PRAL++GVKA+FALCLVK+ R KAV AGA E LI  L   EKCD+ER
Sbjct  219   HGVVSILRNPIAYPRALRIGVKAVFALCLVKETRNKAVSAGAPETLINVLADFEKCDSER  278

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCR+P GCAAFAAH LTVPLLVK ILKISDRATEYAAGALLSLCS+SE+++ +
Sbjct  279   ALATIELLCRVPEGCAAFAAHGLTVPLLVKTILKISDRATEYAAGALLSLCSASEKSKNE  338

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLLVQS CTERAKRKAQ+LLKLLRD WP+DS+ NSDDF  S++V
Sbjct  339   AVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELV  392



>emb|CDX92328.1| BnaA05g20790D [Brassica napus]
Length=423

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 279/427 (65%), Positives = 340/427 (80%), Gaps = 15/427 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN--TTCPV  400
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TGN  TTCPV
Sbjct  1     MPRSLEPLDLG-LQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNNTTCPV  59

Query  401   TRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqass---v  571
             TRAPL+D TLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+    
Sbjct  60    TRAPLSDHTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAACGT  119

Query  572   sshlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSIL  751
                + SR +ALRRLR  ARDS+KNR +I+A+NA+++L+ I+FS++   + EL  E+L++L
Sbjct  120   HVSVRSRAAALRRLRAFARDSEKNRVLIAAHNAKEILIRILFSDV---APELVSESLALL  176

Query  752   SMFQLSEAE-CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPEL-RSQI  925
              MF ++E E CV + SD  RVG+L  LL   SI+ RVN+AALIE VV GTK+ ++ +  +
Sbjct  177   VMFPMTEPEQCVSIISDPGRVGFLTRLLFDSSIETRVNAAALIEMVVTGTKTADIIKGTV  236

Query  926   SNADEIFQGIVGILNHP---STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL  1096
                + IF+G++ +L +P   S+  RALK+GVKALFALCLVK  RQ AV +GA E LI+RL
Sbjct  237   LTTEYIFEGVIDLLRNPTVTSSPRRALKIGVKALFALCLVKNTRQLAVSSGAPEILIDRL  296

Query  1097  QY-LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls  1273
                L++CDTERALATVELLCR P GC AF  HALTVPLLVK IL++SDRATEYAAGALL+
Sbjct  297   AAGLDRCDTERALATVELLCRTPEGCVAFGEHALTVPLLVKTILRVSDRATEYAAGALLA  356

Query  1274  lcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
             LC++ E+ + +AVAAGV+ QLLL+VQS CTERAKRKAQ LLKLLRD WPD S  NS+DF 
Sbjct  357   LCTAEERWREEAVAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSNDFG  416

Query  1454  RSDVVQF  1474
              S+VV F
Sbjct  417   CSEVVPF  423



>ref|XP_009145797.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
 ref|XP_009145799.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
Length=422

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 271/426 (64%), Positives = 332/426 (78%), Gaps = 14/426 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN--TTCPV  400
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TGN  TTCPV
Sbjct  1     MPRSLEPLDLG-LQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNNTTCPV  59

Query  401   TRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvssh  580
             TRAPL+D TLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+    
Sbjct  60    TRAPLSDHTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAACGT  119

Query  581   lnsrlsalrrlrglard---sDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSIL  751
               S  S    LR L      S+KNR +I+A+NA+++L+ I+FS++   + EL  E+L++L
Sbjct  120   HVSVRSRAAALRRLRAFARDSEKNRVLIAAHNAKEILIRILFSDV---APELVSESLALL  176

Query  752   SMFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQIS  928
              +F ++E  +CV + SD  RVG+L  LL   SI+ RVN+AALIE VV GTK+ +++  + 
Sbjct  177   VIFPMTEPDQCVSIISDPGRVGFLTRLLFDSSIETRVNAAALIEMVVTGTKAADIKGTVL  236

Query  929   NADEIFQGIVGILNHP---STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ  1099
              ++ IF+G++ +L +P   S+  RALK+GVKALFALCLVK  R  AV +GA E LI+RL 
Sbjct  237   TSECIFEGVIDLLRNPTVTSSPRRALKIGVKALFALCLVKNTRHLAVSSGAPEILIDRLA  296

Query  1100  Y-LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl  1276
               L++CDTERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+L
Sbjct  297   AGLDRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAL  356

Query  1277  csssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFAR  1456
             C++ E+ + +AVAAGV+ QLLL+VQS CTERAKRK Q LLKLLRD WPD S  NSDDF  
Sbjct  357   CTAEERWREEAVAAGVVVQLLLMVQSECTERAKRKGQKLLKLLRDSWPDYSFANSDDFGC  416

Query  1457  SDVVQF  1474
             S+VV F
Sbjct  417   SEVVPF  422



>emb|CDY16513.1| BnaA08g02540D [Brassica napus]
Length=423

 Score =   471 bits (1211),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 269/424 (63%), Positives = 338/424 (80%), Gaps = 9/424 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISLELM DPVTV TGQTYDR SIESW+ATGNT+CPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLELMTDPVTVSTGQTYDRTSIESWIATGNTSCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
              PL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  S    
Sbjct  60    LPLSDFTLIPNHTLRRLIQEWCVANRSSGVERIPTPKQPADPISVRSLLSQASAISGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMD----SNSSELTHEALS  745
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F+++D    ++SSE+  E+L+
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVDVGVETSSSEVVTESLA  179

Query  746   ILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             +L MF ++E EC  ++SD  RVG++  LL   SI+ RVN+AAL+E V+ G+KS +L+  I
Sbjct  180   LLVMFHMTEGECESISSDPGRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMII  239

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             S +  +F+G++ +L    +  RALK+G+KALFALCLVKQ R  A+ AGA   LI+RL   
Sbjct  240   SGSGSVFEGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAAD  299

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ++CDTER LATVELLCR+P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC+
Sbjct  300   FDRCDTERGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCT  359

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDD++VNSD+F RS+
Sbjct  360   AEERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSE  419

Query  1463  VVQF  1474
             V  F
Sbjct  420   VAPF  423



>ref|XP_009111906.1| PREDICTED: U-box domain-containing protein 25-like [Brassica 
rapa]
Length=417

 Score =   470 bits (1210),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 277/424 (65%), Positives = 337/424 (79%), Gaps = 15/424 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP SL+PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TGN TTCPVT
Sbjct  1     MPRSLEPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGAH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDS+KNR +I+A+NA+++L+ I+FS+ D +SSEL  E+L++L 
Sbjct  120   VSARSRAAALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVSESLALLV  178

Query  755   MFQLSEAE-CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             MF ++E + CV + SD  RV +L  LL   S++ RVN+AALIE  V G+K       +S+
Sbjct  179   MFPMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSS  233

Query  932   ADEIFQGIVGILNHP-STHPR-ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             ++ IF+G++ +L +P S++PR ALK+G+KALFALCL K  R  AV AGA E LI+RL   
Sbjct  234   SESIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAG  293

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
             L++CDTERALATVE+LCR P GCAAF  HALTVP+LVK IL++SDRATEYAAGALL+LC+
Sbjct  294   LDRCDTERALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCT  353

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAGV+ QLLL+VQS CTERAKRKAQ LLKLLRD WPD S  NSDDFA S+
Sbjct  354   AEERWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSE  413

Query  1463  VVQF  1474
             VV F
Sbjct  414   VVPF  417



>gb|ABV89622.1| U-box domain-containing protein [Brassica rapa]
Length=417

 Score =   469 bits (1208),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 277/424 (65%), Positives = 337/424 (79%), Gaps = 15/424 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP SL+PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TGN TTCPVT
Sbjct  1     MPRSLEPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGAH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDS+KNR +I+A+NA+++L+ I+FS+ D +SSEL  E+L++L 
Sbjct  120   VSARSRAAALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVXESLALLV  178

Query  755   MFQLSEAE-CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             MF ++E + CV + SD  RV +L  LL   S++ RVN+AALIE  V G+K       +S+
Sbjct  179   MFPMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSS  233

Query  932   ADEIFQGIVGILNHP-STHPR-ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             ++ IF+G++ +L +P S++PR ALK+G+KALFALCL K  R  AV AGA E LI+RL   
Sbjct  234   SESIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAG  293

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
             L++CDTERALATVE+LCR P GCAAF  HALTVP+LVK IL++SDRATEYAAGALL+LC+
Sbjct  294   LDRCDTERALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCT  353

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAGV+ QLLL+VQS CTERAKRKAQ LLKLLRD WPD S  NSDDFA S+
Sbjct  354   AEERWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSE  413

Query  1463  VVQF  1474
             VV F
Sbjct  414   VVPF  417



>ref|XP_009107285.1| PREDICTED: U-box domain-containing protein 26 [Brassica rapa]
Length=472

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 269/424 (63%), Positives = 338/424 (80%), Gaps = 9/424 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISLELM DPVTV TGQTYDR SIESW+ATGNT+CPVTR
Sbjct  50    MPGNLEPLDLG-IQIPYHFRCPISLELMTDPVTVSTGQTYDRTSIESWIATGNTSCPVTR  108

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
              PL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  S    
Sbjct  109   LPLSDFTLIPNHTLRRLIQEWCVANRSSGVERIPTPKQPADPISVRSLLSQASAISGTHV  168

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMD----SNSSELTHEALS  745
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F+++D    ++SSE+  E+L+
Sbjct  169   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVDVGVETSSSEVVTESLA  228

Query  746   ILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             +L MF ++E EC  ++SD  RVG++  LL   SI+ RVN+AAL+E V+ G+KS +L+  I
Sbjct  229   LLVMFHMTEGECESISSDPGRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMII  288

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             S +  +F+G++ +L    +  RALK+G+KALFALCLVKQ R  A+ AGA   LI+RL   
Sbjct  289   SGSGSVFEGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAAD  348

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ++CDTER LATVELLCR+P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC+
Sbjct  349   FDRCDTERGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCT  408

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDD++VNSD+F RS+
Sbjct  409   AEERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSE  468

Query  1463  VVQF  1474
             V  F
Sbjct  469   VAPF  472



>emb|CDX95458.1| BnaC01g33500D [Brassica napus]
Length=417

 Score =   468 bits (1204),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 277/424 (65%), Positives = 336/424 (79%), Gaps = 15/424 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP SL+PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+TGN TTCPVT
Sbjct  1     MPRSLEPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPLTDFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLTDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGTH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDS+KNR +I+A+NA+++L+ I+FS+ D +SSEL  E+L++L 
Sbjct  120   VSARSRAAALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVSESLALLV  178

Query  755   MFQLSEAE-CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             MF ++E + CV + SD  RV +L  LL   S++ RVN+AALIE  V G+K       +SN
Sbjct  179   MFPMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSN  233

Query  932   ADEIFQGIVGILNHP-STHPR-ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             ++ IF+G++ +L +P S++PR ALK+G+KALFALCL K  R  AV AGA E LI+RL   
Sbjct  234   SESIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAG  293

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
             L++CDTERALATVE+LCR   GCAAF  HALTVP+LVK IL++SDRATEYAAGALL+LC+
Sbjct  294   LDRCDTERALATVEILCRSLEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCT  353

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + ++ + +A AAGV+ QLLL+VQS CTERAKRKAQ LLKLLRD WPD S  NSDDFA S+
Sbjct  354   AEDRWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSE  413

Query  1463  VVQF  1474
             VV F
Sbjct  414   VVPF  417



>gb|EYU37659.1| hypothetical protein MIMGU_mgv1a019070mg, partial [Erythranthe 
guttata]
Length=327

 Score =   464 bits (1195),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 252/328 (77%), Positives = 291/328 (89%), Gaps = 1/328 (0%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G + IPYHFRCPISLELM DPVTVCTGQTYDR+SIESWV TGNTTCPVTR
Sbjct  1     MPGSLEPLDIG-VHIPYHFRCPISLELMCDPVTVCTGQTYDRSSIESWVGTGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PL+DFTLIPNHTLRRLIQEWCVANR+FGVERIPTPKQPA+P LV++LLSQASS S+  +
Sbjct  60    VPLSDFTLIPNHTLRRLIQEWCVANRSFGVERIPTPKQPAEPNLVRTLLSQASSGSAPFS  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
              R+SALRRLRGLARDSDKNRSVI+A NAR++LLS+VF+++ S  SEL  E+++ILSMF L
Sbjct  120   LRVSALRRLRGLARDSDKNRSVIAALNAREILLSVVFADVVSQPSELNLESIAILSMFTL  179

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             SE EC++VASD DRV YLV+LL H SIDVRVNSAA+IE+VVAG +SPE R+QIS +D +F
Sbjct  180   SEPECLYVASDPDRVCYLVNLLFHSSIDVRVNSAAVIENVVAGIRSPEFRTQISCSDGVF  239

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +GIVGIL++P  + RALK+G+KALFALCLVKQHR KAV AGAVEALI+RL   EKCD ER
Sbjct  240   EGIVGILSYPVAYNRALKVGIKALFALCLVKQHRHKAVAAGAVEALIDRLAEFEKCDAER  299

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLL  1210
             ALATVELLCR PSGCAAFA+HALTVPLL
Sbjct  300   ALATVELLCRFPSGCAAFASHALTVPLL  327



>ref|XP_006393215.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
 gb|ESQ30501.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
Length=422

 Score =   465 bits (1197),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 270/423 (64%), Positives = 336/423 (79%), Gaps = 8/423 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQ+PYHFRCPISL+LM DPVTV TGQTYDR+SIESW+A GNTTCP TR
Sbjct  1     MPGNLEPLDLG-IQVPYHFRCPISLDLMSDPVTVSTGQTYDRSSIESWIAMGNTTCPATR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GV RIPTPKQPADP     + S  S  S    
Sbjct  60    VALSDFTLIPNHTLRRLIQEWCVANRSNGVVRIPTPKQPADPISVRSLLSQASAISGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVF--SNMDSNSSELTHEALSIL  751
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F      S+SSEL  E+L++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFDAGRESSSSSELVFESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +F ++E EC  +ASD  RVG++  LL   SI+VRVN+AALIE V+ G+KS +L+  IS 
Sbjct  180   VIFHMTEEECESIASDPGRVGFMTRLLFDSSIEVRVNAAALIEMVLTGSKSTDLKLVISG  239

Query  932   ADEIFQGIVGILNHP-STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-L  1105
             +D +F+G++ +L +P S+  RALK+G+KALFALCLVKQ R  A+ AGA   LI+RL    
Sbjct  240   SDSVFEGVLDLLKNPISSSRRALKIGIKALFALCLVKQTRHLAISAGAPGILIDRLAADF  299

Query  1106  EKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcss  1285
             ++CDTER LATVELLCR+P GC+ F  HALTVPLLVK IL++SDRATEYAAGALL+LC++
Sbjct  300   DRCDTERGLATVELLCRLPEGCSGFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTA  359

Query  1286  sEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDV  1465
              E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDD++VNSDDF RS+V
Sbjct  360   EERCRDEAAAAGLVTQLLLLVQSECTERAKRKAQMLLKLLRDSWPDDTLVNSDDFGRSEV  419

Query  1466  VQF  1474
             V F
Sbjct  420   VPF  422



>emb|CDY59286.1| BnaCnng34640D [Brassica napus]
Length=423

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 267/424 (63%), Positives = 333/424 (79%), Gaps = 9/424 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISLELM DPVTV TGQTYDR SIESW+ATGNT+CPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLELMSDPVTVSTGQTYDRTSIESWIATGNTSCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
              PL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  S    
Sbjct  60    LPLSDFTLIPNHTLRRLIQEWCVANRSSGVERIPTPKQPADPISVRSLLSQASAISGAHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEA----LS  745
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F+++D      + E     L+
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVDVGVETSSSEVVSESLA  179

Query  746   ILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             +L MF ++E EC  ++SD DRVG++  LL   SI+ RVN+AAL+E V+ G+KS +L+  I
Sbjct  180   LLVMFHMTEGECDSISSDPDRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMII  239

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             S +  +F+G++ +L    +  RALK+G+KALFALCLVKQ R  A+ AGA   LI+RL   
Sbjct  240   SGSGSVFEGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAAD  299

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ++CDTER LATVELLCR+P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC+
Sbjct  300   FDRCDTERGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCT  359

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDD++VN D+F RS+
Sbjct  360   AEERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNDDEFGRSE  419

Query  1463  VVQF  1474
             VV F
Sbjct  420   VVPF  423



>gb|KFK39278.1| hypothetical protein AALP_AA3G223600 [Arabis alpina]
Length=418

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 275/422 (65%), Positives = 337/422 (80%), Gaps = 10/422 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDR SIESWV+ GNTTCPVTR
Sbjct  1     MPTNLVPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSIGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APL+DFTLIPNHTLRRLIQEWCVANR++GVERIPTPKQPADP  V++LLSQAS+ S    
Sbjct  60    APLSDFTLIPNHTLRRLIQEWCVANRSYGVERIPTPKQPADPTSVRALLSQASATSGAHV  119

Query  587   srlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSM  757
             S  S    LR L   ARDSDKNR +I+A+NA ++L+ I+F++++ +SSEL  E+L++L M
Sbjct  120   SVRSRAAALRRLRGFARDSDKNRVLIAAHNAGEILIRILFNSVN-DSSELVSESLALLVM  178

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
             F +++ E +  ASD +RV +L  LL   SI+ RVN+AALIE V+ GTKS +L+  ISN++
Sbjct  179   FPITDPESI--ASDPNRVEFLTRLLYDSSIETRVNAAALIEMVLTGTKSSDLKEAISNSE  236

Query  938   EIFQGIVGILNHP-STHPR-ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
              +FQG++ IL +P S++PR ALK+G+KALFALCL K  R  AV +GA E LI+RL    +
Sbjct  237   SVFQGVLDILRNPISSYPRRALKIGIKALFALCLSKTARHIAVFSGAPEILIDRLASDFD  296

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +C+TERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL++C++ 
Sbjct  297   RCETERALATVELLCRSPEGCAAFGDHALTVPLLVKTILRVSDRATEYAAGALLAICTAE  356

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             E+ + +A AAGV+ QLLL+VQS CTERAK+KAQ LLKLLRD WPD S  NS  FA S VV
Sbjct  357   ERWREEAAAAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYSFANSHHFACSQVV  416

Query  1469  QF  1474
              F
Sbjct  417   PF  418



>ref|XP_002894216.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70475.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=421

 Score =   455 bits (1171),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 333/422 (79%), Gaps = 7/422 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  +    
Sbjct  60    VALSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAVTGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL--SIL  751
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F+++++ SS     +   ++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVETTSSSSELVSESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +  ++E EC  +ASD  RVG++  LL   SI++RVN+AALIE V+ G+KS +L+  IS 
Sbjct  180   VLLHMTETECEAIASDPGRVGFMTRLLFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             +D IF+G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AGA   LI+RL    +
Sbjct  240   SDSIFEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFD  299

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTER LATVELLCR+P GCAAF  HALTVPL+VK IL++SDRATEYAAGALL+LC++ 
Sbjct  300   RCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAE  359

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDDS VNSDDF RS+V 
Sbjct  360   ERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVNSDDFNRSEVA  419

Query  1469  QF  1474
              F
Sbjct  420   PF  421



>ref|XP_006406505.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
 gb|ESQ47958.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
Length=420

 Score =   454 bits (1168),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 280/424 (66%), Positives = 343/424 (81%), Gaps = 12/424 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP SL+PLD+G IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV+ GN TTCPVT
Sbjct  1     MPRSLEPLDLG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVSIGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs---  574
             RAPLTDFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS++    
Sbjct  60    RAPLTDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAIYGPH  119

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
               + SR +ALRRLRG ARDS+KNR +I+A+NA+++L+ I+FS+   +S E+  E+L++L 
Sbjct  120   VSVRSRSAALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD---DSPEVVSESLALLV  176

Query  755   MFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             MF ++E  +CV +ASD  RV +L  LL   S++ RVN+AALIE V  G+KSP+L+   SN
Sbjct  177   MFPMTEPDQCVSIASDPGRVEFLTRLLFDSSLETRVNAAALIEMVSTGSKSPDLKGMFSN  236

Query  932   ADEIFQGIVGILNHP-STHPR-ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-  1102
             ++ +F+G++ +L +P S++PR ALK+G+K LFALCL K  R  AV AGA E LI+RL   
Sbjct  237   SESVFEGVLDLLRNPISSYPRRALKIGIKTLFALCLPKNTRHIAVSAGAPEILIDRLAAD  296

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ++CDTERALATVELLCR+P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC+
Sbjct  297   FDRCDTERALATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCT  356

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSD  1462
             + E+ + +A AAGV+ QLLL+VQS CTERAK+KAQ LLKLLRD WPD S  NSDDF  S 
Sbjct  357   AEERWRDEAAAAGVVVQLLLIVQSECTERAKKKAQKLLKLLRDSWPDYSFANSDDFVCSQ  416

Query  1463  VVQF  1474
             VV F
Sbjct  417   VVPF  420



>ref|XP_010500528.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=422

 Score =   453 bits (1166),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 264/423 (62%), Positives = 334/423 (79%), Gaps = 8/423 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  +    
Sbjct  60    VSLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL--SIL  751
              + SR +A+RRLRGLARDS+KNR +I+A+NAR+VL+ I+F+++++ SS     +   ++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAAHNAREVLVRILFADVETTSSSSELVSESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +  ++E EC  VASD  RVG++  LL   SI++RVN+AAL+E V+ G+KS +L+  IS 
Sbjct  180   VVLHMTETECEAVASDPGRVGFMTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             +D IF+G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AGA   LI+RL    +
Sbjct  240   SDSIFEGVLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAAGILIDRLAADFD  299

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTER LATVELLCR+P GCAAF  HALTVPL+VK IL++SDRATEYAAGALL+LC++ 
Sbjct  300   RCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAE  359

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD-SIVNSDDFARSDV  1465
             E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDD S VNSDDF R++V
Sbjct  360   ERFRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEV  419

Query  1466  VQF  1474
               F
Sbjct  420   APF  422



>ref|NP_175400.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
 sp|Q9FXA4.1|PUB26_ARATH RecName: Full=U-box domain-containing protein 26; AltName: Full=Plant 
U-box protein 26 [Arabidopsis thaliana]
 gb|AAG13057.1|AC011807_16 Hypothetical protein [Arabidopsis thaliana]
 gb|ABI93922.1| At1g49780 [Arabidopsis thaliana]
 gb|AEE32475.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
Length=421

 Score =   453 bits (1166),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 262/422 (62%), Positives = 331/422 (78%), Gaps = 7/422 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  +    
Sbjct  60    VALSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL--SIL  751
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F+++++ S      +   ++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADIETTSLSSELVSESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +  ++E EC  VASD  RVG++  LL   SI++RVN+AALIE V+ G KS +L+  IS 
Sbjct  180   VLLHMTETECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             +D IF+G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AGA   LI+RL    +
Sbjct  240   SDSIFEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFD  299

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTER LATVELLCR+P GCAAF  HALTVPL+VK IL++SDRATEYAAGALL+LC++ 
Sbjct  300   RCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAE  359

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDDS V+SDDF RS+V 
Sbjct  360   ERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVA  419

Query  1469  QF  1474
              F
Sbjct  420   PF  421



>ref|XP_010461826.1| PREDICTED: U-box domain-containing protein 26 [Camelina sativa]
Length=422

 Score =   452 bits (1164),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 265/423 (63%), Positives = 334/423 (79%), Gaps = 8/423 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  +    
Sbjct  60    VSLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL--SIL  751
              + SR +A+RRLRGLARDS+KNR +I+A+NAR+VL+ I+F+++++ SS     +   ++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAAHNAREVLVRILFADVETTSSSSELVSESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +  ++E EC  VASD  RVG+L  LL   SI++RVN+AAL+E V+ G+KS +L+  IS 
Sbjct  180   VVLHMTETECEAVASDPGRVGFLTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             +D IF+G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AGA   LI+RL    +
Sbjct  240   SDSIFEGVLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFD  299

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTER LATVELLCR+P GCAAF  HALTVPL+VK IL++SDRATEYAAGALL+LC++ 
Sbjct  300   RCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAE  359

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD-SIVNSDDFARSDV  1465
             E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDD S VNSDDF R++V
Sbjct  360   ERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEV  419

Query  1466  VQF  1474
               F
Sbjct  420   APF  422



>ref|XP_006306175.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
 gb|EOA39073.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
Length=422

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 263/423 (62%), Positives = 333/423 (79%), Gaps = 8/423 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GV RIPTPKQPADP     + S  S  +    
Sbjct  60    VALSDFTLIPNHTLRRLIQEWCVANRSNGVVRIPTPKQPADPISVRSLLSQASAITGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEA---LSI  748
              + SR +A+RRLRGLARDS+KNR +I+ +NAR++L+ I+F++++++SS  +      L++
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVETSSSPSSELVSESLAL  179

Query  749   LSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQIS  928
             L +  ++E EC  VASD  RVG++  LL   SI++RVN+AALIE V+ G+KS +L+  IS
Sbjct  180   LVVLHMTETECEAVASDPGRVGFMTRLLFDSSIEIRVNAAALIEMVLTGSKSMDLKLIIS  239

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-L  1105
              +D IF G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AGA   LI+RL    
Sbjct  240   GSDSIFVGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADF  299

Query  1106  EKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcss  1285
             ++CDTER LATVELLCR+P GCAAF  HALTVPL+VK IL++SDRATEYAAGALL+LC++
Sbjct  300   DRCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTA  359

Query  1286  sEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDV  1465
              E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDDS  NSDDFAR++V
Sbjct  360   EERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTANSDDFARTEV  419

Query  1466  VQF  1474
               F
Sbjct  420   APF  422



>gb|KFK35978.1| hypothetical protein AALP_AA4G062500 [Arabis alpina]
Length=432

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 263/433 (61%), Positives = 334/433 (77%), Gaps = 18/433 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISLELM DPVT+ TGQTYDR SIESW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLELMSDPVTISTGQTYDRTSIESWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
                +DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  S    
Sbjct  60    LSFSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAISGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSS------------  721
              + SR +A+RRLRGLARDS+KNR +I+A+NA+++L++I+FS++D+  S            
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAAHNAKEILINILFSDVDAGKSSSSPSSSPYPSS  179

Query  722   ELTHEALSILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTK  901
             EL  E++++L +F L+E ECV +ASDL RV ++  LL    ID RVN+AALIE V+ G K
Sbjct  180   ELVTESVALLVIFHLTETECVSIASDLGRVKFITRLLFDSLIDNRVNAAALIEMVLTGVK  239

Query  902   SPELRSQISNADEIFQGIVGILNHP-STHPRALKMGVKALFALCLVKQHRQKAVIAGAVE  1078
             S +L+  IS +D +F+G++ +L +P S+  RALK+G+K++FALCLVKQ R  AV AG   
Sbjct  240   SHDLKLMISGSDSVFEGVLDLLKNPNSSSRRALKIGIKSVFALCLVKQSRHLAVSAGVPA  299

Query  1079  ALIERLQY-LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYa  1255
              LI+RL    ++CDTER LATVELLCR+P GCAAF+ HALTV  LVK IL++S+RATEYA
Sbjct  300   VLIDRLAADFDRCDTERGLATVELLCRLPEGCAAFSEHALTVDFLVKTILRVSERATEYA  359

Query  1256  agallslcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
             AGALL+LC++ E+ + +AV  G++TQLLLLVQS CTERAKRKAQMLLKLLRD WP++++ 
Sbjct  360   AGALLALCTAEERCREEAVTVGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPENNLG  419

Query  1436  NSDDFARSDVVQF  1474
             NSD+F RS+V  F
Sbjct  420   NSDEFGRSEVAPF  432



>dbj|BAC42960.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 260/422 (62%), Positives = 329/422 (78%), Gaps = 7/422 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  +    
Sbjct  60    VALSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL--SIL  751
              + SR +A+RRLRGLARDS+KNR +I+ +NA ++L+ I+F+++++ S      +   ++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAGHNAGEILVRILFADIETTSLSSELVSESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +  ++E EC  VASD  RVG++  LL   SI++RVN+AALIE V+ G KS +L+  IS 
Sbjct  180   VLLHMTETECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             +D IF+G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AG    LI+RL    +
Sbjct  240   SDSIFEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGVPGILIDRLAADFD  299

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTER LATVELLCR+P GCAAF  HALTVPL+VK IL++SDRATEYAAGALL+LC++ 
Sbjct  300   RCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAE  359

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             E+ + +A AAG++TQLLLLVQS CTERAKRKAQMLLKLLRD WPDDS V+SDDF RS+V 
Sbjct  360   ERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVA  419

Query  1469  QF  1474
              F
Sbjct  420   PF  421



>ref|XP_008236490.1| PREDICTED: U-box domain-containing protein 26-like [Prunus mume]
Length=436

 Score =   447 bits (1150),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 273/414 (66%), Positives = 323/414 (78%), Gaps = 36/414 (9%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP SL+PLD+G +QIPYHFRCPISLELMRDPVTV TGQTYDR SIESWVATGNTTCP   
Sbjct  56    MPGSLEPLDLG-VQIPYHFRCPISLELMRDPVTVSTGQTYDRPSIESWVATGNTTCPA--  112

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
                                              PTPKQPADP  ++ LL+Q++S S+   
Sbjct  113   ---------------------------------PTPKQPADPTHIRHLLTQSASNSNTYP  139

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +RLSALRRLRGLARD DKNRS IS+ N+R++L+ +VF++  S SSELTHEAL++L +F L
Sbjct  140   TRLSALRRLRGLARDLDKNRSTISSQNSREILVQLVFADTGSESSELTHEALALLVLFPL  199

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E++C  VASD DRV YL  L+ H S++VRVNSAALIE+V+AG+++ ELR++ISN DEI 
Sbjct  200   PESDCAAVASDPDRVAYLARLVQHSSMEVRVNSAALIENVLAGSRTAELRAEISNVDEIH  259

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             QG+V IL +P  +PRALK+G+KALFALCLVKQ R KAV AGA E LI  L   EKCD+ER
Sbjct  260   QGVVSILRNPIAYPRALKIGIKALFALCLVKQTRNKAVSAGAPETLINTLADFEKCDSER  319

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             ALAT+ELLCR+P GC AFAAHALTVPLLVK ILKISDRATEYAAGALLSLCS+SE++Q D
Sbjct  320   ALATIELLCRVPDGCTAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSASEKSQND  379

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVV  1468
             AVAAGVLTQLLLLVQS CT+RAKRKAQ+LLKLLRD WP+DS+ NSDDF  S++V
Sbjct  380   AVAAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELV  433



>ref|NP_566632.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
 sp|Q9LT79.1|PUB25_ARATH RecName: Full=U-box domain-containing protein 25; AltName: Full=Plant 
U-box protein 25 [Arabidopsis thaliana]
 dbj|BAB02462.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63504.1| unknown [Arabidopsis thaliana]
 gb|ABG25071.1| At3g19380 [Arabidopsis thaliana]
 gb|AEE76233.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
Length=421

 Score =   441 bits (1135),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 270/424 (64%), Positives = 332/424 (78%), Gaps = 11/424 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP +++PLD+G IQIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVT
Sbjct  1     MPRNIEPLDLG-IQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+++   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAITGTH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDSDKNR +I+A+NA ++L+ I+FS  ++ SSEL  E+L++L 
Sbjct  120   VSVRSRAAALRRLRGFARDSDKNRVLIAAHNATEILIKILFS--ETTSSELVSESLALLV  177

Query  755   MFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             M  ++E  + V ++SD  RV +L  LL   SI+ RVN+AALIE V  GTKS +L+  ISN
Sbjct  178   MLPITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISN  237

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             ++ +F+G++ +L +P +  RALK+G+K LFALC VK  R  A+ AGA E LI+RL    +
Sbjct  238   SESVFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFD  297

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC++ 
Sbjct  298   RCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAE  357

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-DSIVNSDDFA-RSD  1462
             E+ + +A  AGV+ QLLL+VQS CTERAK+KAQ LLKLLRD WPD +S  NSDDF   S 
Sbjct  358   ERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQ  417

Query  1463  VVQF  1474
             VV F
Sbjct  418   VVPF  421



>ref|XP_006299353.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
 gb|EOA32251.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
Length=425

 Score =   442 bits (1136),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 272/428 (64%), Positives = 330/428 (77%), Gaps = 15/428 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP +L+PLD+G IQIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVT
Sbjct  1     MPRNLEPLDLG-IQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPSSVRALLSQASATSGAH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDS+KNR +I+A+NA  +L+ I+FS  ++ SSEL  E+L++L 
Sbjct  120   VSVRSRAAALRRLRGFARDSEKNRVLIAAHNATGILIMILFS--ETTSSELVSESLALLV  177

Query  755   MFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             M  ++E  + V ++SD  RV +L  LL   SI+ RVN+AALIE V  GTKS +L    SN
Sbjct  178   MLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLVGMFSN  237

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             ++ +F+G++ +L +P +  RALK+G+KALFALCL KQ R  A+ AGA E LI+RL    +
Sbjct  238   SESVFEGVLDLLRNPISSRRALKIGIKALFALCLAKQTRHLAITAGAPEILIDRLAADFD  297

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC++ 
Sbjct  298   RCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLTLCTAE  357

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD------DSIVNSDDF  1450
             E+ + +A  AGV+ QLLL+VQS CTERAK+KAQ LLKLLR+ WPD       S  NSDDF
Sbjct  358   ERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRNSWPDYNHHNNSSFANSDDF  417

Query  1451  ARSDVVQF  1474
             A S VV F
Sbjct  418   ACSQVVPF  425



>dbj|BAF01749.1| hypothetical protein [Arabidopsis thaliana]
Length=419

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 267/421 (63%), Positives = 329/421 (78%), Gaps = 11/421 (3%)
 Frame = +2

Query  236   SLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAP  412
             +++PLD+G IQIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVTRAP
Sbjct  2     NIEPLDLG-IQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAP  60

Query  413   LTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr  592
             L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+++    S 
Sbjct  61    LSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAITGTHVSV  120

Query  593   lsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQ  763
              S    LR L   ARDSDKNR +I+ +NA ++L+ I+FS  ++ SSEL  E+L++L M  
Sbjct  121   RSRAAALRRLRGFARDSDKNRVLIATHNATEILIKILFS--ETTSSELVSESLALLVMLP  178

Query  764   LSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             ++E  + V ++SD  RV +L  LL   SI+ RVN+AALIE V  GTKS +L+  ISN++ 
Sbjct  179   ITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSES  238

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LEKCD  1117
             +F+G++ +L +P +  RALK+G+K LFALC VK  R  A+ AGA E LI+RL    ++CD
Sbjct  239   VFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCD  298

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
             TERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL+LC++ E+ 
Sbjct  299   TERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERW  358

Query  1298  QRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-DSIVNSDDFA-RSDVVQ  1471
             + +A  AGV+ QLLL+VQS CTERAK+KAQ LLKLLRD WPD +S  NSDDF   S VV 
Sbjct  359   REEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVP  418

Query  1472  F  1474
             F
Sbjct  419   F  419



>ref|XP_010466083.1| PREDICTED: U-box domain-containing protein 25 [Camelina sativa]
Length=424

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 271/427 (63%), Positives = 327/427 (77%), Gaps = 14/427 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP +L+PLD+G IQIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVT
Sbjct  1     MPRNLEPLDLG-IQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGTH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDSDKNR +I+A+NA  VL+ I+FS  ++ SSEL  E+L++L 
Sbjct  120   VSVRSRAAALRRLRGFARDSDKNRVLIAAHNATAVLIMILFS--ETTSSELVSESLALLV  177

Query  755   MFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             M  ++E  + V ++SD  RV +L  LL   SI+ RVN+AALIE V  GTKS + +   SN
Sbjct  178   MLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSN  237

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
              + +F+G++ +L +P +  RALK+G+KALF+LC  KQ R  A+ AGA E LI+RL    +
Sbjct  238   YESVFEGVLDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFD  297

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL++C+  
Sbjct  298   RCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTEE  357

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-----DSIVNSDDFA  1453
             E+ + +A  AGV+ QLLL+VQS CTERAK+KAQ LLKLLRD WPD      S  NSDDFA
Sbjct  358   ERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNNHNSSFANSDDFA  417

Query  1454  RSDVVQF  1474
              S VV F
Sbjct  418   CSQVVPF  424



>ref|XP_010507691.1| PREDICTED: U-box domain-containing protein 25-like [Camelina 
sativa]
Length=425

 Score =   429 bits (1103),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 270/428 (63%), Positives = 327/428 (76%), Gaps = 15/428 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP +L+PLD+G IQIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVT
Sbjct  1     MPRNLEPLDLG-IQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGTH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDSDKNR +I+A+NA  VL+ I+FS  ++ SSEL  E+L++L 
Sbjct  120   VSVRSRAAALRRLRGFARDSDKNRVLIAAHNATAVLVIILFS--ETTSSELVSESLALLV  177

Query  755   MFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             M  ++E  + V ++SD  RV +L  LL   SI+ RVN+AALIE V  GTKS + +   SN
Sbjct  178   MLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSEDPKGTFSN  237

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
              + +F+G++ +L +P +  RALK+G+KALF+LC  KQ R  A+ AGA E LI+RL    +
Sbjct  238   YESVFEGVLNLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFD  297

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             +CDTERALATVELLCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL++C+  
Sbjct  298   RCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTEE  357

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD------DSIVNSDDF  1450
             E+ + +A  AGV+ QLLL+VQS CTERAK+KAQ LLKLLRD WPD      +S  NSDDF
Sbjct  358   ERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNNHNNNSFANSDDF  417

Query  1451  ARSDVVQF  1474
             A S V  F
Sbjct  418   ACSQVAPF  425



>ref|XP_006847114.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
 gb|ERN08695.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
Length=420

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 250/425 (59%), Positives = 318/425 (75%), Gaps = 14/425 (3%)
 Frame = +2

Query  227   MPASLD--PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPV  400
             MP S+   PL+V  +QIP+HFRCPISLELMRDPVTV TGQTYDRASIESWVATG+ TCPV
Sbjct  1     MPGSVPVAPLEVRALQIPHHFRCPISLELMRDPVTVSTGQTYDRASIESWVATGHATCPV  60

Query  401   TRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvssh  580
             TR PL D TLIPNHTLRRLIQEWCVAN A GVERIPTPKQPADP L++++L+QA S SS 
Sbjct  61    TRQPLQDQTLIPNHTLRRLIQEWCVANHALGVERIPTPKQPADPTLIRAILAQAESASSS  120

Query  581   lnsrlsalrrlrglardsDKNRSVIS--ANNARQVLLSIVFSNMDS-----NSSELTHEA  739
               +RLSAL+RL  L ++S  NR+ IS   ++    +L +   + ++     NS +L  EA
Sbjct  121   SQARLSALQRLNALTKESPHNRAHISLAMHDPHPAILLLALHDPNTIHDPQNSDDLVQEA  180

Query  740   LSILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRS  919
             +S++++    E  C  V S+ + +  L  LL H S+DVR N+AA++E+ ++  +  E R+
Sbjct  181   ISLIALA--PEPYCASVVSNSNHLSRLSVLLVHASLDVRANTAAIVEAALSSGR--ESRA  236

Query  920   QISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ  1099
              I   D +   +V +L  P  HPRALK+ VK+LF+LCL K +R+ A+ AGA  AL+ERL 
Sbjct  237   IIGATDGLIPALVNLLREPLAHPRALKLAVKSLFSLCLAKPNRELAIEAGAASALVERLV  296

Query  1100  YLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
              L++CD ERALAT+ELLCR P+GCAAF AHAL VPLLVK+ILK+SDRATE AAGALL++C
Sbjct  297   DLDRCDAERALATIELLCRTPAGCAAFEAHALAVPLLVKMILKVSDRATESAAGALLAVC  356

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFARS  1459
             ++SE  Q++AV  GV+TQLLLLVQS CT RAKRKAQ+LLKLLRD WPD+S+ NS D+A S
Sbjct  357   ATSEATQKEAVTVGVVTQLLLLVQSECTARAKRKAQLLLKLLRDAWPDESVANS-DYACS  415

Query  1460  DVVQF  1474
             D+V F
Sbjct  416   DIVPF  420



>ref|XP_010468287.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=412

 Score =   419 bits (1077),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 263/414 (64%), Positives = 316/414 (76%), Gaps = 13/414 (3%)
 Frame = +2

Query  266   QIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPNH  442
             QIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVTRAPL+DFTLIPNH
Sbjct  1     QIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNH  60

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S    S  S    LR L
Sbjct  61    TLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGTHVSVRSRAAALRRL  120

Query  623   ---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEA-ECVFV  790
                ARDSDKNR +I+A+NA  VL+ I+FS  ++ SSEL  E+L++L M  ++E  + V +
Sbjct  121   RGFARDSDKNRVLIAAHNATAVLIMILFS--ETTSSELVSESLALLVMLPITEPNQLVSI  178

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
             +SD  RV +L  LL   SI+ RVN+AALIE V  GTKS + +   SN + +F+G++ +L 
Sbjct  179   SSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGVLDLLR  238

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LEKCDTERALATVEL  1147
             +P +  RALK+G+KALF+LC  KQ R  A+ AGA E LI+RL    ++CDTERALATVEL
Sbjct  239   NPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERALATVEL  298

Query  1148  LCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVAAGVL  1327
             LCR P GCAAF  HALTVPLLVK IL++SDRATEYAAGALL++C+  E+ + +A  AGV+
Sbjct  299   LCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAAGAGVV  358

Query  1328  TQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-----DSIVNSDDFARSDVVQF  1474
              QLLL+VQS CTERAK+KAQ LLKLLRD WPD      S  NSDDFA S VV F
Sbjct  359   VQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNNHNSSFANSDDFACSQVVPF  412



>ref|XP_002885309.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61568.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   400 bits (1027),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 253/399 (63%), Positives = 310/399 (78%), Gaps = 12/399 (3%)
 Frame = +2

Query  308   MRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPNHTLRRLIQEWCVANR  484
             M+DPVTVCTGQTYDRASIESWV+ GN TTCPVTRAPL+DFTLIPNHTLRRLIQEWCVANR
Sbjct  1     MQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNHTLRRLIQEWCVANR  60

Query  485   AFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl---ardsDKNRSVI  655
             + GVERIPTPKQPADP  V++LLSQAS+++    S  S    LR L   ARDSDKNR +I
Sbjct  61    SNGVERIPTPKQPADPTSVRALLSQASAITGTHVSVRSRAAALRRLRGFARDSDKNRVLI  120

Query  656   SANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSE-AECVFVASDLDRVGYLVSLL  832
             +A+NA +VL+ I+FS  ++ SSEL  E+L++L M  ++E  +CV ++SD  RV +L  LL
Sbjct  121   AAHNATEVLIRILFS--ETTSSELVSESLALLVMLPITEPNQCVSISSDPGRVEFLTRLL  178

Query  833   SHPSIDVRVNSAALIESVVAGTKSPELRS--QISNADEIFQGIVGILNHPSTHPRALKMG  1006
                SID RVN+AALIE V  GTKS +L+    ISN++ +F+G++ +L +P +  RALK+G
Sbjct  179   FDSSIDTRVNAAALIEIVSTGTKSADLKGMFSISNSESVFEGVLDLLRNPISSRRALKIG  238

Query  1007  VKALFALCLVKQHRQKAVIAGAVEALIERLQY-LEKCDTERALATVELLCRIPSGCAAFA  1183
             +K LFALCLVK  R  A+ AGA E LI+RL    ++CDTERALATVELLCR P GCAAF 
Sbjct  239   IKTLFALCLVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRSPEGCAAFG  298

Query  1184  AHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVAAGVLTQLLLLVQSGCT  1363
              HALTVPLLVK IL++SDR+TEYAAGALL+LC++ E+ + +A AAGV+ QLLL+VQS CT
Sbjct  299   EHALTVPLLVKTILRVSDRSTEYAAGALLALCTAEERWREEAAAAGVVVQLLLMVQSECT  358

Query  1364  ERAKRKAQMLLKLLRDCWPD-DSIVNSDDFA-RSDVVQF  1474
             ERAK+KAQ LLKLLRD WPD +S  NSDDF   S VV F
Sbjct  359   ERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVPF  397



>ref|XP_009416906.1| PREDICTED: U-box domain-containing protein 26 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 231/421 (55%), Positives = 291/421 (69%), Gaps = 18/421 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP S+ PLD+ G+ IP+HFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN TCPVTR
Sbjct  1     MPGSVAPLDLAGVTIPHHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNITCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               LTDFTLIPNHTLRRLIQ+WCV++R+ GVERIPTPKQPAD          AS+    + 
Sbjct  61    TRLTDFTLIPNHTLRRLIQDWCVSHRSLGVERIPTPKQPAD--APLVRSLLASAAVGSVA  118

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMD----SNSSELTHEALSILS  754
             SR++ALRRL  LAR+S+KNR+VIS +  R  LL I F   +    S++ +   EA+++LS
Sbjct  119   SRVAALRRLCALARESEKNRAVISTHETRSALLEIAFEGGEQPGCSDADQPALEAMAVLS  178

Query  755   MFQLSEAECVFVASD---LDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             M  LSEAE   VA+    L R+G +V    HPS + R+N+AA+IESV  GT+S E R+ I
Sbjct  179   MLPLSEAESAVVATRPERLHRLGEIVK--GHPSSEARINAAAVIESVATGTRSAETRATI  236

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYL  1105
                D +  G+V ++  P  +PRA+++G++ L A+CL K++R +AV AGA  A++ R+  L
Sbjct  237   GGMDGVMGGLVALVEQPG-NPRAVRVGIRGLLAMCLAKENRARAVAAGAAAAVVRRMGEL  295

Query  1106  EKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVK-----IILKISDRATEYaagall  1270
                D ERALATVELLCR   G  A  A        V      +  K S RA E+AAGAL+
Sbjct  296   SSSDLERALATVELLCRGEGGREAVVAGWGGGAAAVAALVRLMAWKASGRAAEHAAGALV  355

Query  1271  slcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDD  1447
             ++   SE  QR+AVAAGV+  LLL+VQ GC++RAKRKAQ+LLKLLR  WP  D I NSDD
Sbjct  356   AVLGGSEALQREAVAAGVVAHLLLMVQGGCSDRAKRKAQLLLKLLRPAWPYRDFIANSDD  415

Query  1448  F  1450
             F
Sbjct  416   F  416



>ref|XP_008784183.1| PREDICTED: U-box domain-containing protein 25-like [Phoenix dactylifera]
Length=416

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 228/417 (55%), Positives = 299/417 (72%), Gaps = 14/417 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP S+ PLD+ G+ +PYH+RCPISLELMRDPVTVCTGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSVAPLDLEGVTVPYHYRCPISLELMRDPVTVCTGQTYDRPSIESWVATGNTTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP      L  + + +    
Sbjct  61    TPLTDFTLIPNHTLRRLIQEWCVAHRSLGVERIPTPKQPADP--SLVRLLVSQASAGEPG  118

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +R +ALRRLR LAR+SDKNR+VIS +  R  L+ I F + DS+   L  EA+ +L+M  L
Sbjct  119   TRAAALRRLRSLARESDKNRTVISTHETRSALIVIAFEDPDSD---LGLEAIRVLAMCSL  175

Query  767   SEAECVFVASDLDRVGYLVSLL-SHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             +E E   VA   +R+  LV ++  HP+++ R+++AA++E+V AG +S E R+ +   + +
Sbjct  176   TEGESAEVAGRPERLRRLVEVMREHPAMEARISAAAVLEAVAAGARSAEARAAVGATEGV  235

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYL--EKCD  1117
              +G+VG++    +  RA+++G++ LF+LCL K++R +AV AGA  A++ R+  L  E+ D
Sbjct  236   MEGLVGLVEEKGSSARAVRVGIRGLFSLCLAKENRGRAVAAGAAAAVVRRIVDLAAERGD  295

Query  1118  TERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ERALATVELLCR   G       A    A    L+  +  K S+RA E+AAGAL+++  
Sbjct  296   AERALATVELLCRTEGGREAVVAGAGGGAAAVEALVRAMAGKASERAAEHAAGALVAVVG  355

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
              SE  QR+AV AGV+TQLLL+VQ GC++RAKRKAQ+LLKLLR  WP DD I NSDDF
Sbjct  356   GSECLQREAVGAGVVTQLLLMVQGGCSDRAKRKAQVLLKLLRSAWPHDDYIANSDDF  412



>ref|XP_010912457.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Elaeis guineensis]
Length=411

 Score =   342 bits (876),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 221/417 (53%), Positives = 290/417 (70%), Gaps = 19/417 (5%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP S+ PLD+ G+ +PYHFRCPISLELMRDPVTVCTGQTYDR SIESWVATGNTTCPVTR
Sbjct  1     MPGSVAPLDLEGVTVPYHFRCPISLELMRDPVTVCTGQTYDRPSIESWVATGNTTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
              PLTDFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP      L  + + +    
Sbjct  61    TPLTDFTLIPNHTLRRLIQEWCVAHRSLGVERIPTPKQPADP--SLVRLLVSQASAGEHG  118

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             +R +ALRRLR LA++SDKNR+VIS +  R  L+ I F +      +L  EA+ +L+M  L
Sbjct  119   TRSAALRRLRSLAQESDKNRAVISTHETRSALIEIAFED---PHPDLGLEAMGVLAMCSL  175

Query  767   SEAECVFVASDLDRVGYLVSLL-SHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             +E E   VA   +R+  LV ++  HP+++ R+++AA++E+V AG +     + +   + +
Sbjct  176   TEGESAEVAGRPERLRRLVEVMREHPAMEARISAAAVLEAVAAGAR-----AAVGATEGV  230

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKC--D  1117
              +G+VG+L    +  RA++ G++ LF+LCL K++R +AV AGA  A++   +       D
Sbjct  231   MEGLVGLLEEKGSSARAVRAGIRGLFSLCLAKENRGRAVAAGAAAAVVXADRGAGGXARD  290

Query  1118  TERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ERALATVELLCR   G       A    A  V L+  +  K S+RA E+AAGAL+++  
Sbjct  291   AERALATVELLCRTEGGREAVVAGAGGGAAAVVALVRAMAGKASERAAEHAAGALVAVVG  350

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
              SE  QR+AV AG++TQLLL+VQ GC++RAKRKAQ+LLKLLR  WP  DSI NSDDF
Sbjct  351   GSEWLQREAVGAGLVTQLLLMVQGGCSDRAKRKAQLLLKLLRSAWPHHDSIANSDDF  407



>ref|XP_009406118.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Musa acuminata subsp. malaccensis]
Length=421

 Score =   341 bits (875),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 232/421 (55%), Positives = 297/421 (71%), Gaps = 13/421 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP S+ PLD+ G+ IP+HFRCPISLELMRDPVT+CTGQTYDRASIESW+ATGNTTCPVTR
Sbjct  1     MPGSVAPLDLAGVTIPHHFRCPISLELMRDPVTMCTGQTYDRASIESWMATGNTTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             APLTDFTLIPNH LRRLIQ+WCVA+R+ GVERIPTPKQPADP  +   L  +++ SS   
Sbjct  61    APLTDFTLIPNHNLRRLIQDWCVAHRSLGVERIPTPKQPADP-SLVRSLLDSAAASSFSA  119

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDS----NSSELTHEALSILS  754
             SR++ALRRLR LAR+SDKNR+VIS +  R  L+ I F   +      + +   EA+++L+
Sbjct  120   SRVAALRRLRSLARESDKNRAVISTHETRSALVEIAFEGGEQLELPEADQPALEAMAVLA  179

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLS-HPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             M  L+E E V VAS  +R+  L  ++  H S++ R+N+AA+IE+V  G +S E R+ +  
Sbjct  180   MLPLTETESVAVASRPERLCRLGEMVRRHASMEARINAAAVIEAVAVGARSAETRASVGG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEK  1111
              + +  G+V  L     +PRA+++G++ LFALCL K++R +AV AGA  A++ RL  L  
Sbjct  240   TNGVVVGLVA-LAEQRGNPRAVRVGIRGLFALCLAKENRGRAVAAGAAAAVVGRLGELAS  298

Query  1112  CDTERALATVELLCRIPSGCAAFAA-----HALTVPLLVKIILKISDRATEYaagallsl  1276
              D ERALATVELLCR+  G  A  A      A  V L+  +  K S RA E+AAGALL++
Sbjct  299   SDAERALATVELLCRVEGGREAVVAGWGGGDAAVVALVRAMAGKASWRAAEHAAGALLAV  358

Query  1277  csssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-DSIVNSDDFA  1453
                SE  Q  AVAAGV+  LL+LVQ GC++RA RKAQ+LLKLLR  WP  DSI NSDDF 
Sbjct  359   LGPSEALQMVAVAAGVVGHLLMLVQGGCSDRAXRKAQLLLKLLRSAWPHYDSIANSDDFL  418

