BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29262_g1_i1 len=1094 path=[1:0-1093]

Length=1094
                                                                      Score     E

ref|XP_009335335.1|  PREDICTED: late embryogenesis abundant prote...    269   2e-84   
ref|XP_002282590.1|  PREDICTED: late embryogenesis abundant prote...    265   5e-83   Vitis vinifera
emb|CAN67177.1|  hypothetical protein VITISV_037455                     264   1e-82   Vitis vinifera
ref|XP_008224307.1|  PREDICTED: late embryogenesis abundant prote...    263   2e-82   
ref|XP_008390908.1|  PREDICTED: late embryogenesis abundant prote...    263   2e-82   
ref|XP_010024280.1|  PREDICTED: late embryogenesis abundant prote...    261   2e-81   
sp|P09444.1|LEA34_GOSHI  RecName: Full=Late embryogenesis abundan...    255   4e-79   Gossypium hirsutum [American cotton]
ref|NP_188888.1|  Seed maturation protein                               253   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517129.1|  Late embryogenesis abundant protein D-34, pu...    252   5e-78   Ricinus communis
ref|XP_006299031.1|  hypothetical protein CARUB_v10015168mg             252   7e-78   
ref|XP_010488278.1|  PREDICTED: late embryogenesis abundant prote...    251   2e-77   
ref|XP_002885505.1|  predicted protein                                  251   2e-77   
ref|XP_004247663.1|  PREDICTED: late embryogenesis abundant prote...    251   3e-77   
ref|XP_006406157.1|  hypothetical protein EUTSA_v10021345mg             250   3e-77   
ref|XP_010466531.1|  PREDICTED: late embryogenesis abundant prote...    250   3e-77   
ref|XP_009775953.1|  PREDICTED: late embryogenesis abundant prote...    248   1e-76   
emb|CDY38305.1|  BnaC05g29980D                                          248   2e-76   
ref|XP_010511424.1|  PREDICTED: late embryogenesis abundant prote...    247   4e-76   
ref|XP_004496718.1|  PREDICTED: late embryogenesis abundant prote...    247   7e-76   
gb|EYU41481.1|  hypothetical protein MIMGU_mgv1a011867mg                247   8e-76   
ref|XP_004299111.1|  PREDICTED: late embryogenesis abundant prote...    246   9e-76   
ref|XP_009145325.1|  PREDICTED: late embryogenesis abundant prote...    245   3e-75   
gb|AIA57963.1|  late embryogenesis abundant protein 3                   245   4e-75   
gb|KFK39540.1|  hypothetical protein AALP_AA3G257500                    243   2e-74   
emb|CDY10647.1|  BnaA05g17150D                                          243   3e-74   
gb|AAF21311.1|  seed maturation protein PM25                            241   5e-74   Glycine max [soybeans]
ref|XP_006489400.1|  PREDICTED: late embryogenesis abundant prote...    242   6e-74   
ref|XP_007224297.1|  hypothetical protein PRUPE_ppa019572mg             241   6e-74   
ref|XP_006419945.1|  hypothetical protein CICLE_v10005469mg             243   6e-74   
gb|ABB16353.1|  seed maturation protein                                 241   7e-74   Medicago truncatula
gb|KDO74561.1|  hypothetical protein CISIN_1g038380mg                   240   3e-73   
ref|XP_004139881.1|  PREDICTED: late embryogenesis abundant prote...    239   4e-73   
gb|KEH43869.1|  late embryogenesis abundant D-like protein              239   4e-73   
ref|XP_008447154.1|  PREDICTED: late embryogenesis abundant prote...    239   6e-73   
emb|CDY10286.1|  BnaC05g29930D                                          239   7e-73   
ref|XP_010693766.1|  PREDICTED: late embryogenesis abundant prote...    239   2e-72   
ref|XP_009599420.1|  PREDICTED: late embryogenesis abundant prote...    237   5e-72   
emb|CCW28814.1|  seed maturation protein                                236   6e-72   
ref|XP_006360815.1|  PREDICTED: late embryogenesis abundant prote...    236   6e-72   
ref|XP_009586710.1|  PREDICTED: late embryogenesis abundant prote...    235   1e-71   
ref|XP_010045838.1|  PREDICTED: late embryogenesis abundant prote...    232   4e-70   
ref|NP_001237506.1|  seed maturation protein PM24                       231   6e-70   
ref|NP_188889.1|  late embryogenesis abundant protein ECP31             229   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143265.1|  hypothetical protein PHAVU_007G057900g             229   3e-69   
ref|XP_002885506.1|  ATECP31                                            229   4e-69   
ref|NP_001237967.1|  seed maturation protein PM26                       228   8e-69   
ref|XP_010041766.1|  PREDICTED: late embryogenesis abundant prote...    228   1e-68   
dbj|BAA11016.1|  LEA protein in group 5                                 228   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010256054.1|  PREDICTED: late embryogenesis abundant prote...    227   4e-68   
ref|XP_010917735.1|  PREDICTED: late embryogenesis abundant prote...    226   9e-68   
ref|XP_010096140.1|  hypothetical protein L484_005419                   228   2e-67   
ref|XP_004168899.1|  PREDICTED: late embryogenesis abundant prote...    225   7e-67   
gb|KGN56981.1|  hypothetical protein Csa_3G146660                       224   1e-66   
ref|XP_010488281.1|  PREDICTED: late embryogenesis abundant prote...    223   1e-66   
ref|XP_006382740.1|  hypothetical protein POPTR_0005s04950g             221   4e-66   
ref|XP_010466535.1|  PREDICTED: late embryogenesis abundant prote...    220   1e-65   
ref|XP_004134446.1|  PREDICTED: late embryogenesis abundant prote...    227   2e-65   
ref|XP_010932759.1|  PREDICTED: late embryogenesis abundant prote...    218   1e-64   
ref|XP_008451333.1|  PREDICTED: late embryogenesis abundant prote...    216   3e-64   
ref|XP_008811249.1|  PREDICTED: late embryogenesis abundant prote...    216   6e-64   
ref|XP_010277180.1|  PREDICTED: late embryogenesis abundant prote...    215   1e-63   
ref|XP_008438669.1|  PREDICTED: late embryogenesis abundant prote...    216   3e-63   
emb|CDY24310.1|  BnaC03g42830D                                          213   4e-63   
ref|XP_010552068.1|  PREDICTED: late embryogenesis abundant prote...    211   4e-62   
ref|XP_009370807.1|  PREDICTED: late embryogenesis abundant prote...    211   4e-62   
ref|XP_004146999.1|  PREDICTED: late embryogenesis abundant prote...    210   7e-62   
gb|ADQ91842.1|  late embryogenesis abundant protein group 5 protein     208   1e-61   
ref|XP_004169378.1|  PREDICTED: late embryogenesis abundant prote...    209   2e-61   
ref|XP_010651983.1|  PREDICTED: late embryogenesis abundant prote...    209   2e-61   
emb|CBI28707.3|  unnamed protein product                                209   5e-61   
emb|CAN76722.1|  hypothetical protein VITISV_029641                     207   8e-61   Vitis vinifera
ref|XP_010256052.1|  PREDICTED: late embryogenesis abundant prote...    207   1e-60   
ref|XP_008235307.1|  PREDICTED: late embryogenesis abundant prote...    207   1e-60   
ref|XP_004247564.2|  PREDICTED: late embryogenesis abundant prote...    207   2e-60   
gb|KDO53322.1|  hypothetical protein CISIN_1g046001mg                   206   2e-60   
ref|XP_006433071.1|  hypothetical protein CICLE_v10003643mg             206   4e-60   
ref|XP_008438670.1|  PREDICTED: late embryogenesis abundant prote...    207   5e-60   
emb|CDX92944.1|  BnaA03g36660D                                          205   6e-60   
ref|NP_001152643.1|  late embryogenesis abundant protein D-34           205   1e-59   Zea mays [maize]
gb|EYU40913.1|  hypothetical protein MIMGU_mgv1a025482mg                204   1e-59   
ref|XP_006299455.1|  hypothetical protein CARUB_v10015620mg             204   2e-59   
ref|XP_007200102.1|  hypothetical protein PRUPE_ppa019190mg             204   3e-59   
ref|XP_008355469.1|  PREDICTED: late embryogenesis abundant prote...    205   3e-59   
ref|XP_002520716.1|  Late embryogenesis abundant protein D-34, pu...    202   1e-58   Ricinus communis
emb|CAA63085.1|  LEA D34 protein homologue type 1                       200   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135809.1|  PREDICTED: late embryogenesis abundant prote...    201   2e-58   
ref|XP_008218178.1|  PREDICTED: late embryogenesis abundant prote...    201   3e-58   
ref|XP_006419946.1|  hypothetical protein CICLE_v10005699mg             201   3e-58   
ref|XP_007206587.1|  hypothetical protein PRUPE_ppa020371mg             201   3e-58   
ref|XP_006489401.1|  PREDICTED: late embryogenesis abundant prote...    201   3e-58   
ref|XP_002520715.1|  Late embryogenesis abundant protein D-34, pu...    201   3e-58   Ricinus communis
ref|XP_003559428.1|  PREDICTED: late embryogenesis abundant prote...    201   3e-58   
ref|XP_006360786.1|  PREDICTED: late embryogenesis abundant prote...    201   4e-58   
ref|XP_008797343.1|  PREDICTED: late embryogenesis abundant prote...    201   5e-58   
ref|XP_003536910.2|  PREDICTED: late embryogenesis abundant prote...    199   1e-57   
gb|KDP21437.1|  hypothetical protein JCGZ_21908                         199   1e-57   
ref|XP_004495777.1|  PREDICTED: late embryogenesis abundant prote...    199   1e-57   
dbj|BAD86645.1|  ECP31 protein                                          199   1e-57   Daucus carota [carrots]
gb|KHN03807.1|  Late embryogenesis abundant protein D-34                200   2e-57   
emb|CAA43046.1|  embryonic cell protein                                 198   3e-57   Daucus carota [carrots]
ref|XP_010326670.1|  PREDICTED: late embryogenesis abundant prote...    198   6e-57   
gb|KDO74560.1|  hypothetical protein CISIN_1g035654mg                   196   1e-56   
ref|XP_010917736.1|  PREDICTED: late embryogenesis abundant prote...    196   2e-56   
ref|XP_004290610.1|  PREDICTED: late embryogenesis abundant prote...    196   3e-56   
gb|ADQ91843.1|  late embryogenesis abundant protein group 5 protein     196   4e-56   
ref|XP_010041757.1|  PREDICTED: late embryogenesis abundant prote...    194   2e-55   
ref|XP_002463881.1|  hypothetical protein SORBIDRAFT_01g008210          192   8e-55   Sorghum bicolor [broomcorn]
ref|XP_003590628.1|  Late embryogenesis abundant protein D-34           191   2e-54   
ref|XP_003590627.1|  Late embryogenesis abundant protein D-34           192   2e-54   
ref|XP_004495192.1|  PREDICTED: late embryogenesis abundant prote...    191   2e-54   
ref|XP_011079873.1|  PREDICTED: late embryogenesis abundant prote...    191   2e-54   
ref|XP_004495776.1|  PREDICTED: late embryogenesis abundant prote...    191   2e-54   
gb|KDP21438.1|  hypothetical protein JCGZ_21909                         190   5e-54   
ref|XP_008218177.1|  PREDICTED: late embryogenesis abundant prote...    189   3e-53   
gb|AIA57962.1|  late embryogenesis abundant protein 1                   187   3e-53   
emb|CDP12311.1|  unnamed protein product                                187   9e-53   
gb|KHG19384.1|  Late embryogenesis abundant D-34                        187   9e-53   
ref|XP_007144645.1|  hypothetical protein PHAVU_007G173100g             184   7e-52   
ref|XP_011091039.1|  PREDICTED: LOW QUALITY PROTEIN: late embryog...    182   9e-52   
ref|XP_003633664.1|  PREDICTED: late embryogenesis abundant prote...    183   2e-51   
ref|XP_010090423.1|  hypothetical protein L484_025090                   182   3e-51   
dbj|BAK04960.1|  predicted protein                                      184   3e-51   
gb|EYU46567.1|  hypothetical protein MIMGU_mgv1a012107mg                182   3e-51   
ref|XP_010679058.1|  PREDICTED: late embryogenesis abundant prote...    182   9e-51   
ref|XP_009802733.1|  PREDICTED: late embryogenesis abundant prote...    181   1e-50   
ref|XP_006382741.1|  seed maturation protein PM26                       179   2e-50   
ref|XP_008797392.1|  PREDICTED: late embryogenesis abundant prote...    179   5e-50   
ref|XP_008370878.1|  PREDICTED: late embryogenesis abundant prote...    180   8e-50   
ref|XP_011032498.1|  PREDICTED: late embryogenesis abundant prote...    176   3e-49   
ref|XP_008364056.1|  PREDICTED: late embryogenesis abundant prote...    176   6e-49   
ref|XP_004986236.1|  PREDICTED: late embryogenesis abundant prote...    177   6e-49   
gb|KHG05102.1|  Late embryogenesis abundant D-34                        176   7e-49   
ref|XP_010070193.1|  PREDICTED: late embryogenesis abundant prote...    176   1e-48   
ref|XP_007030655.1|  Seed maturation protein, putative                  174   3e-48   
ref|XP_009364553.1|  PREDICTED: late embryogenesis abundant prote...    175   4e-48   
ref|XP_007144794.1|  hypothetical protein PHAVU_007G184800g             175   6e-48   
ref|XP_004304720.1|  PREDICTED: late embryogenesis abundant prote...    173   1e-47   
ref|XP_006589172.1|  PREDICTED: late embryogenesis abundant prote...    173   3e-47   
ref|XP_008388644.1|  PREDICTED: late embryogenesis abundant prote...    173   4e-47   
ref|XP_011091040.1|  PREDICTED: late embryogenesis abundant prote...    172   2e-46   
ref|XP_003562052.1|  PREDICTED: late embryogenesis abundant prote...    170   8e-46   
ref|XP_009620120.1|  PREDICTED: late embryogenesis abundant prote...    168   9e-46   
ref|XP_010025078.1|  PREDICTED: late embryogenesis abundant prote...    169   9e-46   
gb|KEH43047.1|  late embryogenesis abundant D-like protein              166   3e-45   
ref|XP_006480098.1|  PREDICTED: late embryogenesis abundant prote...    169   4e-45   
ref|XP_006444042.1|  hypothetical protein CICLE_v10023775mg             168   6e-45   
gb|AFK36784.1|  unknown                                                 164   2e-44   
ref|XP_002512261.1|  Late embryogenesis abundant protein D-34, pu...    162   1e-43   Ricinus communis
ref|XP_007050564.1|  Late embryogenesis abundant protein D-34, pu...    161   6e-43   
ref|XP_009764712.1|  PREDICTED: uncharacterized protein LOC104216384    169   1e-42   
ref|XP_006589173.1|  PREDICTED: late embryogenesis abundant prote...    160   2e-42   
emb|CDO99067.1|  unnamed protein product                                160   2e-42   
ref|NP_001051258.2|  Os03g0747400                                       158   6e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007050563.1|  Late embryogenesis abundant protein D-34, pu...    159   8e-42   
ref|XP_009396738.1|  PREDICTED: late embryogenesis abundant prote...    157   3e-41   
ref|XP_003590629.1|  Late embryogenesis abundant protein D-34           154   9e-41   
ref|XP_007034768.1|  Late embryogenesis abundant protein D-34 iso...    152   2e-40   
ref|XP_004965453.1|  PREDICTED: late embryogenesis abundant prote...    154   3e-40   
ref|XP_002453796.1|  hypothetical protein SORBIDRAFT_04g017790          154   3e-40   Sorghum bicolor [broomcorn]
ref|XP_009411288.1|  PREDICTED: late embryogenesis abundant prote...    151   2e-39   
ref|XP_006349691.1|  PREDICTED: late embryogenesis abundant prote...    148   3e-38   
gb|AFW67487.1|  hypothetical protein ZEAMMB73_891670                    145   9e-38   
gb|AJA33580.1|  late embryogenesis abundant protein LEA7-1              147   2e-37   
ref|XP_010277174.1|  PREDICTED: late embryogenesis abundant prote...    144   8e-37   
emb|CAA41854.1|  rab28                                                  145   1e-36   Zea mays [maize]
ref|NP_001049030.1|  Os03g0159600                                       144   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004135801.1|  PREDICTED: late embryogenesis abundant prote...    144   2e-36   
gb|EAY88627.1|  hypothetical protein OsI_10103                          144   2e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_004165760.1|  PREDICTED: late embryogenesis abundant prote...    143   2e-36   
gb|AJA33583.1|  late embryogenesis abundant protein LEA7-4              142   7e-36   
ref|XP_003599533.1|  Late embryogenesis abundant protein D-34           142   1e-35   
ref|XP_004985623.1|  PREDICTED: late embryogenesis abundant prote...    141   2e-35   
gb|EAZ00817.1|  hypothetical protein OsI_22847                          141   2e-35   Oryza sativa Indica Group [Indian rice]
dbj|BAK03375.1|  predicted protein                                      139   1e-34   
dbj|BAJ96619.1|  predicted protein                                      138   2e-34   
ref|NP_001057565.1|  Os06g0341300                                       137   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006826269.1|  hypothetical protein AMTR_s00004p00042590          136   5e-34   
ref|XP_002465829.1|  hypothetical protein SORBIDRAFT_01g046490          137   5e-34   Sorghum bicolor [broomcorn]
ref|XP_006656949.1|  PREDICTED: late embryogenesis abundant prote...    137   5e-34   
ref|XP_003571800.1|  PREDICTED: late embryogenesis abundant prote...    135   2e-33   
ref|XP_009394613.1|  PREDICTED: late embryogenesis abundant prote...    135   3e-33   
gb|KDO68693.1|  hypothetical protein CISIN_1g027886mg                   133   5e-33   
gb|AFW67486.1|  hypothetical protein ZEAMMB73_891670                    130   3e-32   
ref|XP_007034769.1|  Late embryogenesis abundant protein D-34 iso...    130   3e-32   
ref|XP_009774312.1|  PREDICTED: late embryogenesis abundant prote...    128   2e-31   
ref|XP_008651207.1|  PREDICTED: late embryogenesis abundant prote...    130   2e-31   
gb|KDP23618.1|  hypothetical protein JCGZ_23451                         127   4e-31   
ref|XP_010679056.1|  PREDICTED: late embryogenesis abundant prote...    129   4e-31   
ref|XP_009597797.1|  PREDICTED: late embryogenesis abundant prote...    127   9e-31   
ref|XP_002965692.1|  hypothetical protein SELMODRAFT_84789              127   2e-30   
emb|CDP08585.1|  unnamed protein product                                124   4e-30   
ref|XP_011082573.1|  PREDICTED: late embryogenesis abundant prote...    124   8e-30   
ref|XP_010468377.1|  PREDICTED: late embryogenesis abundant prote...    121   9e-30   
emb|CDP08584.1|  unnamed protein product                                123   1e-29   
ref|XP_010679057.1|  PREDICTED: late embryogenesis abundant prote...    124   2e-29   
ref|XP_002971638.1|  hypothetical protein SELMODRAFT_172144             124   2e-29   
ref|XP_011091892.1|  PREDICTED: late embryogenesis abundant prote...    123   3e-29   
ref|XP_010679062.1|  PREDICTED: late embryogenesis abundant prote...    123   5e-29   
gb|EPS67127.1|  hypothetical protein M569_07649                         119   1e-28   
gb|AJA33581.1|  late embryogenesis abundant protein LEA7-2              121   3e-28   
ref|XP_010041765.1|  PREDICTED: late embryogenesis abundant prote...    119   6e-28   
ref|XP_008369302.1|  PREDICTED: late embryogenesis abundant prote...    116   1e-27   
gb|EYU45247.1|  hypothetical protein MIMGU_mgv1a013828mg                117   2e-27   
ref|XP_006347861.1|  PREDICTED: late embryogenesis abundant prote...    117   2e-27   
ref|XP_010326383.1|  PREDICTED: late embryogenesis abundant prote...    117   4e-27   
ref|XP_004230131.1|  PREDICTED: late embryogenesis abundant prote...    116   5e-27   
gb|AIA57965.1|  late embryogenesis abundant protein 6                   113   2e-26   