Query  1454  R  1456
             R
Sbjct  419   R  419



>ref|XP_009403520.1| PREDICTED: U-box domain-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 216/418 (52%), Positives = 287/418 (69%), Gaps = 11/418 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP S+ PLD+ G+ IP+HFRCPISLELMRDPVTVCTGQTYDR SIESWVATG+TTCPVTR
Sbjct  1     MPGSVAPLDLAGVTIPHHFRCPISLELMRDPVTVCTGQTYDRESIESWVATGSTTCPVTR  60

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
             A L DFTLIPNHTLRRLIQ+WCVA+R+ GVERIPTPKQPAD  L++SL++ A S      
Sbjct  61    ARLADFTLIPNHTLRRLIQDWCVAHRSLGVERIPTPKQPADAALIRSLVAAARSQGGAAA  120

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDS---NSSELTHEALSILSM  757
             SR++ALRRL  L R+S+KNR VIS +  R  L+ I F   +S   ++ +   +A+++LSM
Sbjct  121   SRVAALRRLGSLVRESEKNRVVISTDETRSALVEIAFEGEESGCPDADQPAMDAMAVLSM  180

Query  758   FQLSEAECVFVASDLDRVGYLVSLL-SHPSIDVRVNSAALIESVVAGTKSPELRSQISNA  934
               ++EAE   VA+  +R+  L  ++  HPS + R+N+A +IE+V AG +S E R+ +   
Sbjct  181   LSMTEAESAGVAARPERLRRLGEVVRGHPSTEARINAATVIEAVAAGARSAETRAAVGGT  240

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKC  1114
             + + +G+V ++     + RA ++G++ LFALCL K++R +A+ AGA  A++ R+  L   
Sbjct  241   EGVMEGLVELVAQRG-NGRAGRVGIRGLFALCLAKENRGRALAAGAAAAVVGRVAELASS  299

Query  1115  DTERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
             D ERALATVELLCR   G                 L+  +  K S RA E+AA  L+++ 
Sbjct  300   DVERALATVELLCREDGGRDAVVAGWGGGAVAVAALVRVMAGKASGRAAEHAAAVLVAVL  359

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
               SE    +AVAAGV+  LLL+VQ GC+ERAKRKAQ+LLKL R  WP  D+I NSDDF
Sbjct  360   GGSEALHAEAVAAGVVAHLLLMVQGGCSERAKRKAQLLLKLFRSAWPRHDTISNSDDF  417



>ref|XP_004952703.1| PREDICTED: U-box domain-containing protein 26-like [Setaria italica]
Length=408

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 214/414 (52%), Positives = 272/414 (66%), Gaps = 16/414 (4%)
 Frame = +2

Query  227   MPASLD---PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCP  397
             MP S+     LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCP
Sbjct  1     MPGSVPLALGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCP  60

Query  398   VTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvss  577
             VTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPAD        +       
Sbjct  61    VTRAPLADFTLIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPAD--------ADLVRSLV  112

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSM  757
                  L ALRRLR LAR+SDKNR V++    R  L+ + F +    S EL  EA+++L++
Sbjct  113   AQGPGLPALRRLRALARESDKNRLVMATRETRAALVEVAFGSGSGASEELEAEAMAVLAL  172

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHPS-IDVRVNSAALIESVVAGTKSPELRSQISNA  934
               L EAE   V    +RV  L  +L+    ++ RVN+ A++E+  +     E R+ +  A
Sbjct  173   VGLGEAEAAEVVGREERVTRLGKVLAAGGPLEARVNAGAVVEAAAS-ASGAEARAVLGAA  231

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKC  1114
             + + +G+V  L     H RA+++G++ LFALCL K++R +AV AGA  AL  R+      
Sbjct  232   EGVMEGLVA-LAEEKAHARAVRVGIRGLFALCLAKENRPRAVSAGAASALARRVSEGGAG  290

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISDRATEYaagallslcsssE  1291
             + ERALA VE LCR   G  A  A A   P  V  +++ +S RA E+AAGAL+++   SE
Sbjct  291   EPERALAAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRAAEHAAGALVAVVGGSE  350

Query  1292  QAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
               Q +AV AG ++QLLL+VQ GC+ERAKRKAQ LLKLLR  WP  D I NSDDF
Sbjct  351   ALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDCIANSDDF  404



>ref|XP_010481065.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=361

 Score =   327 bits (839),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 244/314 (78%), Gaps = 7/314 (2%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP +L+PLD+G IQIPYHFRCPISL+LM DPVT+ TGQTYDR SI+SW+A GNTTCPVTR
Sbjct  1     MPGNLEPLDLG-IQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTR  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvss  577
               L+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP     + S  S  +    
Sbjct  60    VSLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHV  119

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSN--SSELTHEALSIL  751
              + SR +A+RRLRGLARDS+KNR +I+A+NAR+VL+ I+F+++++   SSEL  E+L++L
Sbjct  120   SVRSRAAAIRRLRGLARDSEKNRVLIAAHNAREVLVRILFADVETTSSSSELVSESLALL  179

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
              +  ++E EC  VASD  RVG+L  LL   SI++RVN+AAL+E V+ G+KS +L+  IS 
Sbjct  180   VVLHMTETECEAVASDPGRVGFLTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISG  239

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
             +D IF+G++ +L +P +  RALK+G+KA+FALCLVKQ R  A+ AGA   LI+RL    +
Sbjct  240   SDSIFEGVLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFD  299

Query  1109  KCDTERALATVELL  1150
             +CDTER LATVEL+
Sbjct  300   RCDTERGLATVELI  313



>dbj|BAJ97989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   325 bits (833),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 278/420 (66%), Gaps = 25/420 (6%)
 Frame = +2

Query  227   MPASLDPLDVG----GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTC  394
             MP S+ PL +G    G+Q+P++FRCPISLELM+DPVTV TGQTYDRASIESWVATGNTTC
Sbjct  1     MPGSV-PLALGLDTVGLQVPWYFRCPISLELMQDPVTVATGQTYDRASIESWVATGNTTC  59

Query  395   PVTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs  574
             PVTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP              
Sbjct  60    PVTRAPLADFTLIPNHTLRRLIQEWCVAHRSLGVERIPTPKQPADP--------DLIRSL  111

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
                   L  L++LR LAR+SDKNR V++ +  R  L+ + F     ++ E   EA+++L+
Sbjct  112   IAQGPGLPVLKKLRALARESDKNRLVMATHETRAALVEMAFGG---SAEEAQAEAMAVLA  168

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLSH--PSIDVRVNSAALIESVVAGTKSPELRSQIS  928
             +  + EAE V V    DRV  L  +L     +++ +VN+ A++E+  A     E R  + 
Sbjct  169   LVGMGEAEAVDVVGREDRVTRLAKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLG  227

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLE  1108
              AD + +G+V +++  + + RA+++G++ LFALCL K++RQ+AV AGA  AL  R+    
Sbjct  228   AADGVIEGLVALVDEKA-NARAVRVGIRGLFALCLAKENRQRAVSAGAASALARRVAE-G  285

Query  1109  KC--DTERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
              C  + ERALA VE L R   G  A  +       +++ ++  +S RA E+AAGAL+++ 
Sbjct  286   GCAGELERALAAVERLSRTDGGREAVISGAGGGAAVVIALVRAMSGRAAEHAAGALVAVV  345

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDFAR  1456
               SE  Q +AV AG ++QLL++VQ GC+ERAKRKAQ LLKLLR  WP  DS+ NSDDF R
Sbjct  346   GGSEVLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSDDFLR  405



>gb|EMT28323.1| U-box domain-containing protein 25 [Aegilops tauschii]
Length=407

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 207/418 (50%), Positives = 277/418 (66%), Gaps = 25/418 (6%)
 Frame = +2

Query  227   MPASLDPLDVG----GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTC  394
             MP S+ PL +G    G+Q+P++FRCPISLELM+DPVTV TGQTYDRASIESWVATGNTTC
Sbjct  1     MPGSV-PLALGLDTVGLQVPWYFRCPISLELMQDPVTVATGQTYDRASIESWVATGNTTC  59

Query  395   PVTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs  574
             PVTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP              
Sbjct  60    PVTRAPLADFTLIPNHTLRRLIQEWCVAHRSLGVERIPTPKQPADP--------DLIRSL  111

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
                   L  LR+LR LAR+SDKNR V++ +  R  L+ + F     ++ E   EA+++L+
Sbjct  112   IAQGPALPVLRKLRALARESDKNRLVMATHETRAALVEMAFGG---SAEEAQAEAMAVLA  168

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLSH--PSIDVRVNSAALIESVVAGTKSPELRSQIS  928
             +  + EAE V V    DRV  L  +L     +++ +VN+ A++E+  A     E R  + 
Sbjct  169   LVGMGEAEAVDVVGREDRVTRLGKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLG  227

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLE  1108
              AD + +G+V +++  + + RA+++G++ +FALCL K++RQ+AV AGA  AL  R+    
Sbjct  228   AADGVIEGLVALVDEKA-NARAVRIGIRGVFALCLAKENRQRAVSAGAASALARRVAE-G  285

Query  1109  KC--DTERALATVELLCRIPSGCAAFAAHA-LTVPLLVKIILKISDRATEYaagallslc  1279
              C  + ERALA VE L R   G  A  + A     L++ ++  +S RA E+AAGAL+++ 
Sbjct  286   GCAGELERALAAVERLSRTEGGREAVVSGAGGGAALVIALVRAMSGRAAEHAAGALVAVV  345

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
               SE  Q +AV AG ++QLL++VQ GC+ERAKRKAQ LLKLLR  WP  DS+ NS DF
Sbjct  346   GGSEVLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSADF  403



>ref|XP_010489938.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=302

 Score =   317 bits (811),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 231/305 (76%), Gaps = 9/305 (3%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVT  403
             MP +L+PLD+G IQIPYHFRCPISLELM+DPVTVCTGQTYDRASIESWV+ GN TTCPVT
Sbjct  1     MPRNLEPLDLG-IQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVT  59

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             RAPL+DFTLIPNHTLRRLIQEWCVANR+ GVERIPTPKQPADP  V++LLSQAS+ S   
Sbjct  60    RAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASATSGTH  119

Query  584   nsrlsalrrlrgl---ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
              S  S    LR L   ARDSDKNR +I+A+NA  VL+ I+FS  ++ SSEL  E+L++L 
Sbjct  120   VSVRSRAAALRRLRGFARDSDKNRVLIAAHNATAVLIMILFS--ETTSSELVSESLALLV  177

Query  755   MFQLSEA-ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             M  ++E  + V ++SD  RV +L  LL   SI+ RVN+AALIE V  GTKS + +   SN
Sbjct  178   MLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSN  237

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY-LE  1108
              + +F+G++ +L +P +  RALK+G+KALF+LC  KQ R  A+ AGA E LI+RL    +
Sbjct  238   YESVFEGVLDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFD  297

Query  1109  KCDTE  1123
             +CDTE
Sbjct  298   RCDTE  302



>gb|EMS66308.1| U-box domain-containing protein 25 [Triticum urartu]
Length=407

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 206/418 (49%), Positives = 277/418 (66%), Gaps = 25/418 (6%)
 Frame = +2

Query  227   MPASLDPLDVG----GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTC  394
             MP S+ PL +G    G+Q+P++FRCPISLELM+DPVTV TGQTYDRASIESWVATGNTTC
Sbjct  1     MPGSV-PLALGLDTVGLQVPWYFRCPISLELMQDPVTVATGQTYDRASIESWVATGNTTC  59

Query  395   PVTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs  574
             PVTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP              
Sbjct  60    PVTRAPLADFTLIPNHTLRRLIQEWCVAHRSLGVERIPTPKQPADP--------DLIRSL  111

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
                   L  LR+LR LAR+SDKNR V++ +  R  L+ + F     ++ E   EA+++L+
Sbjct  112   IAQGPALPVLRKLRALARESDKNRLVMATHETRAALVEMAFGG---SAEEAQAEAMAVLA  168

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLSH--PSIDVRVNSAALIESVVAGTKSPELRSQIS  928
             +  + EAE V V    +RV  L  +L     +++ +VN+ A++E+  A     E R  + 
Sbjct  169   LVGMGEAEAVDVVGREERVTRLGKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLG  227

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLE  1108
              AD + +G+V +++  + + RA+++G++ LFALCL K++RQ+AV AGA  AL  R+    
Sbjct  228   AADGVIEGLVALVDEKA-NARAVRIGIRGLFALCLAKENRQRAVSAGAASALARRVAE-G  285

Query  1109  KC--DTERALATVELLCRIPSGCAAFAAHA-LTVPLLVKIILKISDRATEYaagallslc  1279
              C  + ERALA VE L R   G  A  + A     +++ ++  +S RA E+AAGAL+++ 
Sbjct  286   GCAGELERALAAVERLSRTEGGREAVVSGAGGGAAVVIALVRAMSGRAAEHAAGALVAVV  345

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
               SE  Q +AV AG ++QLL++VQ GC+ERAKRKAQ LLKLLR  WP  DS+ NS DF
Sbjct  346   GGSEGLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSADF  403



>ref|XP_002453962.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
 gb|EES06938.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
Length=407

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 212/416 (51%), Positives = 273/416 (66%), Gaps = 21/416 (5%)
 Frame = +2

Query  227   MPASLD---PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCP  397
             MP S+     LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCP
Sbjct  1     MPGSVPLGLGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCP  60

Query  398   VTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvss  577
             VTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP               
Sbjct  61    VTRAPLADFTLIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADP--------DLVRSLV  112

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSM  757
                  L ALRRLR LAR+SDKNR V++ +  R  L+   F    S + E+  EA+++L++
Sbjct  113   AQGPGLPALRRLRALARESDKNRLVMATHETRAALVEAAFG---SGAEEVQAEAMAVLAL  169

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHP---SIDVRVNSAALIESVVAGTKSPELRSQIS  928
               L EAE   V    +RV  L  +L+      ++ RVN+ A+ E+  +     E R+ + 
Sbjct  170   VGLGEAEAAAVVGREERVARLGKVLAAGVGVPLEARVNAGAVAEAAAS-ASGAEARAVLG  228

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLE  1108
              A+ +  G+V ++   + + RA+++G++ALFALCL K++R +AV AGA  AL  R+    
Sbjct  229   AAEGVMDGLVALVEEKA-NARAVRVGIRALFALCLAKENRPRAVAAGAASALARRVAEGG  287

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISDRATEYaagallslcss  1285
               + ERALA VE LCR   G  A  A A      V  +++ +S RA E+AAGAL+++   
Sbjct  288   AGEPERALAAVERLCRAEGGRDAVVAGAGGGSAAVTALVRAMSGRAAEHAAGALVAVVGG  347

Query  1286  sEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-DSIVNSDDF  1450
             SE  Q +AV AG ++QLLL+VQ GC+ERAKRKAQ LLKLLR  WP+ D I NSDDF
Sbjct  348   SEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPNTDCIANSDDF  403



>ref|XP_003575105.1| PREDICTED: U-box domain-containing protein 25-like [Brachypodium 
distachyon]
Length=412

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 212/420 (50%), Positives = 275/420 (65%), Gaps = 24/420 (6%)
 Frame = +2

Query  227   MPASLDPLDVG----GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTC  394
             MP S+ PL +G    G+Q+P++FRCPISLELM+DPVTV TGQTYDRASIESWVATGNTTC
Sbjct  1     MPGSV-PLALGLDTVGLQVPWYFRCPISLELMQDPVTVATGQTYDRASIESWVATGNTTC  59

Query  395   PVTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs  574
             PVTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP              
Sbjct  60    PVTRAPLADFTLIPNHTLRRLIQEWCVAHRSLGVERIPTPKQPADP--------DLIRSL  111

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
                   L ALR+LR LAR+SDKNR V++ +  R  L+ + F        E   EA+++LS
Sbjct  112   IAQCPGLPALRKLRALARESDKNRLVMATHETRAALVEMAFGAG-GGGEEAQAEAMAVLS  170

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLSHP----SIDVRVNSAALIESVVAGTKSPELRSQ  922
             +  + EAE V V    +RV  L  LL       +++ RVN+ A++E+  A     E R  
Sbjct  171   LIGMGEAEAVEVVGREERVARLGKLLGSSQGIMTLEARVNAGAVVEAAAA-VSGAEARVV  229

Query  923   ISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQY  1102
             +  A+ + +G+V +++    + RA+++G++ LFALCL K++R +AV AGA  AL  R+  
Sbjct  230   LGVAEGVMEGLVALVDEKGNNARAVRVGIRGLFALCLAKENRPRAVAAGAASALARRVAE  289

Query  1103  LEKC--DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISDRATEYaagalls  1273
                C  + ERALA VE LCR   G  A  + A      V  +++ +S RA E+AAGAL++
Sbjct  290   -GGCAGEPERALAAVERLCRTEGGRDAVVSGAGGGATAVTALVRAMSGRAAEHAAGALVA  348

Query  1274  lcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
             +   SE  Q +AV AG ++QLLL+VQ GC+ERAKRKAQ LLKLLR  WP  DS+ NSDDF
Sbjct  349   VVGGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSDDF  408



>gb|AFW71736.1| ubiquitin-protein ligase [Zea mays]
Length=418

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 254/411 (62%), Gaps = 19/411 (5%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCPVTR  L DFT
Sbjct  11    LDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCPVTRTALADFT  70

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
             LIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP                    L ALR
Sbjct  71    LIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADP--------DLVRSLVAQGPGLPALR  122

Query  608   rlrglardsDKNRSVISANNARQVLLS---IVFSNMDSNSSELTHEALSILSMFQLSEAE  778
             RLR LAR+SDKNR V++ +  R  L+       S   + S EL  EA+++L++  L EAE
Sbjct  123   RLRALARESDKNRLVMATHETRAALVEAAFGSGSGSGAASEELETEAMAVLALVGLGEAE  182

Query  779   CVFVASDLDRVGYLVSLLSHPS-IDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGI  955
                V    +RV  L  +L     ++ RVN+ A++E+ VA     E R+ +  A+ +  G+
Sbjct  183   AAEVVGREERVARLGKVLGGGGPLEARVNAGAVVEA-VASASGAEARAALGGAEGVMDGL  241

Query  956   VGIL-NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERAL  1132
             V +     + + RA+++GV+ALFALCL K++R +AV AGA  AL  R+      + ERAL
Sbjct  242   VALAEEEKANNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGAGEPERAL  301

Query  1133  ATVELLCRIPSG----CAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             A VE LCR   G     A        V  LV+ +          A  A++     SE  Q
Sbjct  302   AAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEALQ  361

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-DSIVNSDDF  1450
              +AV AG + +LLL+VQ GC+ERAKRKAQ LLKLLR  WP  D + NSDDF
Sbjct  362   AEAVRAGAMGRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDF  412



>ref|NP_001148065.1| ubiquitin-protein ligase [Zea mays]
 gb|ACG29626.1| ubiquitin-protein ligase [Zea mays]
Length=416

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 204/409 (50%), Positives = 256/409 (63%), Gaps = 17/409 (4%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCPVTRA L DFT
Sbjct  11    LDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCPVTRAALADFT  70

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
             LIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP                    L ALR
Sbjct  71    LIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADP--------DLVRSLVAQGPGLPALR  122

Query  608   rlrglardsDKNRSVISANNARQVLLSIVF-SNMDSNSSELTHEALSILSMFQLSEAECV  784
             RLR LAR+SDKNR V++ +  R  L+   F S   + S EL  EA+++L++  L EAE  
Sbjct  123   RLRALARESDKNRLVMATHETRAALVEAAFGSGSGAASEELEAEAMAVLALVGLGEAEAA  182

Query  785   FVASDLDRVGYLVSLLSHPS-IDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
              V    +RV  L  +L     ++ RVN+ A++E+ VA     E R+ +  A+ +  G+V 
Sbjct  183   EVVGREERVARLGKVLGGGGPLEARVNAGAVVEA-VASASGAEARAALGGAEGVMDGLVA  241

Query  962   IL-NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALAT  1138
             +     + + RA+++GV+ALFALCL K++R +AV AGA  AL  R+      + ERALA 
Sbjct  242   LAEEEKANNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGAGEPERALAA  301

Query  1139  VELLCRIPSG----CAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             VE LCR   G     A        V  LV+ +          A  A++     SE  Q +
Sbjct  302   VERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEALQAE  361

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD-DSIVNSDDF  1450
             AV AG + +LLL+VQ GC+ERAKRKAQ LLKLLR  WP  D + NSDDF
Sbjct  362   AVRAGAMGRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDF  410



>dbj|BAD16187.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
 dbj|BAD16270.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
Length=423

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 275/424 (65%), Gaps = 27/424 (6%)
 Frame = +2

Query  227   MPASLD---PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCP  397
             MP S+     LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCP
Sbjct  7     MPGSVPLALGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCP  66

Query  398   VTRAPLTD-FTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs  574
             VTR+PL   FTLIPNHTLRRLIQ+WCVA+R+ GVERIPTPKQPADP              
Sbjct  67    VTRSPLDRAFTLIPNHTLRRLIQDWCVAHRSLGVERIPTPKQPADP--------DLIRSL  118

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
                   L  LR+LR LARDSDKNR V++ +  R  L+ + F   ++   E+  EA+++L+
Sbjct  119   LAQCPALPPLRKLRALARDSDKNRLVMATHETRAALVDMAFGT-NAGGEEVEAEAMAVLA  177

Query  755   MFQLSEAECVFVASDLDRVGYLVSLL--------SHPSIDVRVNSAALIESVVAGTKSPE  910
             M  L EAE V V    +RV  L  LL        +  +++ RVN+ A++E+V A + + +
Sbjct  178   MVGLGEAEAVEVVGRRERVARLGELLVSGEGAATTTATLECRVNAGAVVEAVAAVSGA-D  236

Query  911   LRSQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE  1090
              R+ +  A+ + +G+V ++   + H RA+++G++ LFALCL K++R +AV AGA  AL  
Sbjct  237   ARAVLGAAEGVMEGLVALVEEKA-HARAVRVGIRGLFALCLAKENRPRAVAAGAAAALAR  295

Query  1091  RLQYLEKCDT--ERALATVELLCRIPSG-CAAFAAHALTVPLLVKIILKISDRATEYaag  1261
             R+          ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAG
Sbjct  296   RVAEGGGGAGEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAG  355

Query  1262  allslcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVN  1438
             AL+++   SE  Q +AV AG ++QLLL+VQ GC+ERAKRKAQ LLKLLR  WP  DSI N
Sbjct  356   ALVAVVGGSEPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIAN  415

Query  1439  SDDF  1450
             SDDF
Sbjct  416   SDDF  419



>ref|NP_001047085.2| Os02g0548700 [Oryza sativa Japonica Group]
 dbj|BAF08999.2| Os02g0548700 [Oryza sativa Japonica Group]
Length=417

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 275/424 (65%), Gaps = 27/424 (6%)
 Frame = +2

Query  227   MPASLD---PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCP  397
             MP S+     LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDRASIESWVATGNTTCP
Sbjct  1     MPGSVPLALGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCP  60

Query  398   VTRAPLTD-FTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvs  574
             VTR+PL   FTLIPNHTLRRLIQ+WCVA+R+ GVERIPTPKQPADP              
Sbjct  61    VTRSPLDRAFTLIPNHTLRRLIQDWCVAHRSLGVERIPTPKQPADP--------DLIRSL  112

Query  575   shlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS  754
                   L  LR+LR LARDSDKNR V++ +  R  L+ + F   ++   E+  EA+++L+
Sbjct  113   LAQCPALPPLRKLRALARDSDKNRLVMATHETRAALVDMAFGT-NAGGEEVEAEAMAVLA  171

Query  755   MFQLSEAECVFVASDLDRVGYLVSLL--------SHPSIDVRVNSAALIESVVAGTKSPE  910
             M  L EAE V V    +RV  L  LL        +  +++ RVN+ A++E+V A + + +
Sbjct  172   MVGLGEAEAVEVVGRRERVARLGELLVSGEGAATTTATLECRVNAGAVVEAVAAVSGA-D  230

Query  911   LRSQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE  1090
              R+ +  A+ + +G+V ++   + H RA+++G++ LFALCL K++R +AV AGA  AL  
Sbjct  231   ARAVLGAAEGVMEGLVALVEEKA-HARAVRVGIRGLFALCLAKENRPRAVAAGAAAALAR  289

Query  1091  RLQYLEKCDT--ERALATVELLCRIPSG-CAAFAAHALTVPLLVKIILKISDRATEYaag  1261
             R+          ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAG
Sbjct  290   RVAEGGGGAGEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAG  349

Query  1262  allslcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVN  1438
             AL+++   SE  Q +AV AG ++QLLL+VQ GC+ERAKRKAQ LLKLLR  WP  DSI N
Sbjct  350   ALVAVVGGSEPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIAN  409

Query  1439  SDDF  1450
             SDDF
Sbjct  410   SDDF  413



>ref|XP_002974135.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
 gb|EFJ25090.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
Length=405

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 196/410 (48%), Positives = 262/410 (64%), Gaps = 15/410 (4%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP  L  + V  +Q+P++FRCPISLELMRDPVTV TGQTYDR+SIE WV+ GN TCP T 
Sbjct  1     MPG-LKKMQVQNLQVPHYFRCPISLELMRDPVTVATGQTYDRSSIEKWVSDGNATCPATM  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               LTD TLIPNHTLRRLIQEWCVANR+ G+ERIPTPKQPADP  V +L+   +  ++   
Sbjct  60    QRLTDLTLIPNHTLRRLIQEWCVANRSRGIERIPTPKQPADPQRVAALVRDVTRGTAGGT  119

Query  587   srls---alrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSM  757
             +      ALR LR LA+++DKNR ++   NA   L  I       +S ++   +L++L +
Sbjct  120   ALQLLLPALRSLRALAKENDKNRGLMVEANAVSAL--IHHDQHLGDSLDVEESSLAVLVL  177

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHP-SIDVRVNSAALIESVVAGTKSPE-LRSQISN  931
               L ++E   +A    R+G +  ++    S+D R+N+A L+E +   + +PE  +  +  
Sbjct  178   LPLKDSERRSIAQCRRRLGAVSRIVRRGRSMDARINAAVLVEKI--ASDAPEAAKLAMGQ  235

Query  932   ADEIFQGIVGIL--NHPSTHPRALKMGVKALFALCL--VKQHRQKAVIAGAVEALIERLQ  1099
                + +G+V +L  +H +  PRA K GVKALF+LCL     + ++AV AGA  AL+E L 
Sbjct  236   IPGLLEGLVDLLRGDHSAVSPRAPKSGVKALFSLCLCSAASNSERAVSAGAAAALVEHLP  295

Query  1100  YLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKII-LKISDRATEYaagallsl  1276
               +  D +R L  +ELLCR  +G    A HAL VP LV  I  + S +A E AAG LL++
Sbjct  296   AAQHGDADRTLGALELLCRTRAGREVVAQHALAVPALVAAIQCRSSFQAAECAAGTLLAV  355

Query  1277  csssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD  1426
             CS SE+ Q  A  AGVLTQLLLL+QS CT+RAKRKA  LLKLLR  W +D
Sbjct  356   CSGSEEVQLAAAEAGVLTQLLLLIQSDCTDRAKRKAVELLKLLRRWWAED  405



>ref|XP_002968838.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
 gb|EFJ29954.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
Length=396

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 193/428 (45%), Positives = 253/428 (59%), Gaps = 44/428 (10%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             MP  L  + V  +Q+P++FRCPISLELMRDPVTV TGQTYDR+SIE WV+ GN TCP T 
Sbjct  1     MPG-LKKMQVQNLQVPHYFRCPISLELMRDPVTVATGQTYDRSSIEKWVSDGNATCPATM  59

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
               LTD TLIPNHTLRRLIQEWCVANR+ G+ERIPTPKQPADP                  
Sbjct  60    QRLTDLTLIPNHTLRRLIQEWCVANRSRGIERIPTPKQPADP------------------  101

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIV-----FSNMDSNSSELTHEALSIL  751
                      R  A   D  R   +   A Q+LL  +      +  +  +  L   +L++L
Sbjct  102   --------QRVAALVRDVTRGT-AGGTALQLLLPALRSLRALAKENDKNRGLMESSLAVL  152

Query  752   SMFQLSEAECVFVASDLDRVGYLVSLLSHP-SIDVRVNSAALIESVVAGTKSPE-LRSQI  925
              +  L ++E   +A    R+G +  ++    S+D R+N+A L+E +   + +PE  +  +
Sbjct  153   VLLPLKDSERRSIAQCRRRLGAVSRIVRRGRSMDARINAAVLVEKI--ASDAPEAAKLAM  210

Query  926   SNADEIFQGIVGIL--NHPSTHPRALKMGVKALFALCL--VKQHRQKAVIAGAVEALIER  1093
                  + +G+V +L  +H +  PRA K GVKALF+LCL     + ++AV AGA  AL+E 
Sbjct  211   GQIPGLLEGLVDLLRGDHSAVSPRAPKSGVKALFSLCLCSAASNSERAVSAGAAAALVEH  270

Query  1094  LQYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKII-LKISDRATEYaagall  1270
             L   +  D +R L  +ELLCR  +G    A HAL VP LV  I  + S +A E AAG LL
Sbjct  271   LPAAQHGDADRTLGALELLCRTRAGREVVAQHALAVPALVAAIQCRSSFQAAECAAGTLL  330

Query  1271  slcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             ++CS SE+ Q  A  AGVLTQLLLL+QS CT+RAKRKA  LLKLLR  W +D  +   D 
Sbjct  331   AVCSGSEEVQLAAAEAGVLTQLLLLIQSDCTDRAKRKAVELLKLLRRWWAEDPCLAELD-  389

Query  1451  ARSDVVQF  1474
              R+DVV F
Sbjct  390   -RTDVVAF  396



>ref|XP_008680442.1| PREDICTED: U-box domain-containing protein 26-like [Zea mays]
Length=360

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 240/414 (58%), Gaps = 64/414 (15%)
 Frame = +2

Query  227   MPASLD---PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCP  397
             MPAS+     LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDR+SIESWVATGNT+CP
Sbjct  1     MPASVPLCLGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTSCP  60

Query  398   VTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvss  577
             VTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP               
Sbjct  61    VTRAPLADFTLIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADP--------DLVRSLV  112

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVF-SNMDSNSSELTHEALSILS  754
                  L ALRRLR LAR+SDKNR V++ +  R  LL   F S   + S EL  EA+++L+
Sbjct  113   AQGPGLPALRRLRALARESDKNRLVMATHETRAALLEAAFGSGSGAASEELEAEAMAVLA  172

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLS-HPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
             +  L E E V V    +RV  L  +L+   S++ RVN+ A++E+        + R+ +  
Sbjct  173   LVGLGEEEAVEVVGREERVARLGKVLAGGGSLEARVNAGAVVEAAAL-ASGADARAVLGA  231

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEK  1111
             A+ +  G+V ++   ++  RA+++G  A                         R +    
Sbjct  232   AEGVMAGLVTLVEEKAS-ARAVRVGTGAWG-----------------------RGRGSSS  267

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE  1291
             C  E A  T   L R  SG                       RA E+AAGAL+++   SE
Sbjct  268   CTPEPAAVTA--LVRAMSG-----------------------RAAEHAAGALVAVVGGSE  302

Query  1292  QAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
               Q +AV AG + QLL++VQ GC+ERAKRKAQ LLKLLR  WP  D   NSDDF
Sbjct  303   ALQVEAVRAGAMGQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDCTANSDDF  356



>gb|KHN43058.1| U-box domain-containing protein 25 [Glycine soja]
Length=282

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = +2

Query  227  MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
            MP SL+PLD+G + IPYHFRCPISLELMRDPVTVCTGQTYDRASIE+WV+TGNTTCPVTR
Sbjct  1    MPGSLEPLDLG-VHIPYHFRCPISLELMRDPVTVCTGQTYDRASIEAWVSTGNTTCPVTR  59

Query  407  APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
            A LTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADP LV+SLL+QASS S+  +
Sbjct  60   ATLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPALVRSLLNQASSDSAPAH  119

Query  587  srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
             RLS+LRRLR LARDSDKNRS+I+++N  Q+LL IVF+N    S EL+HE+L++L MF L
Sbjct  120  LRLSSLRRLRQLARDSDKNRSLIASHNLLQILLPIVFNN---GSDELSHESLALLVMFPL  176

Query  767  SEAECVFVASDLDRVGYL  820
             E+EC  +ASD  ++GYL
Sbjct  177  GESECASLASDSMKIGYL  194



>emb|CBI32390.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = +2

Query  227  MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
            MP SL+PLDVG +QIPYHFRCPISLELM DPVTV TGQTYDRASIE WV TGNTTCPVTR
Sbjct  51   MPGSLEPLDVG-VQIPYHFRCPISLELMCDPVTVSTGQTYDRASIEYWVGTGNTTCPVTR  109

Query  407  APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshln  586
            + LTDFTLIPNHTLRRLIQ+WCVANR+FGVERIPTPKQPADP  V+SL +Q SS S+  +
Sbjct  110  SSLTDFTLIPNHTLRRLIQDWCVANRSFGVERIPTPKQPADPASVRSLQTQVSSQSNPSH  169

Query  587  srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQL  766
            +RLSA++RLRGLARDSDKNRS+I ++N ++VLL ++FS+ + +S+EL HE+L++L MF L
Sbjct  170  TRLSAVKRLRGLARDSDKNRSIIGSHNVQEVLLPVIFSDSECDSAELKHESLALLVMFPL  229

Query  767  SEAEC  781
            SE+EC
Sbjct  230  SESEC  234


 Score =   186 bits (471),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +2

Query  1001  MGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATVELLCRIPSGCAAF  1180
             + +  +F L   +  R KAV AGAV ALI+RL   EKCD ERALATVELLCR+P+GCAAF
Sbjct  221   LALLVMFPLSESECARHKAVAAGAVTALIDRLADFEKCDVERALATVELLCRVPAGCAAF  280

Query  1181  AAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVAAGVLTQLLLLVQSGC  1360
             AAHALTVPLLV+ ILK+SDRATEYAAGALLSLCS++EQ+QR+AV+AGV+TQLLLLVQS C
Sbjct  281   AAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSAGVVTQLLLLVQSDC  340

Query  1361  TERAKRKAQMLLKLLRDCWPDDSIVNSDDFARSDVVQ  1471
             TERAKRKAQ+LLKLLRD WP+DS+VNSDDF  SDV +
Sbjct  341   TERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVAK  377



>ref|XP_002991371.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
 gb|EFJ07483.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
Length=417

 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 160/414 (39%), Positives = 235/414 (57%), Gaps = 20/414 (5%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             LD+   ++P  FRCPISLELM+DPVT+ TG TYDR+SIE W   G+ TCP T   +    
Sbjct  7     LDIQLPRVPTLFRCPISLELMKDPVTLSTGLTYDRSSIEKWFDDGHHTCPGTMQLVKVRD  66

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
             L+PNHTLRRLIQEWCVAN++ G+ERIPTPKQP D      L+ Q SS      ++   LR
Sbjct  67    LVPNHTLRRLIQEWCVANKSRGIERIPTPKQPLDDEQASHLVRQISSAELSGRAKSRLLR  126

Query  608   rlrglardsDKNRSVISANNARQVLLSIVFS-------NMDSNSSELT--HEALSILSMF  760
              LR   ++S+KNR  I+   A   L S+V S       +  SN  +L    +A+++L + 
Sbjct  127   NLRASCKESEKNRKCIAGAGAIPALSSLVSSFQPRISFDRPSNLEDLQCCEDAVAVLVIL  186

Query  761   QLSEAECV---FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
                E E +    +   L  +  L  +L   + + ++N+A L+E V    +S   +S +  
Sbjct  187   LPLEIESLRKSIINPSL--LAVLSWILHRRNTEGQINAARLLELVATDDES---KSMVGA  241

Query  932   ADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEK  1111
              + +  G+V ++   S +PRA++  + AL A+   +++  KAV  G V  LIE L    +
Sbjct  242   TERLIPGLVKLVKEDSAYPRAVRASLTALLAIVSCRKNLVKAVQGGVVPPLIELLSEASR  301

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE  1291
              +TERALA +E + R   G  A   H+L+VP+LVKIIL +SD A+E A G LL +C + +
Sbjct  302   LNTERALAVLEFVARCAEGREALMDHSLSVPMLVKIILTVSDLASERAVGILLLMCQADD  361

Query  1292  QAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
                + A + G  TQ++LL+Q+  T     +A+  LKLLR   P + +    DFA
Sbjct  362   SVVQAAASEGAFTQMILLIQADNTSETNHRARQFLKLLRGAVPRECM---HDFA  412



>ref|XP_002988236.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
 gb|EFJ10655.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
Length=392

 Score =   221 bits (562),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 155/397 (39%), Positives = 226/397 (57%), Gaps = 17/397 (4%)
 Frame = +2

Query  266   QIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHT  445
             ++P  FRCPISLELM+DPVT+ TG TYDR+SIE W   G+ TCP T   +    L+PNHT
Sbjct  1     RVPTLFRCPISLELMKDPVTLSTGLTYDRSSIEKWFDDGHHTCPGTMQLVKVRDLVPNHT  60

Query  446   LRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgla  625
             LRRLIQEWCVAN++ G+ERIPTPKQP D      L+ Q SS      ++   LR LR   
Sbjct  61    LRRLIQEWCVANKSRGIERIPTPKQPLDDEQAGHLVRQISSAELSGRAKSRLLRNLRASC  120

Query  626   rdsDKNRSVISANNARQVLLSIVFS-------NMDSNSSELT--HEALSILSMFQLSEAE  778
             ++SDKNR  I+   A   L  +V S       +  SN  +L    +A+++L +    E E
Sbjct  121   KESDKNRKCIAGAGAIPALSGLVSSFQPRISFDRPSNLEDLQCCEDAVAVLVILLPLEIE  180

Query  779   CV---FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQ  949
              +    +   L  +  L  +L   + + ++N+A L+E V    +S   +S +   + +  
Sbjct  181   SLRKSIINPSL--LAVLSWILHRRNTEGQINAARLLELVATDDES---KSMMGATERLIP  235

Query  950   GIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERA  1129
             G+V ++   S +PRA++  + AL A+   +++  KAV  G V  LIE L    + +TERA
Sbjct  236   GLVKLVKEDSAYPRAVRASLTALLAIVSCRKNLVKAVQGGVVPPLIELLSEASRLNTERA  295

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDA  1309
             LA +E + R   G  A   H+L+VP+LVKIIL +SD A+E A G LL +C + +   + A
Sbjct  296   LAVLEFVARCAEGREALMDHSLSVPMLVKIILTVSDLASERAVGILLLMCQADDSVVQAA  355

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWP  1420
              + G  TQ++LL+Q+  T     +A+  LKLLR   P
Sbjct  356   ASEGAFTQMILLIQADNTSETNHRARQFLKLLRGAVP  392



>ref|XP_001764309.1| predicted protein [Physcomitrella patens]
 gb|EDQ70863.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/415 (35%), Positives = 230/415 (55%), Gaps = 26/415 (6%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P  F CPISLELMRDPVT+CTG T+DRASIE W+  G+ TCP T   L    LIPNHTL
Sbjct  25    VPAFFLCPISLELMRDPVTLCTGMTFDRASIERWLGLGHNTCPATNQILESQELIPNHTL  84

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             RRLIQ WCVAN+A+GVERIPTPK PA+PG    +      +         +L+ L  LA+
Sbjct  85    RRLIQNWCVANKAYGVERIPTPKAPAEPG---DVKQLLEGIGQCEEVGCDSLKNLWSLAK  141

Query  629   dsDKNRSVIS--------ANNARQVLLSIVFSNMDSNSSELT-HEALSILSMFQLSEAEC  781
             + ++NR  I         A    Q+ + + +S   +   E+   EAL+ +++ QL + + 
Sbjct  142   ECERNRRCIEKVGAVPILAKALAQLWVGMRYSAGCNRGREVACEEALATIALLQLDDGDR  201

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
               + +  + +  LV LL+  S+D ++N+A +I ++    + P +++ +++     +G+V 
Sbjct  202   RALVAP-ESLECLVFLLTSGSLDAKLNAADVIHTLC--EEDPHVKTAVASLPGAMKGLVN  258

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
             +L      PRA++ G++ L  +CL + +R  A+   A+  ++E L   EK   E A A +
Sbjct  259   LLKD-DLCPRAVQAGLRCLLCVCLPRSNRVMAIECRAISVVVELLPNTEKRTKELAFAVM  317

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga--llslcsssEQAQRDAVA  1315
             E+L     G  A + HAL +P++VK +L +S R TE A     ++   +S+      A+ 
Sbjct  318   EILANCAEGREAISNHALAIPMIVKSMLGVSQRVTECAVSTLWVVLSYASNRSVTNTALQ  377

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW------PDDS--IVNSDDFAR  1456
             AG    LL+L+   C++RAK KA+  L+LL + W      P D   I+N  D  +
Sbjct  378   AGAFANLLMLLPGECSQRAKHKARDSLRLLNENWGSYTCRPADEARIINKRDLGQ  432



>ref|XP_010068460.1| PREDICTED: U-box domain-containing protein 26-like [Eucalyptus 
grandis]
Length=193

 Score =   208 bits (529),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +2

Query  260  GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPN  439
            G+QIP+HFRCPISLELMRDPVTV TGQTYDR+SIE W+A GNTTCPVTRAPL D  LIPN
Sbjct  3    GVQIPHHFRCPISLELMRDPVTVSTGQTYDRSSIEPWIAAGNTTCPVTRAPLLDSALIPN  62

Query  440  HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqs-llsqassvsshlnsrlsalrrlr  616
            HTLRRLIQ WCVANR  GVERIPTPKQPADP  V++ L   AS+ SS    RLSALRRLR
Sbjct  63   HTLRRLIQSWCVANRHSGVERIPTPKQPADPSRVRALLSQAASTSSSAAAPRLSALRRLR  122

Query  617  glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVAS  796
             LARDSDKNR++I++ +AR +LL ++F++  + SSEL HEAL++L+M QL+E EC  VAS
Sbjct  123  ALARDSDKNRALIASLDARPLLLDVLFADPRAESSELEHEALALLAMLQLAEPECASVAS  182

Query  797  DLDRVGYL  820
            D DRV +L
Sbjct  183  DPDRVAFL  190



>ref|XP_009380073.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 228/412 (55%), Gaps = 21/412 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP HF CPISLELM+DPVT  TG TYDR SIE+W+  GNTTCPVT   + +  LIPNH
Sbjct  25    ISIPMHFLCPISLELMKDPVTASTGITYDRQSIETWLGLGNTTCPVTNREMENEELIPNH  84

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlr  616
             ++R++IQ+WCVANR+ GVERIPTPK P     V  ++S+    +   +       + +++
Sbjct  85    SIRKVIQDWCVANRSLGVERIPTPKIPVTGSQVADMMSEIGEATRRGDRARCDQLVVKVK  144

Query  617   glardsDKNRSVISANNARQVLLSI--VFSNMDSNS--SELTHEALSIL-SMFQLSEAEC  781
              LA +S++NR   ++N    VL +    F+   S S  +E+  EAL  L ++  L E   
Sbjct  145   NLASESERNRRCFASNGMNGVLAATFNAFAGASSESPAAEILEEALEALATLLPLGEEAA  204

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
               + S  + +  LVS+L H S   R+N+A +++ ++A   +      I+    + + +  
Sbjct  205   SRIGSP-ESLNRLVSILQHGSWAARLNAALVVKELLASNGAGA--DVIAGTKGLVEALAK  261

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHR--QKAVIAGAVEALIERLQYLEKCDTERALA  1135
             ++  P   PRA K  + ++F + + +  R   + V  G V  LIE L   EK   E+ALA
Sbjct  262   LVEEP-ISPRAAKASLVSIFYM-INRDERAASRVVDLGLVPVLIEVLVGPEKSMCEKALA  319

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE-------Q  1294
              +++L    SG      HALT+P+L K + ++SD ATE    AL  LC   E       +
Sbjct  320   VLDVLLGCGSGREKAYGHALTMPVLAKKMFRVSDMATELVVSALWKLCRDDEVGGEGRGR  379

Query  1295  AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
               +DA+ AG   +LLLL+Q GC E  K +A  LLKLL  C   +  V++ DF
Sbjct  380   CLQDALQAGAFQKLLLLLQVGCGEATKERATNLLKLLNGCRGREECVDTMDF  431



>gb|AFW62582.1| hypothetical protein ZEAMMB73_679873 [Zea mays]
Length=289

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 170/257 (66%), Gaps = 14/257 (5%)
 Frame = +2

Query  227  MPASLD---PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCP  397
            MPAS+     LD  G+Q+P++FRCPISLELMRDPVTV TGQTYDR+SIESWVATGNT+CP
Sbjct  1    MPASVPLCLGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTSCP  60

Query  398  VTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvss  577
            VTRAPL DFTLIPNHTLRRLIQEWCVA+R+ GVERIPTPKQPADP               
Sbjct  61   VTRAPLADFTLIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADP--------DLVRSLV  112

Query  578  hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVF-SNMDSNSSELTHEALSILS  754
                 L ALRRLR LAR+SDKNR V++ +  R  LL   F S   + S EL  EA+++L+
Sbjct  113  AQGPGLPALRRLRALARESDKNRLVMATHETRAALLEAAFGSGSGAASEELEAEAMAVLA  172

Query  755  MFQLSEAECVFVASDLDRVGYLVSLLS-HPSIDVRVNSAALIESVVAGTKSPELRSQISN  931
            +  L E E V V    +RV  L  +L+   S++ RVN+ A++E+        + R+ +  
Sbjct  173  LVGLGEEEAVEVVGREERVARLGKVLAGGGSLEARVNAGAVVEAAAL-ASGADARAVLGA  231

Query  932  ADEIFQGIVGILNHPST  982
            A+ +  G+V ++   ++
Sbjct  232  AEGVMAGLVTLVEEKAS  248


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 34/56 (61%), Gaps = 8/56 (14%)
 Frame = +2

Query  1307  AVAAGVLTQLLLLVQ-------SGCTERAKRKAQMLLKLLRDCWP-DDSIVNSDDF  1450
               A GV+  L+ LV+        GC+ERAKRKAQ LLKLLR  WP  D   NSDDF
Sbjct  230   GAAEGVMAGLVTLVEEKASARAGGCSERAKRKAQHLLKLLRSAWPTTDCTANSDDF  285



>ref|XP_004142305.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]
 ref|XP_004168550.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]
 gb|KGN49607.1| hypothetical protein Csa_5G023870 [Cucumis sativus]
Length=444

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 147/416 (35%), Positives = 225/416 (54%), Gaps = 23/416 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LM+DPVT+ TG TYDRASIE+W+  GN TCP T  PL     IPNH
Sbjct  25    LTIPTHFRCPISLDLMKDPVTLSTGITYDRASIETWIEGGNFTCPFTNQPLQTIDSIPNH  84

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
              +R++IQ+WCV NRA+G+ERIPTP+ PA P  V+ +L + ++ +   +     S + +++
Sbjct  85    NIRKMIQDWCVENRAYGIERIPTPRVPASPAQVREILEKMAAAARRGDCDGCKSMVEKIK  144

Query  617   glardsDKNRSVISANNARQVLLSIV--FSNMDSNSS--ELTHEALSILSM-FQLSEAEC  781
              L ++S++N+  I AN     L SI   FSN ++     E+  E LS +++ F L E   
Sbjct  145   KLGKESERNKKCIIANGTGNTLSSIFEAFSNPETFEKRIEILEEILSAMTVAFPLQEESI  204

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
               + S+   +  LV  L    I  R NS  +++ +++    PE   ++       +G++ 
Sbjct  205   KHLKSETS-LQSLVWFLKGGDISGRRNSVLVLKEIISSY--PEKVDELGEIQGALEGLIK  261

Query  962   ILNHP--STHPRALKMGVKALFALCLVKQHRQK----AVIAGAVEALIERLQYLEKCDTE  1123
             ++  P  S+  +A       + A      +R++     +  G V  L+E L   E+   E
Sbjct  262   LIKDPICSSSRKASLFITYHVIASTSSSSNRERFTKELLQMGLVSLLLETLVDAERSVCE  321

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             RAL   + +C    G     AHALT+P++VK IL++SD ATE +   +  L     + + 
Sbjct  322   RALGAFDGICETKQGREEAYAHALTMPVIVKKILRVSDLATELSVCIVWKLVKHESKEEE  381

Query  1304  D------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD-SIVNSDDF  1450
             D      A+  G   +LLLL+Q GC+E  K KA  LLKLL +   D    ++S DF
Sbjct  382   DGGIKVEALQVGAFQKLLLLLQVGCSEWTKEKATELLKLLNNLHRDRLECIDSLDF  437



>ref|XP_009403145.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   206 bits (524),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 149/405 (37%), Positives = 219/405 (54%), Gaps = 14/405 (3%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P  FRCPISLELM+DPVT+ TG TYDR SIESW+  G+ TCPVT   L +  L+PNHT+
Sbjct  31    VPAAFRCPISLELMKDPVTLHTGITYDRQSIESWLEVGSLTCPVTNQALGNDELLPNHTI  90

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADP--Glvqsllsqassvsshlnsrlsalrrlrgl  622
             RRLIQ+WCVANR+FGVERIPTP+ P               +            + +++ L
Sbjct  91    RRLIQDWCVANRSFGVERIPTPRIPVTSIQASELLSEIAFAGRRGDRARCQELVGKIKAL  150

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELT-----HEALSILSMFQLSEAECVF  787
              ++S++NR  I +  A  VL S  FS + + S E +      E LS L +F   + +   
Sbjct  151   GKESERNRRCIGSAGAGCVLAS-CFSELATESFERSRAGAAEEILSALPLFFPLDQDSCR  209

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
               S L  +  +VS+L    +D RVN+A ++  +++ +  P   + ++  D + + +  ++
Sbjct  210   QLSSLKSLESIVSVLRSGDLDARVNAALVLRELLS-SLPPRRINGVAGTDGLVEALSKLI  268

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVI-AGAVEALIERLQYLEKCDTERALATVE  1144
              +P   PRA K  + A F L         A++  G + +L+E L   +K   E+ALA ++
Sbjct  269   QNP-ISPRATKASLVAAFYLVDSSDRAAGALVDTGIIPSLLEILVDSDKGMCEKALAVLD  327

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA---QRDAVA  1315
              +     G      HALTVP+LVK +L++SD ATE+A  AL  LC + ++      +AV 
Sbjct  328   GVLGCSRGREMAYGHALTVPVLVKKMLRVSDMATEFAVSALWKLCRNEKRGGGCSMEAVR  387

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              G   + LLLVQ GC+   K KA  LLKLL  C        + DF
Sbjct  388   VGAFQKSLLLVQVGCSGATKEKANDLLKLLNGCRGSMECTEAVDF  432



>ref|XP_006826592.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
 gb|ERM93829.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
Length=428

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 151/422 (36%), Positives = 232/422 (55%), Gaps = 22/422 (5%)
 Frame = +2

Query  227   MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
             +P  L P  +  IQIP +F+CPISLELMRDPV + TG TYDR SIE W+  G  TCPVT 
Sbjct  8     LPEKLKP-GIKSIQIPSNFKCPISLELMRDPVIMPTGITYDRQSIERWLDEGGKTCPVTN  66

Query  407   APLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQP-ADPGlvqsllsqassvsshl  583
              P+ +  LIPNH LRR+IQ WCVAN + GV+RIPTPK P ++  + + L   + S   +L
Sbjct  67    QPVHEPELIPNHALRRMIQSWCVANSSNGVDRIPTPKIPISEARVSEILSEISVSSDRNL  126

Query  584   nsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFS------NMDSNSSELTHEALS  745
              + L  +R+L+   R+S++NR  ++++ A +VL SI           +S+   L  E ++
Sbjct  127   ANCLKLVRKLKISVRESERNRRCVASSQAGRVLASIFLQIAGKSRAGNSDCRALMEEIMA  186

Query  746   ILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             +L +      E     S  + +  L+  L   ++++R NSA LI+ + +     EL    
Sbjct  187   LLMVLTPLTLEAFSFLSSREILLCLIEGLRQGNLELRKNSALLIKEIASNG---ELTIDF  243

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQY  1102
                D +F+ ++ I+  P     +LK  +  +F +C   +  R KAV  G + A+++ L  
Sbjct  244   RKIDGLFESLLQIIRDPICSS-SLKASLITVFYVCSSDEEIRAKAVKLGFISAILDILPD  302

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              ++   E+A+A ++ LC+   G A  + HAL VPL+VK I ++SD  TE +   L  LC 
Sbjct  303   SDRSVCEKAMAAIDALCKSKEGRAKASEHALMVPLVVKKIFRVSDLVTELSVTVLWRLCK  362

Query  1283  ssE---QAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKL---LRDCWPDDSIVNSD  1444
               E   ++  +A+  G   +LLLL+Q GC  + K K   LLK+    R+ W     V+S 
Sbjct  363   DEECKLKSVSEALQVGAFQKLLLLLQVGCEGKIKEKVTDLLKVTNSYRERW---ECVDSG  419