ref|XP_008338157.1|  PREDICTED: late embryogenesis abundant prote...    113   2e-26   
ref|XP_003575514.1|  PREDICTED: late embryogenesis abundant prote...    116   2e-26   
ref|NP_171811.1|  responsive to abscisic acid 28                        113   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|WP_033581568.1|  hypothetical protein                               110   8e-26   
gb|EEE65653.1|  hypothetical protein OsJ_21239                          114   8e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001781683.1|  predicted protein                                  115   1e-25   
ref|XP_009119571.1|  PREDICTED: late embryogenesis abundant prote...    111   1e-25   
gb|KFK42672.1|  hypothetical protein AALP_AA1G024900                    110   3e-25   
ref|XP_010045839.1|  PREDICTED: late embryogenesis abundant prote...    110   5e-25   
ref|XP_008374066.1|  PREDICTED: late embryogenesis abundant prote...    108   6e-25   
ref|XP_010481583.1|  PREDICTED: late embryogenesis abundant prote...    109   8e-25   
ref|XP_004304719.1|  PREDICTED: late embryogenesis abundant prote...    111   1e-24   
ref|XP_010474918.1|  PREDICTED: late embryogenesis abundant prote...    109   1e-24   
gb|ABF98858.1|  Seed maturation protein                                 109   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AIA57964.1|  late embryogenesis abundant protein 4                   107   2e-24   
gb|KFK26460.1|  hypothetical protein AALP_AA8G252100                    108   2e-24   
ref|XP_006394999.1|  hypothetical protein EUTSA_v10004958mg             108   3e-24   
ref|XP_006289560.1|  hypothetical protein CARUB_v10003106mg             107   5e-24   
ref|XP_010474927.1|  PREDICTED: late embryogenesis abundant prote...    107   5e-24   
ref|XP_010455160.1|  PREDICTED: late embryogenesis abundant prote...    107   6e-24   
gb|EMT23291.1|  hypothetical protein F775_14150                         107   6e-24   
ref|XP_006305695.1|  hypothetical protein CARUB_v10010425mg             107   7e-24   
emb|CDY18152.1|  BnaC05g01750D                                          106   9e-24   
ref|XP_010249416.1|  PREDICTED: late embryogenesis abundant prote...    106   1e-23   
ref|XP_008450758.1|  PREDICTED: late embryogenesis abundant prote...    105   1e-23   
ref|XP_001773842.1|  predicted protein                                  108   2e-23   
ref|XP_010421659.1|  PREDICTED: late embryogenesis abundant prote...    105   2e-23   
ref|XP_010494063.1|  PREDICTED: late embryogenesis abundant prote...    105   2e-23   
ref|XP_010674900.1|  PREDICTED: late embryogenesis abundant prote...    106   2e-23   
emb|CDX86185.1|  BnaA06g29020D                                          105   3e-23   
emb|CDX80679.1|  BnaC07g27650D                                          105   3e-23   
emb|CDY50578.1|  BnaC02g39520D                                          104   4e-23   
ref|XP_009151232.1|  PREDICTED: late embryogenesis abundant prote...    105   5e-23   
ref|XP_009129849.1|  PREDICTED: late embryogenesis abundant prote...    104   5e-23   
emb|CDY52497.1|  BnaAnng11440D                                          104   5e-23   
ref|NP_198150.1|  Seed maturation protein                               104   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874409.1|  seed maturation family protein                     104   6e-23   
ref|XP_003538057.1|  PREDICTED: late embryogenesis abundant prote...    103   8e-23   
ref|XP_009111929.1|  PREDICTED: late embryogenesis abundant prote...    102   3e-22   
emb|CDY19705.1|  BnaA09g03580D                                          102   4e-22   
gb|AJA33582.1|  late embryogenesis abundant protein LEA7-3              103   8e-22   
ref|XP_002314696.1|  hypothetical protein POPTR_0010s09710g           99.8    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_007149042.1|  hypothetical protein PHAVU_005G035800g           99.4    4e-21   
gb|KCW84218.1|  hypothetical protein EUGRSUZ_B010842                  97.1    4e-21   
gb|EPS71362.1|  hypothetical protein M569_03400                       95.5    3e-20   
ref|XP_003596350.1|  Late embryogenesis abundant protein D-34         97.8    3e-20   
ref|XP_009400094.1|  PREDICTED: late embryogenesis abundant prote...  97.8    4e-20   
ref|XP_003596349.1|  Late embryogenesis abundant protein D-34         97.1    7e-20   
gb|AAK71550.1|AC087852_10  putative embryonic cell protein            96.3    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002889438.1|  predicted protein                                92.8    5e-19   
gb|ABD32976.1|  Seed maturation protein                               91.3    9e-19   Medicago truncatula
ref|XP_010522730.1|  PREDICTED: late embryogenesis abundant prote...  90.1    2e-18   
ref|XP_004489023.1|  PREDICTED: late embryogenesis abundant prote...  91.7    3e-18   
ref|XP_010556781.1|  PREDICTED: late embryogenesis abundant prote...  91.7    3e-18   
ref|XP_002467200.1|  hypothetical protein SORBIDRAFT_01g021320        89.0    1e-17   Sorghum bicolor [broomcorn]
ref|XP_008796769.1|  PREDICTED: late embryogenesis abundant prote...  88.6    5e-17   
ref|XP_003596348.1|  Late embryogenesis abundant protein D-34         86.3    5e-17   
ref|XP_011021869.1|  PREDICTED: LOW QUALITY PROTEIN: late embryog...  85.9    7e-17   
gb|EYU20966.1|  hypothetical protein MIMGU_mgv1a019437mg              84.7    9e-17   
gb|ABD32975.1|  Seed maturation protein                               80.9    3e-15   Medicago truncatula
gb|KHG09692.1|  Late embryogenesis abundant D-34                      81.3    9e-15   
ref|XP_010104157.1|  hypothetical protein L484_001468                 78.6    3e-14   
ref|XP_010679061.1|  PREDICTED: late embryogenesis abundant prote...  78.6    5e-14   
ref|XP_004973274.1|  PREDICTED: late embryogenesis abundant prote...  79.3    5e-14   
gb|EMT30483.1|  hypothetical protein F775_15742                       79.3    7e-14   
ref|XP_002974882.1|  hypothetical protein SELMODRAFT_15747            79.7    7e-14   
ref|XP_002963793.1|  hypothetical protein SELMODRAFT_25885            79.0    1e-13   
gb|KCW84219.1|  hypothetical protein EUGRSUZ_B010841                  74.3    5e-13   
ref|XP_002444221.1|  hypothetical protein SORBIDRAFT_07g015410        75.9    8e-13   Sorghum bicolor [broomcorn]
dbj|BAK08023.1|  predicted protein                                    73.9    7e-12   
ref|XP_002463880.1|  hypothetical protein SORBIDRAFT_01g008200        70.1    1e-10   Sorghum bicolor [broomcorn]
ref|XP_010248421.1|  PREDICTED: uncharacterized protein LOC104591312  69.7    3e-10   
ref|NP_200138.1|  Seed maturation protein                             66.2    2e-09   
ref|XP_010524021.1|  PREDICTED: late embryogenesis abundant prote...  66.2    2e-09   
gb|EMT14134.1|  hypothetical protein F775_52423                       66.2    2e-09   
ref|XP_006651816.1|  PREDICTED: late embryogenesis abundant prote...  63.2    1e-08   
ref|NP_200139.1|  Seed maturation protein                             63.5    1e-08   
gb|AHJ80898.1|  late embryogenesis abundant protein                   60.8    2e-08   
ref|XP_004986565.1|  PREDICTED: late embryogenesis abundant prote...  62.0    5e-08   
ref|XP_010442883.1|  PREDICTED: late embryogenesis abundant prote...  62.0    5e-08   
ref|XP_004952922.1|  PREDICTED: late embryogenesis abundant prote...  62.4    5e-08   
ref|XP_010445672.1|  PREDICTED: late embryogenesis abundant prote...  60.8    1e-07   
ref|XP_002865961.1|  predicted protein                                60.1    2e-07   
ref|XP_008665412.1|  PREDICTED: late embryogenesis abundant prote...  60.8    2e-07   
ref|XP_002865960.1|  predicted protein                                59.7    3e-07   
gb|EMS46184.1|  hypothetical protein TRIUR3_05231                     58.2    4e-07   
ref|XP_010482715.1|  PREDICTED: late embryogenesis abundant prote...  58.9    6e-07   
gb|EMS62093.1|  hypothetical protein TRIUR3_32520                     58.2    7e-07   
ref|XP_010482716.1|  PREDICTED: late embryogenesis abundant prote...  58.2    9e-07   
ref|XP_006281995.1|  hypothetical protein CARUB_v10028222mg           57.8    1e-06   
ref|XP_010442884.1|  PREDICTED: late embryogenesis abundant prote...  57.4    2e-06   
ref|XP_008665411.1|  PREDICTED: late embryogenesis abundant prote...  57.4    3e-06   
gb|EEC76173.1|  hypothetical protein OsI_13498                        55.5    4e-06   
ref|XP_004955035.1|  PREDICTED: late embryogenesis abundant prote...  55.1    7e-06   
gb|EAZ28574.1|  hypothetical protein OsJ_12559                        54.3    1e-05   
ref|XP_004955037.1|  PREDICTED: late embryogenesis abundant prote...  53.5    3e-05   
gb|EMS62850.1|  hypothetical protein TRIUR3_20788                     52.8    3e-05   
ref|XP_002978534.1|  hypothetical protein SELMODRAFT_443867           55.5    6e-05   
ref|XP_009132660.1|  PREDICTED: late embryogenesis abundant prote...  52.4    7e-05   
ref|NP_001147239.1|  late embryogenesis abundant protein D-34         51.6    2e-04   
ref|XP_009127182.1|  PREDICTED: late embryogenesis abundant prote...  50.1    4e-04   
emb|CDY49176.1|  BnaA02g10350D                                        50.1    4e-04   
ref|XP_007050567.1|  Uncharacterized protein TCM_004335               48.5    5e-04   
ref|XP_006401725.1|  hypothetical protein EUTSA_v10015357mg           49.7    7e-04   