Query  1445  DF  1450
             DF
Sbjct  420   DF  421



>ref|XP_008465536.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis melo]
Length=445

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 149/424 (35%), Positives = 231/424 (54%), Gaps = 27/424 (6%)
 Frame = +2

Query  242   DPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTD  421
             DP++   + IP HFRCPISL+LM+DPVT+ TG TYDRASIE+W+  GN TCP T  PL  
Sbjct  21    DPVE---LTIPTHFRCPISLDLMKDPVTLSTGITYDRASIETWIEGGNFTCPFTNQPLQT  77

Query  422   FTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--l  595
                IPNH +R++IQ+WCV NRA+G+ERIPTP+ PA P  V+ +L + ++ +   +     
Sbjct  78    IDSIPNHNIRKMIQDWCVENRAYGIERIPTPRVPASPAQVRDILEKMTAAARRGDFEGCK  137

Query  596   salrrlrglardsDKNRSVISANNARQVLLSIV--FSNMDSNSS--ELTHEALSILSM-F  760
             S + +++ L ++S++N+  I AN       SI   FSN ++     E+  E LS ++M F
Sbjct  138   SMVEKIKNLGKESERNKKCIIANGTGNTFSSIFEAFSNPETFEKRIEILEEILSAMTMVF  197

Query  761   QLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
              L E     + S+   +  L   L    I  R NS  +++ +++    PE   ++     
Sbjct  198   PLQEESIKHLKSETS-LQSLAWFLKGGDISGRRNSVLVLKEIISSY--PEKVDELGVIQG  254

Query  941   IFQGIVGILNHP--STHPRA---LKMGVKALFALCLVKQHRQKAVI-AGAVEALIERLQY  1102
               +G++ ++  P  S+  +A   +   V A  +    +    KA++  G V  L+E L  
Sbjct  255   ALEGLIKLIKDPICSSSKKASLFITYHVIASTSSSSNQGRFTKALLQMGLVSLLLETLVD  314

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              E+   ERAL   + +C    G     AHALT+P++VK IL++SD ATE +   +  L  
Sbjct  315   AERSVCERALGAFDGICETKQGREEAYAHALTMPVIVKKILRVSDLATELSVSIVWKLVK  374

Query  1283  ssEQAQR-------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD-SIVN  1438
             +  + ++       +A+  G   +LLLL+Q GC+E  K KA  LLKLL +   D    ++
Sbjct  375   NESKEEKEDGGIEVEALQVGAFQKLLLLLQVGCSEWTKEKATELLKLLNNLHRDRLECID  434

Query  1439  SDDF  1450
             S DF
Sbjct  435   SLDF  438



>ref|XP_009382986.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   198 bits (503),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 140/416 (34%), Positives = 217/416 (52%), Gaps = 26/416 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LM+DPVT  TG TYDRASIE+W+  GN TCPVT   L    LIPNH
Sbjct  26    VSIPTHFRCPISLDLMKDPVTASTGITYDRASIEAWLDMGNATCPVTNRELKQEDLIPNH  85

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlr  616
             ++R++IQ+WCVANR+ G+ERIPTPK P     V  ++S+ ++ S   +       + ++R
Sbjct  86    SIRKMIQDWCVANRSNGIERIPTPKIPVTKAQVTDIVSEIAAASRRRDRARCGQLVAKVR  145

Query  617   glardsDKNRSVISANNARQ-----VLLSIVFSNMDSNSSELTHEALSILSMFQLSEAEC  781
                R+ ++NR    +N   +            S++D + + +  E L+ L+     + E 
Sbjct  146   SSVREGERNRGCFESNGTGRALAAAFGAFAGVSSVDGSVTRVLEEILAALTTLLPLDEEA  205

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA--GTKSPELRSQISNADEIFQGI  955
                    + +  LVS+L H  +  R+N+A +++ ++A  G ++       ++   + + +
Sbjct  206   ASHVGSPESLTCLVSILKHGDLVARLNAAVVVKELLACGGARA----DGTADTAGLVEAL  261

Query  956   VGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-GAVEALIERLQYLEKCDTERAL  1132
             V ++  P   P+  K  + A+F L    +     V+  G V  LIE L   EK   E+AL
Sbjct  262   VKLIKEP-VLPQITKASLVAIFYLTNYSERTASRVVGMGLVPVLIETLVDAEKSMCEKAL  320

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga----------llslcs  1282
             A ++ L     G      HALT P+LVK + ++SD ATE+   A                
Sbjct  321   AVLDALVGCAGGREQAYGHALTTPVLVKKMFRVSDTATEFVVSALWKLCRGEEEAGDEGE  380

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                +  R+A  AG   +LLLL+Q GC E  K KA  LL+LL + +  D  +++ DF
Sbjct  381   GRGRCLREAQQAGAFHKLLLLLQVGCGEATKEKATALLRLL-NGYKKDECIDTTDF  435



>ref|XP_003564002.1| PREDICTED: U-box domain-containing protein 21 [Brachypodium distachyon]
Length=449

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 152/410 (37%), Positives = 211/410 (51%), Gaps = 20/410 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVT-RAPLTDFTLIPN  439
             + IP HFRCPISL+LMRDPVT  TG TYDR ++E W+A G+ TCPVT R PL    L+PN
Sbjct  39    LAIPAHFRCPISLDLMRDPVTAPTGITYDRENLEGWLARGHGTCPVTGRGPLRLADLVPN  98

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQP---ADPGlvqsllsqassvsshlnsrlsalrr  610
             H  RR+IQ WCVANRA GVER+PTPK P   AD   V   LS A+ +         A R 
Sbjct  99    HATRRMIQAWCVANRARGVERVPTPKVPVAEADAAQVLEDLSAAARLGDAAACGEIAARA  158

Query  611   lrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTH-----EALSILSMF--QLS  769
                        R + SA  AR+  LS  F  + +   E        + L+ L++F     
Sbjct  159   RALGKESDRNRRCLASAGAARK--LSSAFGRLAAAGGEPVEGGALGKVLAALTVFFPLDD  216

Query  770   EAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQ  949
             E+    VAS L     LVS+LSH  +  R ++A ++  V +          IS A  +  
Sbjct  217   ESRRCIVASSLT---TLVSVLSHGDLAARASAAIVLREVASSAADRATVEAISRAPGMCD  273

Query  950   GIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERA  1129
              +VG++ +P   P+A K  +   + L   +    +    G V  L E L   +K  +E+A
Sbjct  274   ALVGLVRNP-VSPQATKAALVTAYYLASDRAAASRFAELGVVSVLAELLVDADKGTSEKA  332

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA---Q  1300
             LA ++ +    +G  +  AHAL VP+LVK + ++SD ATE+A  AL  LC +   A   +
Sbjct  333   LAALDGVLCADAGLESARAHALVVPVLVKKMFRVSDMATEFAVSALWRLCHAGADAGACR  392

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              +A+  G   +LLLL+Q GC    K +A  LLKLL         + + DF
Sbjct  393   VEALRVGAFQKLLLLLQVGCGGPTKERASELLKLLNGSRASVECIEAVDF  442



>ref|XP_001783217.1| predicted protein [Physcomitrella patens]
 gb|EDQ51985.1| predicted protein [Physcomitrella patens]
Length=388

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/392 (34%), Positives = 222/392 (57%), Gaps = 18/392 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P  F CPISLELMRDPVT+ TG T+DR+SIE W+  GN TCP T   L +  LIPNH
Sbjct  3     VVVPAFFLCPISLELMRDPVTLSTGMTFDRSSIERWLEFGNNTCPGTNQVLENQELIPNH  62

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLRRLIQ WCVAN+A+GVERIPTPK P      + +    + +     +  ++L++L  L
Sbjct  63    TLRRLIQNWCVANKAYGVERIPTPKAPLQ---TEKVKQLLADIGQCETAGYNSLKKLWSL  119

Query  623   ardsDKNRSVISANNARQVL--------LSIVFSN-MDSNSSELTHEALSILSMFQLSEA  775
             A++S++NR  I    A  +L        + + +S+  + +  E   + L+I+++ ++ + 
Sbjct  120   AKESERNRKCIEEIGAVPILAEALAQLGVDMCYSSRCNRDREEACEDVLAIIALMRVGDG  179

Query  776   ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGI  955
             +   +A+    +  L  +L+  S++ + N+A +I ++    + P L+  + +     +  
Sbjct  180   DKKALAAP-KSLACLAFVLASGSLEAKANAADVIHTLC--EEDPHLKIAVGDLPGAIEAF  236

Query  956   VGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALA  1135
             V +L   + +PR ++ G++ L ++CL +++R  A+   A+  L+E L   EK + + A  
Sbjct  237   VDLLKE-NLYPRVVQAGLRCLLSVCLPRRNRVIAIECRALSVLVELLPNTEKRNKDLAFE  295

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDA  1309
              +E++     G  A + HA  +P++VK +L +S R TE A   L  + S +        A
Sbjct  296   VLEIMANCAEGREAISNHATAIPMIVKSMLGVSQRVTECAVSTLWVVLSYASNRNVINTA  355

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             + AG  T LL+L+ S C++R K+KA+  LKLL
Sbjct  356   LQAGAFTNLLVLLPSECSQRTKQKARDSLKLL  387



>ref|XP_009370082.1| PREDICTED: U-box domain-containing protein 21 [Pyrus x bretschneideri]
Length=446

 Score =   195 bits (496),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 143/398 (36%), Positives = 208/398 (52%), Gaps = 13/398 (3%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             +DV  I IP HFRCPISL+LM+DPVT+ TG TYDR+SIE W+ TGN+TCPVT   LT F 
Sbjct  25    MDVEEIAIPTHFRCPISLDLMKDPVTLPTGMTYDRSSIEKWIETGNSTCPVTNQELTSFD  84

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
              IPNH LRR+IQ+WCV NR++G+ERIPTP+ P  P  V  +  +    +  L+ +     
Sbjct  85    QIPNHALRRMIQDWCVENRSYGIERIPTPRIPVIPYEVSRIRERVMGAARRLDEKKCREL  144

Query  608   rlrglardsDKNRS-VISANNARQVLLSIVFSNMDSNSS----ELTHEALSIL-SMFQLS  769
               +  A   +  R+    A N     LS VF +  S+S+    E+  E L++L  MF L 
Sbjct  145   VGKIKAWGKESERNKKCMAENGIGGCLSAVFESFASSSADEYVEILVEILTVLPWMFPLG  204

Query  770   EAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA-GTKSPELRSQISNADEIF  946
             E +   + S +    ++ S L    +  R N+  ++  + +   K  +   +I    E  
Sbjct  205   EEDQSKLGSSVCLRSFM-SFLEGKDLTARQNTVLVLRKLFSLDQKYVDAFGKIERGVEAI  263

Query  947   QGIVGILNHPSTHPRALK---MGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD  1117
              GI+G    P     AL      + +L +     ++R + V  G V  L+E L   EK  
Sbjct  264   FGIIGEPICPQVTKAALACVLFMISSLPSAGTSDKYRSRFVELGLVSLLLETLVDAEKSV  323

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
             +E+AL  ++ LC    G      +ALT+PLLVK IL+IS+  TE++   +  LC+   Q 
Sbjct  324   SEKALGVLDGLCDCKQGREEALENALTMPLLVKKILRISELGTEFSVSIIWKLCTIETQE  383

Query  1298  QR--DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 +A+  G   +LL+L+Q G     K K   LLKL 
Sbjct  384   SFLIEALQVGAFQKLLVLLQVGVFNGMKDKVTDLLKLF  421



>ref|XP_009404142.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/411 (34%), Positives = 222/411 (54%), Gaps = 18/411 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT-LIPN  439
             I +P HFRCPISLELM+DPVT  TG TYDR SIE+W+  GN TCPVT+  L +   L+PN
Sbjct  25    ITVPTHFRCPISLELMKDPVTASTGITYDRQSIETWLEMGNATCPVTKQELRNADGLLPN  84

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrl  613
             H +R++IQ+WCVANR  G+ERIPTPK P     V  +LS+ ++     +         ++
Sbjct  85    HAIRKMIQDWCVANRRHGIERIPTPKIPVTRTQVVDILSEVAAAGQRGDHARCRQMAAKV  144

Query  614   rglardsDKNRSVISANNARQVLL----SIVFSNMDSNSSELTHEALSILSMFQLSEAEC  781
             R LAR+S++NR   ++N A +VL     ++   + + +++E++ E L+ L+     + E 
Sbjct  145   RNLARESERNRRCFASNGASRVLAATFGAVAGGSSECSAAEVSEEILAALATVSPLDEEA  204

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
                    + +G LVS+L+H ++  R+++A +++ ++A + +      ++    + + +  
Sbjct  205   ASHMGSPESLGCLVSILTHGNLAARLSAALVVKQLLASSGAKV--DAVAGTKGLVEALAK  262

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-GAVEALIERLQYLEKCDTERALAT  1138
             ++  P   P+A K  + A+F +    +     V+  G V  L+E L   EK   E+ALA 
Sbjct  263   LVKEP-IFPQATKASLVAIFYMVSHDERTAAQVVDLGLVPVLVEALVEPEKSMNEKALAV  321

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga-------llslcsssEQA  1297
             +E L     G      HALTVP+LVK + ++SD ATE    A                + 
Sbjct  322   LEGLLSCEGGREKARQHALTVPVLVKKMFRVSDMATELVVSALWKLCRNEGEEGEGKGRC  381

Query  1298  QRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              ++A+  G   +LLLL+Q GC+   K KA  L+K L         V++ DF
Sbjct  382   LQEALRVGAFQKLLLLLQVGCSGETKEKATDLIKQLDGHREAYECVDTMDF  432



>ref|XP_010906325.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=441

 Score =   195 bits (495),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 148/409 (36%), Positives = 220/409 (54%), Gaps = 20/409 (5%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HFRCPISL+LM+DPVTV TG TYDR SIE+W   GN TCPVT   L    LIPNH+L
Sbjct  31    IPTHFRCPISLDLMKDPVTVSTGITYDRHSIETWFEVGNQTCPVTNNVLKSEELIPNHSL  90

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             RR+IQ+WCVANR+ G+ERIPTP+ P  P  V  LLS+ +S S   +         +  A 
Sbjct  91    RRMIQDWCVANRSLGIERIPTPRIPVTPIQVSELLSEIASASRRGDRARCRELVAKIKAL  150

Query  629   dsDKNRS---VISANNARQVLLSIVFSNM-----DSNSSELTHEALSILSM-FQLSEAEC  781
               +  R+   ++S    R  +LS  FS +     D+++S +  E LS L+  F L E   
Sbjct  151   GRESERNWRCIVSGGAGR--VLSASFSELAAGSFDNSTSGVLEEILSALAACFPLDEEAH  208

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
               + S  + +  LV +L+   +  R+N+  +++ +V+   +  + + +++ D + + +V 
Sbjct  209   WHIGSP-ESLNSLVLILNCGDLAGRLNAVLMLKELVSSLDADRI-NVVADTDGLIEALVK  266

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQ-KAVIAGAVEALIERLQYLEKCDTERALAT  1138
             ++  P   P+  K  +   F L    +    K V  G V  L+E L   +K   E+ALA 
Sbjct  267   LIEKP-ISPQTTKASLVTTFYLASSSEMTAVKFVEMGLVSLLLEILVDSDKSMCEKALAV  325

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-----  1303
             ++ +     G    + H+L VP+LVK + ++SD AT +A  AL  LC + EQ +      
Sbjct  326   LDGVLESKKGRETASDHSLAVPVLVKKMFRVSDMATGFAVSALWKLCKNYEQERGEGCLV  385

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             +A+  G   +LLLL+Q GCT   K KA  LLKLL         + + DF
Sbjct  386   EALQVGAFQKLLLLLQVGCTGTTKEKASELLKLLNGMRGRGECIETVDF  434



>ref|XP_008795339.1| PREDICTED: U-box domain-containing protein 21 [Phoenix dactylifera]
Length=446

 Score =   194 bits (493),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 148/398 (37%), Positives = 224/398 (56%), Gaps = 23/398 (6%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HFRCPISL+LM+DPVTV TG TYDR SIE+W   GN TCPVT   L    LIPNH+L
Sbjct  31    IPTHFRCPISLDLMKDPVTVSTGITYDRQSIETWFEHGNQTCPVTNMVLKSEDLIPNHSL  90

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             RR+IQ+WCVANR+ GVERIPTP+ PA P  V  LLS+ +S S   +       + +++ L
Sbjct  91    RRMIQDWCVANRSLGVERIPTPRIPASPAQVAELLSEIASASRRGDHARCRELVGKIKAL  150

Query  623   ardsDKNRSVISANNARQVLLSIVFS-----NMDSNSSELTHEALSILSMFQ-LSEAECV  784
              R+S++NR  I +  A +V LS  FS     +++S++S +  E LS L+ F  L E    
Sbjct  151   GRESERNRRCIVSGGAGRV-LSASFSELAAGSLESSTSGVLEEILSALAAFSPLDEVARR  209

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              + S  + +   VS+L+   +  R+N+  +++ +V+   +  + + ++  + + + +V +
Sbjct  210   QLGSP-ESLKSFVSILNSRDLAGRLNAVLMLKELVSSFDTDRI-NVVAETEGLIEALVKL  267

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHR--QKAVIAGAVEALIERLQYLEKCDTERALAT  1138
             +  P   P+  K  +   F L   +  +   K V  G V  L+E L   +K   E+ALA 
Sbjct  268   IEKP-ISPQTTKASLVVTFYLLSSRGEKAAMKFVEMGLVSLLLEILVDSDKSMCEKALAV  326

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls--lcsssEQAQR---  1303
             ++ + +          H+L +P+LVK + ++SD ATE+A  AL       + E+ +R   
Sbjct  327   LDGVLKCKKARDTAYDHSLAMPVLVKKMFRVSDMATEFAVSALWKLCRSYNQERGEREGE  386

Query  1304  ----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 +A+  G   +LLLL+Q GCT   K KA  LLKLL
Sbjct  387   GCLVEALQVGAFQKLLLLLQVGCTGATKGKASELLKLL  424



>ref|XP_004985053.1| PREDICTED: U-box domain-containing protein 21-like [Setaria italica]
Length=444

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 153/419 (37%), Positives = 222/419 (53%), Gaps = 26/419 (6%)
 Frame = +2

Query  257   GGIQ--IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTL  430
             GG++  IP HFRCPISL+LMRDPVT  TG TYDR SIE+W+ TG  TCPVT APL    L
Sbjct  23    GGVELAIPAHFRCPISLDLMRDPVTAPTGITYDRESIEAWLDTGRATCPVTHAPLRHEDL  82

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr---lsa  601
             +PNH +RR+IQ+WCVANR+ GVERIPTPK P  P     LL   +  +   ++       
Sbjct  83    VPNHAIRRVIQDWCVANRSRGVERIPTPKIPVTPVQASELLFDLAGAARRRDAVPRCAEV  142

Query  602   lrrlrglardsDKNR---SVISANNARQVLLSIVFSNMDSNSSELTHEAL--SILSMFQL  766
             + R++ LARDS++NR   + I    A       + S  D+  +    E +  +++ M  L
Sbjct  143   VARIKALARDSERNRRCFASIGTGRALAAAFKSLASAADTAPAGRVLEDILAALVCMMPL  202

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKS-PELRSQISNADEI  943
              E     + S    +G LV++    S+  R+N+   I+ VV+   +  +L  ++   DEI
Sbjct  203   DEEAAATLGSP-SSLGSLVAIAESGSLAGRMNAVLAIKEVVSCDGAFVDLSRKL---DEI  258

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDT  1120
                +V I+  P   P+A K  + A + L    +    +   AG V  L+E L   +K  +
Sbjct  259   VDALVKIIKAP-ICPQATKAAMVATYHLARSDERVAARLATAGLVPVLVEALVEADKSMS  317

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             E+ALA ++ +     G  +  AHAL VP+LVK + ++SD ATE A  A+  L  +    +
Sbjct  318   EKALAVLDAVLASEEGRESARAHALAVPVLVKKMFRVSDLATELAVSAMWRLGRAPRDGE  377

Query  1301  RD---------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              D         A+  G   +LLLL+Q GC +  K KA  LLK+L         V++ DF
Sbjct  378   EDDEVTRCLVEALRVGAFQKLLLLLQVGCRDATKEKATELLKMLNKYKGVGECVDAGDF  436



>gb|AGT17408.1| hypothetical protein SHCRBa_230_N09_R_300 [Saccharum hybrid cultivar 
R570]
Length=449

 Score =   193 bits (490),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 147/416 (35%), Positives = 220/416 (53%), Gaps = 25/416 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP H+RCPISL+LMRDPVT  TG TYDR SIE+W+ TG  TCPVT APL    L+PNH
Sbjct  31    LAIPAHYRCPISLDLMRDPVTAPTGITYDRESIEAWLDTGRATCPVTHAPLRHEDLVPNH  90

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvsshlnsrlsalrrl  613
              +RR+IQ+WCVANR+ GVERIPTPK P  P     +   L+ ++            + ++
Sbjct  91    AIRRVIQDWCVANRSRGVERIPTPKIPVTPVQASELLFDLAGSARGRDAAARCAEVVAKI  150

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL-----SILSMFQLSEAE  778
             + LARDS++NR   ++    +VL +   S   +  +      L     +++ M  L E E
Sbjct  151   KALARDSERNRRCFASIGTGRVLAAAFESLAAAADAAPAGRVLEDILAALVCMMPLDE-E  209

Query  779   CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKS-PELRSQISNADEIFQGI  955
                       +G LV++  + S+  R+N+   I  VV+   +  +L  ++   DEI   +
Sbjct  210   AARTLGLPTSLGSLVAIAENGSLAGRLNAVLAIREVVSCDGAFTDLSGKV---DEIVDAL  266

Query  956   VGILNHPSTHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDTERAL  1132
               I+  P   P+A K G+ A++ L L  +    +   AG V  L+E L   +K  +E+AL
Sbjct  267   AKIIKAP-ICPQATKAGMVAIYHLALYDERVAARLAAAGLVPVLVEALVDADKSMSEKAL  325

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR---  1303
             A ++ +     G A+  AHAL VP+LVK + ++SD AT+ A  A+  L  +    +    
Sbjct  326   AVLDAVLASEEGRASARAHALAVPMLVKKMFRVSDLATQLAVSAMWRLGKAHSDGEEEED  385

Query  1304  -------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                    +A+  G   +LLLL+Q GC +  K KA  LLK+L         V++ DF
Sbjct  386   AVTRCLVEALRVGAFQKLLLLLQVGCRDATKEKATELLKMLNKYKSVGECVDAMDF  441



>ref|XP_009770354.1| PREDICTED: U-box domain-containing protein 21-like [Nicotiana 
sylvestris]
Length=448

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 136/400 (34%), Positives = 209/400 (52%), Gaps = 21/400 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HF+CPISL+LM+DPVT+ TG TYDR SIE+W+  GN TCP+T+  L     IPNH
Sbjct  29    LMIPSHFKCPISLDLMKDPVTLSTGITYDRESIETWIEGGNQTCPITKQGLKSLEPIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqa-----ssvsshlnsrlsalr  607
             T+R++IQ+WCV N+  GVERIPTP+ P     V  +L +             NS  + + 
Sbjct  89    TMRKMIQQWCVENKDHGVERIPTPRIPVTSSEVTEILRKIESCCLKEQHDSKNSCRALVL  148

Query  608   rlrglardsDKNRSVISANNARQVLLSIV--FS-NMDSNSSELTHEALSILSMFQLSEAE  778
             +++ + ++S +NR     N A ++L S +  FS  +  +  E   E LS L++    + E
Sbjct  149   KMKIMIKESARNRRCFITNGAAKILSSTLVGFSEKLSVHDVETMEEILSTLTILLPLDGE  208

Query  779   CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
                       +  LV  L   S+  R NS  L++ ++   +   +  ++   D   + +V
Sbjct  209   SKSTLGSKSSLNCLVWFLKCGSLSSRRNSVLLLKEIMKIEEKWRV-EELLKIDGALEALV  267

Query  959   GILNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
              ++  P   P   K  +  ++ +      + ++ R K    G VE LIE L   EK   E
Sbjct  268   KLVKEP-ICPTTTKASLLTIYHMVNSSQIINQKARVKFADLGLVELLIEILVDCEKSICE  326

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             +AL  +  +C    G      +ALT+P+L+K +L++SD ATE++   L  L    EQ + 
Sbjct  327   KALGILVGICSSEEGKRRAYGYALTIPVLIKKLLRVSDLATEFSVSILWKLIGKREQREN  386

Query  1304  ------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                   +A+  G   +LLLL+Q GC+ER K KA  LLKLL
Sbjct  387   GNVVLIEALQVGAFQKLLLLIQVGCSERTKEKASELLKLL  426



>ref|XP_008780992.1| PREDICTED: U-box domain-containing protein 21-like [Phoenix dactylifera]
Length=419

 Score =   191 bits (484),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 151/412 (37%), Positives = 225/412 (55%), Gaps = 22/412 (5%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HFRCPISL+LM+DPVTV TG TYDR SIE+W   G  TCPVT   LT   LIPNH+L
Sbjct  5     IPTHFRCPISLDLMKDPVTVSTGITYDRQSIETWFELGRQTCPVTYKVLTTEDLIPNHSL  64

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             RR+IQ+WCV+NR+ G+ERIPTP+ P  P  V  LLS+ +S S+  +       + +++ L
Sbjct  65    RRMIQDWCVSNRSSGIERIPTPRIPVAPTQVSELLSEIASASARGDHVRCQELVAKIKAL  124

Query  623   ardsDKNRSVISANNARQVLLSIVFSNM-----DSNSSELTHEALSILSMFQLSEAECVF  787
              R+S++NR  I +  A  + LS  FS +     DS++S +  E LS L+ F   + E   
Sbjct  125   GRESERNRRCIISGGAVHI-LSASFSELAAGSFDSSTSGVLEELLSALTAFSPLDKEAHR  183

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
                  + +  LVS+L    +  R+N+A +++ +V+      + + ++    + + +V ++
Sbjct  184   HIGSPESLKSLVSILKCGDLAGRLNAALMLKDLVSSLDIDRV-NLVAETYGLIEALVKLI  242

Query  968   NHPSTHPRALKMGVKALFALCLVKQ-HRQKAVIAGAVEALIERLQYLEKCDTERALATVE  1144
               P   P+A K  + A F L    +    K    G V  L+E L   +K   E+ALA ++
Sbjct  243   EQP-VSPQATKASLVATFYLVSSSEITATKFAEMGLVSLLLEILVDSDKSMVEKALAVLD  301

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVAA--  1318
              +     G      H+L +P+LVK +L++SD ATE+A  AL  LC + +Q +R  +A   
Sbjct  302   GVLNCKKGRETAYDHSLAMPVLVKKLLRVSDMATEFAVSALWKLCKNCKQ-ERGEIAGEE  360

Query  1319  --------GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                     G   +LLLL+Q GC+   K KA  LLKLL         + + DF
Sbjct  361   CLVETLQVGAFQKLLLLLQVGCSGATKVKASDLLKLLNGARRMGDCIGTADF  412



>ref|XP_009600234.1| PREDICTED: U-box domain-containing protein 21-like [Nicotiana 
tomentosiformis]
Length=450

 Score =   190 bits (483),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 130/402 (32%), Positives = 207/402 (51%), Gaps = 23/402 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HF+CPISL+LM+DPVT+ TG TYDR SIE+W+  GN TCP+T+  L     IPNH
Sbjct  29    LMIPSHFKCPISLDLMKDPVTLSTGITYDRESIETWIEGGNQTCPITKQVLKYLEPIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqass-----vsshlnsrlsalr  607
             T+R++IQ+WCV N+  GVERIPTP+ P        +L +  S           S    + 
Sbjct  89    TMRKMIQQWCVENKDHGVERIPTPRIPVTSSEATEILREIESCCSFEQHDSKYSCRELVL  148

Query  608   rlrglardsDKNRSVISANNARQVLLSIVFS---NMDSNSSELTHEALSILSMFQLSEAE  778
             +++ + ++S +NR     N A ++L S +      +  +  E   E LS L++    + E
Sbjct  149   KVKIMIKESARNRRCFVTNGAGKILSSTLLGFSEKLSVHDVETMDEILSALTILLPLDGE  208

Query  779   CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
                +      +  LV  L   S+  R NS  L++ ++   +   +   + N D + + +V
Sbjct  209   SKSILGSKSSLNCLVWFLKCGSLSSRRNSVLLLKEIMRIDEKWRVEELLKN-DGVLEALV  267

Query  959   GILNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEALIERLQYLEKCDTE  1123
              ++  P   P   K  +  ++ +      + ++ + K    G VE L+E L   EK   E
Sbjct  268   KLVKEP-ICPTTTKASLLTIYHMVNSSHSINEKAKAKFADLGLVELLVETLVDCEKSICE  326

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             + L  +  +C    G      +ALT+P+L+K +L++SD ATE++   L  L   +E+ + 
Sbjct  327   KVLGILVGICSSEEGKRRAYGYALTIPILIKKLLRVSDLATEFSVSILWKLIGKNEKREN  386

Query  1304  --------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                     +A+  G   +LLLL+Q GC+ER K KA  LLKLL
Sbjct  387   IGGNIVLIEALQVGAFQKLLLLIQVGCSERTKEKASELLKLL  428



>ref|NP_001049509.1| Os03g0240600 [Oryza sativa Japonica Group]
 gb|ABF94888.1| U-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11423.1| Os03g0240600 [Oryza sativa Japonica Group]
 dbj|BAG98618.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74841.1| hypothetical protein OsI_10696 [Oryza sativa Indica Group]
 gb|AEK32593.1| U-box containing E3 ligase [Oryza sativa Japonica Group]
Length=445

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 214/410 (52%), Gaps = 17/410 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LMRDPVT  TG TYDR  IE+W+ TG   CPVT APL    L+PNH
Sbjct  32    LAIPAHFRCPISLDLMRDPVTAPTGITYDREGIEAWLDTGRAVCPVTHAPLRHEDLVPNH  91

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADP---Glvqsllsqassvsshlnsrlsalrrl  613
              +RR+IQ+WCVANR+ GVERIPTPK P  P     +   ++++++          A+ R+
Sbjct  92    AIRRVIQDWCVANRSRGVERIPTPKIPVTPVQASELLFDVAESAARRGAAGRAAGAVARV  151

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVA  793
             R LARDS++NR    +    +VL +   S   +  + +  + L+ L      + E   V 
Sbjct  152   RALARDSERNRRCFVSVGTGRVLAAAFESLAAAGEAGVLEDVLAALVCMMPLDEEAARVL  211

Query  794   SDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNH  973
             +    +G LV++  H S+  R+N+   I+  V+      +       D++   +V I+  
Sbjct  212   ASSSSMGSLVAIAKHGSLAGRLNAVLAIKEAVS-RDGAFVDLADDKVDKVVDALVVIIKA  270

Query  974   PSTHPRALKMGVKALFALCLVKQHRQKAVIA--GAVEALIERLQYLEKCDTERALATVEL  1147
             P   P+A K  + A + L      R  A +A  G V  LIE L   +K  +E+ALA ++ 
Sbjct  271   P-ICPQATKAAMVATYHLA-SSDERVAARVASTGLVPTLIEALVDADKSVSEKALAVLDA  328

Query  1148  LCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVAAGVL  1327
             +     G A+   HAL +P LVK + ++SD ATE A  A+  L   +     +A A G L
Sbjct  329   MLASEEGRASARGHALAMPALVKKMFRVSDVATELAVSAMWRLGCKASSGDEEAAATGCL  388

Query  1328  TQ---------LLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              +         LLLL+Q GC +  K KA  LLK+L         V++ DF
Sbjct  389   VEALRVGAFQKLLLLLQVGCRDATKEKATELLKMLNKHKGLGECVDAVDF  438



>ref|XP_010102878.1| U-box domain-containing protein 20 [Morus notabilis]
 gb|EXB94294.1| U-box domain-containing protein 20 [Morus notabilis]
Length=455

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 135/410 (33%), Positives = 210/410 (51%), Gaps = 33/410 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP HFRCPI+L+LM+DPVT+ TG TYDR SIE W+ +GN TCPVT   L  F  IPNH
Sbjct  27    IVIPAHFRCPITLDLMKDPVTLSTGITYDRDSIEKWIESGNRTCPVTNQVLKSFDQIPNH  86

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             T+RR+IQ+WCV NR+ GVERIPTP+ P     V S+  + +  + + + +       +  
Sbjct  87    TIRRMIQDWCVQNRSHGVERIPTPRIPVTQYEVSSVCERIAIATRNKDRKRCQELVGKMK  146

Query  623   ardsDKNRS---VISANNARQVLLS-----IVFSNMDSNSSE------LTHEALSILSMF  760
                 +  R+   +++    R +LLS     +VFS  +    E      L  + LS+L+  
Sbjct  147   IWAKESERNRKCMVNGGIGRVLLLSFEAFAVVFSAEELGEQESANVRVLLEQILSVLTWD  206

Query  761   QLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
               S  + +   + L     LVS L    +  R N+  +I+ ++A  +  ++   I+  D 
Sbjct  207   ADSLGDGLKNDTSL---RCLVSFLQGNDLSARQNAVMVIKELLASDQGRDVAVSIAEIDG  263

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQH----RQKAVIAGAVEALIERLQYLE  1108
               + +V ++  P   P+A+K  + A+F +          R + V  G V  L+E +   E
Sbjct  264   GVEALVRMIREP-VSPKAMKASLTAVFHMINTNNDTNSVRSRFVDLGLVSLLLENILEGE  322

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsss  1288
             K  +ER+L    ++C    G      +ALT+PL+VK IL++SD A+E     L  LC ++
Sbjct  323   KGVSERSLRVFNVVCDSEEGREKAYDNALTIPLVVKKILRVSDLASELLVSILWKLCKNA  382

Query  1289  EQAQRD-----------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             +  + D           A+  G   +LL+++Q GC  + K K   LLKL 
Sbjct  383   KSKEEDDNDREISAVVEALQVGAFEKLLVVLQIGCGSKTKEKVTQLLKLF  432



>ref|XP_009390871.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=433

 Score =   189 bits (480),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 141/409 (34%), Positives = 220/409 (54%), Gaps = 16/409 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LMRDPVT  TG TYDR SIE+W   GNT+CPVT   L    LIPNH
Sbjct  20    VAIPTHFRCPISLDLMRDPVTASTGITYDRQSIETWQELGNTSCPVTGQQLQHQDLIPNH  79

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             ++R++IQ+WCVA+R +G ERIPTP  P +   V  +LS+ ++ S   +    A    +  
Sbjct  80    SIRKMIQDWCVAHRPYGFERIPTPTAPVNRAEVMDVLSEIATASRQGDVAACARSVAKVT  139

Query  623   --ardsDKNRSVISANNARQVLLS--IVFSNMDSNSS--ELTHEALSILSM-FQLSEAEC  781
               A++SD+NR  ++ +   +VL +  + F+   S+ +   +  E L+ ++M   L E   
Sbjct  140   NWAKESDRNRRRLAFDGMTRVLAATFVAFARASSDVAVVRILEEVLAAMAMLLPLDEEAA  199

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
               + S  + +  LVS+L    +  R+++A  ++ ++A   +      I+    + + +V 
Sbjct  200   ACIGSSPESLKRLVSVLRCGDVAARLHAALTVKELLASGGARA--DAIAATKGMGEALVK  257

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-GAVEALIERLQYLEKCDTERALAT  1138
             ++  P +  RA+K  + ++F +    +     ++  G V  L+E L   EK   E+ALA 
Sbjct  258   LVKRPIS-SRAMKASLVSIFYMVNSDEKTATRIVDLGLVPVLVEILVDDEKSMCEKALAV  316

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-----  1303
             ++ L     G      HALTVP+L K + ++SD ATE+   AL  LC   +   R     
Sbjct  317   LDGLLSCERGRENACGHALTVPVLAKKMFRVSDMATEFVVSALWKLCKDHKGGGRERCLL  376

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             DA+ AG   +LLLL+Q GC E  K +   LL+LL         V++ DF
Sbjct  377   DALQAGTFHKLLLLLQVGCGEATKERVTDLLRLLNGYRGRIQCVDTMDF  425



>ref|XP_009419493.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   189 bits (479),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 152/405 (38%), Positives = 215/405 (53%), Gaps = 29/405 (7%)
 Frame = +2

Query  260   GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVAT-GNTTCPVTRAPLTDFTLIP  436
             G+++P +F CPISLELMRDPVT+ TG TYDR SIE W+     +TCP T+ PL D  L P
Sbjct  3     GVEVPSYFLCPISLELMRDPVTLTTGITYDRDSIERWIFDRKQSTCPATKQPLEDRELTP  62

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC  N + GV+RIPTP+ P D       +++    +     RL +LR LR
Sbjct  63    NHTLRRLIQAWCTLNSSNGVDRIPTPRPPIDKA----QIAKLLEEARLPQFRLGSLRELR  118

Query  617   glardsDKNRSVISANNARQVLLSIVFSNM--------DSNSSELTHEALSILSMFQLSE  772
              +  +SD+NR  + A       L+ V  N          S S+    EAL +L   ++SE
Sbjct  119   TIVSESDRNRRCVEATPGVVDFLASVIVNYGSEGETGDGSESASACDEALVLLQTLEISE  178

Query  773   AEC--VFVASDLDRVGYLVSL---LSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
                  VFV +     G + SL   L   +   R N+  ++ S++     P  RS I    
Sbjct  179   EGLLDVFVKNG----GIMESLSMILRRSNYQSRSNAMLILNSLLGVI--PPARS-IGLGG  231

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKC  1114
             E+FQ IV ++    +  +A K  + AL  LCL  + R KAV AGAV AL+E  L+  +K 
Sbjct  232   ELFQEIVNVVRDRISQ-QATKAALHALLRLCLYGKSRVKAVEAGAVHALVELLLESPQKR  290

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E ALA ++ LC    G A    H   +P + K IL++S  A+E A   L S+   S  
Sbjct  291   VCELALAGLDWLCGCADGRAELVRHRAAIPAVSKKILRVSQLASEKAVRILHSVARHSAT  350

Query  1295  AQ--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
             A   ++ +  GV+++L L++Q GC  + + KA+ +LKL    W D
Sbjct  351   AAVLQEMMNVGVVSKLCLVLQVGCGGKMEEKAREILKLHSRVWKD  395



>ref|XP_010925800.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=445

 Score =   189 bits (480),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 146/415 (35%), Positives = 226/415 (54%), Gaps = 24/415 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISLELM+DPVT  TG TYDR SIE+W+  GN TCPVT   L    LIPNH
Sbjct  29    LSIPTHFRCPISLELMKDPVTASTGITYDRQSIETWIELGNQTCPVTNQALKSQDLIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
             +LRR+IQ+WCVANR+ G+ERIPTP+ PA P  V  LLS+ +  S   + R     + +++
Sbjct  89    SLRRMIQDWCVANRSSGIERIPTPRIPATPTQVSELLSEIALSSREGDRRRCRELVAKIK  148

Query  617   glardsDKNRSVISANNARQVLLSIVF------SNMDSNSSELTHEALSILSMFQL-SEA  775
              L  +S++NR  I++  + ++ LS  F      S ++S +  +     +++ +F L SEA
Sbjct  149   ALGMESERNRLCIASCGSGRI-LSNSFRELARGSTVNSTTGVMEEILSAVVGLFPLDSEA  207

Query  776   ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGI  955
                  A   + +  +VS+L    +  ++N+  +++ +VA   + ++ + ++  D + + +
Sbjct  208   HRHIGAP--ESLEAIVSILKTGDLGGKLNAVLVLKELVASVDAEQI-NVVAETDGLIEAL  264

Query  956   VGILNHPSTHPRALKMGVKALFALCLVKQHR-QKAVIAGAVEALIERLQYLEKCDTERAL  1132
             V ++  P   P+  K  + A F L    +   ++ V  G V  L+E L   EK   E+AL
Sbjct  265   VKLVEKP-ISPQTTKASLVATFYLVSSSERTAERFVEMGLVSLLLEILVDWEKSMYEKAL  323

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD--  1306
               ++ +     G      H+LTVP+LVK + ++SD AT +A  AL  LC + ++   D  
Sbjct  324   GVLDGVLDYKRGREMAYDHSLTVPVLVKKMFRVSDMATGFAVSALWKLCMNYKKEGGDRA  383

Query  1307  -------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                    A+  G   +LLLL+Q GC    K KA  LLKLL         + + DF
Sbjct  384   GEGFLVEALEVGAFQKLLLLLQVGCNGTTKEKASELLKLLNGSRERVECIETADF  438



>ref|XP_004145841.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]
 gb|KGN57802.1| hypothetical protein Csa_3G308190 [Cucumis sativus]
Length=442

 Score =   189 bits (479),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 141/395 (36%), Positives = 215/395 (54%), Gaps = 18/395 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP H+ CPISL+LM+DPV + TG TYDR SIE W+  GN +CPVT+  LT F LIPNH
Sbjct  29    IAIPSHYMCPISLDLMKDPVILSTGITYDRESIEKWIDGGNFSCPVTKQDLTVFDLIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
              LRRLIQ+WCVANR++G+ERIPTP+ P  P  V+ + S+ S  +   +S+     + ++R
Sbjct  89    ALRRLIQDWCVANRSYGIERIPTPRIPVSPYEVKEICSRISIATQRSDSKRCSELMGKIR  148

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQLSEAECV  784
               A++S++NR  I  N     +L+  F +    S E    L  E L +L+       E +
Sbjct  149   NWAKESERNRRCI-VNGGTGDVLAASFEHFAGVSIEKHVGLLEEILLVLTCVYPVAIEGL  207

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
                   D +  LVS L    +  + ++  +++ ++A  +     + ++  + + + +V I
Sbjct  208   SKLGSADSLKCLVSFLVGKDLSPKQSAIFVLKELLAADR--RYVNSLAAIEGVSEALVSI  265

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA----GAVEALIERLQYLEKCDTERAL  1132
             +  P   P A K  + A+F + L     +K  +     G V  L+E L   EK   E+AL
Sbjct  266   IRDPLC-PSATKSSLTAIFYMILPSDIGEKMALKFVELGLVSQLLEFLVDAEKSLCEKAL  324

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR---  1303
               ++ +C    G      +ALT+PLLVK IL++S+ ATEY+   LL LC S E+ +    
Sbjct  325   GILDGICDYKQGREKLYNNALTIPLLVKKILRVSELATEYSLSILLKLCKSGEKGENEVR  384

Query  1304  -DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              +A   G   ++L+L+Q GC    K K   +LKLL
Sbjct  385   VEAAQLGAFQKILVLLQVGCGGDMKDKVTEMLKLL  419



>ref|XP_008798516.1| PREDICTED: U-box domain-containing protein 21-like [Phoenix dactylifera]
Length=445

 Score =   189 bits (479),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 138/419 (33%), Positives = 223/419 (53%), Gaps = 22/419 (5%)
 Frame = +2

Query  251   DVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTL  430
             ++  + IP HFRCPISLELM+DPVTV TG TYDR SIE+W+  GNTTCPVT   L    L
Sbjct  23    NIAEVSIPTHFRCPISLELMKDPVTVSTGITYDRQSIETWLDMGNTTCPVTNQDLEVEDL  82

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--sal  604
             IPNH++RR+IQ+WCVAN ++G+ERIPTPK P  P     +LS  ++ S    +       
Sbjct  83    IPNHSIRRMIQDWCVANHSYGIERIPTPKIPVTPAQASEILSGIAAASRRGETTKCRELA  142

Query  605   rrlrglardsDKNRSVISANNARQVLLSIVFSN----MDSNSSELTHEALSILSMFQLSE  772
              +++  A++S++NR    ++ A + L +   +     ++++ + +  + LS L      +
Sbjct  143   VKVKAFAKESERNRRCFMSHGAGRALAASFSAFAAGPLENSKTGVLEDILSALVFMHPLD  202

Query  773   AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
              E  +     + +  +V +L    +  R+ +  +++ +V+   + E    ++N   + + 
Sbjct  203   EETAWHIGSPESLDSIVLILKCGDLAGRLGAVLVVKELVSA--NGEWVEVMANTKGLIEA  260

Query  953   IVGILNHPSTHPRALKMGVKALFALCL--VKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             +V ++  P   P+A K  + A + +    V++   + V  G V  L+E L   EK   E+
Sbjct  261   LVKLIKEP-IFPQATKASLVATYYMVNSDVERMASRFVDLGLVPVLLEILVDSEKSMCEK  319

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-  1303
             ALA +  L     G      HALT+P+LVK + ++SD ATE+   AL  LC +  + +  
Sbjct  320   ALAVLSGLLSCEEGREKAYEHALTMPVLVKKMFRVSDMATEFVVSALWKLCKNYNEEEAE  379

Query  1304  ----------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                       +A+  G   +LLLL+Q GC+  AK KA  LLKLL         +++ DF
Sbjct  380   EGGRRGESLVEALQVGAFQKLLLLLQVGCSGSAKEKATDLLKLLNGYRGRAECIDTMDF  438



>ref|XP_010105562.1| U-box domain-containing protein 20 [Morus notabilis]
 gb|EXC05057.1| U-box domain-containing protein 20 [Morus notabilis]
Length=454

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 218/419 (52%), Gaps = 39/419 (9%)
 Frame = +2

Query  245   PLDVGG----IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAP  412
             PLD G     + IP HFRCPISL+LM+DPVT+ TG TYDR SIE+W+ +GN TCP+T   
Sbjct  21    PLDGGAGDIELTIPSHFRCPISLDLMKDPVTLTTGITYDRQSIETWIESGNVTCPITNQV  80

Query  413   LTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshln  586
             L     IPNHT+R++IQ+WCV N+++G+ERIPTP+ P  +D           ++      
Sbjct  81    LRSLEPIPNHTIRKMIQDWCVQNKSYGIERIPTPRIPISSDEVSEILFKITEAAERRDRE  140

Query  587   srlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNM--------DSNSSELTHEAL  742
                  + +L+   ++S+ N+  I +N A +  L+  F  +        D N   +  E L
Sbjct  141   KCKELVMKLKDSMKESEGNKRRIMSNGAGKA-LAAAFEALSSSEKAVFDENRMGILEELL  199

Query  743   SILSMF--QLSEAECVF-VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPEL  913
             S L++F     EA+CV  + S L     +V L+    +  R NS  +I+ +V+   +P  
Sbjct  200   SALTLFFPLDEEAKCVLGLESSLH---CMVRLMEAGDLSRRRNSVLVIKQIVSS--NPRK  254

Query  914   RSQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVK----QHRQKAVIAGAVEA  1081
              + ++  +   + +V ++  P   P   K  +  ++ +        + R++ V  G V +
Sbjct  255   IAAMAEIEGAMEALVKLIKEP-ICPTPTKASLMVMYHMVSSSFSNDKIRERFVEMGLVPS  313

Query  1082  LIERLQYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaag  1261
             L+E +   E+   ++AL  ++ +C    G      +ALT+P+LVK IL++SD ATE++  
Sbjct  314   LLEMIVGSERSVCDKALGVLDGICSCKKGREEAYGNALTMPVLVKKILRVSDSATEFSVS  373

Query  1262  allslcsssEQAQRD-----------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              +  LC S E    D           A+  G   +LLL++Q GC ER K +   LLK+L
Sbjct  374   IIWKLCKSREDEGDDNEERIIRAVVEALQVGAFQKLLLVLQVGCGERLKEETSDLLKVL  432



>ref|XP_004236923.1| PREDICTED: U-box domain-containing protein 21-like [Solanum lycopersicum]
Length=442

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 205/395 (52%), Gaps = 16/395 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P HF+CPISL+LM DPVT+ TG TYDR SIE+W+  GN TCP+T+  L     IPNH
Sbjct  28    LMVPSHFKCPISLDLMSDPVTLSTGITYDRVSIETWIENGNQTCPITKKLLNTLEPIPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqass---vsshlnsrlsalrrl  613
             T+R++IQEWCVAN+ +G+ERIPTP+ P     V  +L +  S   +     S    + ++
Sbjct  88    TMRKMIQEWCVANKEYGIERIPTPRIPVTSSEVTGILRKIESCCKLQQGSESSRELVMKM  147

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDSNS---SELTHEALSILSMFQLSEAECV  784
             R + ++S +N+    AN A ++L S +    + +S    E   E +S L++    ++E  
Sbjct  148   RNMIKESTRNKRCFVANGAGKMLSSTLDCFTEKSSVYEVETMEEIISALTILLPLDSESK  207

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              +      +  ++  L   S+  R NS  L++ ++   +   +  ++   D   + +V +
Sbjct  208   SILGSKSSLNCMIWFLKCGSLSSRRNSVFLLKEIMRMEEVWRVE-ELLKIDGGLESLVKL  266

Query  965   LNHPSTHPRALKMGVKALFALCLVKQ-----HRQKAVIAGAVEALIERLQYLEKCDTERA  1129
             +  P   P   K  +  ++ +    Q      R K V  G VE LIE L   EK   E+ 
Sbjct  267   IKEP-ICPTTTKASLLTIYHMVNSSQLSNDKARSKFVDLGLVELLIETLVDCEKSICEKV  325

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ---  1300
             L  +  LC    G      +ALT+P+L+K +L++SD ATE++   L  L           
Sbjct  326   LGILARLCNSQEGRKRANNYALTIPVLIKKLLRVSDLATEFSVSILWKLLIGKNDNVVLI  385

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              +A+  G   +LLLL+Q GC E  K KA  LLKLL
Sbjct  386   NEALQVGAFQKLLLLIQVGCGENTKEKASELLKLL  420



>ref|XP_006355051.1| PREDICTED: U-box domain-containing protein 21-like [Solanum tuberosum]
Length=442

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 128/395 (32%), Positives = 200/395 (51%), Gaps = 16/395 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P HF+CPISL+LM+DPVT+ TG TYDR SIE+W+  GN TCP+T+  +     IPNH
Sbjct  28    LMVPSHFKCPISLDLMKDPVTLSTGITYDRVSIETWIENGNQTCPITKKVVKTLEPIPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             T+R++IQEWCV N+ +G+ERIPTP+ P     V  +L +  S         S+   +  +
Sbjct  88    TMRKMIQEWCVVNKDYGIERIPTPRIPVTSDEVTVILRKIESCCKLQQGSESSRELVMKM  147

Query  623   ardsD---KNRSVISANNARQVLLSIVFSNMDSNS---SELTHEALSILSMFQLSEAECV  784
              +      +N+    AN A ++L SI+    + +S    E   E LS L++    + E  
Sbjct  148   RKMIKESMRNKRCFVANGAGKILSSILVGFTEKSSVYEVETMEEILSTLTILLPLDGESK  207

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
                     +  ++  L   S+  R NS  L++ ++   ++  +  ++   D   + +V +
Sbjct  208   SFLGSKSSLNCMIWFLKCGSLSSRRNSVFLLKEIMRMEETWRV-EELLKIDGSLESLVKL  266

Query  965   LNHPSTHPRALKMGVKALFALCLVKQ-----HRQKAVIAGAVEALIERLQYLEKCDTERA  1129
             +  P   P   K  +  ++ +    Q      R K V  G VE LIE L   EK   E+ 
Sbjct  267   VKEP-ICPTTTKASLLTIYHMVNSSQLSNEKARSKFVDLGLVELLIETLVDCEKSICEKV  325

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ---  1300
             L  +  +C    G      +ALT+P+L+K +L++S  ATE++   L  L           
Sbjct  326   LGILARICNSQEGKKRANNYALTIPVLIKKLLRVSVLATEFSVSILWKLLIEKRDNVVLI  385

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              +A+  G   +LLLL+Q GC+E  K KA  LLKLL
Sbjct  386   NEALQVGAFQKLLLLIQVGCSENTKEKASELLKLL  420



>ref|XP_009378957.1| PREDICTED: U-box domain-containing protein 21-like [Pyrus x bretschneideri]
Length=446

 Score =   187 bits (475),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 142/405 (35%), Positives = 212/405 (52%), Gaps = 27/405 (7%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             ++V  I IP HFRCPISL+LM+DPVT+ TG TYDR+SI+ W+ TGN+TCPVT   L  F 
Sbjct  25    MEVEEIAIPTHFRCPISLDLMKDPVTLSTGMTYDRSSIDMWIETGNSTCPVTNQELMSFD  84

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--sa  601
              IPNH LRR+IQ+WCV NR+ G+ERIPTP+ P  P  V  +  + +  +  L+ +     
Sbjct  85    QIPNHALRRMIQDWCVENRSNGIERIPTPRIPVTPYEVLRIRERVAGAARRLDEKKCHEL  144

Query  602   lrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSS---ELTHEALSIL-SMFQLS  769
             + +++   ++S++N+  +  N     L ++  S  D +     E+  E LS+L  +F LS
Sbjct  145   VGKIKAWGKESERNKKCMVENGIGSCLSAVFESFADGSMDKHVEILVEILSVLPWIFPLS  204

Query  770   EAECVFVASDLDRVGYL---VSLLSHPSIDVRVNSAALIESVVAG-TKSPELRSQISNAD  937
             E       S L   G L   VS L    +  R N+  ++  + +   K  +    I    
Sbjct  205   EEG----QSKLGSSGCLRSFVSFLEGKDLTARKNAVLVLRKLFSSDQKYADAFWAIEGGT  260

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALC-------LVKQHRQKAVIAGAVEALIERL  1096
             E    IVGI+  P   P+A K  +  +  +           + R + V  G V  L+E L
Sbjct  261   E---AIVGIIREP-ICPQATKAALACVLFMISSPPTAQTSDEIRSRFVELGLVSLLLEIL  316

Query  1097  QYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl  1276
                EK  +ERAL  +E+LC    G      +ALT+PLLVK IL+IS+  TE++   +  L
Sbjct  317   VEAEKGVSERALGVLEVLCDCKQGREKALENALTMPLLVKKILRISELGTEFSVSIIWKL  376

Query  1277  --csssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 + E    +A+  G   +LL+++Q G ++  K K   LLKL 
Sbjct  377   CRIETEESVLIEALQVGAFQKLLVVLQVGVSDGIKDKVTDLLKLF  421



>ref|XP_008784119.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=419

 Score =   186 bits (472),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 215/412 (52%), Gaps = 39/412 (9%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             + +P +F CPISLE+MRDPVT+ TG TYDR SIE W+  G + TCPV++ PL D  L PN
Sbjct  4     VDVPSYFLCPISLEIMRDPVTLATGITYDRESIERWIFAGKHETCPVSKQPLPDLELTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC AN + G+ER PTP+ P D       ++     +    SR+SALR+L+ 
Sbjct  64    HTLRRLIQAWCTANASHGIERFPTPRPPVDKA----QIAALLDEAKLPRSRMSALRKLKA  119

Query  620   lardsDKNRSVISANNARQVLLSIV------------------FSNMDSNSSELTHEALS  745
             +  +SD+N+  + A  A   L S++                  F ++  + S    EAL+
Sbjct  120   IISESDRNKRCVEAAGAVDFLASVIEESRSNPREREQEQDEGLFDDVTGSVSAAHDEALN  179

Query  746   ILSMFQLSEAECV-FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQ  922
             IL   Q+SE   +  +  + D +  L ++L   +   R ++  LI+S+++      L+  
Sbjct  180   ILYSLQVSEQSLLHLIERNNDFMESLATILRRSNYQSRTHAMLLIKSLLSVMAPARLK--  237

Query  923   ISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQ  1099
                + E+F  +V +L    ++P A K  V+ L  L    ++R KAV AGAV  +IE  L 
Sbjct  238   -GFSKELFGEVVKVLRDQISYP-ATKAAVQVLGGLSPWGRNRVKAVEAGAVRVVIELLLD  295

Query  1100  YLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATE------Yaag  1261
               E+   E  L  ++ LCR   G A    HA  + ++ K +L++S  A+E      Y+A 
Sbjct  296   KTERRACEMMLVVLDQLCRCAEGRAEMVGHAAGIAVVTKKLLRVSRVASERVVGILYSAA  355

Query  1262  allslcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                   +  ++ ++     G + +L +L+Q  C E+AK K + +L+L    W
Sbjct  356   RFSPTRAVLQEMKQ----VGAVAKLCMLLQVDCGEKAKEKVKEMLRLHSKVW  403



>ref|XP_004503116.1| PREDICTED: U-box domain-containing protein 21-like [Cicer arietinum]
Length=435

 Score =   186 bits (473),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 205/398 (52%), Gaps = 21/398 (5%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             L V  I IP HFRCP+SL+LM+DPVT+ TG TYDR SIE W+ +GN TCPVT   LT F 
Sbjct  26    LPVEEITIPTHFRCPVSLDLMKDPVTLPTGITYDRTSIEKWIESGNKTCPVTNQNLTTFE  85

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
             + PNHT+R++IQ WCV N ++G+ERIPTP+ P     V  + ++  S S   + +     
Sbjct  86    ITPNHTIRKMIQNWCVENSSYGIERIPTPRIPISSYEVSEVCTRLLSASQRGDEKKCLEF  145

Query  608   rlrgla--rdsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQLS  769
               +     R+S++N+  I  N A  V  + VF +  S S E    +  E L I+ M   +
Sbjct  146   VGKIKVWWRESERNKRCIVGNGACSV-FATVFDSFSSVSIEKHVVILEEILEIMMMINKT  204

Query  770   E-AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
                E      +   +  LV  L    +  R NS  L+E V+          +++  + + 
Sbjct  205   HFGETKLCFGNQASLRCLVWFLDGKDLGARQNSVFLLEEVLC-------VDELATIEGVV  257

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHR----QKAVIAGAVEALIERLQYLEKC  1114
             +G+V I+  P     A K  +  +F L    ++R    +K V  G V  L+E +   E+ 
Sbjct  258   EGLVKIIKEP-IGLSATKACLSTIFNLVSSCKNRVEISEKLVELGLVSFLLETIVDGERG  316

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E+AL  +  LC    G      +ALT+PL+VK IL++S  A+ +A G +  +C   E+
Sbjct  317   VIEKALGVLNCLCDCKKGKEVVKMNALTLPLVVKKILRVSPLASSFAVGIVRKMCEKKEE  376

Query  1295  AQR-DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 +A+  G   +LL+++Q GC E  K     LLKLL
Sbjct  377   GILIEALQLGAFQKLLVMLQVGCEENTKENTTELLKLL  414



>ref|XP_001776109.1| predicted protein [Physcomitrella patens]
 gb|EDQ59020.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   186 bits (471),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 131/385 (34%), Positives = 209/385 (54%), Gaps = 9/385 (2%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P  F CPISLELMRDPVT+ TG TYDRA IE W+  G+ TCP T   L    +IPNH
Sbjct  4     VAVPPFFLCPISLELMRDPVTLSTGMTYDRAGIEKWLGLGHNTCPTTNQILDSQEMIPNH  63

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLRRL+  WC  N    V RIPT K+              S         L +LR+LR L
Sbjct  64    TLRRLLHNWCAENEVHDVGRIPTLKE---LDTDMVTQLLQSIAQCREMEWLDSLRKLRML  120

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASDL  802
             A++ ++NR  I+       L + +       S E   +A++I+   QL + +     S+ 
Sbjct  121   AKECERNRKRIAEAGGVGTLAAAMGRGEMDMSVEACEDAVAIIVHLQLGDGD-KRALSEP  179

Query  803   DRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNHPST  982
               + +L  +L+  S++ +VN+A +I ++    ++P +++ + +     + IV +L     
Sbjct  180   KMLSHLGFVLASGSLEGKVNAADIIHALC--KENPRVKAAVGDLPGAIRAIVNLLRE-DL  236

Query  983   HPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATVELLCRIP  1162
             +PRA++ G++ L ++CL +++R  A+    +  L+  L   +K + ER  A +E+L    
Sbjct  237   YPRAVQSGLRCLQSMCLSRRNRVTAINCRTITTLVALLPNTDKRNKERVFALLEILANCA  296

Query  1163  SGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVAAGVLTQL  1336
              G  A + HAL +P++VK +L +S RATEYA  AL  + S +        A+ AG  T L
Sbjct  297   EGREAISNHALAIPVMVKSMLGVSHRATEYAVAALWLVLSYASNRNVINTALQAGAFTNL  356

Query  1337  LLLVQSGCTERAKRKAQMLLKLLRD  1411
             L+L+ S C++ AK++AQ  +KLL +
Sbjct  357   LMLLSSQCSQLAKKRAQDSVKLLNE  381



>ref|XP_004172231.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
21-like [Cucumis sativus]
Length=442

 Score =   186 bits (473),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 142/395 (36%), Positives = 215/395 (54%), Gaps = 18/395 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP H+ CPISL+LM+DPV + TG T DR SIE W+  GN +CPVT+  LT F LIPNH
Sbjct  29    IAIPSHYMCPISLDLMKDPVILSTGITXDRESIEKWIDGGNFSCPVTKQDLTVFDLIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
              LRRLIQ+WCVANR++G+ERIPTP+ P  P  V+ + S+ S  +   +S+     + ++R
Sbjct  89    ALRRLIQDWCVANRSYGIERIPTPRIPVSPYEVKEICSRISIATQRSDSKRCSELMGKIR  148

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQLSEAECV  784
               A++S++NR  I  N     +L+  F +    S E    L  E L +L+       E +
Sbjct  149   NWAKESERNRRCI-VNGGTGDVLAASFEHFAGVSIEKHVGLLEEILLVLTCVYPVAIEGL  207

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
                   D +  LVS L    +  + ++  +++ ++A  +     + ++  + + + +V I
Sbjct  208   SKLGSADSLKCLVSFLIGKDLSPKQSAIFVLKELLAADR--RYVNSLAAIEGVSEALVSI  265

Query  965   LNHPSTHPRALKMGVKALFALCL----VKQHRQKAVIAGAVEALIERLQYLEKCDTERAL  1132
             +  P   P A K  + A+F + L     +Q   K V  G V  L+E L   EK   E+AL
Sbjct  266   IRDPLC-PSATKSSLTAIFYMILPSDIGEQMALKFVELGLVSQLLEFLVDAEKSLCEKAL  324

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR---  1303
               ++ +C    G      +ALT+PLLVK IL++S+ ATEY+   LL LC S E+ +    
Sbjct  325   GILDGICDYKQGREKLYNNALTIPLLVKKILRVSELATEYSLSILLKLCKSGEEGENEVR  384

Query  1304  -DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              +A   G   ++L+L+Q GC    K K   +LKLL
Sbjct  385   VEAAQLGAFQKILVLLQVGCGGDMKDKVTEMLKLL  419



>gb|ACF88418.1| unknown [Zea mays]
 tpg|DAA44319.1| TPA: immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=447

 Score =   185 bits (470),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 147/415 (35%), Positives = 218/415 (53%), Gaps = 22/415 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LMRDPVT   G TYDR SIE+W+ TG  TCPVT APL    L+PNH
Sbjct  28    LAIPAHFRCPISLDLMRDPVTAPAGITYDRESIEAWLDTGRATCPVTHAPLRHEDLVPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPK---QPADPGlvqsllsqassvsshlnsrlsalrrl  613
              +RR+IQ+WCVANR+ GVERIPTPK    P     +   L+ ++         +  + ++
Sbjct  88    AIRRVIQDWCVANRSRGVERIPTPKIPVTPVQASELLFDLAGSARRRDAAARCVEVVTKI  147

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDSNS------SELTHEALSILSMFQLSEA  775
             + LARDS++NRS  ++    +VL +   S   + +        +  + L+ L      + 
Sbjct  148   KVLARDSERNRSCFASIGTGRVLAAAFESLAAAAADAAAPAGRVLEDILAALVCMMPLDE  207

Query  776   ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGI  955
             E     +    +G LV++  + S+  R+N+   I+ VV+   +    S    ADEI   +
Sbjct  208   ESARTLALPTSLGSLVAIAENGSLAGRLNAVLAIKEVVSCDGAATDLS--GKADEIVDAL  265

Query  956   VGILNHPSTHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDTERAL  1132
               I+  P   P+A K G+ A + L L  +    +   AG V  L+E L   +K  +E+AL
Sbjct  266   AKIIKSP-ICPQATKAGMVATYHLALYDERVAARLAAAGLVPVLVEVLVDADKSMSEKAL  324

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD--  1306
             A ++ +     G A+  AHAL VP+L+K + ++SD AT+ A  A+  L  +    + D  
Sbjct  325   AVLDAVLASEEGRASARAHALAVPMLIKKMFRVSDLATQLAVSAMWRLGKAHSDGEDDGA  384

Query  1307  -------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                    A+  G   +LLLL+Q GC +  K KA  LLKLL         V++ DF
Sbjct  385   VTRCLVEALGVGAFQKLLLLLQVGCRDATKEKATELLKLLNKYKSVGECVDAVDF  439



>ref|XP_010932523.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=445

 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 146/413 (35%), Positives = 219/413 (53%), Gaps = 20/413 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HF CPISL+LM+DPVT  TG TYDR SIE W+   N  CPVT   L    LIPNH
Sbjct  29    LSIPNHFCCPISLDLMKDPVTASTGITYDRRSIEKWLELRNQNCPVTNQVLKSEELIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
             +LRR+IQ+WCVANR+FG+ERIPTP+ P  P  V  LLS+ +S S   +     + + ++R
Sbjct  89    SLRRMIQDWCVANRSFGIERIPTPRIPVTPIQVSELLSEIASASRRGDRARCSNLVEKIR  148

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELT-----HEALSILSMFQLSEAEC  781
              L R+S++NR  I +  A +V LS  F  + S S E +      E LS L+ F   + E 
Sbjct  149   NLGRESERNRRRIVSGGAGRV-LSASFGELASRSFESSTTGELEEILSALASFLPLDEEA  207

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
              ++    + +  +V LL    +  R+N+  +++ +V+   +  + + ++  + + + +V 
Sbjct  208   RWLIGSPESLKSIVLLLRSGDLAARLNAVLVLKELVSSLDTEHV-NIVAETEGLIEALVK  266

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHR-QKAVIAGAVEALIERLQYLEKCDTERALAT  1138
             ++ +P   PR  K  + A F L    +    + V  G V  L+E L   +K   E+AL  
Sbjct  267   LIENP-ISPRTTKASLVASFYLVSSSERTAMRFVEMGMVSLLLEILVDSDKSLCEKALVV  325

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls--lcsssEQAQR---  1303
             ++ L +   G      H+LTVP+LVK I ++SD  TE+A  AL         E  +R   
Sbjct  326   LDGLLQSKKGREMAYDHSLTVPILVKKISRVSDMETEFAVSALWKLCKNYKHETGERAGE  385

Query  1304  ----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                 +A+  G   ++LLL+Q GC    K KA  LLKLL         + + DF
Sbjct  386   GCLMEALQVGAFQKILLLLQVGCNGTTKEKASELLKLLNGLRGWGECIETMDF  438



>ref|XP_009410070.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 144/389 (37%), Positives = 216/389 (56%), Gaps = 13/389 (3%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP  FRCPISL+LM+DPVT+ TG TYDR SIE+W+  GN TCPVT+  L +  L+PNH++
Sbjct  30    IPAAFRCPISLDLMKDPVTLHTGITYDRRSIEAWLELGNLTCPVTKQALENEDLVPNHSI  89

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassv--sshlnsrlsalrrlrgl  622
             RR+IQ+WCVANR  G+ERIPTP+ P  P  V  LLS+ S               R+++ L
Sbjct  90    RRMIQDWCVANRCLGIERIPTPRIPVTPTQVSDLLSEISVACRRGDNARCRELARKIKAL  149

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSE-----LTHEALSILSMFQLSEAECVF  787
              R+S++NR  I +  A +V LS  FS + + S E     +  E L+ L+ F   +     
Sbjct  150   GRESERNRRCIISGGAGRV-LSNCFSELAAESLENPRAGVMDEILAALAAFLPLDEGSYL  208

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
               +    +  +VS+L    ++ R+N AAL+   +A +  P+    ++  D + + +V ++
Sbjct  209   QLASPKPLDSIVSVLKSADLEGRLN-AALVLKELASSSPPDRIEVVARTDGLIEALVKLI  267

Query  968   NHPSTHPRALKMG-VKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATVE  1144
               P   PRA     V A + +   ++   + V  G V  L+E L   EK   E+AL  ++
Sbjct  268   EKP-ISPRATNASMVTAFYLVASSERIAARFVEMGIVSLLLEILVDSEKSMCEKALGVLD  326

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR--DAVAA  1318
              +     G    +AH+L VP+LVK   +++D  TE+A  AL  LC + ++ +R  +A+ A
Sbjct  327   GVLSCSRGREMASAHSLAVPVLVKKTSRVADMETEFAVSALWKLCKNDDEGERVVEALQA  386

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             G   +LLLL+Q GC    K K   LLKLL
Sbjct  387   GAFQKLLLLLQVGCKGTTKEKVSDLLKLL  415



>ref|NP_001152389.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
 gb|ACG47370.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=447

 Score =   184 bits (467),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 146/416 (35%), Positives = 220/416 (53%), Gaps = 24/416 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LMRDPVT   G TYDR SIE+W+ TG  TCPVT APL    L+PNH
Sbjct  28    LAIPAHFRCPISLDLMRDPVTAPAGITYDRESIEAWLDTGRATCPVTHAPLRHEDLVPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPK---QPADPGlvqsllsqassvsshlnsrlsalrrl  613
              +RR+IQ+WCVANR+ GVERIPTPK    P     +   L+ ++         +  + ++
Sbjct  88    AIRRVIQDWCVANRSRGVERIPTPKIPVTPVQASELLFDLAGSARRRDAAARCVEVVTKI  147

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDSNS------SELTHEALSILSMFQLSEA  775
             + LARDS++NRS  ++    +VL +   S   + +        +  + L+ L      + 
Sbjct  148   KVLARDSERNRSCFASIGTGRVLAAAYESLAAAAADAAAPAGRVLEDILAALVCMMPLDE  207

Query  776   ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA-GTKSPELRSQISNADEIFQG  952
             E     +    +G LV++  + S+  R+N+   I+ VV+    + +L  ++   DEI   
Sbjct  208   EAARTLALPTSLGSLVAIAENGSLAGRLNAVLAIKEVVSCDGAATDLSGKV---DEIVDA  264

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDTERA  1129
             +  I+  P   P+A K G+ A + L L  +    +   AG V  L+E L   +K  +E+A
Sbjct  265   LAKIIKSP-ICPQATKAGMVATYHLALYDERVAARLAAAGLVPVLVEVLVDADKSMSEKA  323

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD-  1306
             LA ++ +     G A+  AHAL VP+L+K + ++SD AT+ A  A+  L  +    + D 
Sbjct  324   LAVLDAVLASEEGRASARAHALAVPMLIKKMFRVSDLATQLAVSAMWRLGKAHSDGEDDG  383

Query  1307  --------AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                     A+  G   +LLLL+Q GC +  K KA  LLKLL         V++ DF
Sbjct  384   AVTRCLVEALGVGAFQKLLLLLQVGCRDATKEKAXELLKLLNKYKSVGECVDAVDF  439



>gb|AIV00617.1| U-box domain-containing protein [Vitis amurensis]
Length=442

 Score =   184 bits (466),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 218/416 (52%), Gaps = 20/416 (5%)
 Frame = +2

Query  251   DVGGIQI--PYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDF  424
             D+G +++  P HFRCPISL+LM+DPVT+ TG TYDR SIE W+  GN TCP+T   L   
Sbjct  24    DIGSMELTTPNHFRCPISLDLMKDPVTLSTGITYDRESIEMWIEAGNRTCPITNQVLRSL  83

Query  425   TLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--ls  598
               IPNHT+R++IQ+WCV NR+FG+ERIPTP+ P     V  +LS+        +      
Sbjct  84    EPIPNHTIRKMIQDWCVENRSFGIERIPTPRIPLSSVEVTDMLSKFKMAYRREDEAGCRE  143

Query  599   alrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQL  766
              + +++   ++S++N+  I  N A  V LS  F    S S +    +  + L+ L+    
Sbjct  144   LVAKMKSKGKESERNKRCIVINGAAGV-LSAAFEAFSSASFDKYVAVLEDILAALTWMSP  202

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              + E     S    +  LV LL    +  R N+ + ++ +++  K       +S  + + 
Sbjct  203   LDGEAKSYLSSAASLNCLVWLLKSGDLSARGNAVSTLKELLSSDKRKVY--ALSEIEGVK  260

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLV----KQHRQKAVIAGAVEALIERLQYLEKC  1114
             + +V ++  P   P A K  +  +F +       +  + + V  G VE L+E L   EK 
Sbjct  261   EALVKLVKEP-ICPTATKTSLVVIFHMVSSSPSNEDTKVRFVEMGLVELLLELLVDSEKS  319

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E+AL  ++ +C    G      HALT+P+LVK +L++SD ATE++   L  L  + ++
Sbjct  320   VCEKALGVLDGICGCEEGREKAYGHALTMPVLVKKLLRVSDLATEFSVSILWKLSKNEKR  379

Query  1295  AQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                    +A+  G   +LLLL+Q GC++R K KA  LLKLL         ++S DF
Sbjct  380   EDGSVLVEALQVGAFQKLLLLLQVGCSDRTKEKATELLKLLNIHRERLEFIDSMDF  435



>ref|XP_010271201.1| PREDICTED: U-box domain-containing protein 21-like [Nelumbo nucifera]
Length=443

 Score =   184 bits (466),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 145/413 (35%), Positives = 221/413 (54%), Gaps = 22/413 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISLELM+DPVT+ TG TYDR SIE W+ +GN TCPVT   LT F   PNH
Sbjct  29    VTIPTHFRCPISLELMKDPVTLSTGITYDRESIERWIESGNQTCPVTNKVLTSFEPTPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
              +R++IQ+WCV NR+ G+ERIPTP+ P  P  V  LLS+ +  +   +       + +++
Sbjct  89    AIRKMIQDWCVKNRSLGIERIPTPRIPVTPVEVLELLSRITDAAWRGDQSGCGELVAKIK  148

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS----MFQLSEAECV  784
              L +++++N+  I  N A +VL +   +   ++  +       ILS    M  L      
Sbjct  149   RLGKENERNKRCIVGNGAGRVLAAAFDAFAAASFEKNVAALEKILSAMPWMLPLDSEAQS  208

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAG-TKSPELRSQISNADEIFQGIVG  961
             ++AS    +  +V  L+  S+  R N+  +++ +++   K   L ++I  A+   Q +V 
Sbjct  209   YLASPAS-LRCMVWFLNSGSLSGRQNAVLVLKELLSSDQKHVSLLAEIEGAN---QALVK  264

Query  962   ILNHPSTHPRALKMGVKALFALC----LVKQHRQKA--VIAGAVEALIERLQYLEKCDTE  1123
             ++  P   P A K  + A+F +     L    R K+  V  G V  L++ L   +K   E
Sbjct  265   LIKEP-ICPTATKASLVAIFQMVSPSNLSSSDRIKSGFVEMGLVSLLLDILVDSDKSLCE  323

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             +AL  ++ LC          ++ALT+P+LVK IL+ISD ATE++   L  LC +    + 
Sbjct  324   KALGVLDGLCSCQEAREKAYSNALTMPVLVKKILRISDLATEFSVSILWKLCKNRNPDEG  383

Query  1304  ----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                 +A+  G   +LLLL+Q GC E  K KA  LLKLL         ++S DF
Sbjct  384   SIVIEALQVGAFQKLLLLLQVGCGEGTKEKATELLKLLNLYRGKLECIDSTDF  436



>ref|XP_009415614.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   183 bits (464),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 146/402 (36%), Positives = 209/402 (52%), Gaps = 25/402 (6%)
 Frame = +2

Query  260   GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIP  436
             G++IP +F CP+SL+LM+DPVT+ TG TYDR SIE W+ A   TTCPVT   L D  L P
Sbjct  3     GVEIPSYFLCPVSLQLMKDPVTLSTGITYDRDSIERWIFAARKTTCPVTNQTLPDCELTP  62

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC AN   GVER PTPK P D   ++ L+  A    S L S       + 
Sbjct  63    NHTLRRLIQAWCTANADVGVERFPTPKAPVDKAQIEMLVGDAKLPQSQLGSLRKLRAFVS  122

Query  617   glardsDKNRSVISANNARQVLLSIVFSN-----MDSNSSELT----HEALSILSMFQLS  769
                R     R V +A  A  +L SIV  N     +D +  E T     EAL IL   Q+S
Sbjct  123   ESER---NKRCVEAATGAVDLLASIVDRNSSGEDIDDDCLESTSAACDEALHILCSLQIS  179

Query  770   EAECV-FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
             E      VA +   V  L ++L   + + R ++  L+  ++      +L   I+ +D++F
Sbjct  180   EEGLRDLVAKNAGMVESLTTILRRSNYNSRAHATLLLNQILRVMSQDQL---INLSDQLF  236

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD---  1117
             Q IV +++   +H +A K  +  L   C   ++R KA  AGAV  L+E L  LE+ D   
Sbjct  237   QEIVSVIHDRISH-QATKAALHVLVDACPRGRNRIKAANAGAVHVLVELL--LEEPDRRV  293

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E  L  ++ LC    G A    HA  +P++ K IL++S  A+E A   L S+   S   
Sbjct  294   CELVLVAMDRLCGCAEGRAELVGHAAGIPVVSKKILRVSQVASERAVRVLHSVAMHSATP  353

Query  1298  Q--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                ++ +  GV+++L L++Q  C  + K +A  +L+L    W
Sbjct  354   GLLQEMMQVGVVSKLCLMLQLDCNVKTKEQASEILRLHSRVW  395



>ref|XP_008812599.1| PREDICTED: U-box domain-containing protein 21-like [Phoenix dactylifera]
Length=447

 Score =   183 bits (465),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 144/417 (35%), Positives = 216/417 (52%), Gaps = 26/417 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISLELM+DPVT  TG TYDR +IE+W+  GN TCPVT   L +  LIPNH
Sbjct  29    LSIPTHFRCPISLELMKDPVTAPTGITYDRQNIETWLKLGNQTCPVTNQALKNEDLIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             +LRR+IQ+WCVA+R+ GVERIPTP+ P  P  V  LLS+ +S S H + R       +  
Sbjct  89    SLRRMIQDWCVAHRSSGVERIPTPRIPVTPAQVSELLSEIASSSRHGDPRRCCELAAKIT  148

Query  623   ardsDKNRS---VISANNARQVLLSIVFSNMDSNSSELT------HEALSIL-SMFQLSE  772
             A   +  R+   ++S  + R  +LS  F  +   S+ +        E LS L  +F L  
Sbjct  149   ALGRESERNRLCIVSCGSGR--ILSNSFRELARGSAAVNSTTGVMEEILSALVGLFPLDS  206

Query  773   AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
                  V +  + +  +VS+L    +  ++N+A +++ + A   + ++ + ++  D + + 
Sbjct  207   EAHGHVGAP-ESLESIVSILKTGDLAGKLNAALVLKELAASLDAEQINA-VAETDGLIEA  264

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQHR-QKAVIAGAVEALIERLQYLEKCDTERA  1129
             +V ++  P   P+  K  +   F L    +    K V  G V  L+E L   EK   E+A
Sbjct  265   LVKLVEKP-VSPQTTKTSLVTTFYLVSSNESTAAKFVDMGLVSVLLEILVDWEKSMYEKA  323

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR--  1303
             L  ++ +     G      H+LTVP+LVK + ++SD ATE+A  AL  L  + ++     
Sbjct  324   LGVLDAVLDYRRGREMAYGHSLTVPVLVKKMFRVSDMATEFAVSALWKLGKNYKEEGGER  383

Query  1304  --------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                      A+  G   +LLLL+Q GC+   K KA  LLKLL           + DF
Sbjct  384   AGEEGFLVQALEVGAFQKLLLLLQVGCSGTTKEKASELLKLLNGSRERVECTETADF  440



>ref|XP_003631249.1| PREDICTED: U-box domain-containing protein 21-like [Vitis vinifera]
Length=442

 Score =   183 bits (465),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 139/402 (35%), Positives = 213/402 (53%), Gaps = 22/402 (5%)
 Frame = +2

Query  251   DVGGIQI--PYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDF  424
             D+G +++  P HFRCPISL+LM+DPVT+ TG TYDR SIE W+  GN TCP+T   L   
Sbjct  24    DIGSMELTTPNHFRCPISLDLMKDPVTLSTGITYDRESIEMWIEAGNRTCPITNQVLRSL  83

Query  425   TLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--ls  598
               IPNHT+R++IQ+WCV NR+FG+ERIPTP+ P     V  +LS+        +      
Sbjct  84    EPIPNHTIRKMIQDWCVENRSFGIERIPTPRIPLSSVEVTDMLSKFKMAYRREDEAGCRE  143

Query  599   alrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQL  766
              + +++   ++S++N+  I  N A  V LS  F    S S +    +  + L+ L+    
Sbjct  144   LVAKMKSKGKESERNKRCIVINGAAGV-LSAAFEAFSSASFDKYVAVLEDILAALTWMSP  202

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELR-SQISNADEI  943
              + E     S    +  LV LL    +  R N+ + ++ +++  K      S+I  A E 
Sbjct  203   LDGEAKSYLSSAASLNCLVWLLKSGDLSARGNAVSTLKELLSSDKRKVYALSEIEGAKE-  261

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLV----KQHRQKAVIAGAVEALIERLQYLEK  1111
                +V ++  P   P A K  +  +F +       +  + + V  G VE L+E L   EK
Sbjct  262   --ALVKLVKEP-ICPTATKTSLVVIFHMVSSSPSNEDTKVRFVEMGLVELLLELLVDSEK  318

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE  1291
                E+AL  ++ +C    G      HALT+P+LVK +L++SD ATE++   L  L  + +
Sbjct  319   SVCEKALGVLDGICGCEEGREKAYGHALTMPVLVKKLLRVSDLATEFSVSILWKLSKNEK  378

Query  1292  QAQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             +       +A+  G   +LLLL+Q GC++R K KA  LLKLL
Sbjct  379   REDGSVLVEALQVGAFQKLLLLLQVGCSDRTKEKATELLKLL  420



>emb|CDP01660.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   183 bits (465),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 136/394 (35%), Positives = 212/394 (54%), Gaps = 17/394 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HF+CPISL+LM+DPVT+ TG TYDR +IE W+  GN TCPVT   L  F  IPNH
Sbjct  30    LTIPKHFQCPISLDLMKDPVTLSTGITYDRENIERWIEAGNQTCPVTNQALKSFDQIPNH  89

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlr  616
             ++RR+IQ+WCV N+++GVERIPTP+ P  P  V  + S+  + ++  +       + ++R
Sbjct  90    SIRRMIQDWCVDNKSYGVERIPTPRTPITPYEVSEVSSKIVAATTRKDGNKCQELVGKIR  149

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILS-MFQLS-EAE  778
              LA++S++N+  +  N    V LS  F     +S E    L  E LS L+ MF L  E +
Sbjct  150   NLAKESERNKKRVVENGVGYV-LSSSFETFAGDSMEKHEVLLKEILSALTWMFPLGIEGQ  208

Query  779   CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
                 +S   R   +   L    +  R ++  +++ ++A +   ++   +   + I + + 
Sbjct  209   SKLGSSASLRC--IAWFLHGEDLSTRQHAVIVLKELLANSLDHQISDGLIEIEGISEALF  266

Query  959   GILNHPSTHPRALKMGVKALFALCLVKQHRQKA---VIAGAVEALIERLQYLEKCDTERA  1129
              IL  P   P A K  +   + +   ++  + A   V  G V  ++E L   EK  +E+A
Sbjct  267   KILEVP-IGPTATKASLMVTYYMLQSEKSEKLASRFVEMGLVSLVLEILVDGEKRTSEKA  325

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--R  1303
             L  +E +C    G     ++ALT+PLLVK IL++S+  TE+A   L  LC   E      
Sbjct  326   LGVLEAICNWEEGREKACSNALTMPLLVKKILRVSEMGTEFAVSTLSKLCKEVEDENPVI  385

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             +A+  G   +LL+++Q GC E  K K   LLKL+
Sbjct  386   EALEVGAFQKLLVVLQVGCGENTKEKITELLKLM  419



>ref|XP_002275500.2| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=414

 Score =   182 bits (463),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 146/413 (35%), Positives = 217/413 (53%), Gaps = 23/413 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I +P HF CPISL+LMRDPVTV TG TYDR +IE W+ +  N TCP T+  L D  L PN
Sbjct  4     IDVPSHFMCPISLQLMRDPVTVATGITYDRENIERWLFSCKNNTCPFTKQVLVDTDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC+ N   GVERIPTPK P D      ++   +        +L  L+RLR 
Sbjct  64    HTLRRLIQAWCIVNACHGVERIPTPKPPIDKA---QIIKLLNDAIKFPQMQLKCLQRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFSN--------MDSNSSELTH---EALSILSMFQL  766
             +A +SD+N+  + A  A + L SI+  +        ++  S E T    EALSIL   + 
Sbjct  121   IAFESDRNKKCLEAAGAVEFLASIIKKDESAVIEVVLEDGSREFTRASDEALSILYQLET  180

Query  767   SEAEC-VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             SEA     V+S+   +  LV +L   +   R  +A L++S+       +L   I+ + E+
Sbjct  181   SEAALKSLVSSNYGFIESLVHVLKCGNYQSRAYAAMLLKSIFQVADPIQL---INASPEL  237

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIER-LQYLEKCDT  1120
             F  IV +L    +  +A K  +K L  LC   ++R KAV+AG    LIE  L   EK   
Sbjct  238   FTEIVHVLRDGISQ-QASKAALKLLVELCPWGRNRIKAVVAGVSHVLIEHLLDTSEKRTC  296

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             E  L  ++ LC    G A    H   + ++ K IL++S   T+ A   L S+   S  ++
Sbjct  297   ELILVVLDQLCSCAEGRAELLKHGAGLAIVSKKILRVSQVGTDRAVKILASVSKFSATSR  356

Query  1301  --RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
               ++ +  GV+++L L++Q   +++ K K + +L L    W + S + +  F+
Sbjct  357   VLQEMLQVGVVSKLCLVLQVDSSKKTKEKTREILNLHSRVWKNPSCIPARLFS  409



>ref|XP_009781197.1| PREDICTED: U-box domain-containing protein 21-like [Nicotiana 
sylvestris]
Length=445

 Score =   183 bits (465),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 133/418 (32%), Positives = 215/418 (51%), Gaps = 20/418 (5%)
 Frame = +2

Query  251   DVGGIQ--IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDF  424
             D+  I+  IP HF CPISL+LM+DPVT+ TG TYDR +IE W+  GN TCP+T   L + 
Sbjct  23    DITSIELVIPRHFTCPISLDLMKDPVTLSTGITYDRENIEKWIEAGNQTCPITNQTLRNG  82

Query  425   TLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsal  604
               IPNH++R++IQ+WCV N+  G+ERIPTP+ P     V  L ++ S            +
Sbjct  83    EPIPNHSIRKMIQQWCVENKDHGIERIPTPRIPVTSSEVVELHAKISKEMHDSEVCKELV  142

Query  605   rrlrglardsDKNRSVISANNARQVLLS--IVFSNMDSNSSELTHEA-LSILSMFQLSEA  775
               ++ L  +S++N+     N   QVL +  + FS   +  +  T E  LS L      + 
Sbjct  143   SEVKKLVNESERNKRCFVTNGTTQVLSAAFVAFSEEINMKNASTGEVILSTLKTILPLDG  202

Query  776   ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGI  955
             E       +  +  +V  L++ S+  R N+  L++ ++   +  ++   +     + +G+
Sbjct  203   ESKSNLGSISSLRCMVWFLNNGSLSSRRNAVFLLKDILKMEEHDKVEILLGMGGAL-EGL  261

Query  956   VGILNHPSTHPRALKMGVKALFALC--------LVKQHRQKAVIAGAVEALIERLQYLEK  1111
             V ++  P   P   K  + A++ +           K+ + +    G VE L+E L   EK
Sbjct  262   VKLVKEPIC-PTTTKASLLAIYHMVNPSHSSSFANKKAQSRFADVGLVELLVEMLVDCEK  320

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE  1291
                E+AL  ++ +C    G     ++ALTVP+LVK +L++SD ATE++   L  +  + +
Sbjct  321   SICEKALGVLDGICSSIEGRKRAYSYALTVPVLVKKLLRVSDLATEFSVSILWKIGKNEK  380

Query  1292  QAQR-----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             +        +A+  G   +LLLL+Q GC+E  K KA +LLKLL         V+S DF
Sbjct  381   RENGGDVLVEALKLGAFQKLLLLLQVGCSETTKEKASVLLKLLNVHKDRAECVDSLDF  438



>gb|AAK69401.1|AF274564_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum]
 gb|AAK69402.1|AF274565_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum]
Length=442

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 143/408 (35%), Positives = 221/408 (54%), Gaps = 25/408 (6%)
 Frame = +2

Query  239   LDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLT  418
             LD L    + IP HFRCPISL+LM+DPVT+ TG TYDR SIE+W+  GN TCP+T+  L+
Sbjct  20    LDDLSNMEVSIPNHFRCPISLDLMKDPVTLSTGITYDRHSIETWIEAGNKTCPITKQMLS  79

Query  419   DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassv--sshlnsr  592
                 IPNHT+R++IQ+WCV N ++G+ERIPTP+ P     V  +LS+  +       ++ 
Sbjct  80    TLEPIPNHTIRKMIQDWCVDNSSYGIERIPTPRIPVSSHQVTEMLSKVVAACRREEASAC  139

Query  593   lsalrrlrglardsDKNRSVISANNARQVLLSIV--FSNM--DSNSSELTHEALSILSMF  760
                + +++ L +++++N+    AN    VL S    FS +  D N + L  E LS LS+ 
Sbjct  140   QELVGKIKRLVKENERNKRCFVANGTVGVLASTFEAFSKLSFDKNVAVL-EEILSCLSLM  198

Query  761   QLSEAEC-VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA-GTKSPELRSQISNA  934
                + E   F+ S+   +  +V  L    +  R NS  +++ V++   K  E  S I  +
Sbjct  199   TPLDGEAKAFLGSN-SSLNCMVWFLKSGDLSARANSVLVLKHVLSTDQKKMEEFSMIEGS  257

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQ--KAVIAGAVE-ALIER-LQY  1102
                 + +V ++  P   P   K  +  ++ +       +    +IA  ++  LIER L+ 
Sbjct  258   ---LEALVKVIKEP-VSPTTTKASLLIVYYMVSTSSSSRVDDKIIARFIDMGLIERLLEM  313

Query  1103  LEKCDT---ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls  1273
             L  CD    E+AL  ++ LC    G     A+ALT+P+LVK IL++SD ATE++   +  
Sbjct  314   LVDCDKSICEKALGVLDGLCLTNEGREKAYANALTMPVLVKKILRVSDLATEFSVSIVWK  373

Query  1274  lcsssEQAQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             L  + +        +A+  G   +LLLL+Q GC E+ K KA  LLKLL
Sbjct  374   LSKNDKSEDGGVIVEALRVGAFQKLLLLLQFGCNEKIKDKATELLKLL  421



>ref|XP_003616222.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES99180.1| Avr9/Cf-9 rapidly elicited protein [Medicago truncatula]
Length=442

 Score =   182 bits (463),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/398 (34%), Positives = 221/398 (56%), Gaps = 29/398 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP HFRCP++L+LM+DPVT+ TG TYDR SIE W  +GN +CPVT+  LT F ++PNH
Sbjct  33    IAIPTHFRCPVTLDLMKDPVTLSTGITYDRDSIEKWFESGNNSCPVTKTELTSFDIVPNH  92

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlr  616
             +LRR+IQ+WCV +R++GVERIPTP+ P     V    S+  S +   +       +R+++
Sbjct  93    SLRRMIQDWCVQHRSYGVERIPTPRIPVTRYEVTDTCSRILSAAQQGDESKCFELVRKIK  152

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQ-LS-EAE  778
             G  ++S++N+ VI +N    ++L+ VF +      E    L  E L +L+  + LS E+ 
Sbjct  153   GWGKESERNKKVIVSNGV-SLVLAKVFDSFSRGLIEKNVVLLEEILEVLTWMRPLSEESR  211

Query  779   CVFVASDLDRVGYLVSLLS-HPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGI  955
              VF+ S  + +  LV  L+    I  R N++ L++ +   +        ++  + I + +
Sbjct  212   FVFLGSS-NSLSCLVWFLNDQQKISTRQNASLLLKEMNVES--------LAKIEGIVESL  262

Query  956   VGILN-HPSTHPRALKMGVKALFALCLVKQHRQKAVI------AGAVEALIERLQYLEKC  1114
             V ++  +      + K  +  +F   LV   + K VI       G V  L+E L   EK 
Sbjct  263   VNMVKVNVEIGSASTKACLSTIFH--LVYSSKSKKVILERFVELGLVSILLEILVDAEKG  320

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E+AL  +  LC   +G     ++ALT+PL++K +L++S+ ++ +    +  +C  +E+
Sbjct  321   VCEKALGVLNCLCDSKNGVQIAKSNALTLPLVIKKLLRVSELSSSFVVSIVYKICDKAEE  380

Query  1295  AQR-DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 +A+  G+  +LL+L+Q GC E  K KA  LLKLL
Sbjct  381   GILIEAIQLGMFQKLLVLLQVGCAESTKEKATELLKLL  418



>gb|AAP03884.1| Avr9/Cf-9 rapidly elicited protein 74 [Nicotiana tabacum]
Length=445

 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 133/411 (32%), Positives = 214/411 (52%), Gaps = 19/411 (5%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HF CPISL+LM+DPVT+ TG TYDR +IE W+  GN TCP+T   L +   IPNH++
Sbjct  30    IPRHFTCPISLDLMKDPVTLSTGITYDRENIEKWIEAGNQTCPITNQTLRNGEPIPNHSI  89

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             R++IQ+WCV N+  G+ERIPTP+ P     V  LL++ S     L      + +++ L  
Sbjct  90    RKMIQQWCVENKDHGIERIPTPRIPVTSSEVVELLAKISKEIHDLELCGELVSKVKKLVN  149

Query  629   dsDKNRSVISANNARQVLLS--IVFSNMDSNSSELTHEA-LSILSMFQLSEAECVFVASD  799
             +S++N+     N   QVL +  + FS   +  +  T E  LS L+     + E       
Sbjct  150   ESERNKRCFVTNGTAQVLSAAFVAFSEEINMRNASTGEVILSTLTTILPLDGESKLNLGS  209

Query  800   LDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNHPS  979
             +  +  +V  L + S+  R N+  +++ ++   +  ++   +   +   +G+V ++  P 
Sbjct  210   ISSLRCMVWFLKNGSLSSRRNAVFVLKDILKMEEQDKVEILLG-MEGALEGLVKLVKEP-  267

Query  980   THPRALKMGVKALFALC---------LVKQHRQKAVIAGAVEALIERLQYLEKCDTERAL  1132
               P   K  + A++ +            K+ + + V  G VE L+E L   EK   E+AL
Sbjct  268   ICPTTTKASLLAIYHMVNSSHLSSSFANKKAQSRFVDLGLVELLVEMLVDCEKSICEKAL  327

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR---  1303
               ++ +C    G     ++ALTVP+LVK +L++SD ATE++   L  +  + ++      
Sbjct  328   GVLDGICSSIEGRKRAYSYALTVPVLVKKLLRVSDLATEFSVSILWKIGKNEKRENGGDV  387

Query  1304  --DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
               +A+  G   +LLLL+Q GC+E  K KA  LLKLL         V+S DF
Sbjct  388   LVEALKLGAFQKLLLLLQVGCSETTKEKASELLKLLNVHRDRAECVDSLDF  438



>ref|XP_002533776.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF28606.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=436

 Score =   182 bits (461),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 139/410 (34%), Positives = 214/410 (52%), Gaps = 22/410 (5%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP H+ CPISL+LM+DPVT+ +G TYDR SIE+W+  GN TCPVT   L  F  IPNHTL
Sbjct  26    IPNHYLCPISLDLMKDPVTLSSGITYDRESIEAWLEAGNFTCPVTGLVLRSFDQIPNHTL  85

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             R +IQEWCV +R +GVERIPTP+ P  P  V   LS   + +  L+    +  +++++  
Sbjct  86    RAMIQEWCVEHRRYGVERIPTPRVPVSPIQVSETLSCLDASTKRLDQYGCVELVQKIKRW  145

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEAL-SILS-----MFQLSEAECV  784
             + +S++NR  I AN A  V L+  FS    +SS      L  ILS     M  +S++E  
Sbjct  146   SSESERNRRCIVANGASGV-LAAAFSAFSRDSSRRNDSVLEEILSAIAPMMLPMSDSESQ  204

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
                S  D +  +V  L H  +  + NS   ++ +++  +  +    +++ +E+ + +   
Sbjct  205   IYLSSPDSLCTMVRFLEHGDLSSKQNSIIALKELLSSDE--QHAEALASFEEVHELLFKF  262

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA------GAVEALIERLQYLEKCDTER  1126
             +  P   P+  K  +  +F   L+  H     I       G V  +I  +   E+   E 
Sbjct  263   IKDP-VCPKITKASLVVIFH--LLSSHSSGGNIKSTFAKMGLVPLIIGIIIGSERSICEG  319

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga--llslcsssEQAQ  1300
             AL  ++ LC    G     ++ALT P+LVK IL++S+ AT+Y+  A   L+     E+  
Sbjct  320   ALGVLDKLCDCEEGREEAYSNALTWPVLVKKILRVSELATQYSVSAIWKLNKYGRKEKVL  379

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              +A+  G   +L+LL+Q GC    K KA  LLKL+     +   + S DF
Sbjct  380   VEALQVGAFQKLVLLLQVGCGNETKEKATELLKLMNPYRSELECIESVDF  429



>ref|XP_007036951.1| ARM repeat superfamily protein [Theobroma cacao]
 gb|EOY21452.1| ARM repeat superfamily protein [Theobroma cacao]
Length=436

 Score =   182 bits (461),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 134/404 (33%), Positives = 211/404 (52%), Gaps = 10/404 (2%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             ++IP HF CPI+L+LM+DPVT+ +G TYDR SIE+W+  GN TCPVT   L  F  IPNH
Sbjct  28    LEIPRHFLCPITLDLMKDPVTLSSGITYDRESIETWLEDGNFTCPVTNQLLRSFDQIPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsalrrlr  616
             +LR++IQ+WCV N  +GVERIPTP+ P  ++           S+        L ++++++
Sbjct  88    SLRKMIQDWCVENGKYGVERIPTPRIPVTSEEVSEILFAIMDSNRRLDQCGCLDSVQKIK  147

Query  617   glardsDKNRSVISANNARQVL----LSIVFSNMDSNSSELTHEALSILS-MFQLSEAEC  781
                 +S++NR  I+AN    VL     +    + + N++ L  E L +L+ MF L + E 
Sbjct  148   KWCMESERNRRCITANETAGVLAAAFDAFACDSFERNANVL-EEILCVLNWMFPL-DGEA  205

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNS-AALIESVVAGTKSPELRSQISNADEIFQGIV  958
             +        +  +V  L    + V+ NS AAL E +    +  E  + I   +E+    +
Sbjct  206   LEHLGSQSSLRCMVWFLKWRDLSVKQNSMAALKELLSCDQQYGEGLAAIDGVNEMLFNFI  265

Query  959   GILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALAT  1138
                  PS    +L +    + +    ++ + + +  G V  L+E +   E+   ERAL  
Sbjct  266   KDPISPSITKASLMVIFHMVSSCSSSEKIKSEFLDMGLVSLLLETIVESERSLCERALGV  325

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVAA  1318
             ++ LC    G      +AL +P+LVK IL++S+ ATEY+   +  L    E+   +A+  
Sbjct  326   LDKLCDSKQGREVAYNNALAMPVLVKKILRVSELATEYSVSTIWKLSKDEERVLIEALQV  385

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             G   +LLLL+Q GC +  K KA  LLKLL         ++S DF
Sbjct  386   GAFQKLLLLIQVGCGDETKEKATELLKLLNPYRAGLECIDSVDF  429



>ref|XP_010091753.1| U-box domain-containing protein 21 [Morus notabilis]
 gb|EXB45116.1| U-box domain-containing protein 21 [Morus notabilis]
Length=441

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 142/419 (34%), Positives = 217/419 (52%), Gaps = 30/419 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             ++IP HF CPISL+LM+DPVT+ +G TYDR +IE+W+  GN TCPVT+  L  F  IPNH
Sbjct  23    LEIPNHFLCPISLDLMKDPVTLSSGITYDRENIETWLEAGNFTCPVTKQILQSFDQIPNH  82

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
             +LR+LIQEWC+ N+ +GV+RIPTPK P  P  V  +L    +     +    L ++++++
Sbjct  83    SLRKLIQEWCMENQKYGVQRIPTPKTPVLPLEVSEILFSVEASVRRKDLFGCLESVKKIQ  142

Query  617   glardsDKNRSVISANNARQVLLSIV--FSNMDSNSSELTHEALSILS-MFQLSEAECVF  787
                 +S++NR  I  N A  VL + +  F+   S+ S    E LS L+ MF   E    +
Sbjct  143   KWGAESERNRRCIMVNGAANVLANALESFATSGSDMSGF-EEILSALNWMFPFGEEARKY  201

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             + S+   +  LVS L H  + V+ NSA ++  +++      L   I+N     +G+V IL
Sbjct  202   LGSEAS-LRCLVSFLKHDDLSVKQNSAMVLTELLSYGDKRHLEV-IAN----IEGLVLIL  255

Query  968   N---HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGA-VEALIERL------QYLEKCD  1117
                      P+  K  +  +F L     +     I  A VE  +  L       + +   
Sbjct  256   MDFIRKQICPKITKASLMLIFHLVSSSYYTSSETIKSAFVEMGLVSLILGILVDFGKGVI  315

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E AL  ++ +C    G      +ALT+P+LVK +L++SD AT ++  A+  LC +  + 
Sbjct  316   IENALGVMDGICGFEKGRKEAFGNALTIPVLVKKLLRVSDVATAFSISAICKLCKNVNEE  375

Query  1298  QR--------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                       +A+  G   +LLL++Q  C E  K+KA  LLKLL    P    + S DF
Sbjct  376   DDVQGRSVLVEALQVGAFQKLLLIIQVSCCEETKKKATELLKLLNPYRPQLECIESADF  434



>ref|XP_009379827.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   181 bits (458),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 145/393 (37%), Positives = 220/393 (56%), Gaps = 17/393 (4%)
 Frame = +2

Query  257   GGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPL-TDFTL  430
             G +++P ++ CPISL++MRDPVTV TG TYDR SIE W+ +G +  CPVT+ PL  +  L
Sbjct  3     GVLEVPEYYLCPISLQMMRDPVTVTTGITYDRESIERWLFSGKHRDCPVTKQPLPPELDL  62

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrr  610
              PNHTLRRLIQ WCV + + GVER PTP+    P + +S ++          +R+SAL+R
Sbjct  63    TPNHTLRRLIQAWCVEHASDGVERFPTPR----PTVDKSQIAAILDEVVIPQTRMSALQR  118

Query  611   lrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECV-F  787
             L+ +  +SD+NR  +  + A  +L+SI+    + N  +   EAL+IL   Q+S    +  
Sbjct  119   LKSVVLESDRNRRFVEESGAADLLVSIIREQEECNDGD---EALAILCSLQISGERLLDL  175

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +  + D +G L S+LS  +   +  +  L++S+V    SP   S +   +E F GIV  L
Sbjct  176   LRRNDDLIGTLTSILSQRNDQSQAYALLLLKSLVP-VMSPSKMSDLR--EEFFSGIVKGL  232

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDTERALATVE  1144
                 +  +A K  ++ L  +C  K+++ KAV AGAV  LIE  L   E+   E  LA ++
Sbjct  233   QDKVSR-QATKAALQILAGVCCCKRNKVKAVRAGAVFVLIELLLGETERRRCEMLLAVLD  291

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ--AQRDAVAA  1318
              LC    G A   AHA  + ++ K IL++S  A+  +A  L S+   S      ++ +  
Sbjct  292   QLCGCAEGRAEVVAHAAGISVVSKKILRVSKLASAMSARILCSVAKLSPSPPVLQEMLQV  351

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             G +++L LL+Q  C  R K KAQ +LKL    W
Sbjct  352   GAVSKLCLLLQVDCGVRLKDKAQEILKLHSRVW  384



>ref|XP_009592688.1| PREDICTED: U-box domain-containing protein 21-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 133/411 (32%), Positives = 215/411 (52%), Gaps = 19/411 (5%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HF CPISL+LM+DPVT+ TG TYDR +IE W+  GN TCP+T   L +   IPNH++
Sbjct  31    IPRHFTCPISLDLMKDPVTLSTGITYDRENIEKWIEAGNQTCPITNQTLRNGEPIPNHSI  90

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             R++IQ+WCV N+  G+ERIPTP+ P     V  LL++ S     L      + +++ L  
Sbjct  91    RKMIQQWCVENKDHGIERIPTPRIPVTSSEVVELLAKISKEIHDLELCGELVSKVKKLVN  150

Query  629   dsDKNRSVISANNARQVLLS--IVFSNMDSNSSELTHEA-LSILSMFQLSEAECVFVASD  799
             +S++N+     N   QVL +  + FS   +  +  T E  LSIL+     + E       
Sbjct  151   ESERNKRCFVTNGTAQVLSAAFVAFSEEINMRNASTGEVILSILTTILPLDGESKSNLGS  210