>ref|XP_009335335.1| PREDICTED: late embryogenesis abundant protein D-34-like [Pyrus 
x bretschneideri]
Length=260

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 197/245 (80%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LADKPIAPQDA MMQ+AET + GQTQKGGPAA MQ+AA+ N +AGLV 
Sbjct  17   IKYGDVFSVSGQLADKPIAPQDANMMQTAETMIFGQTQKGGPAAVMQSAASRNEKAGLVR  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  ++ AG +GVTVTETDVPGSRIITES+ GQVVGQ V+  P+    A G +  NS   
Sbjct  77   HDQATDVAGSEGVTVTETDVPGSRIITESVGGQVVGQHVQPTPVAQATAAGFMQQNS---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEASAQ  G++ +D+SDAAAIQAAEVRATG+NVI+PGG+AA AQSAAAYN G
Sbjct  134  --ITIGEALEASAQTAGDRPIDQSDAAAIQAAEVRATGSNVISPGGLAAMAQSAAAYNAG  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              R+QDK+KL +VL+ AT KLPADK ATR+DAEGV S++ RNN  M + PGGVAASV AA
Sbjct  192  TEREQDKIKLTDVLSGATAKLPADKAATRQDAEGVVSSELRNNPGMGTRPGGVAASVMAA  251

Query  809  aRLNE  823
            ARLNE
Sbjct  252  ARLNE  256



>ref|XP_002282590.1| PREDICTED: late embryogenesis abundant protein D-34 [Vitis vinifera]
 emb|CBI26260.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 202/245 (82%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G LADKP+APQDAA+MQSAETAVLGQTQKGGPAA MQ+AA  N RAGLV 
Sbjct  16   IKYGDVFPVAGSLADKPVAPQDAALMQSAETAVLGQTQKGGPAATMQSAATRNERAGLVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D++N AG++GVTVTETDVPG RIITES+AGQV+GQ VE  P P  Q    +   +A Q
Sbjct  76   HTDITNAAGDEGVTVTETDVPGRRIITESVAGQVLGQYVE--PTPVSQMNPTV---TARQ  130

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A ITIG+ALEA+AQ  GNK VD+SD+AAIQAAEVRATG+ +I+P GVAA AQSAA+ N G
Sbjct  131  AAITIGEALEATAQTAGNKPVDQSDSAAIQAAEVRATGSTIISPTGVAAAAQSAASMNTG  190

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L RD+DK+KL +VL++AT +LPADK  TR+DAEGV SA+ RNN ++++ PGGVA+SVAAA
Sbjct  191  LTRDEDKIKLTDVLSNATARLPADKAVTRQDAEGVMSAEMRNNPNLATHPGGVASSVAAA  250

Query  809  aRLNE  823
            ARLNE
Sbjct  251  ARLNE  255



>emb|CAN67177.1| hypothetical protein VITISV_037455 [Vitis vinifera]
Length=258

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 202/246 (82%), Gaps = 7/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G LADKP+APQDAA+MQSAETAVLGQTQKGGPAA MQ+AA  N RAGLV 
Sbjct  16   IKYGDVFPVAGSLADKPVAPQDAALMQSAETAVLGQTQKGGPAATMQSAATRNERAGLVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMN-SAL  445
              D++N AG++GVTVTETDVPG RIITES+AGQV+GQ VE  P+        +N+  +A 
Sbjct  76   HTDITNAAGDEGVTVTETDVPGRRIITESVAGQVLGQYVEPTPV------SQMNLTVTAR  129

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            QA ITIG+ALEA+AQ  GNK VD+SDAAAIQ AEVRATG+ +I+P GVAA AQSAA+ N 
Sbjct  130  QAAITIGEALEATAQTAGNKPVDQSDAAAIQEAEVRATGSTIISPTGVAAAAQSAASMNT  189

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
            GL RD+DK+KL +VL++AT +LPADK  TR+DAEGV SA+ RNN ++++ PGGVA+SVAA
Sbjct  190  GLTRDEDKIKLTDVLSNATARLPADKAVTRQDAEGVMSAEMRNNPNLATHPGGVASSVAA  249

Query  806  aaRLNE  823
            AARLNE
Sbjct  250  AARLNE  255



>ref|XP_008224307.1| PREDICTED: late embryogenesis abundant protein D-34-like [Prunus 
mume]
Length=264

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 196/245 (80%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA KPIAPQDA MMQ+AET V GQTQKGGPAA MQ+AA  N R+GLV 
Sbjct  21   IKYGDVFSVSGDLAKKPIAPQDANMMQTAETMVFGQTQKGGPAAVMQSAATRNERSGLVR  80

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  ++  G +GVTVTETDVPGSRI+TE++ GQV+GQ V+  P+    AGG +  N+   
Sbjct  81   HDQATDVGGNEGVTVTETDVPGSRIVTEAVGGQVIGQYVQPTPVAQVAAGGFMEQNA---  137

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEASAQ  G+K +D+SDAAAIQAAEVRATG+NVI+PGG+AA AQSAAAYN G
Sbjct  138  --ITIGEALEASAQTAGDKPIDQSDAAAIQAAEVRATGSNVISPGGLAAMAQSAAAYNAG  195

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             + +QDK+KL +VL+ AT KLP DK ATR+DAEG+ASA+ RNN +M + PGGVAASV AA
Sbjct  196  TLAEQDKIKLTDVLSGATGKLPVDKAATRQDAEGIASAELRNNPEMGTRPGGVAASVTAA  255

Query  809  aRLNE  823
            ARLNE
Sbjct  256  ARLNE  260



>ref|XP_008390908.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=260

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 196/245 (80%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LADKPIAPQDA MMQ+AET + GQTQKGGPA+ MQ+AA+ N RAGLV 
Sbjct  17   IKYGDVFSVSGQLADKPIAPQDANMMQTAETMIFGQTQKGGPASVMQSAASRNERAGLVR  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  ++ AG +GVTVTETDVPGSRIITES+ GQVVGQ V+  P+    A G +  NS   
Sbjct  77   HDQATDVAGSEGVTVTETDVPGSRIITESVGGQVVGQYVQPTPVAQATAAGFMQQNS---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEASAQ  G++ +D+SDAAAIQAAEVRATG++VI+ GG+AA AQSAAAYN G
Sbjct  134  --ITIGEALEASAQTAGDRPIDQSDAAAIQAAEVRATGSSVISQGGLAAMAQSAAAYNAG  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              R+QDK+KL +VL+ AT KLP DK ATR+DAEGV SA+ RNN D+ + PGGVAASV AA
Sbjct  192  TEREQDKIKLTDVLSGATAKLPVDKAATRQDAEGVVSAELRNNPDLGTRPGGVAASVIAA  251

Query  809  aRLNE  823
            ARLNE
Sbjct  252  ARLNE  256



>ref|XP_010024280.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW60731.1| hypothetical protein EUGRSUZ_H03461 [Eucalyptus grandis]
Length=262

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 199/245 (81%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA KP+APQDAAMMQ+AET V GQTQKGGPAA MQ+AA  N RAGLV 
Sbjct  19   IKYGDVFPVSGDLASKPVAPQDAAMMQTAETVVFGQTQKGGPAAVMQSAATRNARAGLVG  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A +QGVTVTE +VPG RI+TES+AGQVVGQ VE  P+ +      +      Q
Sbjct  79   HRDATDVAADQGVTVTEANVPGQRIVTESVAGQVVGQYVEPKPVQHVAPAAVVE-----Q  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG+ALEA+AQ +G+K VD+ DAAAIQAAEVRATG+NVI+PGG+AA+AQSAAA+NEG
Sbjct  134  GTLTIGEALEAAAQTVGDKPVDQGDAAAIQAAEVRATGSNVISPGGLAASAQSAAAHNEG  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KLG VL  AT KLPADK+ATR+DAEGVASA+ RNN D+ + PGGVAASVAAA
Sbjct  194  VDRDEDKIKLGAVLTGATDKLPADKVATRQDAEGVASAELRNNPDLVTQPGGVAASVAAA  253

Query  809  aRLNE  823
            ARLNE
Sbjct  254  ARLNE  258



>sp|P09444.1|LEA34_GOSHI RecName: Full=Late embryogenesis abundant protein D-34; Short=LEA 
D-34
 emb|CAA31594.1| D-34 Lea protein [Gossypium hirsutum]
 gb|AAA33075.1| storage protein [Gossypium hirsutum]
 prf||1601521F Lea D-34 gene
Length=264

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 197/245 (80%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA+KPIAPQDAAMMQ+AET VLGQTQKGG AA MQAAA  N + G+V 
Sbjct  22   IKYGDVFNVSGELANKPIAPQDAAMMQTAETQVLGQTQKGGTAAVMQAAATRNEQVGVVG  81

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             +D+++ AGEQGVT+ ETDV G RIITE++AGQVVGQ V+A P+   Q G        LQ
Sbjct  82   HNDITDIAGEQGVTLAETDVAGRRIITEAVAGQVVGQYVQATPVMTSQVG------VVLQ  135

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEA+A+  G+K VD+SDAAA+QAAEVRATG+NVI PGG+AATAQSAAA+N  
Sbjct  136  NAITIGEALEATAKTAGDKPVDQSDAAAVQAAEVRATGSNVIIPGGLAATAQSAAAHNAT  195

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L RD++K+KL  VL  AT KLPADK  TR+DAEGV SA+ RNN ++++ PGGVAAS+AAA
Sbjct  196  LDRDEEKIKLNQVLTGATAKLPADKAVTRQDAEGVVSAELRNNPNVATHPGGVAASMAAA  255

Query  809  aRLNE  823
            ARLNE
Sbjct  256  ARLNE  260



>ref|NP_188888.1| Seed maturation protein [Arabidopsis thaliana]
 dbj|BAB01464.1| seed maturation protein, LEA protein in group 5-like [Arabidopsis 
thaliana]
 gb|AAO22723.1| putative LEA protein [Arabidopsis thaliana]
 gb|AAO42419.1| putative LEA protein [Arabidopsis thaliana]
 gb|AEE76646.1| Seed maturation protein [Arabidopsis thaliana]
Length=262