Query  800   LDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNHPS  979
             +  +  +V  L + S+  R N+  +++ ++   +  ++   +   +   +G+V ++  P 
Sbjct  211   ISSLRCMVWFLKNGSLSSRRNAVFVLKDILKMEEQDKVEILLG-MEGALEGLVKLVKEP-  268

Query  980   THPRALKMGVKALFALC---------LVKQHRQKAVIAGAVEALIERLQYLEKCDTERAL  1132
               P   K  + A++ +            K+ + + V  G VE L+E L   +K   E+AL
Sbjct  269   ICPTTTKASLLAIYHMVNSSHLSSSFANKKAQSRFVDLGLVELLVEMLVDCDKSICEKAL  328

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR---  1303
               ++ +C    G     ++ALTVP+LVK +L++SD ATE++   L  +  + ++      
Sbjct  329   GVLDGICSSIEGRKRAYSYALTVPVLVKKLLRVSDLATEFSVSILWKIGKNEKRENGGDV  388

Query  1304  --DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
               +A+  G   +LLLL+Q GC+E  K KA  LLKLL         V+S DF
Sbjct  389   LVEALKLGAFQKLLLLLQVGCSETTKEKASELLKLLNVHRDRAECVDSLDF  439



>ref|XP_007215376.1| hypothetical protein PRUPE_ppa005711mg [Prunus persica]
 gb|EMJ16575.1| hypothetical protein PRUPE_ppa005711mg [Prunus persica]
Length=447

 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 138/402 (34%), Positives = 203/402 (50%), Gaps = 23/402 (6%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             +++  I +P HFRCPISL+LM+DPVT+ TG TYDR+SIE W+ TGN TCP T   L  F 
Sbjct  28    MEMEEIAVPTHFRCPISLDLMKDPVTLSTGMTYDRSSIEKWIETGNRTCPATNQELKSFD  87

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
              IPNH LRR+IQ+WCV NR++G+ERIPTP+ P     V  +  + ++ +   + R     
Sbjct  88    QIPNHALRRMIQDWCVENRSYGIERIPTPRIPVTKYEVSRICERIAAAARLGDGRKCGEL  147

Query  608   rlrglardsDKNRS-VISANNARQVLLSIVFSNMDSNSS----ELTHEALSIL-SMFQLS  769
               +  A   +  R+      N     LS    +  S S     E+  E LS+L  MF +S
Sbjct  148   VGKIKAWGKESERNKKCMVENGIGCCLSAALDSFASISMEDHVEILLEILSMLPWMFPVS  207

Query  770   EAECVFVASDLDRVGYL---VSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             E       S L   G L   +S L    +  R N+  ++  +++  +          ++ 
Sbjct  208   EEG----QSKLGSAGSLRCFLSFLEGKDLSARQNAVLVLGKLLSLDQKH--VDDFVESEG  261

Query  941   IFQGIVGILNHPSTHPRALKMGVKA-LFALCL----VKQHRQKAVIAGAVEALIERLQYL  1105
               + +VGI+  P   P A K  + + LF +        + R + V  G V  L+E +   
Sbjct  262   AIEALVGIIREP-ISPAATKAALTSVLFMISFPSAASDEIRSRFVELGLVSLLLEIIVDA  320

Query  1106  EKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl--c  1279
             E+   ERAL  +E LC    G      +ALT+PLLVK IL+IS+ ATE++   +  L   
Sbjct  321   ERRLCERALGVLEGLCDCKQGKDKVLENALTIPLLVKKILRISELATEFSIAIIWKLCRI  380

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              + E    +A+  G   +LL+L+Q GC +  K K   LLKL 
Sbjct  381   ETEESVLIEALQVGAFQKLLVLLQVGCGDGIKEKVTDLLKLF  422



>ref|NP_001147860.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
 gb|ACG28921.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=452

 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 145/406 (36%), Positives = 212/406 (52%), Gaps = 15/406 (4%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP +F CPISLE+M+DPVT  TG TYDR S+E W+  G++TCPVT  PL    LIPNH  
Sbjct  42    IPSNFLCPISLEMMQDPVTAPTGITYDRDSVEGWLERGHSTCPVTARPLRAEDLIPNHAT  101

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlrgl  622
             RR+IQ+WCVANRA GVER+PTP+ P        LL+  S+ +   ++ +      + R L
Sbjct  102   RRMIQDWCVANRALGVERVPTPRVPLSADDAAELLAAVSAAARRGDAMVCRQLAAKARAL  161

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSS---ELTHEALSILSMFQLSEAECVFVA  793
              ++SD+NR  ++A  A +VL S     +D  +S    L     +++  F L E     +A
Sbjct  162   GKESDRNRRCLAAGGAARVLSSAFLRLVDQPASFGGALGEILATLVVFFPLDEVCRSHIA  221

Query  794   S--DLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGT--KSPELRSQISNADEIFQGIVG  961
             S   LD +   VS+LSH       +SAA++   +A +    PE    +S    +   ++ 
Sbjct  222   SPASLDAI---VSILSHDGEATTKSSAAVVLREIASSSDSDPECLDALSVTSGVHDALIK  278

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
             +L  P +        V A + +       ++ V  G V+ L+E L   +K  TE+ALA +
Sbjct  279   LLQKPVSAQATKAALVTAYYLVRGSDLAARRLVDLGMVDLLVEMLVDADKGTTEKALAVL  338

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ---AQRDAV  1312
             + L     G     AHAL VP+LVK +  +S+ ATE+A  AL  LC S       + +A+
Sbjct  339   DSLLLTEEGRGKACAHALAVPVLVKKMQHVSEMATEFAVSALWRLCKSFSGEGPCKAEAL  398

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
               G   +LLLL+Q GC    K +A  LL+LL         + + DF
Sbjct  399   QLGAFQKLLLLLQVGCMGVTKERASELLRLLNGSRDGVECIETVDF  444



>ref|XP_008457035.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis melo]
Length=442

 Score =   181 bits (459),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 139/408 (34%), Positives = 216/408 (53%), Gaps = 19/408 (5%)
 Frame = +2

Query  227   MPASLDPLDVGG-IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVT  403
             +   L  +D G  I IP H+ CPISL+LM+DPV + TG TYDR SIE W+  GN +CPVT
Sbjct  16    LKKQLPGVDCGSEIAIPSHYMCPISLDLMKDPVILSTGITYDRESIEKWIDGGNFSCPVT  75

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshl  583
             +  LT F LIPNH LRRLIQ+WCVANR++G+ERIPTP+ P  P  V+ + S+ S  +   
Sbjct  76    KQELTVFDLIPNHALRRLIQDWCVANRSYGIERIPTPRIPVSPYEVKEICSRISIATQRS  135

Query  584   nsr--lsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALS  745
             + +     + ++R  A++S++NR  +  N     +L+  F +    S E    L  E L 
Sbjct  136   DLKRCSELMGKIRNWAKESERNRRCL-VNGGTGDVLAASFEHFAGVSIEKHVGLLEEILL  194

Query  746   ILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             +L+       E +        +  LVS L    +  + ++  +++ ++A  +     + +
Sbjct  195   VLTCIFPVAIEGISKLGSAGSLKCLVSFLIGKDLSPKQSAVFVLKELLAADR--RYVNSL  252

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA----GAVEALIER  1093
             +  + + + +V I+  P   P   K  +  +F + L     +K  +     G V  L+E 
Sbjct  253   AAIEGVSEALVSIIRDPLC-PSNTKSSLTVIFYMILPSDIGEKMALKFVELGLVSQLLEF  311

Query  1094  LQYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls  1273
             L   EK   E+AL  ++ +C    G      +ALT+PLLVK IL++S+ ATEY+   LL 
Sbjct  312   LVDAEKSLCEKALGILDGICDYKQGREKLYNNALTIPLLVKKILRVSELATEYSLSILLK  371

Query  1274  lcsssEQAQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             LC S E+ +     +A   G   ++L+L+Q GC    K K   +LKLL
Sbjct  372   LCKSGEKGEDEVRVEAAQLGAFQKILVLLQVGCGGDMKDKVTEMLKLL  419



>ref|XP_010043987.1| PREDICTED: U-box domain-containing protein 21-like [Eucalyptus 
grandis]
Length=448

 Score =   181 bits (459),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 131/419 (31%), Positives = 217/419 (52%), Gaps = 31/419 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P  F+CPISL+LM+DPVT+ +G TYDR SIE W+  GN TCP+T        L+PNH
Sbjct  31    LTVPSEFKCPISLDLMKDPVTLLSGITYDRESIEMWIEAGNRTCPITNRAFGSLELVPNH  90

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlr  616
              +RR+IQEWCV NR+ G+ERIPTP+ P     V  +L + S  S   +  +    + +++
Sbjct  91    MIRRMIQEWCVENRSHGIERIPTPRIPVSSMEVVEMLDKISEASKIKDQSVCRKLVVKMK  150

Query  617   glardsDKNRSVISANNARQVLLSIV-----FSNMDSNSSELTHEALSILSM---FQLSE  772
              L+++S++N+    +N    VL +        S+ D  + +++ E LS L++     +  
Sbjct  151   ALSKESERNKKCFKSNGTGSVLAAAFEAFSETSSQDEENDDISKEILSALTLMLPLSVEA  210

Query  773   AECVFVASDLD-RVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSP-ELRSQISNADEIF  946
               C+   S L   VGY    L++  +    NSA ++  +V+  K   E  ++I  A    
Sbjct  211   KSCLGSPSSLHCMVGY----LTNSDLSSGWNSALVLREIVSSDKRKVEALAEIEGA---L  263

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-----GAVEALIERLQYLEK  1111
             + +  ++  P   P A +  +  ++ +       +  +I+     G V  L+E L   ++
Sbjct  264   ESLFKVVKEP-ICPAATRSSLIVIYHMVTSSHPAKDMIISRFVQMGLVSLLVETLVDADR  322

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE  1291
               +E+AL  ++ +C    G  A   ++L VP+LVK +L++SD ATE++   L  L +  E
Sbjct  323   SMSEKALGVLDGICDNEEGKEAVRDNSLAVPVLVKKLLRVSDLATEFSVSVLWKLMAIGE  382

Query  1292  QAQR------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
               +       +A+  G   +LLLL+Q GC ER K KA   +KLL         ++S DF
Sbjct  383   SGEDGGGVLAEALQVGAFQKLLLLLQVGCGERTKEKATQAVKLLNQHRERLECIDSLDF  441



>gb|ADI46214.1| CMPG1b [Nicotiana benthamiana]
Length=444

 Score =   181 bits (459),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 132/413 (32%), Positives = 216/413 (52%), Gaps = 24/413 (6%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP +F CPISL+LM+DPVT+ TG TYDR +IE W+  GN TCP+T   L +   IPNH++
Sbjct  30    IPRNFTCPISLDLMKDPVTLSTGITYDRENIEKWIEAGNQTCPITNQTLRNGEPIPNHSI  89

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             R++IQ+WCV N+  G+ERI TP+ P     V  LL++ S            + +++ L  
Sbjct  90    RKMIQQWCVENKDHGIERIQTPRIPVTSSEVVELLAKISKAMHDSELCRELVSKVKKLVN  149

Query  629   dsDKNRSVISANNARQVLLS--IVFS---NM-DSNSSELTHEALSILSMFQLSEAECVFV  790
             +S++N+     N    VL +  + FS   NM ++++ EL    LS L+     + E    
Sbjct  150   ESERNKRCFVTNGTAHVLSAAFVAFSEEINMKNASTGELI---LSTLTTILPLDGESKSN  206

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
                +  +G +V  L++ S+  R N+  L++ ++   +  ++   +   D   +G+V ++ 
Sbjct  207   LGSISSLGCMVWFLNNGSLSSRRNAVFLLKDILKMEEQDKIEILLG-MDGALEGLVKLVK  265

Query  971   HPSTHPRALKMGVKALFALC--------LVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
              P   P   K  + A++ +           K+ + +    G VE L+E L   EK   E+
Sbjct  266   EP-ICPTTTKASLLAIYHMVNPSHSSSFANKKAQSRFADVGLVELLVEMLVDCEKSICEK  324

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-  1303
             AL  ++ +CR   G     ++ALTVP+LVK +L++SD ATE++   +  +  +  +    
Sbjct  325   ALGVLDGICRSIEGRKRAYSYALTVPVLVKKLLRVSDLATEFSVSIIWKIGKNENRENGG  384

Query  1304  ----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                 +A+  G   +LLLL+Q GC++  K KA  LLKLL         V+S DF
Sbjct  385   DVLVEALKLGAFQKLLLLLQVGCSDTTKEKASELLKLLNVHRDRAECVDSLDF  437



>gb|ADI46213.1| CMPG1a [Nicotiana benthamiana]
Length=444

 Score =   180 bits (457),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 212/410 (52%), Gaps = 18/410 (4%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP +F CPISL+LM+DPVT+ TG TYDR +IE W+  GN TCP+T   L +   IPNH++
Sbjct  30    IPRNFTCPISLDLMKDPVTLSTGITYDRENIEKWIEAGNQTCPITNQTLRNGEPIPNHSI  89

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             R++IQ+WCVAN+  G+ERIPTP+ P     V  LL++ S            + +++ L  
Sbjct  90    RKMIQQWCVANKDHGIERIPTPRIPVTSSEVVELLAKISKGMHDSELCKELVSKVKKLVN  149

Query  629   dsDKNRSVISANNARQVLLS--IVFSNMDSNSSELTHEA-LSILSMFQLSEAECVFVASD  799
             +S++N+     N    VL +  + FS   +  +  T E  LS L+     + E   +   
Sbjct  150   ESERNKRSFVTNGIAHVLSAAFVAFSKEINMKNASTGEVILSTLTTILPLDGESKSILGS  209

Query  800   LDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNHPS  979
             +  +  +V  L++ S+  R N+  L++ ++   +  ++   +     + +G+V ++  P 
Sbjct  210   ISSLRCMVWFLNNGSLSGRRNAVFLLKDILKMEEHDKVEILLGMGGAL-EGLVKLVQEP-  267

Query  980   THPRALKMGVKALFALC--------LVKQHRQKAVIAGAVEALIERLQYLEKCDTERALA  1135
               P   K  + A++ +           K+ + +    G VE L+E L   EK   E+AL 
Sbjct  268   ICPTTTKASLLAIYHMVNPSNSSSFANKKAQSRFADMGLVELLVEMLVDSEKSICEKALG  327

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR----  1303
              ++ +C    G      +ALTVP+LVK +L++SD ATE++   +  +  +  +       
Sbjct  328   VLDGICSSVEGRKGVYNYALTVPVLVKKLLRVSDLATEFSVSIIWKIGKNENRENGGDVL  387

Query  1304  -DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              +A+  G   +LLLL+Q GC+E  K KA  LLKL+         V+S DF
Sbjct  388   VEALKLGAFQKLLLLLQVGCSETTKEKASELLKLMNVHRDRQECVDSLDF  437



>ref|XP_004490855.1| PREDICTED: U-box domain-containing protein 21-like [Cicer arietinum]
Length=446

 Score =   180 bits (457),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 126/401 (31%), Positives = 219/401 (55%), Gaps = 30/401 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPL---TDF-TL  430
             I IP HFRCPI+L++M+DPVT+ TG TYDR SIE W+ +GN TCPVT+  L   T+F  +
Sbjct  32    IAIPTHFRCPITLDIMKDPVTLSTGITYDRDSIEKWIESGNNTCPVTKTELLLPTNFDNI  91

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--sal  604
             +PNH+LRR+IQ+WCV +R++GVERIPTP+ P  P  V    ++  S       +     +
Sbjct  92    VPNHSLRRMIQDWCVQHRSYGVERIPTPRIPVTPYEVTDTCTRILSAVQQDEQQKCFELV  151

Query  605   rrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE-----LTHEALSILSMFQLS  769
             ++++G  ++S++N+  I +N A  ++L+ VF +    S E     L  E L +L+  +  
Sbjct  152   KKIKGWGKESERNKKCIVSNGA-PIVLANVFDSFSRCSFEKINVVLLEEVLGMLTWMRPV  210

Query  770   EAECVFVASDLDRVGYLVSLLSHPS-IDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
               +   +   L+ +  +V  L+  + +  R N++ LI+ +            +   + I 
Sbjct  211   SEQSRLILGSLNSLSCMVWFLNDKNQVSTRQNASLLIKEMHV--------ESLMKIEGIV  262

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHR----QKAVIAGAVEALIERLQYLEKC  1114
             + +V ++  P     + K  +  +F L    + +    ++ V  G V  L+E +   EK 
Sbjct  263   ETLVNMVKVP-IGSASTKACLSTIFHLVFSSKSKKVVLERFVELGLVSILLEIIVDAEKG  321

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E+AL  ++ LC   +G     ++ALT+PL++K +L++S+ ++ +    +  +C  ++ 
Sbjct  322   VCEKALGVLDSLCDSTNGVGIAKSNALTLPLVIKKLLRVSELSSSFVVSIVYKICCDNKG  381

Query  1295  AQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              +     +A+  G+  +LL+L+Q GC E  K KA  LLKLL
Sbjct  382   EEEGVLIEAIQVGMFQKLLVLLQVGCGENTKEKATELLKLL  422



>ref|XP_002298264.1| hypothetical protein POPTR_0001s22370g [Populus trichocarpa]
 gb|EEE83069.1| hypothetical protein POPTR_0001s22370g [Populus trichocarpa]
Length=415

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 148/402 (37%), Positives = 216/402 (54%), Gaps = 24/402 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I +PYHF CPISL+LMRDPVTV TG TYDR +IE W+ +  N TCPVT+  L    L PN
Sbjct  4     IDVPYHFLCPISLQLMRDPVTVSTGITYDRENIEKWLFSCKNKTCPVTKQELFTKDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N +FG+ERIPTPK  AD      +    +      +  L +LRRLR 
Sbjct  64    HTLRRLIQAWCTLNASFGIERIPTPKPLADRA---QISKLLNDAKKFPHLLLKSLRRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFS--------NMDSNSSELTH---EALSILSMFQL  766
             +  +S++NRS +        L SI+ +        + D N SE T    EAL+IL   ++
Sbjct  121   ITLESERNRSCLEEAGVVDFLASILKTDNSTSVQIDSDDNESEFTRASDEALNILYHLKI  180

Query  767   SEAECV-FVASDLDR-VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             S+ +    + +D DR +  L+ +L H S   R  +  L++SV        L   IS   E
Sbjct  181   SQRQLKNLIINDSDRFLESLLQILKHSSYQSRAYATMLLKSVFEVADPTHL---ISIRPE  237

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCD  1117
             +F  IV +L+   +  +A K  +K L  +C   ++R KAV  GAV  LIE  L   +K  
Sbjct  238   MFVEIVRVLDDQISQ-QASKAALKLLVEICPWGRNRIKAVEGGAVSVLIELLLDTSDKRA  296

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E  LA +ELLC    G A    H   + ++ K IL++S  A++ A   L S+C  S  +
Sbjct  297   CELILAVLELLCGCADGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILCSICRFSATS  356

Query  1298  Q--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             +  ++ +  G + +L L++Q   + ++K +A+ +LK+    W
Sbjct  357   RVLQEMLQVGAVAKLCLILQVDSSLKSKERAREILKVHSKVW  398



>dbj|BAJ91241.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 211/417 (51%), Gaps = 25/417 (6%)
 Frame = +2

Query  251   DVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTL  430
             D G + +P HFRCPISLELM+DPVT  TG TYDR S+E W+A G  TCPVT  P+    L
Sbjct  29    DDGELAVPAHFRCPISLELMKDPVTAPTGITYDRESVEGWLARGRATCPVTGGPVRLADL  88

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQP---ADPGlvqsllsqassvsshlnsrlsa  601
             +PNH  RR+IQ+WCVANRA   ER+PTPK P   AD   V   +S A+   +       A
Sbjct  89    VPNHATRRMIQDWCVANRA---ERVPTPKVPVAEADAAEVLDAVSAAARRGNAAACGQVA  145

Query  602   lrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEA--------LSILSM  757
              R            R + +A  ARQ  LS  F ++     E T  A        L+ L++
Sbjct  146   ARARAIGKESDRNRRCLAAAGAARQ--LSSAFQSLAGEPVEGTSAAVLGALGKILAALTV  203

Query  758   FQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
             F   + E     +    +  LVS+LSH  +  R  SAA++   +A +        I+   
Sbjct  204   FFPLDDEARRCIASPASLKTLVSVLSHGDLAARA-SAAIVLRELASSADRHTVDVIARTP  262

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA--GAVEALIERLQYLEK  1111
              +   +VG++ +P   P+A K  +   + L +    R  A  A  GAV  + E L   +K
Sbjct  263   GVCGALVGLVRNP-VSPQATKAALVTAYYL-VSGSDRAAARFAELGAVPVVAELLVDADK  320

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssE  1291
               +E+ALA ++ +    +G  +  AHAL VP+LVK + ++SD ATE+A  AL  LC +S+
Sbjct  321   GTSEKALAMLDGVLCADAGLESARAHALVVPVLVKKMFRVSDMATEFAVSALWRLCRASD  380

Query  1292  QAQRDAVAA----GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              A     A     G   +LLLL+Q GC    K +A  LLKLL         + + DF
Sbjct  381   TAAAACCAEALRVGAFQKLLLLLQVGCGGVTKDRASELLKLLNGFRGSVECIETVDF  437



>ref|XP_010247286.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Nelumbo nucifera]
Length=413

 Score =   179 bits (454),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 143/404 (35%), Positives = 216/404 (53%), Gaps = 30/404 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             I IP +F CPISLE+MRDPVTV TG TYDR  IE WV +G N TCPVT+  L+D  L PN
Sbjct  4     IDIPPYFICPISLEIMRDPVTVSTGITYDRECIEKWVFSGKNKTCPVTKQVLSDVDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N + G+ER PTPK P D       +++  + +     ++  LR+L+ 
Sbjct  64    HTLRRLIQAWCTLNASKGIERFPTPKPPVDKA----EIAKILNDAKLPQLQMRCLRKLKL  119

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSEL-----------THEALSILSMFQL  766
             +A +SD+N+  + A    Q L SIV +   +   ++           + EALS+L   Q+
Sbjct  120   MASESDRNKRCMEAAGVVQFLASIVKNGSSTPVEDVVEDGVLEFTTASDEALSLLYHLQI  179

Query  767   SEAECVFVASDLDR----VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNA  934
             S++    + S ++R    VG L  +L   +   R  ++ L++S+       +L   IS  
Sbjct  180   SQSS---LKSLMNREGEFVGCLTRVLQRGNYQSRAYASLLLKSMFEVADPNQL---ISLR  233

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEK  1111
              E+F  IV +L    +H +A K  +K L  LC   ++R KAV AGAV  +IE  L   EK
Sbjct  234   TELFVEIVNLLRDQISH-QASKAALKVLIELCPWGRNRIKAVEAGAVSVVIELLLDASEK  292

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATE--Yaagallslcss  1285
               +E  L  ++ LC    G A    HA  + ++ K IL++S  ATE      + +S  S+
Sbjct  293   RASEMMLVVLDQLCGCAEGRAELLKHAAGLAVVSKKILRVSHLATERGVRILSSISRYSA  352

Query  1286  sEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             +    ++ +  GV+++L L++Q  C  +   K + +L+L    W
Sbjct  353   TPSVLQEMLNLGVVSKLCLVLQVDCGVKTMEKVREILRLHSRAW  396



>ref|XP_011021423.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Populus euphratica]
Length=415

 Score =   179 bits (454),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 148/402 (37%), Positives = 215/402 (53%), Gaps = 24/402 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I +PYHF CPISL+LMRDPVTV TG TYDR +IE W+ +  N TCPVT+  L    L PN
Sbjct  4     IDVPYHFLCPISLQLMRDPVTVSTGITYDRENIEKWLFSCKNETCPVTKQELFTKDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N +FG+ERIPTPK  AD      +    +      +  L +LRRLR 
Sbjct  64    HTLRRLIQAWCTLNASFGIERIPTPKPLADRA---QISKLLNDAKKFPHLLLKSLRRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFS--------NMDSNSSELTH---EALSILSMFQL  766
             +  +S++NRS +        L SI+ +        + D N SE T    EAL+IL   ++
Sbjct  121   ITLESERNRSCLEEAGVVDFLASILKTDDSTSVEIDSDDNESEFTRASDEALNILYHLKI  180

Query  767   SEAECV-FVASDLDR-VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             S+ +    + +D DR +  L+ +L H S   R  +  L++SV        L   IS   E
Sbjct  181   SQRQLKNLIINDGDRFLESLLQILKHSSYQSRAYATMLLKSVFEVADPTHL---ISIRPE  237

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCD  1117
             +F  IV +L+   +  +A K  +K L  +C   ++R KAV  GAV  LIE  L   +K  
Sbjct  238   MFVEIVRVLDDQISQ-QASKAALKLLMEICPWGRNRIKAVEGGAVSVLIELLLDTSDKRA  296

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E  LA +ELLC    G A    H   + ++ K IL++S  A++ A   L S+C  S  +
Sbjct  297   CELILAVLELLCGCADGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILCSICRFSATS  356

Query  1298  Q--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                ++ +  G + +L L++Q   + ++K +A+ +LK+    W
Sbjct  357   TVLQEMLQVGAVAKLCLILQVNSSLKSKERAREILKVHSKVW  398



>ref|XP_007163365.1| hypothetical protein PHAVU_001G228500g [Phaseolus vulgaris]
 gb|ESW35359.1| hypothetical protein PHAVU_001G228500g [Phaseolus vulgaris]
Length=446

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 134/400 (34%), Positives = 195/400 (49%), Gaps = 29/400 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCP+SLELM DPVT+ TG TYDR SIE W+  GN TCPVT   LT F  IPNH
Sbjct  34    VVIPNHFRCPVSLELMTDPVTLSTGITYDRVSIEKWIEGGNKTCPVTNQVLTTFDTIPNH  93

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
              +RR+IQ+WCV N ++G +RIPTP+ P     V    ++  S S   + +       +  
Sbjct  94    VIRRMIQDWCVENSSYGFQRIPTPRIPLSSYDVSQTCTRILSASQRGDDKKCQELVGKIK  153

Query  623   ardsDK--------NRSVISANNARQVLLSIVFSNMDSNSSELTH-----EALSILS-MF  760
                 D+        N S   A N+   +L+  F       S   H     E L +L+ M 
Sbjct  154   VWGRDERNKRFIIGNHSGTDAGNSPDAVLAYAFDCFSRGDSFDKHVVVLEEILEVLTWMI  213

Query  761   QLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
              L E E V   S    +  +V  L    +  R ++A L+  V           +++   +
Sbjct  214   PLGE-EGVSKLSSKASLNCMVWFLEGKDLASRQSAALLLRQVCV--------QELAKVGK  264

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHR----QKAVIAGAVEALIERLQYLE  1108
             I + +V ++  P     + K  +  +F L    ++R    QK V    V  L+E +   E
Sbjct  265   IVEALVTMIREP-IGSASTKACLTTIFNLVSSAENRGEIAQKFVELDLVSLLLEAIVDGE  323

Query  1109  KCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga-llslcss  1285
             K   E+AL  ++ +C I  G      +ALT+PL+VK +L++S  A+ +A      +    
Sbjct  324   KGVCEKALGVLDCICDIQKGKEVVKNNALTLPLVVKKLLRVSPLASSFAVSILKKNSDKK  383

Query  1286  sEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              E+A  +AV  G   +LL+L+Q GC ER K  A  LLKLL
Sbjct  384   EEEALIEAVQLGAFQKLLVLLQVGCDERTKENATELLKLL  423



>ref|XP_010936891.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=442

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 216/417 (52%), Gaps = 20/417 (5%)
 Frame = +2

Query  251   DVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTL  430
             D+  + IP HFRCPISL+LM+DPVTV TG TYDR SIE+W+   N TCPVT   L    L
Sbjct  22    DIAELSIPTHFRCPISLDLMKDPVTVATGITYDRQSIETWLDMENMTCPVTNQELNVEDL  81

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsal  604
             IPNH++R++IQ+WCVAN ++G+ERIPTPK P  A            +S           +
Sbjct  82    IPNHSIRKMIQDWCVANHSYGIERIPTPKIPVTAAQASEILSGIATASRKGETTKCRELV  141

Query  605   rrlrglardsDKNRSVISANNARQVLLSIVFSNM----DSNSSELTHEALSILSMFQLSE  772
              +++  A++S++NR    +  A + L +   +      +++++ +  + LS L+     +
Sbjct  142   VKVKAFAKESERNRRCFMSKGACRALAASFSAFASGPSENSTAGVLEDILSALAFMLPLD  201

Query  773   AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
              E  +     + +  +VS+L    +  R+++  +++ +V+  +  E    ++  + + + 
Sbjct  202   EEAAWHIGSPESLNSMVSILKGGDLAGRLSAVLVVKELVSANR--EWVEVMAKTEGLIEA  259

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQHR-QKAVIAGAVEALIERLQYLEKCDTERA  1129
             +V ++  P   P+A K  + A F +    +    + V  G V  L++ L   EK   E+A
Sbjct  260   MVQLIKEP-IFPQATKASLVATFYMVNSDERTASRFVDLGLVPVLLDILVDTEKSMCEKA  318

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR--  1303
             LA +  L     G      HALT+P+LVK + ++SD ATE+   AL  LC + ++ +   
Sbjct  319   LAVLSGLLSCEEGREKAYEHALTMPVLVKKMFRVSDMATEFVVSALWKLCKNYKEEEEEG  378

Query  1304  --------DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                     +A+  G   +LLLL+Q GC    K KA  LLKLL         +++ DF
Sbjct  379   ERRGGCLVEALQVGAFQKLLLLLQVGCGGSTKEKATDLLKLLNGYTSRAECIDTMDF  435



>ref|XP_007141935.1| hypothetical protein PHAVU_008G238500g [Phaseolus vulgaris]
 gb|ESW13929.1| hypothetical protein PHAVU_008G238500g [Phaseolus vulgaris]
Length=437

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/413 (31%), Positives = 209/413 (51%), Gaps = 30/413 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP HFRCP++L++M+DPVT+ TG TYDR SIE W+ +GN TCPVT+  LT F +IPNH
Sbjct  30    IAIPTHFRCPVTLDMMKDPVTMATGITYDRDSIEKWIESGNRTCPVTKTELTSFEMIPNH  89

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             ++RR+IQ+WCV +R+ G+ERIPTP+ P  P  V    ++  S + H +         +  
Sbjct  90    SIRRMIQDWCVEHRSHGIERIPTPRIPVTPYEVTDTCTRILSAAQHGDENKCVELVRKIK  149

Query  623   ardsDKNRS-----VISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVF  787
             A   +  R+     V  A  A     +I    +   +  +  E L  L+  +    +   
Sbjct  150   AWGKESERNKRCIVVNGAALALANAFNIFSRGVVEKNVVVLDEILGALTWMRPLSEDGRS  209

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQ-ISNADEIFQGIVGI  964
             V   +  +G +V  ++   +  R N+A L++         E+R + +   + +F+ +V +
Sbjct  210   VLGSVSSIGCMVWFMNGKQLATRQNAALLLK---------EMRVEALVKCEGVFEALVNM  260

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYL---------EKCD  1117
             +  P  +  + K  +  +F L +      + V   A E  +E              E+  
Sbjct  261   VKEPVGNASS-KACLSTIFKLLVNSSGSNRGV---ARERFVELGLVSVLLELLVDAERGV  316

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E+AL  ++ LC    G     ++ALT+PL++K +L++S+ ++ +A   L  +C  +E+ 
Sbjct  317   CEKALGVLDCLCDCKQGVEMAKSNALTLPLVIKKLLRVSELSSSFAVSVLWKVCDKTEEG  376

Query  1298  QR-DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD-DF  1450
                +A+  GV  +LL+L+Q GC E  K KA  LLKL   C      V+S  DF
Sbjct  377   VLIEALQIGVFHKLLVLLQVGCAEGTKEKATELLKLFNGCRSKAECVDSSLDF  429



>ref|XP_008799715.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Phoenix dactylifera]
Length=416

 Score =   178 bits (451),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 138/408 (34%), Positives = 221/408 (54%), Gaps = 34/408 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             ++IP +F CPISL++MRDPVT+ TG T+DR SIE W+ +G + TCPVTR PL+D  L PN
Sbjct  4     VEIPSYFLCPISLQIMRDPVTLTTGMTFDRESIERWIFSGKHKTCPVTRQPLSDLELTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC AN ++G+ER PTP+ P      ++ ++     +   +S +SALR+L+ 
Sbjct  64    HTLRRLIQAWCTANASYGIERFPTPRPPV----CKAQIAALLDEAKLPHSLMSALRKLKA  119

Query  620   lardsDKNRSVISANNARQVLLSIVFSN------------------MDSNSSELTHEALS  745
             +  +S++N+  + A+ A   L S++  +                  +D+++S+   EAL+
Sbjct  120   IVSESERNKRCVEASGAVDFLASLIKKSKSNPREQQQEGLINDGIELDASASD---EALN  176

Query  746   ILSMFQLSEAECVFVASDLDR-VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQ  922
             IL   Q+SE   + +    D  +  L ++L   +   R  +  L++S+++      L   
Sbjct  177   ILYSLQISEQSLLHLIERNDGFIESLTAILRRSNYQSRAYAILLLKSLLSVIAPARL---  233

Query  923   ISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQ  1099
              S + E F+ +V +L    +H +A +  ++ L  L    +++ KAV AGAV  +IE  L 
Sbjct  234   TSFSQEFFEEVVNVLRDQISH-QATRAALQVLGLLSPWGRNKVKAVEAGAVPVVIELLLD  292

Query  1100  YLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
               EK   E  L  ++ LC    G A  A HA    ++ K +L +S  A+E A   L  + 
Sbjct  293   ETEKRACEMMLVVLDRLCGCAEGRAEMAGHAAGFAVVSKKVLGVSPAASERAVRILYWVA  352

Query  1280  sssEQ--AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
               S       + V  GV+T+L +L+Q  C E+AK KA+ +L+L    W
Sbjct  353   RFSPTPAVLHEMVLVGVVTKLCILLQVHCGEKAKEKAKEILRLHSRVW  400



>ref|XP_006448117.1| hypothetical protein CICLE_v10015253mg [Citrus clementina]
 gb|ESR61357.1| hypothetical protein CICLE_v10015253mg [Citrus clementina]
Length=444

 Score =   177 bits (450),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 202/390 (52%), Gaps = 13/390 (3%)
 Frame = +2

Query  272   PYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPNHTL  448
             P HFRCPISL+LM+DPVT+ TG TYDR +IE W+   GN TCPVT   LT F  IPNHT+
Sbjct  34    PNHFRCPISLDLMKDPVTLSTGITYDRENIEKWIHEDGNITCPVTNRVLTSFEPIPNHTI  93

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             RR+IQ+WCV NR++G+ERIPTP+ P     V  +    ++     +       + +++  
Sbjct  94    RRMIQDWCVENRSYGIERIPTPRIPVSSVEVFEINCNITTACKSEDQAGCRDLVAKIKKW  153

Query  623   ardsDKNRSVISANNARQVLLSI--VFSNM--DSNSSELTHEALSILSMFQLSEAECVFV  790
              ++SD+N+  I  N A  VL      FS M  D N S L  E LS L++      E +  
Sbjct  154   TKESDRNKRCIVDNGAVSVLAEAFETFSKMCLDENVSVL-EEILSTLTLLFPLAGEGLTY  212

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGT-KSPELRSQISNADEIFQGIVGIL  967
                   +  +V  L    +  R N+  ++  +V+   +   +   I  A E    ++   
Sbjct  213   LGSASSMRCMVWFLKSGDLSRRRNAVLVLREIVSSDHRKVNVLLDIEGAIEPLFKLIKEP  272

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATVEL  1147
               P+    +L +  + + +    ++  QK V  G V  L+E L   ++   E+AL+ ++ 
Sbjct  273   ICPTATKASLVVVYRTITSASATEKPIQKFVDMGLVSLLLEMLVDAQRSLCEKALSVLDG  332

Query  1148  LCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVA----  1315
             LC    G      ++L  P++VK IL++SD ATE+A   L  LC + E+ ++ A A    
Sbjct  333   LCSSDYGRGDAYNNSLIFPVIVKKILRVSDLATEFAVSILWKLCKNEEREEKTAFAEALQ  392

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              G   +LLLL+Q GC ++ K     LLKLL
Sbjct  393   VGAFQKLLLLLQVGCADKTKEHVSELLKLL  422



>gb|AFW73318.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=477

 Score =   178 bits (452),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 143/403 (35%), Positives = 211/403 (52%), Gaps = 9/403 (2%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP +F CPISLE+M+DPVT  TG TYDR S+E W+  G++TCPVT  PL    LIPNH  
Sbjct  67    IPSNFLCPISLEMMKDPVTALTGITYDRDSVEGWLQRGHSTCPVTARPLRAEDLIPNHAT  126

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--salrrlrgl  622
             RR+IQ+WCVANRA GVER+PTP+ P        LL+  S+ +   ++ +      + R L
Sbjct  127   RRMIQDWCVANRALGVERVPTPRVPLSAADAAELLAAVSAAARRGDAMVCRQLAAKARAL  186

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSS--ELTHEALSILSMFQLSEAECVFVAS  796
              ++SD+NR  ++A  A + L S     +D  +S      E L+ L +F   + EC    +
Sbjct  187   GKESDRNRRCLAAGGAARALSSAFLRLVDQPASFGGALGEILATLVVFFPLDEECRSHIA  246

Query  797   DLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGT--KSPELRSQISNADEIFQGIVGILN  970
                 +  +VS+LSH       +SAA++   +A +    PE    +S  + +   ++ +L 
Sbjct  247   SPASLDAIVSILSHDGEATSKSSAAVVLREIASSSDSDPECLDALSETNGVHDALIKLLQ  306

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATVELL  1150
              P +        V A + +       ++ V  G VE L+E L   +K  TE+ALA ++ L
Sbjct  307   KPVSAQATKAALVTAYYLVRGSDLAARRLVDLGMVELLVEMLVDADKGTTEKALAVLDSL  366

Query  1151  CRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ---AQRDAVAAG  1321
                  G     AHAL VP+LVK +  +S+ ATE+A  AL  LC S       + +A+  G
Sbjct  367   LLTEEGRGKACAHALAVPVLVKKMQHVSEMATEFAVSALWRLCKSFSGEGPCKAEALQLG  426

Query  1322  VLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                +LLLL+Q GC    K +A  LL+LL         + + DF
Sbjct  427   AFQKLLLLLQVGCMGVTKERASELLRLLNGSRDGVECIETVDF  469



>ref|XP_002976407.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
 gb|EFJ22667.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
Length=434

 Score =   177 bits (449),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 198/407 (49%), Gaps = 25/407 (6%)
 Frame = +2

Query  266   QIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHT  445
             ++P HF+CPISL LM DPV+VCTG TYDR+SIE W   G  TCPVT   L    LIPNHT
Sbjct  16    EVPSHFKCPISLCLMADPVSVCTGITYDRSSIEKWFQEGRRTCPVTMQELHSHELIPNHT  75

Query  446   LRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgla  625
             L+R+I  WC ANR F        +QP D        +Q       +        +     
Sbjct  76    LQRIIHGWCAANR-FQSGARGDREQPMD-----LREAQVLVAQLRIPRSRPEAVKRLIAR  129

Query  626   rdsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMF-----QLSEAECVFV  790
                ++++ ++       VL+S    +      E   +A  ILS+       L E     +
Sbjct  130   SQEERSKKLLIRAGLAPVLVSSFSEDQGQEQDEEDSQA-QILSLLPPLIANLDEPSRKEL  188

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
              S  + +  +  LL    +  RV++AALIE +    K  E R  +     IF+G+V ++ 
Sbjct  189   LSPRN-LAAIARLLQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVG  245

Query  971   HPSTHPR---ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
                +  R   A++  ++A+ A+C   ++R + V  G V  L E L   +K  TE  LA +
Sbjct  246   EDHSQRRHRPAIRGSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAAL  305

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcss--sEQAQRDAVA  1315
             E LC    G AA A HAL VP + + + K+SD ATEYA   L ++C     E  +R  V 
Sbjct  306   ECLCGCAEGRAAVARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVE  365

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLL----RDCWPDDSIVNSD  1444
              G+  +L   +Q GC  R K KA  LLKLL    R+C  D S  N+D
Sbjct  366   VGLFPKLFFFLQIGCNPRTKHKAGDLLKLLHRAYRECI-DGSGSNND  411



>ref|XP_004953855.1| PREDICTED: U-box domain-containing protein 21-like [Setaria italica]
Length=454

 Score =   178 bits (451),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 146/408 (36%), Positives = 205/408 (50%), Gaps = 19/408 (5%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P HF CPISL++MRDPVT  TG TYDR S+E W+  G+ TCPV+  PL    LIPNH  
Sbjct  44    VPGHFVCPISLDMMRDPVTAPTGITYDRDSVEGWLERGHATCPVSGRPLRAEDLIPNHAT  103

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             RR+IQEWCVANRA GVER+PTP+ P        LL+  +  +   +         R  A 
Sbjct  104   RRMIQEWCVANRALGVERVPTPRVPVSADDAAELLAAVNVAAGRGDGLACRQLAARARAV  163

Query  629   dsDKNRS-VISANNARQVLLSIVFSNMDSNSSELTHEAL-----SILSMFQLSEAECVFV  790
               +  R+    A       LS  FS +    +  T  AL     +++  F L E     +
Sbjct  164   GKESERNRRCLAAAGAARALSSAFSQLVDRPALTTTGALEEVLAALVVFFPLGEESRRHI  223

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
             AS    +  +VS+LSH     R  SAA++   +A +   +    +S  D I   ++ +L 
Sbjct  224   ASPAS-LNAVVSILSHGETTARA-SAAVVLREIASSSDAQCLDAMSETDGIHDALIKLLE  281

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKA-----VIAGAVEALIERLQYLEKCDTERALA  1135
              P + P+A K  +  + A  LV+   + A     V  G V+ L+E L   +K  TE+ALA
Sbjct  282   KPVS-PQATKAAL--VTAYYLVQNTGRAASSRRLVELGMVQLLVELLVDADKGMTEKALA  338

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ---AQRD  1306
              ++ L     G     AHAL VP+LVK +  +SD ATE+A  AL  LC +       + +
Sbjct  339   VLDSLFLTEEGRGRAYAHALAVPVLVKKMQHVSDMATEFAVSALWRLCKNFSGEGPCKAE  398

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             A+  G   +LLLL+Q GC    K +A  LL+LL         + S DF
Sbjct  399   ALQVGAFQKLLLLLQVGCMGVTKERASELLRLLNGSRSGVECIESVDF  446



>dbj|BAK07065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 138/405 (34%), Positives = 203/405 (50%), Gaps = 15/405 (4%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P HF CPISL++MRDPVT  TG TYDR S+E W+  G+ TCPVT  PL    L+PNH  
Sbjct  47    VPTHFLCPISLDMMRDPVTAPTGITYDRESVEGWLERGHATCPVTGRPLRLEELVPNHAT  106

Query  449   RRLIQEWCVANRAFGVERIPTPKQPA---DPGlvqsllsqassvsshlnsrlsalrrlrg  619
             RR+IQEWCVANR  GVER+PTP+ P    D   + + +S A+        R    R    
Sbjct  107   RRVIQEWCVANRGLGVERVPTPRVPISAFDASELLAAVSDAARRGDGPRCRELVARARAQ  166

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNS---SELTHEALSILSMFQLSEAECVFV  790
                     R  +SA  AR   LS  F ++       +    E L+ L +F   + E    
Sbjct  167   GKESERNRRCFVSATAARA--LSSAFCHLAGQRVVPATALEEILAALVVFLPLDEESRRR  224

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
              +    +  +VS+LSH     RV SAA++   +A +   +    +S    I+  +V +L 
Sbjct  225   IATPASLESVVSILSHGEPVARV-SAAVVLREIASSSDRQCLEAMSKTTAIYAALVKLLE  283

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVI-AGAVEALIERLQYLEKCDTERALATVEL  1147
              P++ P+A K  +   + L +  +     ++  GAV+ L+E L   +K  TE+ALA ++ 
Sbjct  284   KPAS-PQATKAALVTAYYLAMHTELAASCLVDLGAVQLLLELLVDADKGTTEKALAVLDC  342

Query  1148  LCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagal----lslcsssEQAQRDAVA  1315
             L     G       AL VP++VK +  +SD ATE+A  AL     +  +     + +A+ 
Sbjct  343   LLLTCKGRDEAYEQALAVPVIVKKMQHVSDMATEFAVSALWRLCKNFAAEDGGCKAEALQ  402

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              G   +LLLL+Q GC    K +A  LL+LL         ++S DF
Sbjct  403   VGAFQKLLLLLQVGCEGATKERASELLRLLNGSRDGAECIDSLDF  447



>ref|XP_002987240.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
 gb|EFJ11816.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
Length=434

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 199/407 (49%), Gaps = 25/407 (6%)
 Frame = +2

Query  266   QIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHT  445
             ++P HF+CPISL LM DPV+VCTG TYDR+SIE W   G  TCPVT   L    LIPNHT
Sbjct  16    EVPSHFKCPISLCLMADPVSVCTGITYDRSSIEKWFQEGRRTCPVTMQELHSHELIPNHT  75

Query  446   LRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgla  625
             L+R+I  WC ANR F        +QP D        +Q       +        +     
Sbjct  76    LQRIIHGWCAANR-FQSGARGDREQPMD-----LREAQVLVAQLRIPRSRPVAVKRLIAR  129

Query  626   rdsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMF-----QLSEAECVFV  790
                +++++++       VL+S    +      E   +A  ILS+       L E     +
Sbjct  130   SQEERSKTLLIRAGLAPVLVSSFSEDQGQEQDEEDSQA-QILSLLPPLIANLDEPSRKEL  188

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
              S  + +  +  LL    +  RV++AALIE +    K  E R  +     IF+G+V ++ 
Sbjct  189   LSPRN-LAAIARLLQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVG  245

Query  971   HPSTHPR---ALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
                +  R   A++  ++A+ A+C   ++R + V  G V  L E L   +K  TE  LA +
Sbjct  246   EDHSQRRHRPAIRGSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAAL  305

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcss--sEQAQRDAVA  1315
             E LC    G AA A HAL VP + + + K+SD ATEYA   L ++C     E  +R  V 
Sbjct  306   ECLCGCAEGRAAVARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVE  365

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLL----RDCWPDDSIVNSD  1444
              G+  +L   +Q GC  R K KA  LLKLL    R+C  D S  N+D
Sbjct  366   VGLFPKLFFFLQIGCNPRTKHKAGDLLKLLHRAYRECI-DGSGSNND  411



>ref|XP_008343072.1| PREDICTED: U-box domain-containing protein 21-like [Malus domestica]
Length=446

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 142/405 (35%), Positives = 209/405 (52%), Gaps = 27/405 (7%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             +DV  I IP HFRCPISLELM+DPVT+ TG TYDR+SIE W+ TGN+TCPVT   L  F 
Sbjct  25    MDVEEIAIPTHFRCPISLELMKDPVTLSTGMTYDRSSIEMWIETGNSTCPVTNQELVSFD  84

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--sa  601
              IPNH LRR+IQ+WCV NR+ G+ERIPTP+ P     V  +  + +  +  L+ +     
Sbjct  85    QIPNHALRRMIQDWCVENRSNGIERIPTPRIPVTXYEVLRIRERVAGAARRLDEKKCHEL  144

Query  602   lrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS----MFQLS  769
             + +++   ++S++N+  ++ N     L ++  S  D +  E     + ILS    +F LS
Sbjct  145   VGKIKAWGKESERNKKCMAENGIGSCLSAVFESFADRSMDEHVEILVEILSVLPWVFPLS  204

Query  770   EAECVFVASDLDRVGYL---VSLLSHPSIDVRVNSAALIESVVA-GTKSPELRSQISNAD  937
             E       + L   G L   VS L    +  R N+   +  + +   K  +    I    
Sbjct  205   EEG----QTKLGSSGCLRSFVSFLEGKDLTARQNAVLXLRKLFSLDQKYVDAFGAIEGGT  260

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALC-------LVKQHRQKAVIAGAVEALIERL  1096
             E    IVGI+  P   P+A K  +  +  +           + R + V  G V  L+E L
Sbjct  261   E---AIVGIIRZP-ICPQATKAALACVLFMISSPPSVQTSDEIRSRFVELGLVXLLLEIL  316

Query  1097  QYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls-  1273
                EK  +ERAL  +E+LC    G      +ALT+PLLVK IL+IS+  TE++   +   
Sbjct  317   VEAEKSVSERALGVLEVLCDCKQGREKALENALTMPLLVKKILRISELGTEFSVSIIWKL  376

Query  1274  -lcsssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 + E+   +A+  G L +LL+++Q G  +  K K   LLKL 
Sbjct  377   CRIETEERVLIEALQVGALQKLLVVLQVGVCDGIKDKITDLLKLF  421



>ref|XP_003558390.1| PREDICTED: U-box domain-containing protein 21-like [Brachypodium 
distachyon]
Length=433

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 140/408 (34%), Positives = 215/408 (53%), Gaps = 22/408 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNT-TCPVTRAPLTDFTLIPN  439
             + IP HFRCPISL+LMRDPVT  TG TYDR SIE+W+ TG    CPVT APL    L+PN
Sbjct  29    LSIPAHFRCPISLDLMRDPVTAPTGITYDRESIEAWLDTGRAAVCPVTHAPLRHEDLVPN  88

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             H +RR+IQ+WCVANR+ GVERIPTPK P  P       S+     +      +A+ R+R 
Sbjct  89    HAIRRVIQDWCVANRSRGVERIPTPKIPLTP----VQASELLFDLAESRDTAAAIARVRA  144

Query  620   lardsDKNRS-VISANNARQVLLSIVFSNMDSNS-SELTHEALSILSMFQLSEAECVFVA  793
             LARDS++NR  ++S    R +  ++     D  + +    + L+ L      + E   + 
Sbjct  145   LARDSERNRRCLVSVGAGRVLASALASLAADGETPAAALEDVLAALVCMTPLDDEAARIL  204

Query  794   SDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNH  973
             +    +G LV++  + S+  R+N+  +I+ +V+     +L   +   +E+   +  ++  
Sbjct  205   ATPTSLGSLVAIAENGSLAGRLNAVLVIKEIVSCI---QLTGNV--VEELVDALAKVIKA  259

Query  974   PSTHPRALKMGVKALFALCLVKQHRQKAVIAGA-VEALIERLQYLEKCDTERALATVELL  1150
             P   P+A K  + A + L    +           V  L+E L   +K   E+ALA ++ +
Sbjct  260   P-ICPQATKAAMVATYHLASSSERAAAHAAGAGLVPVLVESLVGADKSAAEKALAVLDAV  318

Query  1151  CRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR--------D  1306
                  G  +  AHALTVP+LVK + ++SD ATE A  A+  L   +++++         +
Sbjct  319   LASEEGRTSARAHALTVPVLVKKMFRVSDLATELAVSAMWRLGRGAKESEEGEATKCLVE  378

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             A+  G   +LLLL+Q GC +  K K   LLK+L         V++ DF
Sbjct  379   ALRVGAFQKLLLLLQVGCRDATKEKTTELLKMLNKHKGVGECVDAMDF  426



>ref|XP_003544976.1| PREDICTED: U-box domain-containing protein 21-like [Glycine max]
Length=439

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 137/413 (33%), Positives = 220/413 (53%), Gaps = 28/413 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDF-TLIPN  439
             I IP HFRCP++L++M+DPVTV TG TYDR SIE W+ +GN TCPVT+  LT    +IPN
Sbjct  31    IAIPTHFRCPVTLDMMKDPVTVSTGITYDRDSIEKWIESGNRTCPVTKTELTSLDDMIPN  90

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvss--hlnsrlsalrrl  613
             H +RR+IQ+WCV +R+ G+ERIPTP+ P  P  V    ++  S +     N  +  +R++
Sbjct  91    HAIRRMIQDWCVEHRSHGIERIPTPRIPVTPYEVADTCTRILSAAQHGDENKCVELVRKI  150

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDS-------NSSELTHEALSILSMFQLSE  772
             +   ++S++N+  I AN A  + LS  F++  S       N   L     +++ M  LSE
Sbjct  151   KAWGKESERNKRCIVANGA-ALALSNAFNSFSSRGLLIEKNVVVLDEILGALVWMRPLSE  209

Query  773   AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
              E   V      +  +V  ++   +  R N+A ++       K   + + +   D + + 
Sbjct  210   -EGRSVLGSTSSISCMVWFMNGKQLSTRQNAALVL-------KEMHVEALVKCVD-VVEA  260

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQHR----QKAVIAGAVEALIERLQYLEKCDT  1120
             +V ++  P  +  + K  +  +F L      R    ++ V  G V+A++E L   E+   
Sbjct  261   LVNMIKEPVGNG-STKPCLSTIFNLVSYSSVRGVTCERFVELGLVDAVLEVLVDAERGVC  319

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslc--sssEQ  1294
             E+AL  ++ +C    G     A+ALT+PL++K +L++S+ ++ +A   L  L    + E 
Sbjct  320   EKALGVLDCVCDCKQGVQMAKANALTLPLVIKKLLRVSELSSSFAVSVLWKLFCDKNEEG  379

Query  1295  AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD-DF  1450
                +A+  GV  +LL+L+Q GC E  K KA  LLKLL  C      V+S  DF
Sbjct  380   VLIEALQMGVFHKLLVLLQVGCGEGTKEKATELLKLLNGCRSKAECVDSSLDF  432



>ref|XP_006410763.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
 gb|ESQ52216.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
Length=412

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 136/401 (34%), Positives = 215/401 (54%), Gaps = 21/401 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             IQIP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  ++D  L PN
Sbjct  5     IQIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDISDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+ +++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIKESASSHQNQVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSN----SSELTHEALSILSMFQLSEA--EC  781
                    N+  + A    + L +IV +N   N    S+ LT EALS+L   + SE   + 
Sbjct  125   ENAT---NKRCLEAAGVPEFLATIVSNNDLENGFDSSNSLTDEALSLLYHLETSETVLKN  181

Query  782   VFVAS-DLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
             +F  + + D V  L+ ++     + R  +  L+++++      ++   ++    +F  +V
Sbjct  182   LFNNNKENDIVNSLIKIMERGIYESRAYATLLLKNILEVADPMQI---MTLKPTVFTEVV  238

Query  959   GILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTER  1126
              IL+   +H +A K  +  L  +C   ++R KAV AGA+  +IE L       ++   E 
Sbjct  239   QILDDQISH-KATKAAMHILVNICPWGRNRHKAVEAGAISVIIELLMDDSFSSDRRGPEM  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--  1300
             A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+          
Sbjct  298   AMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATPALL  357

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
              + +  GV+T+L L++Q  C  + K KA+ LLKL    W D
Sbjct  358   NEMLQLGVVTKLCLVLQVSCGSKTKEKAKELLKLHARVWRD  398



>ref|XP_010558593.1| PREDICTED: U-box domain-containing protein 21 [Tarenaya hassleriana]
Length=439

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 204/387 (53%), Gaps = 17/387 (4%)
 Frame = +2

Query  257   GGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPL--TDFT-  427
             G I+IP  FRCPISL+LM+DPVT+ TG TYDR SIESW  +G  +CPVT   L  T+ T 
Sbjct  23    GEIKIPADFRCPISLDLMKDPVTLSTGITYDRNSIESWFESGKDSCPVTNRTLDHTNRTV  82

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrl--sa  601
             LIPNHT+R++IQEWCV +R++G+ERIPTP+ P  P  V  +  +        ++      
Sbjct  83    LIPNHTMRKMIQEWCVDHRSYGIERIPTPRVPLTPREVSEICKKLMEAVVRQDNAKCLEI  142

Query  602   lrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQLS  769
             + +++ L R+S++N+  ++ N    V LS  F    S + E    L  E +S+L+   L 
Sbjct  143   VGKIKNLGRESERNKKCLAQNGVVSV-LSSCFERFSSAARERHMALLEEVISVLAWPLLV  201

Query  770   EAECVF-VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAG-TKSPELRSQISNADEI  943
              +E +  +      +  +V  L+      R N+A L+  VV+  T      + I  A E 
Sbjct  202   RSEGLSKIMGTASSLRCIVHFLNSSDPSARQNAAFLLREVVSSDTSYARTLTDIEGASE-  260

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVK-QHRQKAVIAGAVEALIERLQYLEKCDT  1120
               G+V ++ +P T P + K  +  ++ +     Q   + V  G V ++ E +   EK  +
Sbjct  261   --GLVNLIQNP-TSPNSTKSSLMVIYHMATTNDQTVSRFVQMGLVSSITEMVLNTEKGIS  317

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             ERAL  ++ +C    G  A   + L VPLLVK IL++SD AT  +   L  L    E   
Sbjct  318   ERALVVLDAICNDEQGREAILRNDLIVPLLVKKILRVSDLATMCSISILWKLGKKEESVL  377

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRK  1381
              +A+  G   +LL+++Q GC    + K
Sbjct  378   VEALQVGAFEKLLVVLQVGCEGETREK  404



>ref|XP_010911941.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=415

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 145/403 (36%), Positives = 219/403 (54%), Gaps = 26/403 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             ++IP HF CPISL++MRDPVT+ TG TYDR SIE W+ +G + TCPVT+  L +  LIPN
Sbjct  4     VEIPSHFLCPISLQIMRDPVTLPTGITYDRDSIERWIYSGKHNTCPVTKQSLPECDLIPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N++  +ER PTPK P D       +++    +   + +LS+LR+L+ 
Sbjct  64    HTLRRLIQAWCALNQSDDIERFPTPKPPIDNA----QIAKLIDDAKLPHLQLSSLRKLKE  119

Query  620   lardsDKNRSVISAN-NARQVLLSIVFSNM------------DSNSSELTHEALSILSMF  760
             +  +S++N+  + A       L SIV  N             D  S+    EALSIL + 
Sbjct  120   IVSESERNKLCVEATPGVLDFLASIVKKNSFTPGEEGILIRDDVESTTACDEALSILYLL  179

Query  761   QLSEAEC-VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
             Q+SE     F   + D +  L S+L   +   R  +  L++S++ G  +P   + +   +
Sbjct  180   QISEQRLHDFAIKNEDIIESLTSILQQQNYQSRAYATLLLKSIL-GVIAPAKLAGVR--E  236

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKC  1114
             E+FQ IV +L    +H RA K  ++ L  LC   ++R KA  AGAV  LIE  L   EK 
Sbjct  237   ELFQEIVNVLGDRISH-RADKAALQVLSLLCRWGRNRVKAAHAGAVPVLIELLLDENEKR  295

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E  L  + L+C    G +    HA  + ++ K IL+IS+ A++ A   L S+   S  
Sbjct  296   VCELVLVVLALVCGCAEGRSELVGHAAGIAIVSKKILRISEVASDGAVRILNSVAKFSAT  355

Query  1295  AQ--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             A   ++ +  GV+++L L++Q  C  + K KA+ +L+L    W
Sbjct  356   AAVLQEMLQIGVVSKLCLVLQLDCGMKTKEKAKEILRLHSRVW  398



>ref|XP_010024158.1| PREDICTED: U-box domain-containing protein 25-like [Eucalyptus 
grandis]
Length=163

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +2

Query  260  GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPN  439
            G+QIP+HFRCPISLELMRDPVTV TGQTYDR+SIE W+A  NTTCPVTRAPL D  LIPN
Sbjct  3    GVQIPHHFRCPISLELMRDPVTVSTGQTYDRSSIEPWIAARNTTCPVTRAPLLDSALIPN  62

Query  440  HTLRRLIQEWCVANRAFGVERIPTPKQPADP  532
            HTLRRLIQ WCVANR  GV+RIPTPKQPADP
Sbjct  63   HTLRRLIQSWCVANRRSGVKRIPTPKQPADP  93



>emb|CAK18856.1| putative fungal elicitor protein CMPG1 [Phillyrea latifolia]
Length=88

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 2/90 (2%)
 Frame = +2

Query  227  MPASLDPLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTR  406
            MP SL+PLDVG +QIPYHFRCPISLEL RDPVTVCTGQTYDR SIESWVA GNTTCPVTR
Sbjct  1    MPGSLEPLDVG-VQIPYHFRCPISLEL-RDPVTVCTGQTYDRTSIESWVACGNTTCPVTR  58

Query  407  APLTDFTLIPNHTLRRLIQEWCVANRAFGV  496
            + LTDFTLIPNHTLR+LIQ+WCVANR+FGV
Sbjct  59   STLTDFTLIPNHTLRQLIQDWCVANRSFGV  88



>ref|XP_006469284.1| PREDICTED: U-box domain-containing protein 21-like [Citrus sinensis]
 gb|KDO60832.1| hypothetical protein CISIN_1g038250mg [Citrus sinensis]
Length=444

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 132/390 (34%), Positives = 202/390 (52%), Gaps = 13/390 (3%)
 Frame = +2

Query  272   PYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPNHTL  448
             P HFRCPISL+LM+DPVT+ TG TYDR +IE W+   GN TCPVT   LT F  IPNHT+
Sbjct  34    PNHFRCPISLDLMKDPVTLSTGITYDRENIEKWIHEDGNITCPVTNRVLTSFEPIPNHTI  93

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             RR+IQ+WCV NR++G+ERIPTP+ P     V  +    ++     +       + +++  
Sbjct  94    RRMIQDWCVENRSYGIERIPTPRIPVSSVEVFEINCNITTACKSEDQAGCRDLVAKIKKW  153

Query  623   ardsDKNRSVISANNARQVLLSI--VFSN--MDSNSSELTHEALSILSMFQLSEAECVFV  790
              ++SD+N+  I  N A  VL      FS   +D N S L  E LS L++      E +  
Sbjct  154   TKESDRNKRCIVDNGAVSVLAEAFETFSKTCLDENVSVL-EEILSTLTLLFPLAGEGLTY  212

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGT-KSPELRSQISNADEIFQGIVGIL  967
                   +  +V  L    +  R N+  ++  +V+   +   +   I  A E    ++   
Sbjct  213   LGSASSMRCMVWFLKSGDLSRRRNAVLVLREIVSSDHRKVNVLLDIEGAIEPLFKLIKEP  272

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATVEL  1147
               P+    +L +  + + +    ++  QK V  G V  L+E L   ++   E+AL+ ++ 
Sbjct  273   ICPTATKASLVVVYRTITSASATEKPIQKFVDMGLVSLLLEMLVDAQRSLCEKALSVLDG  332

Query  1148  LCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRDAVA----  1315
             LC    G      ++L  P++VK IL++SD ATE+A   L  LC + E+ ++ A A    
Sbjct  333   LCSSDYGRGDAYNNSLIFPVIVKKILRVSDLATEFAVSILWKLCKNEEREEKTAFAEALQ  392

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
              G   +LLLL+Q GC ++ K     LLKLL
Sbjct  393   VGAFQKLLLLLQVGCADKTKEHVSELLKLL  422



>ref|XP_008244313.1| PREDICTED: U-box domain-containing protein 21-like [Prunus mume]
Length=448

 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 133/399 (33%), Positives = 200/399 (50%), Gaps = 17/399 (4%)
 Frame = +2

Query  248   LDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFT  427
             +++  I +P HFRCPISL+LM+DPVT+ TG TYDR+SIE W+ TGN TCP T   L  F 
Sbjct  29    MEMEEIAVPTHFRCPISLDLMKDPVTLSTGMTYDRSSIEKWIETGNRTCPATNQELKSFD  88

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
              IPNH LRR+IQ+WCV N+++G+ERIPTP+ P     V  +  +  + +   + R     
Sbjct  89    QIPNHALRRMIQDWCVENQSYGIERIPTPRIPVTKYEVSRICERIEAAARRGDGRKCGEL  148

Query  608   rlrglardsDKNRS-VISANNARQVLLSIVFSNMDSNSSELTHEA-LSILS----MFQLS  769
               +  A   +  R+      N     LS VF +  S S E   E  L ILS    MF +S
Sbjct  149   VGKIKAWAKESERNKKCMVENGLGCCLSAVFDSFASISMEDHVEILLDILSVLPWMFPVS  208

Query  770   EAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQ  949
             E   + + S      +L S L    +  R N+  ++  +++  +          ++   +
Sbjct  209   EEGQLKLGSAGSLRCFL-SFLEGKDLSARQNAVLVLRKLLSLDQKH--VDDFVESEGAIE  265

Query  950   GIVGILNHPSTHPRALKMGVKALFAL-----CLVKQHRQKAVIAGAVEALIERLQYLEKC  1114
              +VGI+  P   P A +  + ++  +         + R + V  G V  L+E +   E+ 
Sbjct  266   ALVGIIREP-ISPAATRAALTSVLFMISSPSAASDEIRSRFVELGLVSLLLEIIVDAERR  324

Query  1115  DTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl--csss  1288
               ERAL  +E LC    G      + LT+PLLVK IL+IS+  TE++   +  L    + 
Sbjct  325   LCERALGVLEGLCDCKQGKDKALENPLTIPLLVKKILRISELVTEFSIAIIWKLCRIETE  384

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             E    +A+  G   +LL+L+Q GC +  K K   LLKL 
Sbjct  385   ESILIEALQVGAFQKLLVLLQVGCGDGIKEKVTDLLKLF  423



>gb|KDO46582.1| hypothetical protein CISIN_1g040073mg [Citrus sinensis]
Length=407

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 145/401 (36%), Positives = 216/401 (54%), Gaps = 18/401 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVAT-GNTTCPVTRAPL--TDFT-L  430
             I++P HF CPISL+LMRDPVTV TG TYDR +IE W+ T  N TCPVT+  L  TD T  
Sbjct  4     IEVPAHFLCPISLQLMRDPVTVSTGITYDRVNIERWLFTCKNNTCPVTKQVLQETDLTST  63

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrr  610
              PNHTLRRLIQ WC  N   G+ERIPTP+ P D      ++   +      ++    LRR
Sbjct  64    TPNHTLRRLIQAWCTINACHGIERIPTPQPPVDK---TQIVKILNDAKKSPSTGRKCLRR  120

Query  611   lrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEA--ECV  784
             LR +   S++NRS + A  A + L +I+ +  D+ S E   EALSIL    +SE+  + +
Sbjct  121   LRSITLQSERNRSCLEAAGAIEFLATII-TKSDAGSDE-CDEALSILYHLNVSESYLKSI  178

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              + +  + +  L+ +L   +   R  +  L++S+       +L   IS   E F  IV +
Sbjct  179   VINNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFEVADPFQL---ISVKQEFFTEIVNV  235

Query  965   L-NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL-QYLEKCDTERALAT  1138
             L +H     +A K  +K L  LC   ++R KAV  G V  L++ L    E+   E  L  
Sbjct  236   LRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELMLNV  295

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLCR   G A    H   + ++ K IL++S  A++ A   L S+C  S  A+  ++ +
Sbjct  296   LDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQEML  355

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
               GV+++L L++Q   + + K +A+ +LKL    W D   V
Sbjct  356   QVGVVSKLCLVLQVDASVKTKERAREILKLNARAWRDSPCV  396



>ref|XP_010911942.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=415

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 143/414 (35%), Positives = 218/414 (53%), Gaps = 32/414 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             ++IP +F CPISL++MRDPV + TG TYDR SIE W+ +G + TCPVT+  L +  L PN
Sbjct  4     VEIPSYFLCPISLQIMRDPVILPTGITYDRDSIERWIFSGKHNTCPVTKQSLPECDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N + G+ER PTPK P D       +++    +   + +LS+LR+L+ 
Sbjct  64    HTLRRLIQAWCALNPSDGIERFPTPKPPIDNA----QIAKLIDDAKLPHLQLSSLRKLKE  119

Query  620   lardsDKNRSVISAN-NARQVLLSIVFSNM------------DSNSSELTHEALSILSMF  760
             +  +S++N+  + A       L SIV  N             D  S+    EALSIL + 
Sbjct  120   IVSESERNKRCVEATPGVLDFLASIVKKNSFTPGEEGILIRDDVESTTACDEALSILYLL  179

Query  761   QLSEAEC-VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIES---VVAGTKSPELRSQIS  928
             Q+SE     F   + D +  L S+L   +   R  +  L++S   V+A  K   +R    
Sbjct  180   QISEQRLHDFAIKNEDIIESLTSILQQQNYQSRAYATLLLKSILGVIAHAKLAGVR----  235

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYL  1105
               +E+FQ IV +L    +H RA K  ++ L  LC   ++R KA  AGAV  LIE  L   
Sbjct  236   --EELFQEIVNVLRDRISH-RADKAALQVLSLLCRWGRNRVKAAHAGAVPVLIELLLDEN  292

Query  1106  EKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATE--Yaagallslc  1279
             EK   E AL  +  +C    G +    HA  + ++ K IL+IS+ A+E        ++  
Sbjct  293   EKRVCELALVVLAWVCGCAEGRSELVGHAAGIAIVSKKILRISEVASEGAVRILNSVAKF  352

Query  1280  sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNS  1441
             S++    ++ +  GV+++L L++Q  C  + K KA+ +L+L    W     ++S
Sbjct  353   SATTAVLQEMLQIGVVSKLCLVLQVDCGMKTKEKAREILRLHSRVWKKSPCLSS  406



>ref|XP_010912561.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Elaeis guineensis]
Length=419

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 139/409 (34%), Positives = 214/409 (52%), Gaps = 33/409 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             +++P +F CPISLE+MRDPVT+ TG TYDR SIE W+ +  + TCP T+ PL D  L PN
Sbjct  4     VEVPSYFLCPISLEIMRDPVTLATGITYDRESIERWIFSEKHETCPATKQPLPDLELTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC AN + G+ER PTP+ P D       ++     +    S++++LR+L+ 
Sbjct  64    HTLRRLIQAWCTANASHGIERFPTPRPPVDKA----QIAALLDEAKLPRSQMNSLRKLKA  119

Query  620   lardsDKN-RSVISANNARQVLLSI----------------VFSNMDSNSSELTHEALSI  748
             +  +SD+N R VI A  A   L S+                VF +  + S+  T EALSI
Sbjct  120   IISESDRNKRCVIEAAGAVDFLASLIKESRSNEREQEQEQHVFDD-GTGSTTATDEALSI  178

Query  749   LSMFQLSEAECV-FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
             L   Q+SE   +  +  +   +  L ++L   +   R ++  L++S+V       L+   
Sbjct  179   LYSLQISEQSLLHLIERNNGFIESLTTVLRRSNYQSRAHAMLLMKSLVLVMAPARLKKGF  238

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYL  1105
                 E+F+ +V +L    ++ +A K  ++ L  L    ++R KAV  GAV  +IE L  L
Sbjct  239   GK--ELFEEVVKVLRDQISY-QATKAALRVLRELSPWGRNRVKAVEGGAVGVVIE-LLLL  294

Query  1106  EKCDT---ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl  1276
              K +T   E  +  +E LCR   G A    HA  + ++ K +L++S  A E     L S+
Sbjct  295   GKRETRECEMMVVVLEQLCRCAEGRAEMVGHAAGIAVVSKKLLRVSRVANERVVRILHSV  354

Query  1277  csssEQ--AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                S      ++    G + +L +L+Q  C E+AK KA+ +L+L    W
Sbjct  355   ARYSPTPAVLQEMKQVGAVGKLCMLLQMDCGEKAKEKAKEILRLHSKVW  403



>ref|XP_008350837.1| PREDICTED: U-box domain-containing protein 21-like [Malus domestica]
Length=443

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 219/416 (53%), Gaps = 20/416 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISLELM+DPVT+ TG TYDR SIE+W+  GN  CP+T   LT F  IPNH
Sbjct  25    LTIPNHFRCPISLELMKDPVTLSTGITYDRQSIETWIEAGNFKCPITNQVLTSFDPIPNH  84

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
             T+R++IQ WCV  ++FG+ERIPTP+ P     V  +LS+ ++ S H N       + ++ 
Sbjct  85    TIRKMIQGWCVEKKSFGIERIPTPRIPISSVQVTEILSKITTSSHHQNKDDCQVLVAKIN  144

Query  617   glardsDKNRSVISANNARQVL---LSIVFSNMDSNSSELTHEALSILSM-FQLSEAECV  784
              LA++S++N+  I A+    VL    +   S+    +  +  E LS L++ F L +   +
Sbjct  145   ALAKESERNKRCIVASGTGSVLAGAFNAFSSSQHHQNVAVLEEILSALTLVFPLDKEANL  204

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVN-SAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             ++ S    +  +V  L    +  R N S  L E+ V+     +    ++  +   + +V 
Sbjct  205   YLGSPAS-LCCMVWFLESGDLSQRRNASLVLKETAVSSDHDHQKTDALAEIEGALEALVK  263

Query  962   ILNHPSTHPRALKMGVKALFALC-------LVKQHRQKAVIAGAVEALIERLQYLEKCDT  1120
             ++  P   P + K  +  ++ +          +Q +++ V  G V  L + L   E+   
Sbjct  264   LIKEPVC-PTSTKASLVIMYRMVNSSSSSPSKEQIKERFVEMGLVSLLSDILVDAERSIC  322

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             E+AL  ++ LC    G      HALT+P++VK IL++SD ATE++   L  LC +  +  
Sbjct  323   EKALGVLDGLCGSKQGREKAYLHALTMPVVVKKILRVSDLATEFSVSILWKLCKNETRED  382

Query  1301  R----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFAR  1456
                  +A+  G   +LLLL+Q GC ER K KA  LL+ L         ++S DF +
Sbjct  383   GGVLVEALQVGAFQKLLLLLQVGCAERTKDKATDLLRALNIHRERLECIDSMDFKQ  438



>ref|XP_007015662.1| U-box domain-containing protein 23 [Theobroma cacao]
 gb|EOY33281.1| U-box domain-containing protein 23 [Theobroma cacao]
Length=413

 Score =   175 bits (443),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 147/413 (36%), Positives = 223/413 (54%), Gaps = 24/413 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I+IP HF CPISL+LMRDPVT+ TG TYDR SIE W+ +  N TCPV++  L D  L PN
Sbjct  4     IEIPPHFLCPISLQLMRDPVTISTGITYDRDSIEKWLFSCKNNTCPVSKQALHDSDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC+ N + G+ERIPTPK   D      +             +L  L+RLR 
Sbjct  64    HTLRRLIQAWCILNASHGIERIPTPKPLVDK---TQISKLLKDAKKFPEMQLKCLKRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFSN------MDSN-SSEL---THEALSILSMFQLS  769
             +  + ++NRS + A  A Q L+S++ SN      ++SN  SEL   + EALSIL   ++S
Sbjct  121   ITLEGERNRSYLEAAGAVQFLVSMIKSNDSTLLEVESNEGSELLKASDEALSILYHIKVS  180

Query  770   EAECV--FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             ++ C+   +++D + V  LV ++ + +   R  +  L++ V       +L   +S     
Sbjct  181   QS-CLKSIISNDQEFVESLVQVMKYGNYQSRAYATMLLKDVFEVADPIQL---MSATPVF  236

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDT  1120
             F  +V  L    +  +A K  +K L  LC   ++R KAV  GAV  LIE  L+  EK   
Sbjct  237   FAEMVRTLRDQISQ-QASKASLKLLVELCPWGRNRIKAVEGGAVFVLIEFLLKTSEKRAC  295

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             E AL  ++ LC    G A    H   + ++ K I ++S  A++ A   L S+C  S  + 
Sbjct  296   ELALILLDQLCACAEGRAELLKHGAGLAIVSKKIFRVSHVASDRAVRILSSICRCSATSW  355

Query  1301  --RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
               ++ +  GV+++L L++Q   + + K +A+ +LKL    W + S + S  F+
Sbjct  356   VLQEMLQVGVVSKLCLVLQLDSSYKTKERAREILKLHSRVWRNPSCIPSHLFS  408



>emb|CAN66286.1| hypothetical protein VITISV_011184 [Vitis vinifera]
Length=397

 Score =   174 bits (442),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 142/389 (37%), Positives = 217/389 (56%), Gaps = 15/389 (4%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP+ FRCPISL+L  DPVT+ TGQTYDR+SIE W+A GN TCPVT   L D +++PNHTL
Sbjct  3     IPHLFRCPISLDLFTDPVTLSTGQTYDRSSIEQWLAAGNLTCPVTMQKLHDPSMVPNHTL  62

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             R LI +W    +    E + T   P  P L     S  S  SS  N   +          
Sbjct  63    RHLIDQWLQTGQQVDPESL-TVMGPG-PSLAAMKCSLQSQESSLENKLETLKAIRVSSDE  120

Query  629   dsDKNRSVISANNARQVLLSIVFSNMDS----NSSELTHEALSI-LSMFQLSEAECVFVA  793
              S +N  +I       +L  +VF  +++    +S +L  EALS  L +   SE  C+ + 
Sbjct  121   LSSRNSYMIQLGFLPLLL-ELVFGQVEAEQYRDSLKLVEEALSCALKLLAFSELGCLNML  179

Query  794   SDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNH  973
              +  ++  LV L  H +  ++ +   L+E++ + +++ EL + +    ++ QGIV +++H
Sbjct  180   KEESKLESLVVLFKHGTPMIKTSVCNLLEAISSSSETKELCATLGTTHQLLQGIVLLVHH  239

Query  974   PSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL---QYLEKCDTERALATVE  1144
                   A   G+KA+ ALC V+ +++  +  GAV+ LI  +   Q  EK     A+A +E
Sbjct  240   DCEASEA---GIKAMLALCSVESNKENLIREGAVDGLISYISNAQVKEKSAAPLAIAVLE  296

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISD-RATEYaagallslcsssEQAQRDAVAAG  1321
             +L  + SG  A   +   V  LVK+  K+SD + +E A  +L+ LC+ S +A+ +A++AG
Sbjct  297   VLLGVESGREAVLNNPNGVKALVKMTFKVSDHQGSENAVSSLMVLCTDSLRAREEAISAG  356

Query  1322  VLTQLLLLVQSGCTERAKRKAQMLLKLLR  1408
             VL+QLL L+QS C+   K KA+MLLKLLR
Sbjct  357   VLSQLLFLLQSQCSGTIKTKARMLLKLLR  385



>ref|XP_002262704.2| PREDICTED: U-box domain-containing protein 26-like [Vitis vinifera]
Length=399

 Score =   174 bits (442),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 142/389 (37%), Positives = 217/389 (56%), Gaps = 15/389 (4%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP+ FRCPISL+L  DPVT+ TGQTYDR+SIE W+A GN TCPVT   L D +++PNHTL
Sbjct  8     IPHLFRCPISLDLFTDPVTLSTGQTYDRSSIEQWLAAGNLTCPVTMQKLHDPSMVPNHTL  67

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             R LI +W    +    E + T   P  P L     S  S  SS  N   +          
Sbjct  68    RHLIDQWLQTGQQVDPESL-TVMGPG-PSLAAMKCSLQSQESSLENKLETLKAIRVSSDE  125

Query  629   dsDKNRSVISANNARQVLLSIVFSNMDS----NSSELTHEALSI-LSMFQLSEAECVFVA  793
              S +N  +I       +L  +VF  +++    +S +L  EALS  L +   SE  C+ + 
Sbjct  126   LSSRNSYMIQLGFLPLLL-ELVFGQVEAEQYRDSLKLVEEALSCALKLLAFSELGCLNML  184

Query  794   SDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNH  973
              +  ++  LV L  H +  ++ +   L+E++ + +++ EL + +    ++ QGIV +++H
Sbjct  185   KEESKLESLVVLFKHGTPMIKTSVCNLLEAISSSSETKELCATLGTTHQLLQGIVLLVHH  244

Query  974   PSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL---QYLEKCDTERALATVE  1144
                   A   G+KA+ ALC V+ +++  +  GAV+ LI  +   Q  EK     A+A +E
Sbjct  245   DCEASEA---GIKAMLALCSVESNKENLIREGAVDGLISYISNAQVKEKSAAPLAIAVLE  301

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISD-RATEYaagallslcsssEQAQRDAVAAG  1321
             +L  + SG  A   +   V  LVK+  K+SD + +E A  +L+ LC+ S +A+ +A++AG
Sbjct  302   VLLGVESGREAVLNNPNGVKALVKMTFKVSDHQGSENAVSSLMVLCTDSLRAREEAISAG  361

Query  1322  VLTQLLLLVQSGCTERAKRKAQMLLKLLR  1408
             VL+QLL L+QS C+   K KA+MLLKLLR
Sbjct  362   VLSQLLFLLQSQCSGTIKTKARMLLKLLR  390



>gb|AEF30545.1| CMPG [Dasypyrum villosum]
Length=454

 Score =   175 bits (444),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 141/406 (35%), Positives = 204/406 (50%), Gaps = 17/406 (4%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P HF CPISL++MRDPVT  TG TYDR S+E W+  G+ TCPVT  PL    L+PNH  
Sbjct  47    VPTHFLCPISLDMMRDPVTAPTGITYDRESVEGWLERGHATCPVTGRPLRLEELVPNHAT  106

Query  449   RRLIQEWCVANRAFGVERIPTPKQPA---DPGlvqsllsqassvsshlnsrlsalrrlrg  619
             RR+IQEWCVANR  GVER+PTP+ P    D   + + +S A+        R    R    
Sbjct  107   RRVIQEWCVANRGLGVERVPTPRVPISAFDASELLAAVSAAARRGDGPRCRELVARARAL  166

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNS---SELTHEALSILSMF-QLSEAECVF  787
                     R  +SA+ AR   LS VF ++       +    E L+ L +F  L E     
Sbjct  167   GKESERNRRCFVSASAART--LSSVFCHLAGQRVVPATALEEILAALVVFLPLDEESRRH  224

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +AS    +  +VS+LSH     RV SA ++   +A +   +    +S    I+  +V +L
Sbjct  225   IASPAS-LESVVSILSHSEPLARV-SAVVVLREIASSSDRQCLEAMSKTTGIYAALVKLL  282

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVI-AGAVEALIERLQYLEKCDTERALATVE  1144
               P + P+A K  +   + L +  +     ++  GAV  L+E L   +K  TE+ALA ++
Sbjct  283   EKPVS-PQATKAALVTAYYLVMHTELAASPLVDLGAVRLLLELLVDADKGTTEKALAVLD  341

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagal----lslcsssEQAQRDAV  1312
              L     G     A AL VP++VK +  +SD ATE+A  AL     +  +       +A+
Sbjct  342   SLLLTCKGRDEAYAQALAVPVIVKQMQHVSDMATEFAVSALWRLCKNFAADGGGCTAEAL  401

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
               G   +LLLL+Q GC    K +A  LL++L         ++S DF
Sbjct  402   QVGAFQKLLLLLQVGCEGVTKERASELLRILNGSRDGAECIDSLDF  447



>ref|XP_008230336.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Prunus mume]
Length=408

 Score =   174 bits (441),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 140/399 (35%), Positives = 207/399 (52%), Gaps = 15/399 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFT-LIP  436
             + IP HF CPISLE+MRDPVT+ TG TYDR SIE W+  G N  CP+T+ PL D T L P
Sbjct  4     VDIPSHFLCPISLEIMRDPVTISTGITYDRESIERWLFAGKNKACPITKQPLFDGTDLTP  63

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRR+IQ WC  N + GVERIPTPK P +    Q +     +      +     R   
Sbjct  64    NHTLRRIIQAWCTLNASHGVERIPTPKSPLEKS--QIVKLIEQAKKLPNTNLHCLRRLRS  121

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECV-FVA  793
                  S++N+S + A  A + + SI+ +   S+   +   A+ +L + + SEA     ++
Sbjct  122   IAITQSERNKSCLEAAGAVEYVASII-NKAPSDDPSIIEVAVEVLFLLKGSEAGLKDLIS  180

Query  794   SDLDR--VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +D D   V  LV  L   +   R ++  L++SV       +L   +S   E F  IV +L
Sbjct  181   NDGDNNIVESLVKALKFKNFQSRAHAIILLKSVFKVADPIQL---MSVKVECFHEIVHVL  237

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIER-LQYLEKCDTERALATVE  1144
             +   +  +A K  +K L  LC   ++R KAV  GAV  LIE  L+  EK  +E  L  ++
Sbjct  238   DDRISQ-QASKAALKLLVELCPWGRNRIKAVEGGAVAVLIEALLETHEKRASELILILLD  296

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVAA  1318
              LC    G A    H   + ++ K IL++S  A++ A   L S+C  S      ++ +  
Sbjct  297   QLCGCAEGRAELLKHGAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCGVLQEMLQV  356

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
             GV+ +L L++Q  C  + K KA+ +LKL    W + S +
Sbjct  357   GVVAKLCLVLQVDCRFKTKEKAREVLKLHSRVWKNSSCI  395



>ref|XP_007207682.1| hypothetical protein PRUPE_ppa023672mg [Prunus persica]
 gb|EMJ08881.1| hypothetical protein PRUPE_ppa023672mg [Prunus persica]
Length=408

 Score =   174 bits (441),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 141/399 (35%), Positives = 208/399 (52%), Gaps = 15/399 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFT-LIP  436
             + IP HF CPISLE+MRDPVT+ TG TYDR SIE W+ +G N  CPVT+ PL D T L P
Sbjct  4     VDIPSHFLCPISLEIMRDPVTISTGITYDRESIERWLFSGKNKACPVTKQPLFDGTDLTP  63

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRR+IQ WC  N + GVERIPTPK P D    Q +     +      +     R   
Sbjct  64    NHTLRRIIQAWCTLNASQGVERIPTPKSPLDKS--QIVKLIEQAKKLPNTNLHCLRRLRS  121

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECV-FVA  793
                  S++ +S + A  A + + SI+ +   S+   +   A+ +L + + SEA     ++
Sbjct  122   IAITQSERTKSCLEAAGAVEYVASII-NKAPSDDPSIIEVAVEVLFLLKGSEAGLKDLIS  180

Query  794   SDLDR--VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +D D   V  LV  L   +   R ++  L++SV       +L   +S   E F  I+ +L
Sbjct  181   NDGDNNIVESLVKALKFKNFQSRAHAIILLKSVFKVADPIQL---MSAKVECFHEILHVL  237

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIER-LQYLEKCDTERALATVE  1144
             +   +  +A K  +K L  LC   ++R KAV  GAV  LIE  L+  EK  +E  L  ++
Sbjct  238   DDRISQ-QASKAALKLLVELCPWGRNRIKAVEGGAVAVLIEALLETHEKRASELILILLD  296

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVAA  1318
              LC    G A    HA  + ++ K IL++S  A++ A   L S+C  S      ++ +  
Sbjct  297   QLCGCAEGRAELLKHAAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCGVLQEMLQV  356

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
             GV+ +L L++Q  C  + K KA+ +LKL    W + S +
Sbjct  357   GVVAKLCLVLQVDCRFKTKEKAREVLKLHSRVWKNSSCI  395



>ref|XP_008449598.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis melo]
Length=414

 Score =   174 bits (441),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 134/400 (34%), Positives = 216/400 (54%), Gaps = 14/400 (4%)
 Frame = +2

Query  257   GGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDF--T  427
             GGI++P +F CPISL+LMRDPVT+ TG TYDR+SIE W+ + N T CP+T+ PL+     
Sbjct  11    GGIEVPSYFLCPISLQLMRDPVTISTGITYDRSSIEKWLFSFNKTVCPITKQPLSSDPDL  70

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
             L PNHTLRRLIQ WC  N + G+ERIPTPK P D      +        +  NS    L 
Sbjct  71    LTPNHTLRRLIQSWCTLNASNGIERIPTPKSPIDK---THIAKILKQAQNFPNSNHKCLL  127

Query  608   rlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECV-  784
              L+ +A ++++NR++++ ++     L++V  +  SN+      A+ IL   + S+A    
Sbjct  128   ALKAIALENERNRNLVAQSDGAFDFLAMVIKSGGSNNIASIELAVEILFHIKSSQAHLKN  187

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              V  D+D +  L  +L + +   R  +  L++S +       L   +S   E+ +  V +
Sbjct  188   LVNGDVDFINSLTFVLQNGNCQSRAYAVMLLKSSLELADPIRL---MSIERELLRETVRV  244

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDTERALATV  1141
             ++   +H +A K  +K L  +C   ++R KAV  GAV  L+E  L   E+  +E  L  +
Sbjct  245   IHDHISH-QASKSALKVLAEVCPWGRNRVKAVEGGAVGVLVELLLNSTERRWSELGLVVL  303

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVA  1315
             + LC    G      HA  + ++ K IL++S  A++ A   L S+C  S  A+  ++ + 
Sbjct  304   DQLCGCAEGREKLVEHAAGLAVVSKKILRVSAMASDRAVRILSSICRFSASAKVLQEMLE  363

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
              GV+ +L L++Q  C+ + + KA+  LKL    W + S +
Sbjct  364   VGVVAKLCLVLQMDCSLKTREKARDTLKLHSRVWSNSSCI  403



>ref|XP_002862799.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39057.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 109/254 (43%), Positives = 146/254 (57%), Gaps = 43/254 (17%)
 Frame = +2

Query  335   GQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTP  514
             GQTYDR +I+SW+  GN  CP TR  L+D TLIPNHTL RLIQEWCV NR+  VERIPTP
Sbjct  9     GQTYDRTNIDSWIGKGNPPCPFTRVALSDLTLIPNHTLGRLIQEWCVDNRSNSVERIPTP  68

Query  515   KQPADPGlvqsllsqassvsshlnsrlsalrrl--rglardsDKNRSVISANNARQVLLS  688
             KQPADP  V+SLLSQAS++S    S  S    +         +KNR +I+ +NAR++L  
Sbjct  69    KQPADPISVRSLLSQASAISGTHASVRSRAAAICRLRELARDEKNRVLIAGHNAREIL--  126

Query  689   IVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSA  868
                              + IL +  ++E EC                      +  VN A
Sbjct  127   -----------------VRILVLLHMTETEC----------------------EALVNGA  147

Query  869   ALIESVVAGTKSPELRSQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHR  1048
             ALIE V+ G+K  +L+  IS +D IF+G++ +L    +  RAL++G+KA+FALCLVKQ +
Sbjct  148   ALIEMVLTGSKLMDLKLIISGSDSIFEGVLDLLKILISSRRALQIGIKAIFALCLVKQKK  207

Query  1049  QKAVIAGAVEALIE  1090
               A+  GA   LI+
Sbjct  208   HLAISTGAPGILID  221



>ref|XP_008381777.1| PREDICTED: U-box domain-containing protein 21-like [Malus domestica]
Length=442

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 142/414 (34%), Positives = 221/414 (53%), Gaps = 17/414 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LM+DPVT+ TG TYDR SIE+W+   N TCP+T   LT F LIPNH
Sbjct  25    LTIPNHFRCPISLDLMKDPVTLSTGITYDRHSIETWIEAENFTCPITNQVLTSFDLIPNH  84

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
             T+R++IQ+WCV  ++FG+ERIPTP+ P     V  +LS+ S+ S H N       + +++
Sbjct  85    TIRKMIQDWCVEKKSFGIERIPTPRIPISSVQVAEILSKISTSSHHQNKDDCQVLVTKIK  144

Query  617   glardsDKNRSVISANNARQVL---LSIVFSNMDSNSSELTHEALSILSM-FQLSEAECV  784
              LA++S++N+  I A     VL    S + ++    +  +  E LS L++ F L     +
Sbjct  145   ALAKESERNKRCIVATGTGSVLAGAFSALSNSQHHQNVAVLEEILSALTLVFPLDGEASL  204

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSA-ALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             ++ S    +  +V  L    +  R N+A  L E+ V+     +    ++  +   + +V 
Sbjct  205   YLGSPAS-LRCMVWFLESGDLSQRRNAALVLKETAVSSDHDHQKTDALAEIEGALEALVK  263

Query  962   ILNHP--STHPRALKMGVKALF--ALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDTER  1126
             ++  P  +T  +A  + +  +   +  L K+  +++ V    V  L + L   E+   ER
Sbjct  264   LIKEPVCATSTKASLVIIYQMVNSSSSLSKEKIKERFVEMELVSLLSDFLVDAERSICER  323

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD  1306
             AL  ++ LC    G      HALT+P++VK IL++SD ATE++   L  LC +  +    
Sbjct  324   ALGVLDRLCGSKQGREKAYLHALTMPVVVKKILRVSDLATEFSVSILWKLCKNETREDGG  383

Query  1307  AVA----AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFAR  1456
              V      G   +LLLL+Q GC ER K KA  LLK L         ++S DF +
Sbjct  384   VVVESLQVGAFQKLLLLLQVGCAERTKEKATDLLKALNIHRERLECIDSMDFKQ  437



>ref|XP_006387887.1| hypothetical protein POPTR_0497s00200g [Populus trichocarpa]
 gb|ERP46801.1| hypothetical protein POPTR_0497s00200g [Populus trichocarpa]
Length=415

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 144/408 (35%), Positives = 218/408 (53%), Gaps = 24/408 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I +PYHF CPISL+LMRDPVT+ TG TYDR +IE W+ +  N TCPVT+  L    L PN
Sbjct  4     IDVPYHFLCPISLQLMRDPVTISTGITYDRENIERWLFSCKNNTCPVTKQELFGKDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N +FG+ERIPTPK P +      +    +      + +L +LRRLR 
Sbjct  64    HTLRRLIQAWCTLNASFGIERIPTPKPPIERA---QIAKLLNDAKKFPHLQLKSLRRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFSN--------MDSNSSELTH---EALSILSMFQL  766
             +  +S++NR  +    A   L +I+ +          D N SE +    EAL+IL   ++
Sbjct  121   ITLESERNRICLEEAGAVDFLATILKNGDSTSVDIASDDNESEFSRASDEALNILYHLKI  180

Query  767   SEAECV-FVASDLDR-VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             S+ +    + +D D+ +  L+ +L H S   R  +  L++SV        L   IS   E
Sbjct  181   SQRKLKNLITNDGDQFLESLLQILKHSSYQSRAYATMLLKSVFEVADPMHL---ISIRPE  237

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCD  1117
             +F  +V +LN   +   + K  +K L  +C   ++R KAV   AV  LIE  L   EK  
Sbjct  238   MFVELVRVLNDQISQQSS-KAALKLLVEVCPWGRNRIKAVEGSAVSVLIELLLDKSEKRA  296

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E  LA ++LLC    G A    H   + ++ K IL++S  A++ A   L S+C  S  +
Sbjct  297   CELVLAVLDLLCGCAEGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILYSICRFSATS  356

Query  1298  Q--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
             +  ++ +  GV+ +L L++Q   + ++K +A+ +LKL    W + + V
Sbjct  357   RVLQEMLQVGVVAKLCLVLQVDSSFKSKERAREILKLHSRVWRNSACV  404



>ref|XP_006424086.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
 gb|ESR37326.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
Length=407

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 144/401 (36%), Positives = 215/401 (54%), Gaps = 18/401 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPL--TDFT-L  430
             I++P HF CPISL+LMRDPVTV TG TYDR +IE W+    N TCPVT+  L  TD T  
Sbjct  4     IEVPAHFLCPISLQLMRDPVTVSTGITYDRVNIERWLFLCKNNTCPVTKQVLQETDLTST  63

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrr  610
              PNHTLRRLIQ WC  N   G+ERIPTP+ P D      ++   +      ++    LRR
Sbjct  64    TPNHTLRRLIQAWCTINACHGIERIPTPQPPVDK---TQIVKILNDAKKSPSTGRKCLRR  120

Query  611   lrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEA--ECV  784
             LR +   S++NRS + A  A + L +I+ +  D+ S E   EALSIL    +SE+  + +
Sbjct  121   LRSITLQSERNRSCLEAAGAIEFLATII-TKSDAGSDE-CDEALSILYHLNISESYLKSI  178

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              + +  + +  L+ +L   +   R  +  L++S+       +L   IS   E F  IV +
Sbjct  179   VINNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFEVADPFQL---ISVKQEFFTEIVNV  235

Query  965   L-NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL-QYLEKCDTERALAT  1138
             L +H     +A K  +K L  LC   ++R KAV  G V  L++ L    E+   E  L  
Sbjct  236   LRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELMLNV  295

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLCR   G A    H   + ++ K IL++S  A++ A   L S+C  S  A+  ++ +
Sbjct  296   LDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQEML  355

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
               GV+++L L++Q   + + K +A+ +LKL    W D   V
Sbjct  356   QVGVVSKLCLVLQVDASVKTKERAREILKLNARAWRDSPCV  396



>ref|XP_002513723.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF48670.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=414

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 152/413 (37%), Positives = 224/413 (54%), Gaps = 34/413 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTR-APLTDFTLIP  436
             I IP HF CPISL+LMRDPVTV TG TYDR +IE W+ A  N TCPVT+   L D  L P
Sbjct  3     IDIPCHFLCPISLQLMRDPVTVSTGITYDRENIERWLFACKNNTCPVTKQVILNDEDLTP  62

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC  N + G+ERIPTPK P D      +    +  ++  + +L  LRR+R
Sbjct  63    NHTLRRLIQAWCTLNASHGIERIPTPKPPID---KTQIAELLNDCNTFPHLQLKYLRRIR  119

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSEL-----------THEALSILSMFQ  763
              +  +S++NRS + A  A  +L SIV  N +S S E+           + EALSIL + +
Sbjct  120   SITLESERNRSFLEAAGAVDILASIVV-NDNSTSVEISIDDDPEFTRASDEALSILYLLK  178

Query  764   LSEAECV-FVASDLD-RVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD  937
             +S+++    +A D    V  L+ +L H +   R  S  L++S+       +L   I+   
Sbjct  179   ISDSKLKNLIAKDRGVFVESLIQILKHSNYQSRAYSTMLLKSIFEVADPIQL---ITIRP  235

Query  938   EIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD  1117
             EI   +V +L    +   + K  +K L  +C   ++R KAV  GAV  LIE L  LE  D
Sbjct  236   EILTEVVHVLRDQISQQTS-KAALKLLVEVCPWGRNRIKAVEGGAVTVLIELL--LETSD  292

Query  1118  ---TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl--cs  1282
                 E  L  ++LLC    G A F  H   + ++ K IL++S  A++ A   L S+   S
Sbjct  293   RRSCELTLIILDLLCGCAEGRAEFLKHGAGLAIVSKKILRVSHVASDRAVRILCSICRFS  352

Query  1283  ssEQAQRDAVAAGVLTQLLLLVQ--SGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
             ++ +  ++ +  GV+ +L L++Q  SGC  ++K +A+ +L+L    W +   V
Sbjct  353   ATPRVLQEMLQVGVVAKLCLVLQVDSGC--KSKERAREILRLHSRVWKNSPCV  403



>gb|KFK36486.1| hypothetical protein AALP_AA4G130900 [Arabis alpina]
Length=412

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 210/401 (52%), Gaps = 21/401 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  ++D  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDISDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIKVSASSHQNQVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSN----SSELTHEALSILSMFQLSEAECVF  787
                    N+  + A    + L +IV +N   N    S  +T EALS+L   + SE     
Sbjct  125   ENAT---NKRCLEAAGVPEFLATIVSNNDLENGFDSSRSMTDEALSLLYHLETSETVLKN  181

Query  788   VASDL---DRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
             + ++    D V  L  ++     + R  +  L+++++      ++   +S   E+F  +V
Sbjct  182   LLNNKKCNDIVNSLTKIMQRGIYESRAYATLLLKNILEVADPMQI---MSLKPEVFIEVV  238

Query  959   GILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTER  1126
              IL+   +H +A+K  +  L  +C   ++R KAV A A+  +IE L       E+   E 
Sbjct  239   QILDDQISH-KAMKAAMHILVNICPWGRNRHKAVDAAAISVIIELLMDESFSSERRGPEM  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--  1300
             AL  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+          
Sbjct  298   ALVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFCATPNLL  357

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
              + +  GV+ ++ L++Q  C  + K KA+ LLKL    W D
Sbjct  358   NEMLQLGVVAKMCLVLQVSCGSKTKDKAKELLKLHARVWKD  398



>ref|XP_006847226.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
 gb|ERN08807.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
Length=400

 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 140/390 (36%), Positives = 219/390 (56%), Gaps = 19/390 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP+ FRCPISL+L+ DPV + TGQTYDRASIE W++ GN TCPVT   L DF++IPNH
Sbjct  1     MSIPHLFRCPISLDLLTDPVILSTGQTYDRASIEKWLSYGNQTCPVTMQKLHDFSMIPNH  60

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLR+LI  W +             K P       SL S    + S     L  ++++R L
Sbjct  61    TLRQLIDRWLLCEL----------KNPGSIARDSSLESLKQILESQQPPTLELMQKIRSL  110

Query  623   ardsDKNRSVISANNARQVLLSIVFSN------MDSNSSELTHEAL-SILSMFQLSEAEC  781
             + +SD+NR  +       +LL I+F++      +   +S +  EAL ++L++   S+   
Sbjct  111   SAESDENRVSMVQMGYLPLLLKIMFTDHSMKYFLSIENSCIAEEALDAVLNLLPNSQLGP  170

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             + +  +   +  L+ LL   ++ ++++   L+ ++ +     EL  +I     I QG++ 
Sbjct  171   LLLLREASAMNALLVLLKGGTMKIKISICQLMVAISSSHDLKELCYEIGQNQVILQGLIS  230

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
             ++ H S H  AL  G++AL +L L     +  + AG +++L+E +   +K +   ALA +
Sbjct  231   VMQH-SHHVGALNAGIRALSSLALSLTTVEITIEAGIIDSLVECVMQADKSNVSLALAAI  289

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISD-RATEYaagallslcsssEQAQRDAVAA  1318
             E L RI SG      + L + +LVK++ ++SD   +E A G LL +C  S  AQ  A+  
Sbjct  290   EHLSRIESGKKVLRENPLAIRVLVKLVFRVSDHEGSENAIGCLLVICEESLSAQEVAINE  349

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLLR  1408
             G+LTQLLLL+QS C  RAK KA++LLKLLR
Sbjct  350   GILTQLLLLLQSQCNSRAKTKARVLLKLLR  379



>ref|XP_002527537.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF34846.1| Spotted leaf protein, putative [Ricinus communis]
Length=426

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 201/391 (51%), Gaps = 24/391 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LM+DPVT+ TG TYDR SIE W+  GN TCP+T   L     IPNH
Sbjct  28    LAIPNHFRCPISLDLMKDPVTLSTGITYDRQSIEKWIEGGNVTCPITAQVLRSLEPIPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             T+R++IQ+WCV N++FG+ERIPTP+ P        + S+ ++  +  +         +  
Sbjct  88    TIRKMIQDWCVDNKSFGIERIPTPRIPVSSVEALEIQSRITASCNQGDRVGCRNLVAKIK  147

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILS-MFQLSEAECVFVASD  799
                 +  R      N R +L +   S+   N++ L  E LS L+ MF L      ++ S 
Sbjct  148   TLLKESER------NKRCILSNA--SSFSENAAVL-EEILSCLTLMFPLDVEAKGYLGSS  198

Query  800   LDRVGYLVSLLSHPSIDVRVNSAALIESVVA-GTKSPELRSQISNADEIFQGIVGILNHP  976
                +  LV  L    +  R N+  +++ +V+   +  E  S I    E    +  ++  P
Sbjct  199   AS-MNCLVWFLKGGVLSGRRNAVLVLKELVSLDQRKVEALSGIEGGAE---ALFKLIKEP  254

Query  977   STHPRALKMGVKALFALCLVKQHRQKAVIA----GAVEALIERLQYLEKCDTERALATVE  1144
                P A K  +  ++ + +      + + +    G V  L+E L   EK   E+AL  ++
Sbjct  255   -ICPTATKASLVIIYNMAMSTPTNARVISSFVDMGIVSLLMEMLVDTEKSICEKALGVLD  313

Query  1145  LLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR----DAV  1312
              +C    G      H+LT+P+LVK I ++S+ ATE++   L  LC + ++ +     +A+
Sbjct  314   GICCSDQGREKAYDHSLTIPVLVKKIHRVSELATEFSVSILWKLCKNEKRKEGNVLPEAL  373

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
               G   +LLLL+Q GC ER K KA  LLKLL
Sbjct  374   QVGAFQKLLLLLQVGCGERTKEKATELLKLL  404



>ref|XP_009415651.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 139/407 (34%), Positives = 217/407 (53%), Gaps = 33/407 (8%)
 Frame = +2

Query  260   GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIP  436
             G ++P +F CP+SLE+MRDPVT+ TG TYDR +IE W+ + N   CPVT+ PL +  + P
Sbjct  3     GAEVPPYFLCPVSLEIMRDPVTLATGITYDRENIERWIFSHNHEICPVTKQPLPNLDVTP  62

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC AN + GVER PTP+ P +     + ++     +    ++++AL +L+
Sbjct  63    NHTLRRLIQAWCAANASNGVERFPTPRPPVN----MTRIAALLDEARLPQTQVTALGKLK  118

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSEL-------------THEALSILSM  757
              +  +SD+NR  + ++ A  VL SI+  ++ SNS++L             T EA +IL  
Sbjct  119   AIVAESDRNRRCVESSGAVDVLASIIEKSV-SNSTDLEEEVCDGVGSSSATDEAFTILCS  177

Query  758   FQLSEAECV-FVASDLDRVGYLVSLL---SHPSIDVRVNSAALIESVVAGTKSPELRSQI  925
              QLS+   +  +  D + +  L  +L   S+PS    +     + SVVA  +   LR   
Sbjct  178   LQLSDKSLLGLLQRDDNVIESLTKVLERSSYPSRAYSLLLLESLLSVVAPARLLSLR---  234