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 188/246 (76%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VTYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+    A     +  +LQ
Sbjct  74   PGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATAAAMEAEVVGLSLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA GTNVI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRACGTNVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++S+ PGGVAAS+ AA
Sbjct  194  IDRDEDKIKLIDVLAGATGKLAADKAVTRQDAEGVVSAELRNNPNLSTHPGGVAASITAA  253

Query  809  aRLNER  826
            ARLNER
Sbjct  254  ARLNER  259



>ref|XP_002517129.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF45292.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=264

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 190/245 (78%), Gaps = 7/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSG+LA K IAP+DA MMQSAET V G TQKGG AA MQAAA  N RAGLV 
Sbjct  23   VKYGDVFNVSGDLASKTIAPEDANMMQSAETMVFGHTQKGGAAATMQAAATRNERAGLVG  82

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E+GVTVTE+DVPG+RI+TE +AGQVVGQ VEA P+    AG        +Q
Sbjct  83   HRDATDAASERGVTVTESDVPGARIVTERVAGQVVGQYVEATPVVGMTAG-------TVQ  135

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEA+AQ  GNK VD+SDAAAIQAAEVRATG+NVI PGG+AATAQSAA +N  
Sbjct  136  NAITIGEALEATAQTAGNKPVDQSDAAAIQAAEVRATGSNVIIPGGLAATAQSAACHNAA  195

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              R++DK+KL  VL  AT KLPADK+ TR DAEGV SA+ RNN ++S+ PGGVAAS+AAA
Sbjct  196  ARREEDKIKLTEVLTAATTKLPADKVVTRADAEGVVSAEIRNNPNLSTHPGGVAASMAAA  255

Query  809  aRLNE  823
            ARLNE
Sbjct  256  ARLNE  260



>ref|XP_006299031.1| hypothetical protein CARUB_v10015168mg [Capsella rubella]
 gb|EOA31929.1| hypothetical protein CARUB_v10015168mg [Capsella rubella]
Length=262

 Score =   252 bits (643),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 189/246 (77%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+    A     +   LQ
Sbjct  74   PGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATAAATASEVLGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GTNVI PGG++A+AQSAA +N  
Sbjct  134  SAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIAPGGISASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK  TR+DAEGV +A+ RNN ++S+ PGG+AAS+ AA
Sbjct  194  VDRDEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVTAELRNNPNLSTHPGGIAASITAA  253

Query  809  aRLNER  826
            ARLN++
Sbjct  254  ARLNQK  259



>ref|XP_010488278.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=262

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 189/246 (77%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+    A     +   LQ
Sbjct  74   PGDTTDLAVERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATASATAAETLGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GTNVI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++S+ PGGVAASV AA
Sbjct  194  VDRDEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVSAELRNNPNLSTHPGGVAASVTAA  253

Query  809  aRLNER  826
            ARLN++
Sbjct  254  ARLNQK  259



>ref|XP_002885505.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 189/246 (77%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVQ  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+    A     +  +LQ
Sbjct  74   PGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATAAATEAEAVGLSLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GTNVI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK  TR+DAEGV  A+ RNN ++S+ PGGV+AS+ AA
Sbjct  194  VDRDEDKIKLIDVLAGATGKLTADKAVTRQDAEGVVGAELRNNPNLSTHPGGVSASITAA  253

Query  809  aRLNER  826
            ARLNER
Sbjct  254  ARLNER  259



>ref|XP_004247663.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
lycopersicum]
Length=267

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 196/249 (79%), Gaps = 7/249 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGEL +K + P+DAAMMQSAETAVLG+TQK GPAAAMQ+AANVNV AGLV 
Sbjct  18   IKYGDVFAVSGELGEKAVKPEDAAMMQSAETAVLGKTQKSGPAAAMQSAANVNVSAGLVQ  77

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGG---GINMNS  439
            P DV++ A  +GVTVT T VPG+ IITES+AGQVV Q ++    P    GG   G     
Sbjct  78   PGDVTDVAAREGVTVTGTAVPGANIITESVAGQVVAQYIQ----PTGGVGGQPQGAATTG  133

Query  440  ALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaY  619
              +  ITIG+ALEA+ Q +  K VD+ DAAAIQAAEVRATG+NVITPGGVAATAQSAAAY
Sbjct  134  GSRREITIGEALEAAGQTIPGKPVDQCDAAAIQAAEVRATGSNVITPGGVAATAQSAAAY  193

Query  620  NEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasv  799
            NE +I+D+DKVKLG+VL+ AT+ LPADK ATR+DAEGV  A+ RN  DMS+TPGGVAASV
Sbjct  194  NESMIKDEDKVKLGDVLSGATKVLPADKAATRQDAEGVVGAELRNKQDMSTTPGGVAASV  253

Query  800  aaaaRLNER  826
              AAR+NER
Sbjct  254  TVAARMNER  262



>ref|XP_006406157.1| hypothetical protein EUTSA_v10021345mg [Eutrema salsugineum]
 gb|ESQ47610.1| hypothetical protein EUTSA_v10021345mg [Eutrema salsugineum]
Length=262

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 188/246 (76%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADK IAP+DA+MMQ+AET V G TQKGG AA MQ+AA  N + G V 
Sbjct  14   VKYGDVFQVSGELADKTIAPEDASMMQAAETRVFGHTQKGGVAAVMQSAATANKQGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E+ VTV +TDVPG+R+ TE + GQVVGQ +E  P+    A     +   LQ
Sbjct  74   SGDTTDLAAEKSVTVAQTDVPGARVTTEFVGGQVVGQYIEPKPVTAVAAMDAEALGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GTNVI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTNVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KLPADK+ TR+DAEGV SA++RNNL +S  PGGVAASV AA
Sbjct  194  IDRDEDKIKLVDVLAGATGKLPADKVVTRQDAEGVLSAERRNNLSLSIHPGGVAASVIAA  253

Query  809  aRLNER  826
            A LNE+
Sbjct  254  ANLNEK  259



>ref|XP_010466531.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=262

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 189/246 (77%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+    A     +   LQ
Sbjct  74   PADTTDVAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATATATAAETLGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GTNVI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + R++DK+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++S+ PGGVAASV AA
Sbjct  194  VDREEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVSAELRNNPNLSTHPGGVAASVTAA  253

Query  809  aRLNER  826
            ARLN++
Sbjct  254  ARLNQK  259



>ref|XP_009775953.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
sylvestris]
Length=261

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 194/246 (79%), Gaps = 3/246 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA +PIAPQDAAMMQSAET V GQTQKGGPAA MQ+AA  N R+G VS
Sbjct  17   IKYGDVFNVRGELAKQPIAPQDAAMMQSAETMVFGQTQKGGPAAVMQSAATKNERSGFVS  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  +  AG +GVTVTET VPG RIITES+AGQV+GQSVE +P+     G G       +
Sbjct  77   HDATTPVAGAEGVTVTETTVPGRRIITESVAGQVLGQSVEPVPVTAAVGGAG---GEPEE  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A ITIG+AL A+A   G+K V++SDAAAIQAAEVRATG++V+TPGG+AATAQSAA+ NEG
Sbjct  134  APITIGEALAATALTAGDKPVEQSDAAAIQAAEVRATGSSVVTPGGLAATAQSAASVNEG  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L +D DK+KL NVL  AT KLP DK ATR+DAEGV  A+ RNN ++++ PGGVAASVAAA
Sbjct  194  LTQDVDKIKLNNVLTGATAKLPTDKAATRQDAEGVMEAELRNNPELTTYPGGVAASVAAA  253

Query  809  aRLNER  826
            ARLNER
Sbjct  254  ARLNER  259



>emb|CDY38305.1| BnaC05g29980D [Brassica napus]
Length=262

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 187/246 (76%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADK IAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKTIAPEDANMMQAAETRVFGHTQKGGTAAVMQSAATANKRGGFVQ  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E GVTV +TDVPG+R+ TE + GQVVGQ VE MP+    A     +   LQ
Sbjct  74   QGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQHVEPMPVGTTAATDAETLGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GT+VI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTSVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++++ PGGVAASV AA
Sbjct  194  VDRDEDKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNNPNLTTHPGGVAASVTAA  253

Query  809  aRLNER  826
            ARLNE+
Sbjct  254  ARLNEK  259



>ref|XP_010511424.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=262

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 189/246 (77%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELAD+PIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADRPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +TD+PG+R+ TE + GQVVGQ VE  P+    A     +   LQ
Sbjct  74   PGDTTDLAVERGVTVAQTDIPGARVTTEFVGGQVVGQYVEPRPVATAAATAAETLGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GTNVI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + R++DK+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++S+ PGGVAAS+ AA
Sbjct  194  VDREEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVSAELRNNPNLSTHPGGVAASITAA  253

Query  809  aRLNER  826
            ARLN++
Sbjct  254  ARLNQK  259



>ref|XP_004496718.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cicer 
arietinum]
Length=260

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 194/245 (79%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDV  VSG+LA KPIAP+DAAMMQSAE+ VLGQTQ GG A+ MQ+AA  N +AG+V 
Sbjct  16   IKYGDVLPVSGDLAQKPIAPEDAAMMQSAESRVLGQTQPGGVASVMQSAATRNEQAGIVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++   ++GVTVTET VPG RI+TESI GQVVGQ VE  P+   Q G  +   SAL 
Sbjct  76   HRDVTDVTCDRGVTVTETQVPGRRIVTESIGGQVVGQFVEPTPVQGGQTG--VVGESAL-  132

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
               TIG+ALEA+A  +G+K V++SDA+AIQAAEVRATG NVITPGG+A+ AQSAA+YN  
Sbjct  133  ---TIGEALEATAHTVGDKPVEQSDASAIQAAEVRATGCNVITPGGLASMAQSAASYNAD  189

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              RD+DK+K+G+VL+ AT KLPADK ATR+DA GVASA+ RNN D ++TPGGVAASVAAA
Sbjct  190  CQRDEDKIKIGDVLSGATAKLPADKAATRQDAAGVASAEMRNNPDATATPGGVAASVAAA  249

Query  809  aRLNE  823
            ARLNE
Sbjct  250  ARLNE  254



>gb|EYU41481.1| hypothetical protein MIMGU_mgv1a011867mg [Erythranthe guttata]
Length=268