Query  926   SNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQY  1102
                +E+F+ +  +L    ++ +A K  + AL A+C   Q+R KAV AGAV  LIE  L  
Sbjct  235   ---EELFRELTKVLRDQISY-QATKAALHALGAVCPWGQNRLKAVQAGAVRVLIELLLDE  290

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              EK   E  L  +  LC    G A    HA  + ++ K + ++S  A+  A   L ++  
Sbjct  291   PEKRMCEMILGILHQLCTCAEGRAELIGHAAGIAVVSKKMHRVSQPASRMAVKILYTVAK  350

Query  1283  ssEQ--AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             SS       + +  G +++L L++Q  C  +AK K Q +L+L    W
Sbjct  351   SSPSLAVLHEMLQVGAVSKLCLMLQMDCDMKAKEKIQGILRLHSKVW  397



>emb|CDY32070.1| BnaC04g44960D [Brassica napus]
Length=412

 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 209/401 (52%), Gaps = 21/401 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVER PTP+ P        +       +S   +++  L+RLR 
Sbjct  65    HTLRRLIQSWCTLNASYGVERFPTPRPPI---CKSEIEKLIKDSASSHQNQVKCLKRLRQ  121

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSN----SSELTHEALSILSMFQLSEA---E  778
             +  ++  N+  + A    + L +IV +N   N    S  LT EALS+L   + SE     
Sbjct  122   IVSENKTNKRCLEAAGVPEFLATIVSNNESQNVFDSSMSLTDEALSLLYHLETSETVLKN  181

Query  779   CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
              +      D V  L++++     + R  +  L+++++   +   +   ++    +F  +V
Sbjct  182   LLNKKKGRDIVSSLINIMQRGMYESRAYATLLLKNILEVAEPMHI---MNLKPLVFTEVV  238

Query  959   GILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTER  1126
              IL    +H +A K  +  L  +C   ++R KAV AGA+  +IE L       ++   E 
Sbjct  239   QILEDRISH-KATKAALHILVNICPWGRNRHKAVEAGAIYVMIELLMDESFSSDRRGPEM  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--  1300
             A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+          
Sbjct  298   AMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFCATPALL  357

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
              + +  GV+++L L++Q  C  + K KA+ LLKL    W D
Sbjct  358   HEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_006378430.1| hypothetical protein POPTR_0010s11370g [Populus trichocarpa]
 gb|ERP56227.1| hypothetical protein POPTR_0010s11370g [Populus trichocarpa]
Length=446

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 215/421 (51%), Gaps = 29/421 (7%)
 Frame = +2

Query  251   DVGGIQ--IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDF  424
             ++G I+  IP HFRCPISLELM+DPVT+ +G TYDR SIE W+  GN TCPVT   L   
Sbjct  26    EMGDIEVTIPNHFRCPISLELMKDPVTMSSGITYDRESIEKWIEAGNVTCPVTNRVLRSL  85

Query  425   TLIPNHTLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrls  598
               IPNHT+R++IQ+WCV N ++G+ERIPTP+ P  ++  L   L  + +          +
Sbjct  86    DPIPNHTIRKMIQDWCVTNSSYGIERIPTPRIPVSSEEALEIHLKIKTACKKGDQIGCQN  145

Query  599   alrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMFQL  766
                +++ LA++S++N+S + A     V LS  F      S E    +  E LS L++   
Sbjct  146   LAAKIKALAKESERNKSCLVATGTAGV-LSYAFDEFSKASFEENVAVLDEILSSLAVLLH  204

Query  767   SEAECVFVASD--LDRVGYLVSLLSHPSIDVRVNSAALIESVV--AGTKSPELRSQISNA  934
              E    +  SD  +DR+   V  L    +  R N+  +++ +V     +  ++  +I  A
Sbjct  205   HEKATNWPGSDASIDRI---VLFLKSEDLSARRNAVLVLKELVPILDYRKVDMLLEIEGA  261

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-----GAVEALIERLQ  1099
                 + +  ++  P  H  A K  +  ++ +          +IA     G V  L+E L 
Sbjct  262   ---MEALFKLIKAPICHA-ATKASLMVIYHMVTSPSPSNAKIIAKFVDLGLVSLLLEMLV  317

Query  1100  YLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
               E+   E+AL  ++ +C    G      HALT+P+LV+ I ++SD A +++   L  LC
Sbjct  318   DAERSLCEKALGVLDGICGSDQGREEAYNHALTIPVLVRKIHRVSDLAMKFSVSILFKLC  377

Query  1280  sssEQAQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDD  1447
              + ++       +A+      +LL+L+Q GC ER K KA  LL++L         ++S D
Sbjct  378   MNEKRENGGVLVEAIQRNAFEKLLVLLQVGCDERTKEKATQLLRVLNAYRSSVDCIDSVD  437

Query  1448  F  1450
             F
Sbjct  438   F  438



>ref|XP_006494889.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Citrus sinensis]
Length=407

 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 143/401 (36%), Positives = 214/401 (53%), Gaps = 18/401 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVAT-GNTTCPVTRAPL--TDFT-L  430
             I++P HF CPISL+LMRDPVTV TG TYDR +IE W+ T  N TCPVT+  L  TD T  
Sbjct  4     IEVPAHFLCPISLQLMRDPVTVSTGITYDRVNIERWLFTCKNNTCPVTKQVLQETDLTST  63

Query  431   IPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrr  610
              PNHTLRRLIQ WC  N   G+ERIPTP+ P D      ++   +      ++    LRR
Sbjct  64    TPNHTLRRLIQAWCTINACHGIERIPTPQPPVDK---TQIVKILNDAKKSPSTGRKCLRR  120

Query  611   lrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEA--ECV  784
             LR +   S++NRS + A  A + L + +  + D   S+   EALSIL    +SE+  + +
Sbjct  121   LRSITLQSERNRSCLEAAGAIEFLATTITKSDDG--SDECDEALSILYHLNVSESYLKSI  178

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              + +  + +  L+ +L   +   R  +  L++S+       +L   IS   E F  IV +
Sbjct  179   VINNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFEVADPFQL---ISVKQEFFTEIVNV  235

Query  965   L-NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL-QYLEKCDTERALAT  1138
             L +H     +A K  +K L  LC   ++R KAV  G V  L++ L    E+   E  L  
Sbjct  236   LRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELMLNV  295

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLCR   G A    H   + ++ K IL++S  A++ A   L S+C  S  A+  ++ +
Sbjct  296   LDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQEML  355

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
               GV+++L L++Q   + + K +A+ +LKL    W D   V
Sbjct  356   QVGVVSKLCLVLQVDASVKTKERAREILKLNARAWRDSPCV  396



>ref|XP_004288606.1| PREDICTED: U-box domain-containing protein 21-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 136/397 (34%), Positives = 194/397 (49%), Gaps = 19/397 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP HFRCPI+L+LM+DPVT+ TG TYDR+SI++W+  G+ TCPVT   L  F  IPNH
Sbjct  31    IVIPSHFRCPITLDLMKDPVTLSTGMTYDRSSIDAWIEKGHNTCPVTNQVLATFDQIPNH  90

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
              LR++IQ WCV NR+ GVERIPTP+ P     V  +  +  +V+   +         +  
Sbjct  91    ALRKMIQGWCVQNRSHGVERIPTPRIPVSAYEVTRVYQRMMAVTQRGDYNKCLELVAKIR  150

Query  623   ardsDKNRS-VISANNARQVLLSIVFSNMDSNSSE--LTHEALSILS-MFQLSEAECVFV  790
             A   D  R+      N     LS  F     N +   L  E LS+++ MF + E     +
Sbjct  151   AWGKDSERNKKCMVENRMGCCLSATFEFFAENEAATLLKEEILSVMTWMFPMGEEGQSRL  210

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA-GTKSPELRSQISNADEIFQGIVGIL  967
              S    +  LV  L    +  R N+  ++  +++   K  +   QI  A E    I  I 
Sbjct  211   GS-AKSLRCLVWFLEGKDLSSRQNAVLVLRKLLSLDQKHVDGIVQIEGAIEALVKI--IR  267

Query  968   NHPSTHPRALKMGVKALFALC--LVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
               PS  P A K  +  +F +      + + + V  G V  L+E L   EK   ERAL  +
Sbjct  268   EGPSICPTATKASLSCVFYMISGASDEIKSRFVELGLVSLLLEILVDAEKSLCERALGVL  327

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQRD-----  1306
             E LC    G A    ++LT+PLLVK +L++S  A E++   +  LC +      D     
Sbjct  328   EGLCDCKQGRAKAYENSLTMPLLVKKMLRVSALANEFSVSIIWKLCKNQNGDGDDEEEIR  387

Query  1307  ----AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
                 A+  G   +LL+L+Q GC +  K K   LLKL 
Sbjct  388   ILMEALQVGAFQKLLVLLQVGCGDEIKDKVTELLKLF  424



>ref|XP_009141534.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDY40422.1| BnaA04g20950D [Brassica napus]
Length=412

 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 133/401 (33%), Positives = 211/401 (53%), Gaps = 21/401 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVER PTP+ P        +       +S   +++  L+RLR 
Sbjct  65    HTLRRLIQSWCTLNASYGVERFPTPRPPI---CKSEIEKLIKDSASSHQNQVKCLKRLRQ  121

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSN----SSELTHEALSILSMFQLSEAECVF  787
             +  ++  N+  + A    + L +IV +N   N    S  LT EALS+L   + SE     
Sbjct  122   IVSENKTNKRCLEAAGVPEFLATIVSNNESENVFDSSMSLTDEALSLLYHLETSETVLKN  181

Query  788   VASD---LDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIV  958
             + ++    D V  L+ ++     + R  +  L+++++   +   +   ++    +F  +V
Sbjct  182   LLNNKKGRDIVSSLIKIMQRGMYESRAYATLLLKNILEVAEPMHI---MNLKPSVFTEVV  238

Query  959   GILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTER  1126
              IL+   ++ +A K  +  L  +C   ++R KAV AGA+  +IE L       ++   E 
Sbjct  239   QILDDRISN-KATKAALHILVNICPWGRNRHKAVEAGAISMMIELLMDESFSSDRRGPEM  297

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--  1300
             A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+          
Sbjct  298   AMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFCATPSLL  357

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
              + +  GV+++L L++Q  C  + K KA+ LLKL    W D
Sbjct  358   HEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_009351577.1| PREDICTED: U-box domain-containing protein 21-like [Pyrus x bretschneideri]
Length=441

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 138/422 (33%), Positives = 219/422 (52%), Gaps = 34/422 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISL+LM+DPVT+ TG TYDR SIE+W+ T N TCP+T   LT F LIPNH
Sbjct  25    LTIPNHFRCPISLDLMKDPVTLSTGITYDRHSIETWIETENFTCPITNQVLTSFDLIPNH  84

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQP-ADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             T+R++IQ+WCV  ++FG+ERIPTP+ P +   + + L   ++S     +     + +++ 
Sbjct  85    TIRKMIQDWCVEKKSFGIERIPTPRIPISSVQVTEILSKISTSSHHQNHDCQVLVAKIKA  144

Query  620   lardsDKNRSVISANNARQVL---LSIVFSNMDSNSSELTHEALSILSM-FQLSEAECVF  787
             LA++S++N+  I A+    VL    S + ++    +  +  E LS L++ F L     ++
Sbjct  145   LAKESERNKRCIVASGTGSVLAGAFSALSNSQHHQNVAVLEEILSALTLVFPLDGEASLY  204

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSA-ALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
             + S    +  +V  L    +  R N+A  L E+ V+     +    ++  +   + +V +
Sbjct  205   LGSPAS-LRCMVWFLESGDLSQRRNAALVLKETAVSSDHDHQKIDALAEIEGALEALVKL  263

Query  965   LNHP--STHPRALKMGVKALFALCLVKQH------------RQKAVIAGAVEALIERLQY  1102
             +  P  +T  +A         +L ++ Q             +++ V    V  L + L  
Sbjct  264   IKEPVCATSTKA---------SLVIIYQMVNSSSSPSKEKIKERFVEMELVSMLSDILVD  314

Query  1103  LEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcs  1282
              E+   E+AL  ++ LC    G      HALT+P++VK IL+ISD ATE++   L  LC 
Sbjct  315   AERSICEKALGVLDGLCGSQQGREKAYLHALTMPVVVKKILRISDLATEFSVSILWKLCK  374

Query  1283  ssEQAQRDAVA----AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
             +  +     V      G   +LLLL+Q GC ER K KA  LLK L         ++S DF
Sbjct  375   NETREDGGVVVESLQVGAFQKLLLLLQVGCAERTKEKATDLLKALNIHRERLECIDSMDF  434

Query  1451  AR  1456
              +
Sbjct  435   KQ  436



>ref|XP_006647860.1| PREDICTED: U-box domain-containing protein 21-like [Oryza brachyantha]
Length=451

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 138/410 (34%), Positives = 200/410 (49%), Gaps = 17/410 (4%)
 Frame = +2

Query  257   GGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIP  436
             GG  +P HF CPISLE+MRDPVT  TG TYDR  IE W+  G   CPVT  PL    L+P
Sbjct  39    GGGDVPDHFLCPISLEMMRDPVTAPTGITYDRDGIEGWLELGRGACPVTGRPLRAEELVP  98

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NH  RR+IQEWCVANRAFGVER+PTP+ P      + +    ++ +   +         R
Sbjct  99    NHATRRMIQEWCVANRAFGVERVPTPRVPVSGADAREVFEAVAAAARRGDGVACGKMVAR  158

Query  617   glardsDKNRS-----VISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAE-  778
               A   +  R+        A  A     S + +  D   +    E L+ L +F   + E 
Sbjct  159   ARALGKESERNRRCFAAAGAARALAFAFSRLVAASDQAETRALEEILAALVVFFPLDEES  218

Query  779   --CVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
               C+   + LD    LV ++SH     RV++  ++  + + + S  L + +S A+ ++  
Sbjct  219   RRCIASPASLD---ALVKIMSHGEPVARVSAVVVLREIASSSDSQCLEA-MSKANAMYDA  274

Query  953   IVGILNHPSTHPRALKMG-VKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERA  1129
             +V ++  P   P+A K   V A + +  V+    + V  G VE L+E L   +K  TE+A
Sbjct  275   LVKLVAKP-VSPQATKAALVTAYYLVKNVEHAASRFVDLGVVELLVELLADADKGTTEKA  333

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagall---slcsssEQAQ  1300
             LA ++ +           AHAL VP+L K  + +SD ATE+A  AL              
Sbjct  334   LAVLDSVLVTAKARDKAYAHALAVPVLAKKTMHVSDMATEFAVSALWRLCKNSPVDGGCT  393

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              +A+  G   +LLLL+Q GC    K +A  LLKLL         + + DF
Sbjct  394   AEALQVGAFQKLLLLLQLGCEGITKERASELLKLLNASRDSAECIETADF  443



>ref|XP_004140266.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis sativus]
 ref|XP_004156108.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cucumis sativus]
 gb|KGN48051.1| hypothetical protein Csa_6G426370 [Cucumis sativus]
Length=412

 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 134/400 (34%), Positives = 216/400 (54%), Gaps = 14/400 (4%)
 Frame = +2

Query  257   GGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDF--T  427
             G I++P +F CPISL+LMRDPVT+ TG TYDR+SIE W+ + N T CP+T+ PL+     
Sbjct  9     GEIEVPSYFLCPISLQLMRDPVTISTGITYDRSSIEMWLFSFNKTVCPITKQPLSSDPDL  68

Query  428   LIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalr  607
             L PNHTLRRLIQ WC  N + G+ERIPTPK P D      +        S  +S    L 
Sbjct  69    LTPNHTLRRLIQSWCTLNASNGIERIPTPKSPIDK---THIAKILKQAQSFPDSTHKCLL  125

Query  608   rlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECV-  784
              L+ +A ++++NR++++ ++     L++V  +  SN+      A+ IL   + S+     
Sbjct  126   ALKAIALENERNRNLVAQSDGAFDFLAMVIKSGGSNNIASIELAVEILFHIKSSQTHLKN  185

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              V  D+D +  L  +L + +   R  +  L++S +       L   +S   E+ + IV +
Sbjct  186   LVNGDVDFINSLTFVLQNGNCQSRAYAVMLLKSSLELADPIRL---MSIERELLREIVRV  242

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDTERALATV  1141
             ++   +H +A K  +K L  +C   ++R KAV  GAV  L+E  L   E+  +E  L  +
Sbjct  243   IHDHISH-QASKSALKVLAEVCPWGRNRVKAVEGGAVGVLVELLLNSTERRWSELGLVIL  301

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVA  1315
             + LC    G     AHA  + ++ K IL++S  A++ A   L S+C  S  A+  ++ + 
Sbjct  302   DQLCGCAEGREKLVAHAAGLAVVSKKILRVSAMASDRAVRILSSICRFSASAKVMQEMLE  361

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIV  1435
              GV+ +L L++Q  C+ + + KA+  LKL    W + S +
Sbjct  362   VGVVAKLCLVLQMDCSMKTREKARDTLKLHSRVWSNSSCI  401



>dbj|BAD16037.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
Length=452

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 142/414 (34%), Positives = 213/414 (51%), Gaps = 28/414 (7%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P HF CPISL++MRDPVT  TG TYDR  +E W+  G  TCPVT  PL    L+PNH  
Sbjct  39    VPDHFLCPISLDMMRDPVTAPTGITYDRDGVEVWLERGRPTCPVTGRPLRPEELVPNHAT  98

Query  449   RRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             RR+IQEWCVANRA GVER+PTP+ P  A           A++      +    + R R L
Sbjct  99    RRMIQEWCVANRALGVERVPTPRVPVSAADAREILEGVAAAARRGDAAACGRMVARARAL  158

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEA---------LSILSMFQLSEA  775
              ++S++NR  +++  A +  L++ FS + + S++   EA          +++  F L E 
Sbjct  159   GKESERNRRCLASAGAERA-LALAFSRLAAASTDQQAEARACALEEILAALVVFFPLDEE  217

Query  776   --ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQ  949
                C+     LD    LVS+LSH     RV++  ++  + +   +  L + +S A+ ++ 
Sbjct  218   SRRCIASPPSLD---ALVSILSHGEQVTRVSAVVVLREIASSCDNQCLEA-MSKANAMYD  273

Query  950   GIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKA----VIAGAVEALIERLQYLEKCD  1117
              +V ++  P   P+A K  +  + A  LVK   + A    V  G VE L+E L   +K  
Sbjct  274   ALVNLVAKP-VSPQATKAAL--VTAYYLVKNDIEHAASRLVDLGTVELLVELLADADKGT  330

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga---llslcsss  1288
             TE+ALA ++ +           AHAL VP+L K  + +SD ATE+A  A   L     + 
Sbjct  331   TEKALAVLDTVLVAAKARDRAYAHALAVPVLAKKTMHVSDMATEFAVSALWRLCKNSPAD  390

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                + +A+  G   +LLLL+Q GC    K +A  LL+LL         + + DF
Sbjct  391   GGCKAEALQVGAFQKLLLLLQLGCDGVTKERASELLRLLNASRDSTECIETADF  444



>ref|NP_001048059.2| Os02g0738200 [Oryza sativa Japonica Group]
 dbj|BAH01535.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF09973.2| Os02g0738200 [Oryza sativa Japonica Group]
Length=456

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 142/414 (34%), Positives = 213/414 (51%), Gaps = 28/414 (7%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P HF CPISL++MRDPVT  TG TYDR  +E W+  G  TCPVT  PL    L+PNH  
Sbjct  43    VPDHFLCPISLDMMRDPVTAPTGITYDRDGVEVWLERGRPTCPVTGRPLRPEELVPNHAT  102

Query  449   RRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             RR+IQEWCVANRA GVER+PTP+ P  A           A++      +    + R R L
Sbjct  103   RRMIQEWCVANRALGVERVPTPRVPVSAADAREILEGVAAAARRGDAAACGRMVARARAL  162

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEA---------LSILSMFQLSEA  775
              ++S++NR  +++  A +  L++ FS + + S++   EA          +++  F L E 
Sbjct  163   GKESERNRRCLASAGAERA-LALAFSRLAAASTDQQAEARACALEEILAALVVFFPLDEE  221

Query  776   --ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQ  949
                C+     LD    LVS+LSH     RV++  ++  + +   +  L + +S A+ ++ 
Sbjct  222   SRRCIASPPSLD---ALVSILSHGEQVTRVSAVVVLREIASSCDNQCLEA-MSKANAMYD  277

Query  950   GIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKA----VIAGAVEALIERLQYLEKCD  1117
              +V ++  P   P+A K  +  + A  LVK   + A    V  G VE L+E L   +K  
Sbjct  278   ALVNLVAKP-VSPQATKAAL--VTAYYLVKNDIEHAASRLVDLGTVELLVELLADADKGT  334

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga---llslcsss  1288
             TE+ALA ++ +           AHAL VP+L K  + +SD ATE+A  A   L     + 
Sbjct  335   TEKALAVLDTVLVAAKARDRAYAHALAVPVLAKKTMHVSDMATEFAVSALWRLCKNSPAD  394

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                + +A+  G   +LLLL+Q GC    K +A  LL+LL         + + DF
Sbjct  395   GGCKAEALQVGAFQKLLLLLQLGCDGVTKERASELLRLLNASRDSTECIETADF  448



>ref|XP_010912070.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Elaeis guineensis]
Length=417

 Score =   172 bits (436),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 145/406 (36%), Positives = 220/406 (54%), Gaps = 32/406 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             I+IP +F CPISL++MRDPVT+ TG TYDR SIESW+ +G + TCPVT+  L +  L PN
Sbjct  4     IEIPSYFLCPISLQIMRDPVTLPTGITYDRDSIESWIFSGKHNTCPVTKQSLPECDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N + G+ER PTPK P D       +++    +   + +L++LR+L+ 
Sbjct  64    HTLRRLIQAWCALNPSDGIERFPTPKPPMDKA----QIAKLIDDARLPHLQLTSLRKLKD  119

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSS-------------ELT---HEALSIL  751
             +  +S++N+  + A      +L  + S M  NSS             E T    EALSIL
Sbjct  120   IVSESERNKRCVEATPG---VLDFLASIMKKNSSTPGEEGILIRDGAESTTACDEALSIL  176

Query  752   SMFQLSEAECV-FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQIS  928
              + Q+SE     F   +   +  L S+L   +   R  +  L++S++ G  +P   + + 
Sbjct  177   YLLQISEQRLRDFAVKNEAIIESLTSILQQSNYQSRAYATLLLKSIL-GVIAPAKLAGVR  235

Query  929   NADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL-QYL  1105
               +E+FQ IV +L    +H RA K  ++ L  LC  +++R KA  AGAV  LIE L    
Sbjct  236   --EELFQEIVNVLRDRISH-RAGKAALQVLSLLCRWRRNRVKAAHAGAVPVLIELLPDEN  292

Query  1106  EKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcss  1285
             EK   E  L  + L+C    G +    H+  + ++ K IL IS+ A+E A   L S+   
Sbjct  293   EKRVCELVLVVLALVCGCAEGRSELVGHSAGIAIVSKKILSISEVASEAAVRILNSVAKF  352

Query  1286  sEQAQ--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             S  A   ++ +  GV+++L L++Q  C  + K KA+ +L+L    W
Sbjct  353   SATAAVLQEMLQIGVVSKLCLVLQIDCGMKTKEKAREILRLHSRVW  398



>ref|XP_009133058.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Brassica rapa]
Length=409

 Score =   172 bits (436),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 129/398 (32%), Positives = 211/398 (53%), Gaps = 18/398 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRSPICKSEIEKLIKDSASSHKNKVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSN-MDSNSSELTHEALSILSMFQLSEAECVFVAS  796
                    N+  +      + L +I+ +N +DS+   L+ EALS+L   + SE     + +
Sbjct  125   ENTT---NKRCLEVAGVPEFLATIISNNGVDSSMVSLSDEALSLLYHLESSERVLKNLLN  181

Query  797   DL---DRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +    + V  L+ ++     + R  +  L+++++      ++   ++    +F  +V IL
Sbjct  182   NKKGGNIVKSLIKIMQRGIYESRAYATLLLKNILEVADPMQI---MTLKPSVFTEVVQIL  238

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALA  1135
             +   +H +A K  +  L  +C   ++R KAV AGA+  +IE L       ++   E A+ 
Sbjct  239   DDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSDRRGPEMAMV  297

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDA  1309
              +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+           + 
Sbjct  298   VLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEM  357

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
             +  GV+ +L L++Q  C  + K KA+ LLKL    W D
Sbjct  358   LQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>emb|CDX84587.1| BnaA03g16430D [Brassica napus]
Length=409

 Score =   172 bits (435),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 129/398 (32%), Positives = 211/398 (53%), Gaps = 18/398 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRSPICKSEIEKLIKDSASSHKNKVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSN-MDSNSSELTHEALSILSMFQLSEAECVFVAS  796
                    N+  +      + L +I+ +N +DS+   L+ EALS+L   + SE     + +
Sbjct  125   ETTT---NKRCLEVAGVPEFLATIISNNGVDSSMVSLSDEALSLLYHLESSERVLKNLLN  181

Query  797   DL---DRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +    + V  L+ ++     + R  +  L+++++      ++   ++    +F  +V IL
Sbjct  182   NKKGGNIVKSLIKIMQRGIYESRAYATLLLKNILEVADPMQI---MTLKPSVFTEVVQIL  238

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALA  1135
             +   +H +A K  +  L  +C   ++R KAV AGA+  +IE L       ++   E A+ 
Sbjct  239   DDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSDRRGPEMAMV  297

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDA  1309
              +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+           + 
Sbjct  298   VLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEM  357

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
             +  GV+ +L L++Q  C  + K KA+ LLKL    W D
Sbjct  358   LQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>emb|CDY59599.1| BnaCnng35300D [Brassica napus]
Length=409

 Score =   172 bits (435),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 137/408 (34%), Positives = 210/408 (51%), Gaps = 18/408 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISL++M+DPV V TG TYDR SIE W+ TG   TCPVT+  +T+  L PN
Sbjct  5     IEIPTFFLCPISLDIMKDPVIVSTGITYDRDSIEKWLFTGKKNTCPVTKQVITETDLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N + G+ERIPTPK P     ++ L+  +SS   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASHGIERIPTPKPPISKSEIEKLIKDSSSSHQNQVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVF-SNMDSNSSELTHEALSILSMFQLSEAECVFVAS  796
                    N+  + A N  + L  IV  SN   +S  L  EALS+L     SE     + +
Sbjct  125   ENTT---NKRCLEAANVPEFLAKIVSNSNRFDSSRSLMDEALSLLYHLDTSETARKSLLN  181

Query  797   D---LDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
             +    + V  L  ++     + R  +  L++ ++      ++   I    E+F  +V IL
Sbjct  182   NKKGTNLVKTLTKIMQRGIYESRAYATFLLKKILEVADPMQI---ILLERELFNEVVQIL  238

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALA  1135
             +   +H +A K  ++ L  +C   ++R KAV AGA+  +IE L       E+   E A+ 
Sbjct  239   HDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSSERRTLEMAMV  297

Query  1136  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDA  1309
              +++LC+   G A F  H   + ++ K IL++S   +E A   LLS+          +D 
Sbjct  298   VLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRFCATPSLLQDM  357

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDFA  1453
             +  GV+ ++ L++Q  C  + K KA+ LLKL    W +   V  + +A
Sbjct  358   LQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRESPCVPRNLYA  405



>ref|XP_011024493.1| PREDICTED: U-box domain-containing protein 21-like [Populus euphratica]
Length=444

 Score =   172 bits (437),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 213/415 (51%), Gaps = 25/415 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P HFRCP+SL+LM DPVT+ +G TYDR SIE W+  GN TCP+T   L     IPNH
Sbjct  29    VTVPNHFRCPVSLDLMNDPVTMSSGITYDRESIEKWIEAGNVTCPITNKVLRSLDPIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsalrrlr  616
             T+R++IQ+WCVAN ++G+ERIPTP+ P  ++  L      + +          + + +++
Sbjct  89    TIRKMIQDWCVANSSYGIERIPTPRIPVSSEEALEIHSKIKTACKKGDQAGCQNLVAKIK  148

Query  617   glardsDKNRSVISANNARQVLLSIV--FS--NMDSNSSELTHEALSILSMFQLSEAECV  784
              LA++S++NR  + A     VL S    FS  + D N + L  E LS L++F   +    
Sbjct  149   ALAKESERNRRCLVATGTAGVLSSAFEDFSKASFDDNVAVL-EEILSGLAVFLPHDKATT  207

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVV-AGTKSPELRSQISNADEIFQGIVG  961
              ++SD   +  +V  L    +  R N+  +++ +V    +  ++  +I  A    + +  
Sbjct  208   CLSSDAS-MDCVVWFLKSEDLSTRRNAVLVLKELVPLDNRKVDMLLEIEGA---MEALFK  263

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQ--------KAVIAGAVEALIERLQYLEKCD  1117
             ++  P   P A K  +  ++ + +              K V  G V  L+E L   E+  
Sbjct  264   LIKAP-IFPSATKASLLIIYHMVMSSSSSSPTKAKIIAKFVDLGLVSLLLEMLVDAERST  322

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E+AL  ++ +C    G      HALT+P+LV+ I ++SD A +++   L  LC + ++ 
Sbjct  323   CEKALGVLDGICDWDQGREKAYNHALTIPVLVRKIHRVSDLAMKFSVSILFKLCMNEKRG  382

Query  1298  QR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
                   +A+      +LL+L+Q GC ER + KA  LLKLL         ++S DF
Sbjct  383   NGGVLVEAIQRNAFEKLLVLLQVGCDERTREKATQLLKLLNVYRGRVDCIDSVDF  437



>ref|XP_009408289.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   172 bits (435),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 140/403 (35%), Positives = 214/403 (53%), Gaps = 27/403 (7%)
 Frame = +2

Query  260   GIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIP  436
             G++IP +F CPISL+LM+DPVT+ TG TYDR SIE W+ + G+ TCPVT+  L D  + P
Sbjct  3     GVEIPPYFLCPISLQLMKDPVTLSTGITYDRESIERWIFSGGHNTCPVTKRALPDCEVTP  62

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC  N + GVER+PTPK P + G     + +    +    S+L +L RLR
Sbjct  63    NHTLRRLIQAWCTVNASSGVERVPTPKAPVEQG----QIVKLLDEAKLPQSQLRSLARLR  118

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----------LTHEALSILSMFQL  766
              +  +S++N+  + A       L+ V +N   +S+E             EAL+IL    +
Sbjct  119   AIVSESERNKRCVEATAGVVDFLASVIANDGYSSNEEVDDGLESTGACDEALNILHSLTI  178

Query  767   SEAECV-FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             SE   +  V      +  L ++L   S   R  +  L+ S++      +L   I+  +E+
Sbjct  179   SEGGLLDLVTRHAGMIESLTTILRRSSYQSRAYATLLLRSMLGVLTQEKL---INLGEEL  235

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD--  1117
             FQ IV ++ H     +  +  + AL   C   ++R KAV AGAV  LIE L  LE+ D  
Sbjct  236   FQEIVNVI-HDRISNQETRAALHALIEACPCARNRIKAVNAGAVHVLIELL--LEEDDRR  292

Query  1118  -TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
               E AL  ++ LC    G A    HA  + ++ K IL++S+ A+E A   L S+   S  
Sbjct  293   ICELALVAMDRLCGCAEGRAELVGHAAGITVVSKKILRVSEMASERAVRILHSVARHSAT  352

Query  1295  AQ--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
              +  ++ +  GV+++L L++Q  C  + K KA+ +L +    W
Sbjct  353   PRLLQEMMQMGVVSKLCLVLQVDCKAKTKEKAKEILSMHSRVW  395



>ref|XP_010931056.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Elaeis guineensis]
Length=421

 Score =   172 bits (435),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 132/409 (32%), Positives = 211/409 (52%), Gaps = 31/409 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             ++IP +F CPISL++MRDPVT+ TG +Y+R SIE W+ +G +  CPVT+ PL D  L PN
Sbjct  4     VEIPSYFLCPISLQIMRDPVTLTTGISYERESIERWIFSGKHEICPVTKQPLPDLELTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC AN ++G+ER PTP+ P D   + +LL +A    S +++       +  
Sbjct  64    HTLRRLIQAWCAANASYGIERFPTPRPPVDKAQIAALLDEAKLPHSQMSALRKLKAIVSE  123

Query  620   lardsDKNRSVISANNARQVLLSIVFSNM-------------------DSNSSELTHEAL  742
               R     R V+ A+ A   L S++  +                     S+ +  + EAL
Sbjct  124   SER---NKRCVVEASGAVDFLASLIKKSKSNPREHEQEGIISINDAIDQSSQNTASDEAL  180

Query  743   SILSMFQLSEAECV-FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRS  919
             SIL   Q+SE   +  + S+ D +  L ++L   +   R  +  L++S+V+      L  
Sbjct  181   SILYSLQISEQSLLHLIESNNDIIESLTTILRRSNYRSRAYAILLLKSLVSVIAPSRL--  238

Query  920   QISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RL  1096
               S + E F+ +V +L    +H +A +  ++ L  L    +++ KAV AGAV+ +IE  L
Sbjct  239   -TSFSQEFFEEVVSVLRDQISH-QAARAALQVLGVLSPWGRNKVKAVEAGAVQVVIELLL  296

Query  1097  QYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl  1276
                E+   E  L  ++ LC    G A    HA  + ++ K ++ ++  A+E A   L S+
Sbjct  297   DETERRACEVMLVVLDRLCGCAEGRAEMVGHAAGLAVVSKKVVGVTQVASERAVRILYSV  356

Query  1277  csssEQ--AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                S       + V  GV+T+L + +Q    E+AK KA+ +L+L    W
Sbjct  357   ARFSPTPAVLHEMVQVGVVTKLCMFLQMESGEKAKEKAKEILRLHSKVW  405



>ref|XP_007152651.1| hypothetical protein PHAVU_004G147500g [Phaseolus vulgaris]
 gb|ESW24645.1| hypothetical protein PHAVU_004G147500g [Phaseolus vulgaris]
Length=437

 Score =   172 bits (435),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 143/411 (35%), Positives = 216/411 (53%), Gaps = 22/411 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P HFRCPISL+LM+DPVT+ TG TYDR ++E W   GN TCPVT   + +F +IPNH
Sbjct  24    VVVPNHFRCPISLDLMKDPVTLSTGITYDRENVERWFEEGNITCPVTNQVVRNFDMIPNH  83

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
             +LR ++Q+WCV NR  GVERIPTP+ P  P  V  LL Q    +  L+    L  L+R++
Sbjct  84    SLRIMVQDWCVENRQHGVERIPTPRIPISPIEVAELLMQVKDSARVLDQYGCLELLQRMK  143

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILS-MFQLSEAEC  781
                 +S++N+  I  N A  V L+  F    ++S E    +  E LS L+ MF L + E 
Sbjct  144   KWGGESERNKRCIVDNGA-PVALASSFDAFANDSVERNVVVLEEILSALNWMFPL-QLEA  201

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA--GTKSPELRSQISNADEIFQGI  955
                   L  +  +V  L H  +  +  S   ++ +++    +  E  SQI   +E+   +
Sbjct  202   HKSLGSLASLSCMVWFLKHQDLSGKEKSIVALKELLSFGDVQHVEALSQIEGVNEL---L  258

Query  956   VGILNH--PSTHPRALKMGVKALFALCLVKQHRQKAVIA--GAVEALIERLQYLEKCDTE  1123
             V ++N    ST  +A    V  L +       + K      G V +L++ L   +K   E
Sbjct  259   VELINKRVSSTITKASLRVVWYLVSSSSNSSEKMKLAFVELGLVSSLLDILIDSDKSRYE  318

Query  1124  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR  1303
             +ALA ++ LC    G      + LT+PLLVK IL+IS   T+Y+  AL  +C   E+ + 
Sbjct  319   KALAILDSLCSCEEGRNKACGNDLTIPLLVKKILRISPLTTDYSVSALWKVCKFGEKDEG  378

Query  1304  ----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD  1444
                 +A+  G   +LLL++Q GC +  K KA  LLKL+     +   ++SD
Sbjct  379   RTLLEALQVGAFQKLLLVLQVGCGDETKEKATELLKLMNPYRAELECIDSD  429



>ref|XP_010541793.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Tarenaya hassleriana]
Length=433

 Score =   172 bits (435),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 139/422 (33%), Positives = 213/422 (50%), Gaps = 42/422 (10%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             I++P  F CPISLE+M+DPV V TG TYDR SIE W+ +G N TCPVT+  +TD    PN
Sbjct  5     IEVPPFFLCPISLEIMKDPVIVSTGITYDRESIEKWLFSGKNKTCPVTKQAVTDTDPTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++G+ERIPTPK P     ++ L+  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIRDSASSYQNQVKTLKRLRQILL  124

Query  620   lardsDKNRSVISANNARQVLLSIV----------------------FSNMDS---NSSE  724
                    NR  + A    + L  I+                      +SNM++   +S  
Sbjct  125   ENAT---NRRCLEAAGVPEFLAKILRDSIDSYNSSSSPSASNLNDLCYSNMENGFDSSKS  181

Query  725   LTHEALSILSMFQLSEA---ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAG  895
             LT EALS+L   + SE+     V   + +D V  L  ++     + R  ++ L+++++  
Sbjct  182   LTDEALSLLYNLETSESVLKNLVNNENGIDIVQLLTKIMQCGIYESRAYASLLLKNILEV  241

Query  896   TKSPELRSQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAV  1075
                 ++   I    EIF  +  IL+   +H +A K  ++ L  +C   ++R KAV AGA+
Sbjct  242   ADPMQI---IVLKTEIFTEVFQILHDQISH-KATKSALQILVNICPWGRNRHKAVEAGAI  297

Query  1076  EALIERLQYLEKCDTERALATV----ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRA  1243
               +IE L         R +  V    +LLC+   G A F  H   + ++ K IL++S  A
Sbjct  298   SVIIELLMDETFSSVRRIIEMVMVVLDLLCQCAEGRAEFLNHGAAIAVVSKKILRVSQTA  357

Query  1244  TEYaagallslcsssEQAQ--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             +E A   LLS+      A   ++ +  GV+ +L L++Q  C  + K KA+ LL+L    W
Sbjct  358   SERAVRVLLSVGRFCATASLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLRLHARVW  417

Query  1418  PD  1423
              D
Sbjct  418   RD  419



>ref|XP_010665787.1| PREDICTED: U-box domain-containing protein 20-like [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 133/401 (33%), Positives = 208/401 (52%), Gaps = 29/401 (7%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             +P HFRCPISLELM+DPVT+ TG TYDR +IE W+  GN TCP+T   L     IPNHT+
Sbjct  29    VPNHFRCPISLELMKDPVTLSTGITYDRETIEKWIEAGNVTCPMTNQVLKSLEPIPNHTI  88

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrglar  628
             RR+IQ+WCV NR+ GVERIPTP+ P +       L +  S+    N     + ++    +
Sbjct  89    RRMIQDWCVDNRSHGVERIPTPRIPINSD-EVGTLLERLSMVRSPNECRDLVAKVSEAMK  147

Query  629   dsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSM---FQLSEAECVF  787
             +S++NR  I  N A    LS+VF +   +  E    L  + +S+L+     +    E + 
Sbjct  148   ESERNRRCIIGNGAGNT-LSLVFQSFSDSEGETVISLLEDIMSLLTSVTPLEQQAQENLK  206

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSP-ELRSQISNADEIFQGIVGI  964
                 L+R   LV  L    +  R N+  +++ +V  +K   +L   +       +G+V +
Sbjct  207   SPKSLER---LVWFLIKGGLSGRRNAVMILKELVLSSKDEGKLIDSLLTIKGAMEGLVKL  263

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHR--QKAVIAGA------VEALIERLQYLEKCDT  1120
             +  P   P + K  +  ++ + +   H    K++I G       V  +++ L   EK   
Sbjct  264   IKEP-ICPASTKASLIVIYHM-ITSTHNSLSKSIIIGKFIDMSLVSLVLDILVDAEKSIC  321

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ  1300
             E+AL  ++ LC+   G  A    AL VP++VK IL++SD ATE++   L  LC + ++  
Sbjct  322   EKALGVLDGLCQSDKGRDAAYNQALAVPVVVKKILRVSDLATEFSVSILWRLCQNEDRED  381

Query  1301  R----DAVAAGVLTQLLLLVQSG--CTERAKRKAQMLLKLL  1405
                  +A+  G   +LLL++Q G    +R K K   +LKLL
Sbjct  382   GGVLVEALQVGAFQKLLLVLQVGWNINDRIKEKVTKILKLL  422



>ref|XP_004494254.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Cicer arietinum]
Length=419

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 138/410 (34%), Positives = 216/410 (53%), Gaps = 22/410 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFT-LIP  436
             I++P  F CPISLE+M+DPVTV TG TYDR SIE W+ +  N TCPVT+  L D T L P
Sbjct  7     IEVPSFFVCPISLEIMKDPVTVSTGITYDRESIEKWLFSKKNITCPVTKQQLQDSTDLTP  66

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC  N + G+ERIPTPK P +   +  L+++ASS +S    ++ +L+RLR
Sbjct  67    NHTLRRLIQAWCTLNASQGIERIPTPKPPINKTQITKLINEASSHNSSPLMQIKSLKRLR  126

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSEL------THEALSILSMFQLSEA-  775
              +A  S+ N+ ++      + L S+V  N+D NS+ L        E+LSIL    +SE+ 
Sbjct  127   SIASGSETNKRIMEDAGVVEFLASVVIDNIDHNSASLLTENNPVDESLSILHNLHVSESG  186

Query  776   -ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
              + +    + + +  L  ++     + R  +  L++S+    +  +L  Q     E+F  
Sbjct  187   LKTLLCFRNGEFIESLTKVMQKGFFESRAYAVFLLKSMTEVAEPVQLLHQ---KTELFME  243

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD----T  1120
             +V +L       +  K  ++ L  LC   ++R K V AG V  LIE L  L+ C      
Sbjct  244   LVQVLKD-QISIKVSKATLQTLIVLCPWGRNRIKGVEAGTVSVLIELL--LDNCKDRKPN  300

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATE--YaagallslcsssEQ  1294
             E  L  +E LC+   G A    H   + ++ K IL++S  A +        +S  S++  
Sbjct  301   EMMLVLLENLCQCAEGRAELLRHGAGLAVVSKKILRVSSVANDRGVRILLSVSRFSATPN  360

Query  1295  AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD  1444
               ++ +  GV+ +L L++Q  C  + K KA  +LK+    W +   + S+
Sbjct  361   VVQEMLKLGVVAKLCLVLQVDCGSKTKEKASEILKMHARVWRNSPCIPSN  410



>ref|XP_003600684.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES70935.1| Avr9/Cf-9 rapidly elicited protein [Medicago truncatula]
Length=439

 Score =   171 bits (434),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 131/411 (32%), Positives = 212/411 (52%), Gaps = 31/411 (8%)
 Frame = +2

Query  227   MPASLD-PLDVGGIQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVT  403
             +P + D  L V  I IP +FRCP+SL+LM+DPVT+ TG TYDR SI+ W+  GN TCPVT
Sbjct  21    LPGAGDGELTVEEITIPTNFRCPVSLDLMKDPVTLSTGITYDRFSIDKWIEAGNKTCPVT  80

Query  404   RAPLTDFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqass--vss  577
                L+ F + PNHT+R++IQ WCV N ++G+ERIPTP+ P     V  + ++  S   + 
Sbjct  81    NQKLSTFEITPNHTIRKMIQSWCVENSSYGIERIPTPRIPVSGYEVNEVCTRLLSGCRNL  140

Query  578   hlnsrlsalrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNS----SELTHEALS  745
                  +  + +++   R+S++N+ VI  N    V L+ VF +    S      +  E L 
Sbjct  141   DEKKCVEFVGKIKIWWRESERNKRVIIGNGVSSV-LATVFDSFSCVSFEEHVVVLEEVLE  199

Query  746   ILSM-----FQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPE  910
             IL+      F  S+ +    +S L+    LV  L    +  R N+  L++ +        
Sbjct  200   ILTWIVKTSFGDSKTKMCLSSSSLN---CLVWFLDGKDLGARQNAVLLLKEMNV------  250

Query  911   LRSQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHR----QKAVIAGAVE  1078
                ++S  + + +G+V I+  P     A K  +  +F L    ++R    ++ V  G V 
Sbjct  251   --EELSRIEGVVEGLVKIVKEP-IGSSATKACLTTIFKLVSSAKNRDEISERFVELGLVS  307

Query  1079  ALIERLQYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaa  1258
              L+E +   EK   E+AL  ++ LC    G      +AL +PL++K +L++S  A+ +A 
Sbjct  308   FLLETIVDGEKGICEKALGVLDCLCDCKKGKEVVQTNALALPLVIKKLLRVSPLASSFAV  367

Query  1259  gallsl--csssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             G +  +      E+   +A+  G   +LL+++Q GC E+ K     LLKLL
Sbjct  368   GIVRKILCEKKEERVLIEAIQLGAFQKLLVMLQVGCEEKTKENTTELLKLL  418



>ref|XP_003537115.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=420

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 141/404 (35%), Positives = 208/404 (51%), Gaps = 24/404 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG---NTTCPVTRAPLTDFTLI  433
             I +P  F CPISLELM+DPVTV TG TYDR SIE W+      N TCPVT+ PL    L 
Sbjct  4     IDVPPFFVCPISLELMKDPVTVSTGITYDRHSIEKWLFAAVPKNNTCPVTKQPLLP-DLT  62

Query  434   PNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrl  613
             PNHTLRRLIQ WC  N + GV+RIPTPK P D  L++ LL  AS+  S      S     
Sbjct  63    PNHTLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRDASASDSPSLQLRSLRTLK  122

Query  614   rglardsDKNRSVISANNARQVLLSIVFSNMDSN-------------SSELTHEALSILS  754
                +      R + SA +A   L S + + +                 + + HEALS+L 
Sbjct  123   SIASESQSNKRCIESAKDAVSFLASFITTTVTVTTTTVLLDDVELEIKTSIAHEALSLLH  182

Query  755   MFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNA  934
               QLSE+    + +  + +  L  ++     + R  +  L+ S ++    P L   +   
Sbjct  183   SIQLSESGLKALMNHPEFINSLTKIMQSGIYESRAYAVFLLNS-LSEVADPALLVNLK--  239

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEK  1111
              ++F  +V +L    +  +A K  ++AL  +C   ++R KAV AGAV  L+E  L+  E+
Sbjct  240   IDLFTELVQVLKDQVSE-KASKATLRALIQVCPWGRNRVKAVEAGAVPVLVELLLECKER  298

Query  1112  CDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl--css  1285
                E  L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LLS+   S+
Sbjct  299   KPIEMMLVLLEILCQSADGRAGLLAHAAGVAIVAKKILRVSTMANDRAAKILLSVCRFSA  358

Query  1286  sEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             +    ++ +  GV+ ++ L++Q     +AK KA+ +LKL    W
Sbjct  359   THGVVQEMLQLGVVAKMCLVLQVDSGNKAKEKAREILKLHARAW  402



>ref|XP_003533316.1| PREDICTED: U-box domain-containing protein 21-like [Glycine max]
Length=438

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 142/396 (36%), Positives = 208/396 (53%), Gaps = 24/396 (6%)
 Frame = +2

Query  272   PYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTLR  451
             P HFRCPISL+LM+DPVT+ TG TYDR S+E W   GN TCPVT   + +F +IPNH+LR
Sbjct  28    PNHFRCPISLDLMKDPVTLSTGITYDRESVEMWFDEGNITCPVTNQVVRNFDMIPNHSLR  87

Query  452   RLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgla  625
              +IQ+WCV NR  GVERIPTP+ P     V  LL    + S+ L+    L  +++L+   
Sbjct  88    VMIQDWCVENRQHGVERIPTPRIPIGSIEVAELLMLVKASSTDLDQYGCLELVQKLKRWG  147

Query  626   rdsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILS-MFQLSEAECVFV  790
              +S++N+  I  N A  V L+  F    ++S E    L  E LS L+ MF L + E    
Sbjct  148   GESERNKRCIVDNGA-PVALASSFDAFANDSIERNVVLLEEILSALNWMFPL-QLEAHKS  205

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVV--AGTKSPELRSQISNADEIFQGIVGI  964
                L  +  +V  L H  +  +  S   ++ ++     K  E  SQI   +E+   +V  
Sbjct  206   LGSLASLRCMVWFLKHQDLSGKEKSIVALKELLKFGDVKHLEALSQIEGVNEL---LVEF  262

Query  965   LNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEALIERLQYLEKCDTERA  1129
             +N     P   K  + A++ L         + R K V  G V +L++ L   +K   E+A
Sbjct  263   INK-RISPTITKASLSAVWYLVSSSSNSSDKMRLKFVELGLVSSLLDILIDSDKSMCEKA  321

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR--  1303
             +  ++ LC    G      + LT+PLLVK IL++S   T+Y+  A+  LC   E+ +   
Sbjct  322   VTILDSLCSSEEGRNKACGNDLTIPLLVKKILRVSPLTTDYSVSAIWKLCKFGEKDEGRT  381

Query  1304  --DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
               +A+  G   +LLL++Q GC +  K KA  LLKLL
Sbjct  382   LVEALQVGAFQKLLLVLQVGCGDETKEKATELLKLL  417



>gb|KHN08793.1| U-box domain-containing protein 21 [Glycine soja]
Length=431

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 200/392 (51%), Gaps = 21/392 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HF CP+SLELM DPVT+ TG TYDR SIE W+  GN TCPVT   LT F +IPNH
Sbjct  27    VVIPNHFHCPVSLELMTDPVTLSTGITYDRVSIEKWIEGGNRTCPVTNQVLTTFDIIPNH  86

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsalrrlr  616
              +RR+IQ+WCV N ++G++RIPTP+ P  A           ++            + +++
Sbjct  87    AIRRMIQDWCVENSSYGIDRIPTPRIPISAYEVSDTCTRILSACQRGDDKRCQELVGKIK  146

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE-----LTHEALSILSMFQLSEAEC  781
               +R+S++N+  I    A  V L+  F    SNS E     L      +  M  L E E 
Sbjct  147   VWSRESERNKRCIVGAGAGAV-LAYAFDCFSSNSIEKHVVLLEEVLEVMTWMVPLGE-EG  204

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             V   S    +  LV  L    +  R ++A L++ V           +++   E+ + +V 
Sbjct  205   VSKLSSGASLNSLVWFLEGKDLASRQSAALLLKEVCV--------QELAKVGEVVEALVK  256

Query  962   ILNHP--STHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDTERAL  1132
             ++  P  ST  +A    +  L +L   ++   Q+ V  G V  L+E +   EK   E+AL
Sbjct  257   MVREPIGSTSTKACLATIFNLVSLAANREGIAQRFVELGLVSLLLEAIVDGEKGVCEKAL  316

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-DA  1309
               ++ +C    G     ++AL +PL+V+ +L++S  A+ +A   L  +C   E+    +A
Sbjct  317   GVLDCICDCEKGKEVVKSNALALPLVVRKLLRVSPLASGFAVSILRKICDKREEGILIEA  376

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             +  G+  +LL+L+Q GC E  K  A  LLKLL
Sbjct  377   LQVGLFQKLLVLLQVGCDESTKENATGLLKLL  408



>ref|XP_010279125.1| PREDICTED: U-box domain-containing protein 21-like [Nelumbo nucifera]
Length=440

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 136/416 (33%), Positives = 210/416 (50%), Gaps = 31/416 (7%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCPISLELM+DPVT+ TG TYDR SIE+W+ +GN TCPVT   L     IPNH
Sbjct  29    VTIPTHFRCPISLELMKDPVTLSTGITYDRESIETWIESGNQTCPVTNQVLRSLDQIPNH  88

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlr  616
              +R++IQ+WCV NR+FGVERIPTP+ P  P  V  +LS+ +  +   +       + +++
Sbjct  89    AIRKMIQDWCVENRSFGVERIPTPRIPVTPFEVSQILSRITDAARRGDQSGCQELVVKIK  148

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVAS  796
              L ++S++N+  I  N   +VL +   +   ++  + T     ILS           +  
Sbjct  149   NLGKESERNKRCIVGNGTGRVLAATFEAFAAASFEKNTDVLEEILSALTW------MLPL  202

Query  797   DLDRVGYL---------VSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQ  949
             DL+   YL         V       +  R N+  +++ + +  +   L ++   A E   
Sbjct  203   DLEAQSYLGLPAPLRCMVWFSKSGGLSGRQNAVLVLKELSSDQRHVSLLARTEGASE---  259

Query  950   GIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERA  1129
              +V ++  P   P A K  +  ++ +        K + +  V+  +  L      D++++
Sbjct  260   ALVKLIKEP-ICPTATKASLVVIYRMVSSSVSSDK-IRSRFVDMDLISLLLDILVDSDKS  317

Query  1130  L-----ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQ  1294
             L       ++ LC          AHALT+P+LVK IL+ISD ATE+    L  LC + + 
Sbjct  318   LCEKALGVLDGLCSCQEAREKAYAHALTMPVLVKKILRISDLATEFTVSILWKLCKNKKI  377

Query  1295  AQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDDF  1450
              +     +A+  G   +LLLL+Q GC ER K KA  LLKLL         ++S DF
Sbjct  378   DEGSILVEALQVGAFQKLLLLLQVGCGERTKEKATELLKLLNLYRGKLECIDSMDF  433



>gb|KDP34438.1| hypothetical protein JCGZ_12798 [Jatropha curcas]
Length=395

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 225/406 (55%), Gaps = 33/406 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP+ F CPISL+L +DPVT+CTGQTYDR+SIE W++TGN TCPVT   L D +++PNH
Sbjct  1     MTIPHLFICPISLDLFKDPVTLCTGQTYDRSSIEKWLSTGNLTCPVTMQKLHDISMVPNH  60

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLR LI EW                   DP  ++++ S AS   S +++ ++  ++ + L
Sbjct  61    TLRHLIDEWLKMGPQL------------DPDYLKTIDSLASLKHSLVSNEVTLEKKFQAL  108

Query  623   ardsDKNRSVISANNAR------QVLLSIVFSNMDSNSSE----LTHEALS-ILSMFQ-L  766
                   +  +IS N+         +L  +VF +++S  S+       ++LS IL +   L
Sbjct  109   KSIQSLSDELISRNSCLIQLGFLPLLFELVFGSVESKLSQESINFAEKSLSSILKLLPIL  168

Query  767   SEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIF  946
              E E +    +  ++     LL   S  ++     LIE + +  ++ EL + I    +I 
Sbjct  169   GELESLNTLKEESKLESFRILLEQGSSMMQEGLCHLIEGISSSLETKELCAIIGENRQIL  228

Query  947   QGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
             QG++ ++   S  P A   G+KA++ALC ++ +R+  V AG +  L+  +   E+ +  R
Sbjct  229   QGLILLVQQTSGVPEA---GIKAIYALCSLESNRENLVQAGVINGLLMYISNTERRENVR  285

Query  1127  -----ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISD-RATEYaagallslcsss  1288
                  A+AT+E+L R+ +   A   +   V  LVK++ ++SD   +E A  +L+ +CS S
Sbjct  286   NLAPKAMATIEILLRVETAKDAVINNPNGVSSLVKMVFRVSDHEGSESAVRSLMVICSDS  345

Query  1289  EQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD  1426
              QA+ +A+  GVLTQLLLL+QS C+ R K  A+MLLKLLR  W ++
Sbjct  346   LQAREEAICRGVLTQLLLLLQSQCSVRTKTNARMLLKLLRSKWNEE  391



>ref|XP_010106989.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC12987.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=419

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 215/410 (52%), Gaps = 36/410 (9%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             I +P  F CPISLE+M+DPVTV TG TYDR SIE W+ +G N TCPVT+  L+D  L PN
Sbjct  5     IDVPPFFLCPISLEIMKDPVTVLTGITYDRESIEKWLFSGKNDTCPVTKQVLSDSDLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N A G+ERIPTPK P         +++  S +    S++  LRRLR 
Sbjct  65    HTLRRLIQAWCTMNAALGIERIPTPKPPISKS----QIAKLLSDAKSPQSQIKCLRRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSN-------SSE----------LTHEALSI  748
             +A +S+ N+  + +  A + L+S++ ++ + N       SSE           + EAL+I
Sbjct  121   IAAESETNKRCLESAGAVEFLVSLIANDNNENAVSSPLSSSENDESFDFARSASDEALTI  180

Query  749   LSMFQLSEAECVFVASDLDRVGYLVSLLS----HPSIDVRVNSAALIESVVAGTKSPELR  916
             L    LSE     +   +DR G  V  L+      S D R  S  L++S+        + 
Sbjct  181   LHNLHLSE---TVLKKLIDRNGEFVDSLTRVMRQGSYDSRAYSIMLLKSMFDVADPMRM-  236

Query  917   SQISNADEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-R  1093
               IS   E +  +V IL      P+A K  ++ L  LC   ++R KAV AGAV  LIE  
Sbjct  237   --ISLRTEFYAELVQILRD-QISPQASKAALQLLVQLCPWGRNRIKAVEAGAVAVLIELL  293

Query  1094  LQYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagalls  1273
             L  +E+   E  L  ++L+C    G A    HA  + ++ K +L++S   +E A   L S
Sbjct  294   LDSVERRPCEMILTGLDLMCGCAEGRAELIRHAAGLAVVSKRVLRVSHIGSEKAMRILFS  353

Query  1274  lc--sssEQAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
             +   S++     + +  GV+ +L L++Q  C  + K KA+ +L+L    W
Sbjct  354   VARFSATPAVLAEMLQLGVVAKLCLVLQVDCGGKTKEKAREILRLHARTW  403



>ref|XP_003530079.1| PREDICTED: U-box domain-containing protein 21-like [Glycine max]
Length=437

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 213/410 (52%), Gaps = 25/410 (6%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HFRCPISL+LM+DPVT+ TG TYDR S+E W   GN TCPVT   + +F +IPNH+L
Sbjct  27    IPNHFRCPISLDLMKDPVTLSTGITYDRESVERWFDEGNITCPVTNQVVRNFDMIPNHSL  86

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             R +IQ+WCV NR  GVERIPTP+ P  P  V  LL Q  + +  L+    L  +++L+  
Sbjct  87    RIMIQDWCVENRQHGVERIPTPRIPISPNEVAELLMQVKASARGLDQYGCLKLVQKLKRW  146

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILS-MFQLSEAECVF  787
               +S++N+  I  N A  V L+  F    ++S E    +  E LS L+ MF L + E   
Sbjct  147   GGESERNKRCIVDNGA-PVALASSFDAFANDSVERNVVVLEEILSALNWMFPL-QLEAHK  204

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA--GTKSPELRSQISNADEIFQGIVG  961
                 L  +  +V  L H  +  +  S   ++ +++    +  E  SQI   + + + I  
Sbjct  205   SLGSLASLRCMVWFLKHQDLSGKEKSIVALKELLSFGDVQHVEALSQIEGVNVLLEFI--  262

Query  962   ILNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
                +    P   K  ++ ++ L        ++ R   V  G V +L++ L   +K   E+
Sbjct  263   ---NKRISPTITKASLRVVWYLVSSSSKSSEKMRLAFVELGLVSSLLDILIDSDKSLCEK  319

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-  1303
             A A ++ LC    G      + LT+PLLVK IL++S   T+Y+  A+  LC   E+ +  
Sbjct  320   AAAILDSLCSSEEGRNKACGNDLTIPLLVKKILRVSPLTTDYSVSAIWKLCKFGEKDEGR  379

Query  1304  ---DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD  1444
                +A+  G   +LLL++Q GC +  K KA  LLK L     +   ++SD
Sbjct  380   TLVEALQVGAFQKLLLVLQVGCGDETKEKATELLKFLNPYRAELECIDSD  429



>ref|XP_006295808.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
 gb|EOA28706.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
Length=408

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 130/397 (33%), Positives = 209/397 (53%), Gaps = 17/397 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ ++    CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSSKKNLCPVTKLDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ LL  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRPPICKAEIEKLLRDSASSHQNQVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASD  799
                    N+  + A    + L +IV ++ ++     T EAL++L   + SEA    + ++
Sbjct  125   ENAT---NKRCLEAAGVPEFLANIVSNDSENGLGSFTDEALNLLYHLETSEAVLKNLLNN  181

Query  800   L---DRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
                 D V  L  ++     + RV +  L+++++      ++   ++   E+F  +V IL+
Sbjct  182   KKGNDIVKSLTKIMQRGIYESRVYATLLLKNILEVADPMQI---MTLKPEVFTEVVEILD  238

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALAT  1138
                +  +A K  +  L  +C   ++R KAV AG +  +IE L       ++   E A+  
Sbjct  239   DRISR-KATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSSDRRGPEMAMVV  297

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+           + +
Sbjct  298   LDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKYCATPALLNEML  357

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
               GV+++L L++Q  C  + K KA+ LLKL    W D
Sbjct  358   QLGVVSKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  394



>gb|KHN25100.1| U-box domain-containing protein 21 [Glycine soja]
Length=437

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 213/410 (52%), Gaps = 25/410 (6%)
 Frame = +2

Query  269   IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTL  448
             IP HFRCPISL+LM+DPVT+ TG TYDR S+E W   GN TCPVT   + +F +IPNH+L
Sbjct  27    IPNHFRCPISLDLMKDPVTLSTGITYDRESVERWFDEGNITCPVTNQVVRNFDMIPNHSL  86

Query  449   RRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgl  622
             R +IQ+WCV NR  GVERIPTP+ P  P  V  LL Q  + +  L+    L  +++L+  
Sbjct  87    RIMIQDWCVENRQHGVERIPTPRIPISPNEVAELLMQVKASARGLDQYGCLKLVQKLKRW  146

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILS-MFQLSEAECVF  787
               +S++N+  I  N A  V L+  F    ++S E    +  E LS L+ MF L + E   
Sbjct  147   GGESERNKRCIVHNGA-PVALASSFDAFANDSVERNVVVLEEILSALNWMFPL-QLEAHK  204

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVA--GTKSPELRSQISNADEIFQGIVG  961
                 L  +  +V  L H  +  +  S   ++ +++    +  E  SQI   + + + I  
Sbjct  205   SLGSLASLRCMVWFLKHQDLSGKEKSIVALKELLSFGDVQHVEALSQIEGVNVLLEFI--  262

Query  962   ILNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEALIERLQYLEKCDTER  1126
                +    P   K  ++ ++ L        ++ R   V  G V +L++ L   +K   E+
Sbjct  263   ---NKRISPTITKASLRVVWYLVSSSSKSSEKMRLAFVELGLVSSLLDILIDSDKSLCEK  319

Query  1127  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-  1303
             A A ++ LC    G      + LT+PLLVK IL++S   T+Y+  A+  LC   E+ +  
Sbjct  320   AAAILDSLCSSEEGRNKACGNDLTIPLLVKKILRVSPLTTDYSVSAIWKLCKFGEKDEGR  379

Query  1304  ---DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD  1444
                +A+  G   +LLL++Q GC +  K KA  LLK L     +   ++SD
Sbjct  380   TLVEALQVGAFQKLLLVLQVGCGDETKEKATELLKFLNPYRAELECIDSD  429



>ref|XP_003522485.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=393

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 130/402 (32%), Positives = 210/402 (52%), Gaps = 34/402 (8%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I IP+ FRCPISL+L  DPVT+CTGQTYDR+SIE W +TGN TCPVT   L D +++PNH
Sbjct  8     ITIPHLFRCPISLDLFEDPVTLCTGQTYDRSSIEKWFSTGNLTCPVTMQKLHDPSIVPNH  67

Query  443   TLRRLIQEWCVANRAFG----VERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrr  610
             TLR LI +W      FG    ++ +   K   +   +++ L     +    +   S    
Sbjct  68    TLRHLIDQWLQLGPQFGNSATIDYLAALKHTLESPQLENKLQALEKIRVLSDEYCSF---  124

Query  611   lrglardsDKNRSVISANNARQVLLSIVFSNMDSNSS--ELTHEALS-ILSMFQLSEAEC  781
                        +S     +   +LL +VF +  S S   E T  ALS IL +  L   E 
Sbjct  125   ----------RKSYFHQLSFLPLLLELVFGSRLSKSHNREFTELALSCILKLLPLVSLEP  174

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             + +  D  ++   + L    +  V+ +   +I+S +A  ++ E+   + ++ ++   IV 
Sbjct  175   LNMIKDESKLATFLLLFEKGTSSVKTSLCHIIDS-IASPQTEEVCHMLGHSHKLVHEIVV  233

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTER-----  1126
             ++     +    K+ +KA+ ALC ++ +R+  V  GA++ +I    Y+  C+T +     
Sbjct  234   LVRQ---NCEVSKVAIKAMLALCSLQSNRENLVREGAIDGVI---TYISGCETRQKNAAP  287

Query  1127  -ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDR-ATEYaagallslcsssEQAQ  1300
              A+A ++ L  + S   A   H   V  LVK++ ++ ++  +E A G L  +C    +A+
Sbjct  288   LAMAIIKKLLVLESAKEALVNHPNGVETLVKMVFRVCNQECSESAVGILAIICCDFGRAR  347

Query  1301  RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD  1426
              +A+ AGVLTQLL L+QS C  + K KA+MLLKLLR  W ++
Sbjct  348   EEAIEAGVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWIEE  389



>ref|NP_181137.2| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
 sp|Q84TG3.1|PUB23_ARATH RecName: Full=E3 ubiquitin-protein ligase PUB23; AltName: Full=Plant 
U-box protein 23; AltName: Full=U-box domain-containing 
protein 23 [Arabidopsis thaliana]
 gb|AAO64764.1| At2g35930 [Arabidopsis thaliana]
 dbj|BAE99354.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09178.1| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
Length=411

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 134/397 (34%), Positives = 208/397 (52%), Gaps = 19/397 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+  G   +CPVT+  +TD  L PN
Sbjct  10    IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDADLTPN  69

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+  ++S   +    L  LR++  
Sbjct  70    HTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCLKRLRQIVS  129

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASD  799
                    N+  + A    + L +IV SN DS +  LT EAL++L   + SE     + ++
Sbjct  130   ENAT---NKRCLEAAGVPEFLANIV-SN-DSENGSLTDEALNLLYHLETSETVLKNLLNN  184

Query  800   LDR---VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
                   V  L  ++     + RV +  L+++++   +  +    ++   E+F  +V IL+
Sbjct  185   KKDNNIVKSLTKIMQRGMYESRVYATLLLKNIL---EVADPMQSMTLKPEVFTEVVQILD  241

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALAT  1138
                +  +A K  +  L  +C   ++R KAV AG +  +IE L       E+   E A+  
Sbjct  242   DRISQ-KATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEMAMVV  300

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+           + +
Sbjct  301   LDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEML  360

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
               GV+ +L L++Q  C  + K KA+ LLKL    W D
Sbjct  361   QLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  397



>gb|KHN48421.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=416

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 140/401 (35%), Positives = 208/401 (52%), Gaps = 22/401 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             I +P  F CPISLELM+DPVTV TG TYDR SIE W+   + TCPVT+ PL    L PNH
Sbjct  4     IDVPPFFVCPISLELMKDPVTVSTGITYDRHSIEKWL-FADDTCPVTKQPLLP-DLTPNH  61

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLRRLIQ WC  N + GV+RIPTPK P D  L++ LL  AS+  S      S        
Sbjct  62    TLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRDASASDSPSLQLRSLRTLKSIA  121

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSN-------------SSELTHEALSILSMFQ  763
             +      R + SA +A   L S + + +                 + + HEALS+L   Q
Sbjct  122   SESQSNKRCIESAKDAVSFLASFITTTVTVTTTTVLLDDVELEIKTSIAHEALSLLHSIQ  181

Query  764   LSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             LSE+    + +  + +  L  ++     + R  +  L+ S ++    P L   +    ++
Sbjct  182   LSESGLKALMNHPEFINSLTKIMQSGIYESRAYAVFLLNS-LSEVADPALLVNLKI--DL  238

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDT  1120
             F  +V +L    +  +A K  ++AL  +C   ++R KAV AGAV  L+E  L+  E+   
Sbjct  239   FTELVQVLKDQVSE-KASKATLRALIQVCPWGRNRVKAVEAGAVPVLVELLLECKERKPI  297

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl--csssEQ  1294
             E  L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LLS+   S++  
Sbjct  298   EMMLVLLEILCQSADGRAGLLAHAAGVAIVAKKILRVSTMANDRAAKILLSVCRFSATHG  357

Query  1295  AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
               ++ +  GV+ ++ L++Q     +AK KA+ +LKL    W
Sbjct  358   VVQEMLQLGVVAKMCLVLQVDSGNKAKEKAREILKLHARAW  398



>gb|AAD21464.1| unknown protein [Arabidopsis thaliana]
Length=406

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 134/397 (34%), Positives = 208/397 (52%), Gaps = 19/397 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+  G   +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASD  799
                    N+  + A    + L +IV SN DS +  LT EAL++L   + SE     + ++
Sbjct  125   ENAT---NKRCLEAAGVPEFLANIV-SN-DSENGSLTDEALNLLYHLETSETVLKNLLNN  179

Query  800   LDR---VGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
                   V  L  ++     + RV +  L+++++   +  +    ++   E+F  +V IL+
Sbjct  180   KKDNNIVKSLTKIMQRGMYESRVYATLLLKNIL---EVADPMQSMTLKPEVFTEVVQILD  236

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALAT  1138
                +  +A K  +  L  +C   ++R KAV AG +  +IE L       E+   E A+  
Sbjct  237   DRISQ-KATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEMAMVV  295

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+           + +
Sbjct  296   LDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEML  355

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
               GV+ +L L++Q  C  + K KA+ LLKL    W D
Sbjct  356   QLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  392



>ref|XP_003518177.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=418

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 144/402 (36%), Positives = 205/402 (51%), Gaps = 22/402 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV--ATGNTTCPVTRAPLTDFTLIP  436
             I +P  F CPISLELM+DPVTV TG TYDR SIE W+     N TCPVT+ PL    L P
Sbjct  4     IDVPPFFVCPISLELMKDPVTVSTGITYDRDSIEKWLFAEVKNDTCPVTKQPLLP-DLTP  62

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC  N + GV+RIPTPK P D  L++ LL   S+  S      S      
Sbjct  63    NHTLRRLIQAWCTVNASHGVQRIPTPKPPVDKTLIEKLLRNTSASDSPSLQLRSLRTLKS  122

Query  617   glardsDKNRSVISANNARQVL------LSIVFSNMDSNSSEL------THEALSILSMF  760
               +      R + SA  A   L       +   +N+  +  EL       HEALS+L   
Sbjct  123   IASESQSNKRCIESAEGAVNFLATIITTTTTTTTNLLDDDIELEIKTSTAHEALSLLHSI  182

Query  761   QLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             QLSE+    + +  + +  L  ++     + R  +  L+ S+       +L   I+   +
Sbjct  183   QLSESGLKALLNHPEFINSLTKMMQRGIYESRAYAVFLLNSLSEVADPAQL---INLKTD  239

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCD  1117
             +F  +V +L    +  +  K  ++AL  +C   ++R KAV AGAV  L+E  L+  E+  
Sbjct  240   LFTELVQVLKDQVSE-KVSKATLQALIQVCSWGRNRVKAVEAGAVPVLVELLLECNERKP  298

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E  L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LLS+C  S   
Sbjct  299   IEMVLVLLEILCQSADGRAGLLAHAAGVVIVAKKILRVSTMANDRAAKILLSVCRFSPTP  358

Query  1298  Q--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                ++ V  GV+ +L L++Q     +AK KA+ +LKL    W
Sbjct  359   GLVQEMVQLGVVAKLCLVLQVDSGNKAKEKAREILKLHARAW  400



>ref|XP_007145787.1| hypothetical protein PHAVU_007G267700g [Phaseolus vulgaris]
 gb|ESW17781.1| hypothetical protein PHAVU_007G267700g [Phaseolus vulgaris]
Length=411

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 142/400 (36%), Positives = 214/400 (54%), Gaps = 21/400 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I +P  F CPISLELM+DPVTV TG TYDR SIE W+ A+ N TCPVT+ PL    L PN
Sbjct  4     IDVPPFFLCPISLELMKDPVTVSTGITYDRHSIEKWLFASNNATCPVTKQPLLP-DLTPN  62

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N + G++RIPTPK P D      + +     S   N +L  LR L+ 
Sbjct  63    HTLRRLIQAWCTVNASHGIQRIPTPKPPVD---KTIIQNLLKDASGSPNLQLQCLRTLKS  119

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSN---------SSELTHEALSILSMFQLSE  772
             +A +S  N+  I +  A + L S++ + ++S           + +  EALS+L   QLSE
Sbjct  120   IASESQTNKRSIESAGAVKFLASVITNTINSCLDDDVELELKASVADEALSLLHNIQLSE  179

Query  773   AECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQG  952
                  + S  +    L  ++     + R  +  L++S+       +L   I+   E+F  
Sbjct  180   PGLKTLLSHPEFTHSLTKVMQKGIYESRAYAVFLLKSLSEVADPVQL---INLKPELFIE  236

Query  953   IVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDTERA  1129
             +V +L    +  +A K  ++ L  +C   ++R KAV AGAV  ++E  L+  E+   E  
Sbjct  237   LVQVLKDQISQ-KASKATLQTLIQVCPWARNRVKAVEAGAVPVIVELLLECRERKPCEMM  295

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallsl--csssEQAQR  1303
             L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LL++   S++    +
Sbjct  296   LVLLEILCQSADGRAELLAHAAGVAIVAKKILRVSTTANDRAAKILLAVCRFSATPSVVQ  355

Query  1304  DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
             + V  GV+ +L L++Q     +AK KA+ +LKL    W +
Sbjct  356   EMVQLGVVAKLCLVLQVDSGNKAKEKAREILKLHAKAWKN  395



>ref|XP_011021738.1| PREDICTED: U-box domain-containing protein 21-like [Populus euphratica]
Length=442

 Score =   169 bits (428),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 132/421 (31%), Positives = 213/421 (51%), Gaps = 29/421 (7%)
 Frame = +2

Query  251   DVGGIQ--IPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDF  424
             ++G I+  IP HFRCPISLELM+DPVT+ +G TYDR SIE W+  GN TCPVT   L   
Sbjct  23    EMGDIEVTIPNHFRCPISLELMKDPVTMSSGITYDRESIEKWIEAGNVTCPVTNRVLRSL  82

Query  425   TLIPNHTLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrls  598
               IPNHT+R++IQ+WCVAN ++G+ERIPTP+ P  ++  L      + +  +       +
Sbjct  83    DPIPNHTIRKMIQDWCVANSSYGIERIPTPRIPVSSEEALEIHFKIKTACKNGDQIGCQN  142

Query  599   alrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILSMF--  760
                +++ LA++S++++S + A     V LS  F      S E    +  E LS L++   
Sbjct  143   LAAKIKALAKESERDKSCLVATGTAGV-LSYAFEEFSKASFEENVAVLDEILSSLAVLLH  201

Query  761   QLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESV--VAGTKSPELRSQISNA  934
                   C    + +DR+   V  L    +  R N+  +++ +  V   +  ++  +I  A
Sbjct  202   HDKATNCPGSDASIDRI---VLFLKSEDLSARRNAVLVLKELVPVLDYRKVDMFLEIEGA  258

Query  935   DEIFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-----GAVEALIERLQ  1099
                 + +  ++  P  H  A K  +  ++ +          +IA     G V  L+E L 
Sbjct  259   ---MEALFKLIKAPICHA-ATKASLMVIYHMVTSPSPSSAKIIAKFVDLGLVSLLLEMLV  314

Query  1100  YLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslc  1279
               E+   E AL  ++ +C    G      HALT+P+LV+ I ++SD A +++   L  LC
Sbjct  315   DAERSLCEEALGVLDGICGSDQGREEAYNHALTIPVLVRKIHRVSDLAMKFSVSILFKLC  374

Query  1280  sssEQAQR----DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSDD  1447
              + ++       +A+      +LL+L+Q GC ER K KA  LL++L         ++S D
Sbjct  375   MNEKRENGGVLVEAIQRNAFEKLLVLLQVGCDERTKEKATQLLRVLNAHRSSVDCIDSVD  434

Query  1448  F  1450
             F
Sbjct  435   F  435



>ref|XP_009143630.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDX75084.1| BnaA05g08300D [Brassica napus]
Length=406

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 135/397 (34%), Positives = 206/397 (52%), Gaps = 19/397 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +    +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSAKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N + GVERIPTP+ P     ++ LL  ++S   +L      LR +  
Sbjct  65    HTLRRLIQSWCTVNASHGVERIPTPRPPISKSEIEKLLKDSASSHQNLAKCFKRLRHIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASD  799
                    N+  + A    + L +IV SN DS+ S LT EALS+L     SE     + ++
Sbjct  125   ENA---SNKRCLEAAGVPEFLATIV-SNKDSSMS-LTDEALSLLYHLDTSETCLKNLLNN  179

Query  800   L---DRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILN  970
                 D V  L  +++    + R  +  L+++++      ++   ++    IF  +V IL+
Sbjct  180   KKGNDIVNSLTKIMNRGIYESRAYATLLLKNILEVADPMQI---MTLKPAIFTEVVQILD  236

Query  971   HPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERALAT  1138
                +H +A K  +  L  +C   ++R KAV AG +  +IE L       ++   E A+  
Sbjct  237   DRISH-KATKSALHILVNVCPWGRNRHKAVEAGVISMIIELLMDESFSSDRRGPEMAMVV  295

Query  1139  VELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAV  1312
             ++LLC+   G A F  H   + ++ K IL++S  A++ A   L S+           + +
Sbjct  296   LDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLFSVGRFCATPALLNEML  355

Query  1313  AAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
               GV+ +L L++Q  C  + K KA+ LLKL    W D
Sbjct  356   QLGVVAKLCLVLQVSCGSKTKEKAKELLKLHARIWRD  392



>ref|XP_011090297.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Sesamum indicum]
Length=400

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 144/394 (37%), Positives = 213/394 (54%), Gaps = 22/394 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             ++IP HF CPIS++LM+DPVTV TG TYDR SIE W+ +  N TCPVT+  L +  L PN
Sbjct  7     VEIPCHFLCPISMQLMKDPVTVSTGITYDRESIEKWLFSRKNPTCPVTKQELFNTDLTPN  66

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N AF  ERIPTPK P D      ++   +   +   S+L  L+RLR 
Sbjct  67    HTLRRLIQAWCTLN-AF--ERIPTPKPPVD---RSQIVKLLNEAKNSPKSQLVCLQRLRS  120

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAEC-VFVAS  796
             +AR ++  ++ + A  A   LLS+V  N D+ S +   EALS+L   +LS+++   F++ 
Sbjct  121   IARRNESGKNHLQAAGAVHFLLSVVRKNEDAFSRD---EALSLLQEMELSDSDLKTFLSE  177

Query  797   DLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGILNHP  976
             +   +  L+ +L       R  +  L++S        +L   I +  E+F  IV IL   
Sbjct  178   NGGILDSLIQVLETGDCQNRTVAMMLLKSAFYVADPADL---IGSRPELFTHIVHILRDR  234

Query  977   STHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCD---TERALATVEL  1147
              +  +A K  +K L  LC   ++R KAV AGAV ALIE L  LE  D    E  L  ++ 
Sbjct  235   ISQ-QATKAALKLLVELCPWGRNRIKAVDAGAVAALIELL--LETADRRACELVLTVLDQ  291

Query  1148  LCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVAAG  1321
             LC    G A    H   + ++ K IL++S  A+E     L S+   S  +   ++ +  G
Sbjct  292   LCGCAEGRAELLRHGCGLAVVSKKILRVSHAASERGVRILSSISKYSANSWVLQEMLQVG  351

Query  1322  VLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
             V ++L L++Q   + + K +A+ +L+L    W D
Sbjct  352   VASKLCLVLQVEASLKTKERAKEILRLHSRVWRD  385



>ref|XP_002267438.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=411

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 144/403 (36%), Positives = 210/403 (52%), Gaps = 24/403 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLT-DFTLIP  436
             I +P  F CPISLE+M+DPVTV TG TYDR SIE W+ +G N TCP T+  L+ D  L P
Sbjct  4     IDVPPFFLCPISLEIMKDPVTVSTGITYDRESIEKWLFSGKNNTCPATKQVLSADSDLTP  63

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRLIQ WC  N + GVERIPTPK P +    +  + +  + +     ++  + +LR
Sbjct  64    NHTLRRLIQAWCTLNASNGVERIPTPKIPIN----KIQIVKLLNDAKSPQLQMKCIGKLR  119

Query  617   glardsDKNRSVISANNARQVLLSIV----FSNMDSNSSE------LTHEALSILSMFQL  766
              LA +SD N+  I +  A + L SIV    F+  +  S +       + EALSIL    L
Sbjct  120   ALATESDANKRCIESAGAVEFLASIVSKANFTTFEEESDKGLESRSASSEALSILHYLLL  179

Query  767   SEAEC-VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEI  943
             SEA     V  + + VG LV +L   + + R  +  L+ S++      +L   I+   E 
Sbjct  180   SEAGLKKLVGKNGEFVGCLVRVLQRGNYESRAYAVMLLSSMLQVADPIQL---IALKPEF  236

Query  944   FQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCDT  1120
             F   V +L    +H +A K  +K L  +C   +++ KAV AGAV  L E  L   EK   
Sbjct  237   FVEAVQVLQDHISH-QATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEKRAC  295

Query  1121  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaa--gallslcsssEQ  1294
             E  L  ++ LC    G A    HA  + ++ K IL++S  A+E A      +S  S++  
Sbjct  296   EMILTVLDQLCGCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSATPS  355

Query  1295  AQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
               ++    GV+ +L L++Q  C  R K K + +L+L    W +
Sbjct  356   VLQEMSQLGVVAKLCLVLQVDCGSRTKEKTRDILRLHARAWKN  398



>ref|XP_002524056.1| Spotted leaf protein, putative [Ricinus communis]
 ref|XP_002524059.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38266.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38269.1| Spotted leaf protein, putative [Ricinus communis]
Length=413

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 144/404 (36%), Positives = 214/404 (53%), Gaps = 25/404 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATG-NTTCPVTRAPLTDFTLIPN  439
             I +P  F CPISL+LM DPVTV TG TYDR SIE W+  G N TCPVT+  ++D  L PN
Sbjct  4     IDVPSFFLCPISLQLMTDPVTVPTGITYDRQSIEKWLFAGKNHTCPVTKQLISDCDLTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
              TL RLIQ WC  N + GVERIPTPK P    + +  +++    +     +L  LR+LR 
Sbjct  64    LTLMRLIQSWCTLNASHGVERIPTPKPP----ISKQQIAKLLKDAKSPQQQLKCLRKLRS  119

Query  620   lardsDKNRSVISANNARQVLLSIV--FSNMDSNSSE----------LTHEALSILSMFQ  763
             +A  +D N+  + A  A + L SIV  F+++    S           L+ EALSIL   Q
Sbjct  120   IANVNDTNKRCMEAAGAVEFLASIVNNFTSLSFEESSLDGAGIEIARLSDEALSILYSLQ  179

Query  764   LSEAEC-VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             LSE+     +  + + +  L  ++ + + + R  +  L++S +      +L   +S   E
Sbjct  180   LSESGLRNLIGKNGEVIQSLTRVMQNGNYESRAYAVLLLKSALEVADPMQL---VSLRPE  236

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCD  1117
             +F  IV +L+   +H +A K  ++ L  LC   + R KA  A AV  LI+  L   EK  
Sbjct  237   LFVEIVQVLSDQISH-QASKAALQLLINLCPWGRSRLKATEAKAVSTLIDLLLDSSEKRT  295

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQA  1297
              E ALA ++LLC+   G A    H   + ++ K IL++S  A+E A   LLS+   S  +
Sbjct  296   CEMALAVLDLLCQCAEGRAELLKHGAGLAVVSKKILRVSQVASEKAVRILLSISKFSATS  355

Query  1298  Q--RDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
                 + +  GV+ +L L++Q  C  + K KA+ +LKL    W +
Sbjct  356   TVLHEMLQIGVVAKLCLVLQVDCGSKGKDKAREVLKLHARAWKN  399



>ref|XP_010260460.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=407

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 216/395 (55%), Gaps = 15/395 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP+ FRCPISL+L  DPVT+CTGQTYDR+SIE W+A GN TCPVT   L D +L+PNH
Sbjct  10    MAIPHLFRCPISLDLFTDPVTLCTGQTYDRSSIEKWLAAGNLTCPVTMQRLHDPSLVPNH  69

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
             TLR LI +W   + +F  + + T     DP L  + L           +          +
Sbjct  70    TLRHLIDQWLCMDHSFDPDYLKT----IDPDLSLTTLKHKLESQEVTLATKIGAVGKLEV  125

Query  623   ardsDKNRSVISANNARQVLLSIVF------SNMDSNSSELTHEALS-ILSMFQLSEAEC  781
                    RS +   N   ++L + F      +N+D   SEL   AL+ IL+MF  S+   
Sbjct  126   LSKDLAWRSGLIQLNFFPLILRLFFVKFTQQANLDQEDSELAEGALTCILNMFPFSKLCS  185

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             + +  +   +   + LL H +  ++ +   L+  + + +++ +L        +I +G++ 
Sbjct  186   LNMLKEDSNLASFLVLLDHGTAKIKTSLCHLVGLIASSSETRDLCVVFGQNPKILRGLIT  245

Query  962   ILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQYLEKCDTERALATV  1141
             +L+  S    A    VKA+ ALC ++ +++  V  G V+ LI  +       +  ALAT+
Sbjct  246   LLHQNSEASNA---AVKAISALCYLELNQENVVTEGGVDGLIAYISGTNISQSSMALATL  302

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDR-ATEYaagallslcsssEQAQRDAVAA  1318
             ELL  + SG  A   +  TV  LVK++ ++SD   +E A G+LL +C  S + + +A++A
Sbjct  303   ELLLGLESGKKAAVNNPSTVHALVKMVFRVSDHEGSENAVGSLLIICYDSLKVREEAISA  362

Query  1319  GVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
             GVLTQLLLL+QS C+ R+K KA++LLKLLR  W +
Sbjct  363   GVLTQLLLLLQSQCSCRSKNKARVLLKLLRSMWAE  397



>ref|XP_004297410.1| PREDICTED: U-box domain-containing protein 21-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 134/428 (31%), Positives = 208/428 (49%), Gaps = 37/428 (9%)
 Frame = +2

Query  248   LDVGG---IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLT  418
             ++ GG   + IP HFRCPISLELM DPVT+ TG TYDR SIE W+  GN TCP T   LT
Sbjct  21    VEAGGDIELTIPSHFRCPISLELMTDPVTLSTGITYDRLSIEKWIEAGNVTCPTTNQVLT  80

Query  419   DFTLIPNHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrls  598
                 IPNHT+R++IQ+WCV  ++FGVERIPTP+ P     V  +LS+ +S +   +    
Sbjct  81    TLEPIPNHTIRKMIQDWCVEKKSFGVERIPTPRIPVSSVEVAEILSRVTSAAEKKDQAGC  140

Query  599   alrrlrglardsDKNRSVISANNARQVLLSIVFSNMDSNSSELT-----HEALSILS---  754
                  +  A   +      SA N R ++ +   S + +     +     HE + +L    
Sbjct  141   RELVKKVKALTRE------SARNKRCIVANGAASALAAAFGAFSTAGGFHENVGVLEEIL  194

Query  755   -----MFQLSEAECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRS  919
                  +F L     V++ S  D +  +V  L    +  R N+  +++  ++  K     S
Sbjct  195   SALTLIFPLDAEANVYLGST-DSLHGMVRFLDGGDLSQRRNAVLVLKEALSFDKQKT--S  251

Query  920   QISNADEIFQGIVGILNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEAL  1084
              +   D   + +V ++  P   P + K  +  ++ +           +++ V  G V  L
Sbjct  252   ALEEIDGALEALVKLIKEPIC-PTSTKASLVIIYHMLNSTSSSSSNVKERLVQMGLVSML  310

Query  1085  IERLQYLEKCDTERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga  1264
              E +   E+   E+AL  ++ +C    G      +ALT+P++VK +L++SD ATE+A   
Sbjct  311   SELVVDAERSICEKALGVLDAICGSKQGREEARDNALTMPVVVKKMLRVSDLATEFAVSI  370

Query  1265  llslcsssEQAQRDA------VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDD  1426
             L  LC   ++   +       +  G   +LLLL+Q GC ER K K   LLKLL       
Sbjct  371   LWKLCKKDQREDDEGGLALEVLQVGAFQKLLLLLQVGCAERTKEKTTELLKLLNLYRARL  430

Query  1427  SIVNSDDF  1450
               ++S DF
Sbjct  431   ECIDSMDF  438



>gb|KHN43656.1| U-box domain-containing protein 20 [Glycine soja]
Length=438

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 140/396 (35%), Positives = 206/396 (52%), Gaps = 24/396 (6%)
 Frame = +2

Query  272   PYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNHTLR  451
             P HFRCPISL+LM+DPVT+ TG TYDR S+E W   GN TCPVT   + +F +IPNH+LR
Sbjct  28    PNHFRCPISLDLMKDPVTLSTGITYDRESVEMWFDEGNITCPVTNQVVRNFDMIPNHSLR  87

Query  452   RLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsr--lsalrrlrgla  625
              +IQ+WCV NR  GVERIPTP+ P     V  LL    + S+ L+    L  +++L+   
Sbjct  88    VMIQDWCVENRQHGVERIPTPRIPIGSIEVAELLMLVKASSTDLDQYGCLELVQKLKRWG  147

Query  626   rdsDKNRSVISANNARQVLLSIVFSNMDSNSSE----LTHEALSILS-MFQLSEAECVFV  790
              +S++N+  I  N A  V L+  F    ++S E    L  E LS L+ MF L + E    
Sbjct  148   GESERNKRCIVDNGA-PVALASSFDAFANDSIERNVVLLEEILSALNWMFPL-QLEAHKS  205

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVV--AGTKSPELRSQISNADEIFQGIVGI  964
                L  +  +V  L H  +  +  S   ++ ++     K  E  SQI   +E+   +V  
Sbjct  206   LGSLASLRCMVWFLKHQDLSGKEKSIVALKELLKFGDVKHLEALSQIEGVNEL---LVEF  262

Query  965   LNHPSTHPRALKMGVKALFALC-----LVKQHRQKAVIAGAVEALIERLQYLEKCDTERA  1129
             +N     P   K  +  ++ L         + R K V  G V +L++ L   +K   E+A
Sbjct  263   INK-RISPTITKASLSVVWYLVSSSSNSSDKMRLKFVELGLVSSLLDILIDSDKSMCEKA  321

Query  1130  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR--  1303
             +  ++ LC    G      + LT+PLLVK IL++S   T+Y+  A+  LC   E+ +   
Sbjct  322   VTILDSLCSSEEGRNKACGNDLTIPLLVKKILRVSPLTTDYSVSAIWKLCKFGEKDEGRT  381

Query  1304  --DAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
               +A+  G   +LLL++Q GC +  K KA  LLK L
Sbjct  382   LVEALQVGAFQKLLLVLQVGCGDETKEKATELLKFL  417



>gb|ACU18165.1| unknown [Glycine max]
Length=432

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/392 (31%), Positives = 186/392 (47%), Gaps = 22/392 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HFRCP+SLELM DPVT+ TG TYDR SIE W+   N TCPVT   LT F LIPNH
Sbjct  28    VVIPNHFRCPVSLELMTDPVTLSTGITYDRVSIEKWIEGENRTCPVTNQVLTTFDLIPNH  87

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrgl  622
              +R +IQ+WCV N ++G+ERIPTP+ P     V    ++  S       +    +     
Sbjct  88    AIRMMIQDWCVQNSSYGIERIPTPRIPISSYEVSDTCTRILSACQRGRCQELVGKIKVWG  147

Query  623   ardsDKNRSVISANNARQVLLSIVFSNMDSNSSE-----LTHEALSILSMFQLSEAECVF  787
                    R ++ A      +L+  F    SNS +     L      +  M    E E V 
Sbjct  148   RESERNKRCIVGAGAG--AVLAYAFDCFSSNSIDKHVVVLEEVLEVMTWMIPFGE-EGVS  204

Query  788   VASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGIL  967
               S    +  LV  L    +  R ++A L++ V           +++    + + +V +L
Sbjct  205   KLSSRASLNSLVWFLEGKDLASRQSAALLLKEVCV--------QELAKVGNVVEALVKML  256

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIA-----GAVEALIERLQYLEKCDTERAL  1132
               P       K  +  +F L       ++ ++      G V  L+E +   EK   E+AL
Sbjct  257   REPIGSSTPTKACLATIFNLVSSAAANREGIVQRFVELGLVSLLLEAIVDGEKGVCEKAL  316

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-DA  1309
               ++ +C    G     ++AL +PL+VK +L++S  A+ +A   L  +C   E+    +A
Sbjct  317   GVLDCICDCQKGKEVVESNALALPLVVKKLLRVSPLASSFAVSILRKICDKREEGVLVEA  376

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             +  GV  +LL+++Q GC E  K  A  LLKLL
Sbjct  377   LQVGVFQKLLVMLQVGCDESTKENATRLLKLL  408



>emb|CDX79645.1| BnaC03g19810D [Brassica napus]
Length=408

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 127/399 (32%), Positives = 207/399 (52%), Gaps = 21/399 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGN-TTCPVTRAPLTDFTLIPN  439
             I+IP  F CPISLE+M+DPV V TG TYDR SIE W+ +G   +CPVT+  +TD  L PN
Sbjct  5     IEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFSGKKNSCPVTKQDITDADLTPN  64

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTP+ P     ++ L+  ++S   +    L  LR++  
Sbjct  65    HTLRRLIQSWCTLNASYGVERIPTPRSPICKSEIEKLIKDSASSHKNQVMCLKRLRQIVS  124

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHEALSILSMFQLSEAECVFVASD  799
                    N+  +      + L +I+ +N   +S  L+ EALS+L  + L  +E V     
Sbjct  125   ENAT---NKRCLEVAGVPEFLATIISNNGFDSSMSLSDEALSLL--YHLESSETVLKNLL  179

Query  800   LDRVG-----YLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              ++ G      L  ++     + R  +  L+++++      ++   ++    +F  +V I
Sbjct  180   NNKKGGNIVKSLTKIMQRGIYESRAYATLLLKNILEVADPMQI---MTLKPSVFTEVVQI  236

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERLQ----YLEKCDTERAL  1132
             L+   +H +A K  +  L   C   ++R KAV AG +  +IE L       ++   E A+
Sbjct  237   LDDRISH-KATKAAMHILVTTCPWGRNRHKAVEAGVISVIIELLLDESFSSDRRGPEMAM  295

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RD  1306
               +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+          ++
Sbjct  296   VVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLQE  355

Query  1307  AVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPD  1423
              +  GV+ ++ L++Q  C  + K KA+ LLKL    W D
Sbjct  356   MLQLGVVEKMFLVLQVSCGSKTKEKAKELLKLHARVWKD  394



>ref|XP_009348934.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
Length=406

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 135/403 (33%), Positives = 215/403 (53%), Gaps = 17/403 (4%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLT-DFTLIP  436
             I +P  F CPISLE+M+DPVT+ TG TYDR SIE W+ ++ N TCPVT+  ++ D  + P
Sbjct  5     IDVPSFFLCPISLEIMKDPVTISTGITYDRESIEKWLFSSKNKTCPVTKQVVSEDSDITP  64

Query  437   NHTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlr  616
             NHTLRRL+Q WC  N + G+ERIPTPK P +   +  LL  A    + L   L  LR + 
Sbjct  65    NHTLRRLLQAWCTMNASHGIERIPTPKPPVNKSQIARLLRDAKKSPNGLAKCLRELRSIS  124

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSELTHE-ALSILSMFQLSEAEC-VFV  790
               +   + N+  I A  A + L S + +N+ ++   + +E ALSIL    LSE      +
Sbjct  125   SDS---EANKKSIEAAGAVEFLASTIINNIKNDRENVENEDALSILHNLNLSEDVLKTLI  181

Query  791   ASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNAD-EIFQGIVGIL  967
               + + V  L+ L+   S + R  +  L+ S+    +S    ++++N   E F  +V +L
Sbjct  182   GKEGEFVEALIKLMQRGSYESRAYAVMLLRSIFEVAES----TRMANVKPEFFAEVVQVL  237

Query  968   NHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIERL--QYLEKCDTERALATV  1141
             N   +  +A K  ++ L  LC   ++R KAV AGAV  LIE L     ++   E  L  +
Sbjct  238   NDQISQ-QASKATLQLLIQLCPWGRNRIKAVEAGAVMVLIELLLDTSSDRRTLEMTLMVL  296

Query  1142  ELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQ--RDAVA  1315
             +++C    G A    H   + ++ K I+++S  A+E A   L S+C  S  +   ++ + 
Sbjct  297   DMICGCAEGRAELLTHGAGLAVVSKKIMRVSKVASERAVRILFSICKFSATSSVLQEMMQ  356

Query  1316  AGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCWPDDSIVNSD  1444
              GV+ +L L++Q     + K KA+ +LKL    W + + + S+
Sbjct  357   LGVVAKLCLVLQVDSGSKTKDKAREVLKLHGRTWKNSTCIPSN  399



>ref|NP_001238594.1| syringolide-induced protein 13-1-1 [Glycine max]
 dbj|BAB86896.1| syringolide-induced protein 13-1-1 [Glycine max]
Length=431

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 129/392 (33%), Positives = 199/392 (51%), Gaps = 21/392 (5%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + IP HF CP+SLELM DPVT+ TG TYDR SIE W+  GN TCPVT   LT F +IPNH
Sbjct  27    VVIPNHFHCPVSLELMTDPVTLSTGITYDRVSIEKWIEGGNRTCPVTNQVLTTFDIIPNH  86

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQP--ADPGlvqsllsqassvsshlnsrlsalrrlr  616
              +RR+IQ+WCV N ++G++RIPTP+ P  A           ++            + +++
Sbjct  87    AIRRMIQDWCVENSSYGIDRIPTPRIPISAYEVSDTCTRILSACQRGDDKRCQELVGKIK  146

Query  617   glardsDKNRSVISANNARQVLLSIVFSNMDSNSSE-----LTHEALSILSMFQLSEAEC  781
               +R+S++N+  I    A  V L+  F    SNS E     L      +  M  L E E 
Sbjct  147   VWSRESERNKRCIVGAGAGAV-LAYAFDCFSSNSIEKHVVLLEEVLEVMTWMVPLGE-EG  204

Query  782   VFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVG  961
             V   S    +  LV  L    +  R ++A L++ V           +++   E+ + +V 
Sbjct  205   VSKLSSGASLNSLVWFLEGKDLASRQSAALLLKEVCV--------QELAKVGEVVEALVK  256

Query  962   ILNHP--STHPRALKMGVKALFALCLVKQH-RQKAVIAGAVEALIERLQYLEKCDTERAL  1132
             ++  P  ST  +A    +  L +L   ++   Q+ V  G V  L+E +   EK   E+AL
Sbjct  257   MVREPIGSTSTKACLATIFNLVSLAANREGIAQRFVELGLVSLLLEAIVDGEKGVCEKAL  316

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaagallslcsssEQAQR-DA  1309
               ++ +C    G     ++AL +PL+V+ +L++S  A+ +A   L  +C   E+    +A
Sbjct  317   GVLDCICDCEKGKEVVKSNALALPLVVRKLLRVSPLASGFAVSILRKICDKREEGILIEA  376

Query  1310  VAAGVLTQLLLLVQSGCTERAKRKAQMLLKLL  1405
             +  G+  +L +L+Q GC E  K  A  LLKLL
Sbjct  377   LQVGLFQKLSVLLQVGCDESTKENATGLLKLL  408



>ref|XP_011085881.1| PREDICTED: U-box domain-containing protein 21 [Sesamum indicum]
Length=443

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 218/418 (52%), Gaps = 25/418 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWVATGNTTCPVTRAPLTDFTLIPNH  442
             + +P HFRCPISL+LM+DPV++ TG TYDR SIE W+  GN TCPVT   L +F  IPNH
Sbjct  31    LTVPTHFRCPISLDLMKDPVSLSTGITYDRESIEKWMDMGNFTCPVTNQVLRNFDQIPNH  90

Query  443   TLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvss--hlnsrlsalrrlr  616
              LR++IQ+WCV ++++GVERIPTP+ P  P  V  + ++ S+ +           + ++ 
Sbjct  91    ALRKMIQDWCVEHKSYGVERIPTPRVPITPYEVSEVCARMSAAAKDGDEKKCQELVVKIM  150

Query  617   glardsDKNRSVISANNARQVLLSI--VFSNMD-SNSSELTHEALSILSM-FQLSEAECV  784
               A++S++N+  I  N     L  +  +FS+        L  E LS L+  F L E    
Sbjct  151   TSAKESERNKRCIIGNGIGSALADMFEMFSHFSVEKHVNLLKETLSALTWSFPLGEEGVS  210

Query  785   FVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADEIFQGIVGI  964
              + S +  +  + S L    +  R N   +++ ++   +       +   D I + ++ I
Sbjct  211   KLKSAIS-LRCMTSFLKDEDLSSRQNVIFVLKELILEDQG--CVDGLVEIDGIEETLLRI  267

Query  965   LNHPSTHPRALKMGVKALFALCLVKQHR----QKAVIAGAVEALIERLQYLEKCDTERAL  1132
             +  P   P+A +  +  +  + L+++       + V  G +  +++ L    K   E+AL
Sbjct  268   VKVP-ICPKATQACLVVIHNMMLLQEKSPMITLRFVQLGLIPLILDILVDGNKSMCEKAL  326

Query  1133  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaaga--llslcsssEQAQRD  1306
               ++++C +  G  +   +ALT+PLLVK IL++SD AT ++      LSL   SE A  +
Sbjct  327   GVLDIVCNLEEGRDSAYTNALTIPLLVKKILRVSDTATAFSISTLWKLSLGEISENALVE  386

Query  1307  AVAAGVLTQLLLLVQSGCTERA-KRKAQMLLKLLR------DCWPDDSIVNSDDFARS  1459
             AV  G   +LL+++Q GC ER  K K   LLK++       DC+  DS +      RS
Sbjct  387   AVELGAFQKLLVVLQVGCGERTLKEKVTELLKMMNLYRDKLDCF--DSSLGFKHLKRS  442



>ref|XP_002323382.1| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEF05143.1| U-box domain-containing family protein [Populus trichocarpa]
Length=412

 Score =   167 bits (423),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 133/402 (33%), Positives = 219/402 (54%), Gaps = 26/402 (6%)
 Frame = +2

Query  263   IQIPYHFRCPISLELMRDPVTVCTGQTYDRASIESWV-ATGNTTCPVTRAPLTDFTLIPN  439
             I++P  F CPISL++M+DPV V TG TYDR SIE W+ ++ N TCPVT+  ++   + PN
Sbjct  4     IEVPSFFLCPISLQIMKDPVIVPTGITYDRESIEKWLFSSKNDTCPVTKQVISGCEVTPN  63

Query  440   HTLRRLIQEWCVANRAFGVERIPTPKQPADPGlvqsllsqassvsshlnsrlsalrrlrg  619
             HTLRRLIQ WC  N ++GVERIPTPK P         +++  + +     +++ LR+LR 
Sbjct  64    HTLRRLIQSWCTLNASYGVERIPTPKPPISKA----QIAKLLNDAKSPEQQVTCLRKLRS  119

Query  620   lardsDKNRSVISANNARQVLLSIVFSNMDSNSSELT-----------HEALSILSMFQL  766
              A +++ N+  + A  A + L+S+  +N  S S E+T            EALSIL   Q+
Sbjct  120   FANENETNKRCMEAAGAVEFLVSM-LNNFHSLSFEVTSDDGFEISRPSDEALSILYGLQI  178

Query  767   SEA--ECVFVASDLDRVGYLVSLLSHPSIDVRVNSAALIESVVAGTKSPELRSQISNADE  940
             SE+  + + +  + + +  L  ++   + + R  +  L++S++    + +L   IS   E
Sbjct  179   SESGLKNLVMGRNGEFIETLTKVMQGGNYESRAYAVFLLKSMLEVADTLKL---ISLKHE  235

Query  941   IFQGIVGILNHPSTHPRALKMGVKALFALCLVKQHRQKAVIAGAVEALIE-RLQYLEKCD  1117
             +F  IV +L    +H +A K  ++ L +LC   ++R KA+ A AV  LI+  L   EK  
Sbjct  236   LFDEIVQVLRDQISH-QASKATLQLLISLCPWGRNRIKAIEAKAVPVLIDLLLDSPEKRT  294

Query  1118  TERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISDRATEYaa--gallslcsssE  1291
              E  L  ++LLC+   G A    H   + ++ K IL++S  A+E A      +S  S + 
Sbjct  295   CEMVLMVLDLLCQCAEGRAELLGHGAGLAIVSKKILRVSQVASERAVRIILSISKYSITT  354

Query  1292  QAQRDAVAAGVLTQLLLLVQSGCTERAKRKAQMLLKLLRDCW  1417
                ++ +  G++ +L L++Q  C  + K KA+ +LK+    W
Sbjct  355   SVLQEMLQIGIVAKLCLVLQVDCGSKIKDKAREVLKMQARVW  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791533042520