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 197/248 (79%), Gaps = 5/248 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA KPIAP+DAAMMQ+ ET V GQTQKGGPAA MQAAA +N RAGLV 
Sbjct  20   IKYGDVFQVSGELAAKPIAPEDAAMMQAGETQVFGQTQKGGPAATMQAAATLNERAGLVG  79

Query  269  PDDVSNP-AGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              DVS+  AG++GV V ET +PG+RIITES+ GQV+GQ ++  P+ N  A GG+ M SA 
Sbjct  80   HRDVSDVVAGKEGVAVAETALPGARIITESVGGQVLGQYIQPTPVMNTAAAGGVVMQSA-  138

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+A+  GNK VD SDAAAIQAAE RATG+++I PGG+AATAQSAAA+N+
Sbjct  139  ---ITIGEALEATARTAGNKPVDHSDAAAIQAAECRATGSSLIVPGGLAATAQSAAAFND  195

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
            GL+ D+ KVKL +VL  A  KLPADK ATR+DAEGV +A+ RN+ ++ + PGGVAASVAA
Sbjct  196  GLVGDEGKVKLADVLTGAIAKLPADKAATRDDAEGVIAAELRNDPNLHTHPGGVAASVAA  255

Query  806  aaRLNERG  829
            A RLNE G
Sbjct  256  AVRLNEGG  263



>ref|XP_004299111.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=262

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 191/245 (78%), Gaps = 4/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA K +APQDAAMMQ+AE+ VLGQTQKGGPAA MQ+AA  N RAGLV 
Sbjct  16   IKYGDIFNVSGDLASKTVAPQDAAMMQTAESMVLGQTQKGGPAAVMQSAATQNERAGLVR  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D+ ++ AG +GVTVTETDVPG RIITES+ GQV+GQ V+ +P+    A GG       Q
Sbjct  76   HDEATDVAGNEGVTVTETDVPGRRIITESVGGQVIGQYVKPVPVAQQAAVGGYKQ----Q  131

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              I+IG+ALEASAQ  G++ +D SDAAAIQAAEVRATG+NVI PGG+AATAQSAAA+N  
Sbjct  132  NTISIGEALEASAQTAGDRPLDLSDAAAIQAAEVRATGSNVIVPGGLAATAQSAAAHNAS  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              R+QDK+K+ +VL+ AT KLPADK AT EDA+GV  A+ RNN DM   PGGVAASV AA
Sbjct  192  TDREQDKIKVSDVLSGATAKLPADKAATMEDAQGVVGAEMRNNPDMVLRPGGVAASVNAA  251

Query  809  aRLNE  823
            ARL E
Sbjct  252  ARLKE  256



>ref|XP_009145325.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=262

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 187/246 (76%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADK +AP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKTVAPEDANMMQAAETRVFGHTQKGGTAAVMQSAATANKRGGFVQ  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E GVTV +TDVPG+R+ TE + GQVVGQ VE MP+    A     +   LQ
Sbjct  74   QGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQFVEPMPVGTTAATDAETLGLNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GT+VI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTSVIAPGGIAASAQSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD++K+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++++ PGGVAASV AA
Sbjct  194  VDRDEEKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNNPNLTTHPGGVAASVTAA  253

Query  809  aRLNER  826
            ARLNE+
Sbjct  254  ARLNEK  259



>gb|AIA57963.1| late embryogenesis abundant protein 3 [Jatropha curcas]
 gb|KDP40182.1| hypothetical protein JCGZ_02180 [Jatropha curcas]
Length=274

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 189/245 (77%), Gaps = 7/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G+LA +PIAP+DA MMQSAET V GQTQKGG AA+MQAAA VN R+GLV 
Sbjct  33   IKYGDVFNVTGDLAKEPIAPEDANMMQSAETRVFGQTQKGGAAASMQAAATVNERSGLVG  92

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              + ++ A E+GVTV E DVPG+RI+TE +AGQVVGQ VE  P+    AG        +Q
Sbjct  93   HREATDAASERGVTVMEADVPGARIVTERVAGQVVGQYVEVTPVQGLAAGN-------VQ  145

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEASAQ  G+KAVD+SDAAAIQ AEVRATG+NVI PGG+AATAQSAA+YN  
Sbjct  146  NAITIGEALEASAQTAGDKAVDQSDAAAIQEAEVRATGSNVIVPGGIAATAQSAASYNAA  205

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              R ++K+KL +VL+ AT KL ADK+ TR DAEGV SA+ RNN ++++ PGGVA S+  A
Sbjct  206  TNRAEEKIKLADVLSGATSKLAADKVVTRADAEGVVSAELRNNPNLNTHPGGVAVSMTTA  265

Query  809  aRLNE  823
            ARLNE
Sbjct  266  ARLNE  270



>gb|KFK39540.1| hypothetical protein AALP_AA3G257500 [Arabis alpina]
Length=263

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 188/246 (76%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGDVF V+GELADKPIAP+DA MMQ+AET V G TQK G AA MQ AA  N R G V 
Sbjct  15   VTYGDVFEVTGELADKPIAPEDANMMQAAETRVFGHTQKSGAAAVMQFAATANKRGGFVH  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +T+VPG+R+ TE + GQVVGQ VE  P+   +A     +   LQ
Sbjct  75   PGDTTDLAAERGVTVAQTEVPGARVTTEFVGGQVVGQYVEPRPVATAEATEAEAIGLKLQ  134

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK V++SDAAAIQAAEVRA+GTNVI PGG+AA+AQSAA +N  
Sbjct  135  SAITIGEALEATVQTAGNKPVNQSDAAAIQAAEVRASGTNVIAPGGIAASAQSAAIHNAN  194

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK ATR+DAEGV SA+ RNN ++S+ PGGVAASV AA
Sbjct  195  VDRDEDKIKLIDVLAGATGKLSADKAATRQDAEGVVSAELRNNPNLSTHPGGVAASVTAA  254

Query  809  aRLNER  826
            ARLNE+
Sbjct  255  ARLNEK  260



>emb|CDY10647.1| BnaA05g17150D [Brassica napus]
Length=262

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 188/246 (76%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADK +AP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKTVAPEDANMMQAAETRVFGHTQKGGTAAVMQSAATANKRGGFVQ  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E GVTV +TDVPG+R+ TE + GQVVGQ VE MP+    A     +  +LQ
Sbjct  74   QGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQYVEPMPVGTTAATDAETLGLSLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA+GT+VI PGG+AA+AQSAA +N  
Sbjct  134  SAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTSVIAPGGIAASAQSAAIHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD++K+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN ++++ PGGVAASV AA
Sbjct  194  VDRDEEKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNNPNLTTHPGGVAASVTAA  253

Query  809  aRLNER  826
            ARLNE+
Sbjct  254  ARLNEK  259



>gb|AAF21311.1| seed maturation protein PM25 [Glycine max]
Length=253

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 195/246 (79%), Gaps = 11/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA KP+AP+DAAMMQSAE  VLGQTQ GG A+ MQ+AA  N +AGLV 
Sbjct  15   IKYGDVFVVSGDLAQKPVAPEDAAMMQSAEARVLGQTQPGGAASVMQSAATRNEQAGLVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++  G++GVTVTET VPG RIITE++ GQVV Q VEA P+   +AG     +SA++
Sbjct  75   HRDVTDVTGDRGVTVTETKVPGRRIITEAVGGQVVEQYVEATPV---EAG----RSSAIK  127

Query  449  A-GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+AQ +G KAVD+SDA+AIQAAEVRATG+NVITPGG+AA AQSAAAYN 
Sbjct  128  ENAITIGEALEATAQTVGQKAVDQSDASAIQAAEVRATGSNVITPGGLAAMAQSAAAYNA  187

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
                DQDKVKL   LA AT KLPADK AT +DAEGVA A+ RNN D ++TPGGVAASVAA
Sbjct  188  DCKLDQDKVKL---LAGATAKLPADKAATLQDAEGVACAEVRNNPDATATPGGVAASVAA  244

Query  806  aaRLNE  823
            AARLNE
Sbjct  245  AARLNE  250



>ref|XP_006489400.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
Length=261

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 190/245 (78%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA KPIAP+DAAMMQ+AE  ++GQTQKGGPAA MQ+AA  N  AG V 
Sbjct  19   IKYGDLFNVSGDLAQKPIAPEDAAMMQTAEATIMGQTQKGGPAAVMQSAAARNEGAGFVG  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ AG+QGVTVTETDVPG RIITES+ GQVVG+  E  P+      G +      Q
Sbjct  79   HRDVTDVAGDQGVTVTETDVPGRRIITESVGGQVVGRHEEPTPVSLAPTTGRVE-----Q  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALE +AQ  G+K VD+SDAAAIQAAEVRATG+ V TP G+AA+AQSAAA+NE 
Sbjct  134  GAITIGEALETTAQTAGDKPVDQSDAAAIQAAEVRATGSTVTTP-GLAASAQSAAAHNET  192

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VLA AT KL ADK  TR+DAEG+ASA+QRNN +  + PGGVAASVAAA
Sbjct  193  VDRDEDKIKLNQVLAGATAKLAADKAVTRQDAEGIASAEQRNNPNADTHPGGVAASVAAA  252

Query  809  aRLNE  823
            ARLNE
Sbjct  253  ARLNE  257



>ref|XP_007224297.1| hypothetical protein PRUPE_ppa019572mg [Prunus persica]
 gb|EMJ25496.1| hypothetical protein PRUPE_ppa019572mg [Prunus persica]
Length=242

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 184/245 (75%), Gaps = 27/245 (11%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VS +LA KPIAPQDA MMQ+AET V G+TQKGGPAA MQ+AA  N R+GLV 
Sbjct  21   IKYGDVFSVSADLAKKPIAPQDANMMQTAETMVFGKTQKGGPAAVMQSAATRNERSGLVR  80

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  ++  G +GVTVTETDVPGSRI+TE++ GQ                           
Sbjct  81   HDQATDVGGNEGVTVTETDVPGSRIVTEAVGGQ---------------------------  113

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEASAQ  G+K +D+SDAAAIQAAEVRATG+NVI+PGG+AA AQSAAAYN G
Sbjct  114  NAITIGEALEASAQTAGDKPIDQSDAAAIQAAEVRATGSNVISPGGLAAMAQSAAAYNAG  173

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +R+QDK+KL +VL+ AT+KLPADK ATR+DAEG+ASA+ RNN +M + PGGVAASV AA
Sbjct  174  TLREQDKIKLTDVLSGATEKLPADKAATRQDAEGIASAELRNNPEMGTRPGGVAASVTAA  233

Query  809  aRLNE  823
            ARLNE
Sbjct  234  ARLNE  238



>ref|XP_006419945.1| hypothetical protein CICLE_v10005469mg [Citrus clementina]
 gb|ESR33185.1| hypothetical protein CICLE_v10005469mg [Citrus clementina]
Length=313

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 190/245 (78%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA KPIAP+DAAMMQ+AE  ++GQTQKGGPAA MQ+AA  N  AG V 
Sbjct  71   IKYGDLFNVSGDLAQKPIAPEDAAMMQTAEATIMGQTQKGGPAAVMQSAAARNEGAGFVG  130

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ AG+QGVTVTETDVPG RIITES+ GQVVG+  E  P+      G +      Q
Sbjct  131  HRDVTDVAGDQGVTVTETDVPGRRIITESVGGQVVGRHEEPTPVSLAPTTGRVE-----Q  185

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALE +AQ  G+K VD+SDAAAIQAAEVRATG+ V TP G+AA+AQSAAA+NE 
Sbjct  186  GAITIGEALETTAQTAGDKPVDQSDAAAIQAAEVRATGSTVTTP-GLAASAQSAAAHNET  244

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VLA AT KL ADK  TR+DAEG+ASA+QRNN +  + PGGVAASVAAA
Sbjct  245  VDRDEDKIKLNQVLAGATAKLAADKAVTRQDAEGIASAEQRNNPNADTHPGGVAASVAAA  304

Query  809  aRLNE  823
            ARLNE
Sbjct  305  ARLNE  309



>gb|ABB16353.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 195/246 (79%), Gaps = 8/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDV  VSG+L+ KPI P+DAAMMQSAE+ VLGQTQ GG A+ MQ+AA  N +AG+V 
Sbjct  16   IKYGDVLPVSGDLSQKPITPEDAAMMQSAESRVLGQTQPGGVASVMQSAATRNEQAGIVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL-  445
              DV++  G++GVTVTET VPG RIITE++ GQVVGQ VE  P+        + +  A+ 
Sbjct  76   HKDVTDVTGDRGVTVTETQVPGRRIITETVGGQVVGQFVEPTPVQ-------VGLTGAVR  128

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            ++ +TIG+ALEA+A  +G+K V++SDA+AIQAAEVRATG+NVITPGG+A+ AQSAAA+N 
Sbjct  129  ESALTIGEALEATAHTVGDKPVEQSDASAIQAAEVRATGSNVITPGGLASMAQSAAAFNA  188

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               R+++K+K+GNVL  AT KLPADK ATR+DA GVASA+ RNN D ++TPGGVAASVAA
Sbjct  189  ECQREEEKIKMGNVLTGATAKLPADKAATRQDAAGVASAEMRNNPDATATPGGVAASVAA  248

Query  806  aaRLNE  823
            AARLNE
Sbjct  249  AARLNE  254



>gb|KDO74561.1| hypothetical protein CISIN_1g038380mg [Citrus sinensis]
Length=261

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 190/245 (78%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD F VSG+LA KPIAP+DAAMMQ+AE  ++GQTQKGGPAAAMQ+AA  N  AG V 
Sbjct  19   IKYGDFFNVSGDLAQKPIAPEDAAMMQTAEATIMGQTQKGGPAAAMQSAAARNEGAGFVG  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ AG+QGVTVTETDVPG RIITES+ GQVVG+  E  P+      G +      Q
Sbjct  79   HRDVTDVAGDQGVTVTETDVPGRRIITESVGGQVVGRHEEPTPVSLAPTTGRVE-----Q  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALE +AQ  G+K VD+SDAAAIQAAEVRATG+ V TP G+AA+AQSAAA+NE 
Sbjct  134  GAITIGEALETTAQTAGDKPVDQSDAAAIQAAEVRATGSTVTTP-GLAASAQSAAAHNET  192

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VLA AT KL ADK  TR+DAEG+ASA+QRNN +  + PGGVAASVAAA
Sbjct  193  VDRDEDKIKLNQVLAGATAKLAADKAVTRQDAEGIASAEQRNNPNADTHPGGVAASVAAA  252

Query  809  aRLNE  823
            ARLNE
Sbjct  253  ARLNE  257



>ref|XP_004139881.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 ref|XP_004159055.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 gb|KGN44242.1| hypothetical protein Csa_7G234140 [Cucumis sativus]
Length=264

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 187/245 (76%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF ++G+LA K I P DA MMQ+AET V G+TQKGGPAA MQ+AA  N  +G V 
Sbjct  15   IKYGDVFNITGDLASKVIPPVDADMMQTAETIVFGRTQKGGPAATMQSAATRNELSGFVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             +DVS+ A +QGV V ETD+PGSRIITE++AGQ+VGQ VE  P   + A       + +Q
Sbjct  75   HEDVSDAARDQGVAVKETDIPGSRIITETVAGQIVGQFVE--PTSFFGAA------AVMQ  126

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIGQALEA+A   G+K VD+SDAAAIQAAEVRATG+NV+ PGG+AA+AQSAA++N G
Sbjct  127  NAVTIGQALEATAHTAGDKPVDQSDAAAIQAAEVRATGSNVVIPGGLAASAQSAASFNAG  186

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + +D+DK+KL + L DA  +LPADK+ T++DAEGV SA+ RNN  +++ PGGVA S+  A
Sbjct  187  VSKDEDKIKLNDTLMDAAMRLPADKVVTKQDAEGVMSAELRNNPRLAAHPGGVADSITEA  246

Query  809  aRLNE  823
            ARLNE
Sbjct  247  ARLNE  251



>gb|KEH43869.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=260

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 195/246 (79%), Gaps = 8/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDV  VSG+L+ KPI P+DAAMMQSAE+ VLGQTQ GG A+ MQ+AA  N +AG+V 
Sbjct  16   IKYGDVLPVSGDLSQKPITPEDAAMMQSAESRVLGQTQPGGVASVMQSAATRNEQAGIVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL-  445
              DV++  G++GVTVTET VPG RIITE++ GQVVGQ VE  P+        + +  A+ 
Sbjct  76   HKDVTDVTGDRGVTVTETQVPGRRIITETVGGQVVGQFVEPTPVQ-------VGLTGAVR  128

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            ++ +TIG+ALEA+A  +G+K V++SDA+AIQAAEVRATG+NVITPGG+A+ AQSAAA+N 
Sbjct  129  ESALTIGEALEATAHTVGDKPVEQSDASAIQAAEVRATGSNVITPGGLASMAQSAAAFNA  188

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               R+++K+K+G+VL  AT KLPADK ATR+DA GVASA+ RNN D ++TPGGVAASVAA
Sbjct  189  ECQREEEKIKMGDVLTGATAKLPADKAATRQDAAGVASAEMRNNPDATATPGGVAASVAA  248

Query  806  aaRLNE  823
            AARLNE
Sbjct  249  AARLNE  254



>ref|XP_008447154.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
melo]
Length=264

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 187/245 (76%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G+LA K I P DA MMQ+AET V G+TQKGGPAA MQ+AA  N R+G V 
Sbjct  15   IKYGDVFNVTGDLASKVIPPVDADMMQTAETMVFGRTQKGGPAATMQSAATTNERSGFVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DVS+ A +QGV V ETD+PGSRIITE++AGQ+VGQ VE  P   + A       + +Q
Sbjct  75   HKDVSDAARDQGVAVKETDIPGSRIITETVAGQIVGQFVE--PTSFFGAA------AVVQ  126

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIGQALEA A   G+K VD+SDAAAIQAAEVRATG+NV+ PGG+AA+AQSAA++N G
Sbjct  127  NAVTIGQALEAIAHTAGDKPVDQSDAAAIQAAEVRATGSNVVIPGGLAASAQSAASFNAG  186

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + +D+DK+KL ++L DA  +LPADK+ T++DAEGV SA+ RNN  +++ PGGVA S+  A
Sbjct  187  VSKDEDKIKLNDILMDAAMRLPADKVVTKQDAEGVMSAELRNNPRLAAYPGGVAESITEA  246

Query  809  aRLNE  823
            ARLNE
Sbjct  247  ARLNE  251



>emb|CDY10286.1| BnaC05g29930D [Brassica napus]
Length=262

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 183/246 (74%), Gaps = 0/246 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADK IAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKTIAPEDANMMQAAETRVFGHTQKGGTAAVMQSAATANKRGGFVQ  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E GVTV +TDVPG+R+ TE + GQVVGQ VE MP+    A     +   LQ
Sbjct  74   QGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQYVEPMPVGTTAATDAETLGMNLQ  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ Q  GNK VD+SDA AIQAAEVRA+GT+ I PGG+AA+A+SAA +N  
Sbjct  134  SAITIGEALEAAVQTAGNKPVDQSDATAIQAAEVRASGTSDIAPGGIAASARSAANHNAT  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL +VLA AT KL ADK  TR+DAEGV SA+ RNN  ++  PGGVAASV AA
Sbjct  194  VDRDEDKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNNPYLTIHPGGVAASVTAA  253

Query  809  aRLNER  826
            ARLNE+
Sbjct  254  ARLNEK  259



>ref|XP_010693766.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=318

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 191/251 (76%), Gaps = 7/251 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V+YGDVF V+GELA KP+AP+DAAMMQ+AE AV GQTQKGGPAA MQAAA VN RAG VS
Sbjct  68   VRYGDVFPVAGELASKPVAPRDAAMMQTAENAVFGQTQKGGPAATMQAAATVNERAGFVS  127

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL-  445
               VS+PA  QGVTVTETDVPG+ +ITES+ GQVVGQ+++  P P  Q   G      + 
Sbjct  128  HIGVSDPAARQGVTVTETDVPGACVITESVGGQVVGQTIQ--PRPVRQGENGTRKQRGIG  185

Query  446  ----QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
                   +TIG+ALEA A   G+K VD+SDAAA+QAAEVRATG   I PGGVAA AQSAA
Sbjct  186  GTGATGKVTIGEALEAVAATAGDKPVDQSDAAAVQAAEVRATGNTGIVPGGVAAAAQSAA  245

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaa  793
            + N     ++DK+KLG++L +AT KLPADK ATR+DAEGV SA+ RNN D+++ PGGVAA
Sbjct  246  SMNAQTTLEEDKIKLGDILTNATMKLPADKEATRQDAEGVVSAELRNNPDVATQPGGVAA  305

Query  794  svaaaaRLNER  826
            SVAAAARLNER
Sbjct  306  SVAAAARLNER  316



>ref|XP_009599420.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
tomentosiformis]
Length=274

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 197/254 (78%), Gaps = 8/254 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVFGVSGEL +K I P+DAAMMQSAETAVLGQTQ+GGPA AMQ+AAN N+ AG V 
Sbjct  16   IKYGDVFGVSGELGEKAIKPEDAAMMQSAETAVLGQTQRGGPADAMQSAANYNISAGAVQ  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVE--------AMPLPNYQAGGG  424
            P DV++ A  +GVTVT T VPG+ IITES+AGQVVGQ ++           +   +  GG
Sbjct  76   PGDVTDVAAREGVTVTGTAVPGANIITESVAGQVVGQYIQPTGGMAQGGGGVQEQEGSGG  135

Query  425  INMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataq  604
                     GITIGQALEA+AQ +  K +D+SDAAAIQAAE+RATG+NVITPGGVAATAQ
Sbjct  136  GGGQQQGGGGITIGQALEATAQTIPGKPIDQSDAAAIQAAEIRATGSNVITPGGVAATAQ  195

Query  605  saaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
            SAAAYNE ++RD+DKVKLG+VL+ AT  LPAD+ ATR+DAEGV  A+ RN  DMS+TPGG
Sbjct  196  SAAAYNESMMRDEDKVKLGDVLSGATTVLPADRPATRQDAEGVVGAEIRNKQDMSTTPGG  255

Query  785  vaasvaaaaRLNER  826
            VAASV  AARLNER
Sbjct  256  VAASVTVAARLNER  269



>emb|CCW28814.1| seed maturation protein [Arachis hypogaea]
Length=256

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 192/245 (78%), Gaps = 7/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA KP+ P+DAAMMQSAET VLG+TQ GG AAAMQ+AA +N +AGLV 
Sbjct  15   IKYGDVFNVSGELAQKPVKPEDAAMMQSAETRVLGKTQPGGAAAAMQSAATLNEQAGLVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV+  AG++GVTVT+   PG RI+TES+ GQVVGQ VE  P+ + +A      ++  +
Sbjct  75   HHDVNEVAGDRGVTVTDMQAPGRRIVTESVGGQVVGQYVEPTPVQSSRA------SAVRE  128

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+AQ +G+K V++SDAAAIQAAEVRATG+NVI PGG+AA AQSA A+N G
Sbjct  129  SAITIGEALEATAQTVGSKPVEQSDAAAIQAAEVRATGSNVIQPGGLAAMAQSAVAFNAG  188

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
                +DK+KL ++L  AT KLPADK AT +DAEGVASA+ RNN    +TPGGVAASVAAA
Sbjct  189  CRNPRDKIKLADILTGATAKLPADKAATHQDAEGVASAEARNNTG-GTTPGGVAASVAAA  247

Query  809  aRLNE  823
            ARLNE
Sbjct  248  ARLNE  252



>ref|XP_006360815.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=263

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 182/236 (77%), Gaps = 4/236 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGEL +K + P+DAAMMQSAETAVLG+ QK GPAAAMQ+AANVNV AGLV 
Sbjct  18   IKYGDVFSVSGELGEKAVKPEDAAMMQSAETAVLGKMQKSGPAAAMQSAANVNVSAGLVQ  77

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P DV++ A  +GVTVT T VPG+ IITES+AGQVVGQ ++       Q  G         
Sbjct  78   PGDVTDVAAREGVTVTGTAVPGANIITESVAGQVVGQYIQPTGGGGGQPQGAATTGGGGG  137

Query  449  AG----ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
             G    ITIG+ALEA+ Q +  K VD+ DAAAIQAAEVRATG+NVITPGGVAATAQSAAA
Sbjct  138  GGSTREITIGEALEAAGQTIPGKPVDQCDAAAIQAAEVRATGSNVITPGGVAATAQSAAA  197

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
            YNE +I+D+DKVKLG+VL+ AT+ LPADK ATR+DAEGV  A+ RN  DMS+TPGG
Sbjct  198  YNESMIKDEDKVKLGDVLSGATKVLPADKAATRQDAEGVVGAELRNKHDMSTTPGG  253



>ref|XP_009586710.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
tomentosiformis]
Length=260

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 193/245 (79%), Gaps = 3/245 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA +PIAPQDAAMMQSAET V GQTQKGGPA+ MQ+AA  N R+GLVS
Sbjct  17   IKYGDVFNVRGELAKQPIAPQDAAMMQSAETMVFGQTQKGGPASVMQSAATKNERSGLVS  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  +  AG++GVTVTET V G RIITES+AGQV+GQ VE  P+P   A GG      + 
Sbjct  77   HDATTPVAGDEGVTVTETTVLGRRIITESVAGQVLGQYVE--PVPVTAAVGGAGGEPEV-  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A ITIG+AL  +A   G+K +++SDAAAIQAAEVRATG+++ITPGG+AATAQSAA+ NEG
Sbjct  134  APITIGEALAVTALTAGDKPMEQSDAAAIQAAEVRATGSSLITPGGLAATAQSAASVNEG  193

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L +D DK+KL +VL  AT KLPADK ATR+DAEGV  A+ RNN ++++  GGVAASVAAA
Sbjct  194  LTQDVDKIKLNDVLTGATAKLPADKAATRQDAEGVMEAELRNNPELTTYAGGVAASVAAA  253

Query  809  aRLNE  823
            ARLNE
Sbjct  254  ARLNE  258



>ref|XP_010045838.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW84217.1| hypothetical protein EUGRSUZ_B01083 [Eucalyptus grandis]
Length=270

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 184/245 (75%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG LA KPIAPQDAAMMQSAE AVLGQ Q+GGPA AM+AAA  N RAGLV 
Sbjct  27   IKYGDVFSVSGNLASKPIAPQDAAMMQSAEAAVLGQPQRGGPADAMRAAAAWNERAGLVG  86

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D S+ A E+G+TVTET VPG RIITE +AGQVVGQ VE  P    Q+        A Q
Sbjct  87   RGDRSDVAEEEGITVTETGVPGGRIITERVAGQVVGQYVEGSPAAEAQS------QVAQQ  140

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+AQ+ G+K VDR+DAAAI  AE   TG+NV+ PGG+AA+AQ+AAAYNEG
Sbjct  141  SAITIGEALEATAQSAGDKPVDRADAAAIFVAEQCVTGSNVVVPGGLAASAQTAAAYNEG  200

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +RD  K+K+ +VL  AT KLPAD++A+R+DAE V +A+ R     ++ PGGV ASVAAA
Sbjct  201  TLRDDAKIKISDVLTGATAKLPADRVASRQDAEWVVNAEMRTGNKAAAHPGGVGASVAAA  260

Query  809  aRLNE  823
             R+NE
Sbjct  261  VRINE  265



>ref|NP_001237506.1| seed maturation protein PM24 [Glycine max]
 gb|AAF21310.1| seed maturation protein PM24 [Glycine max]
Length=259

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 186/245 (76%), Gaps = 3/245 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G+LA  PIAP+DAAMMQSAE  VLG+TQ GG ++ MQ+AA  N +AGLV 
Sbjct  15   IKYGDVFDVYGDLAQMPIAPEDAAMMQSAEARVLGKTQPGGASSVMQSAATRNEQAGLVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++  G+ GVTVTET   G RIITE++ GQVV Q VE  P   ++AG   + N    
Sbjct  75   HQDVTDITGDHGVTVTETTFHGRRIITEAVGGQVVEQYVE--PKSQFEAGR-TSCNLRRS  131

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A   +G+AL+A+AQ +G+K VD+SDA+AIQ AEVRATG+NVITPGG+AA AQSAAAYN  
Sbjct  132  AYNQLGEALKATAQTVGHKPVDQSDASAIQTAEVRATGSNVITPGGLAAMAQSAAAYNAD  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
               DQDKVKL +VL  AT KLPADK AT +DAEGVASA+ RNN D ++TPGGVAASVAAA
Sbjct  192  CKHDQDKVKLADVLTGATAKLPADKAATLQDAEGVASAEARNNPDATATPGGVAASVAAA  251

Query  809  aRLNE  823
            ARLNE
Sbjct  252  ARLNE  256



>ref|NP_188889.1| late embryogenesis abundant protein ECP31 [Arabidopsis thaliana]
 dbj|BAB01466.1| LEA protein in group 5 [Arabidopsis thaliana]
 gb|AAK96509.1| AT3g22500/F16J14_6 [Arabidopsis thaliana]
 gb|AAN38682.1| At3g22500/F16J14_6 [Arabidopsis thaliana]
 gb|AEE76647.1| late embryogenesis abundant protein ECP31 [Arabidopsis thaliana]
Length=256

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 176/246 (72%), Gaps = 5/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQSAET V G TQKGGPAA MQ+AA  N+R G V 
Sbjct  13   VKYGDVFEVSGELADKPIAPEDAKMMQSAETHVFGHTQKGGPAAVMQSAATTNIRGGFVH  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            PDD +    E+G TV +T VP + + TE + GQVVGQ VE    P            ALQ
Sbjct  73   PDDKTELVAERGATVEQT-VPAATVTTEFVGGQVVGQHVE----PRRVVAAARTDEEALQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ +  GNK VD+SDAAAIQAAE+RA+GTNVI   GVAA+AQSAA +N  
Sbjct  128  STITIGEALEATVKTAGNKPVDQSDAAAIQAAEMRASGTNVIALAGVAASAQSAADHNAT  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+ K+KL +VL  A  KL AD+  TREDAEGV SA+ RNN  + + PGGVAAS+  A
Sbjct  188  VDRDERKIKLRDVLTGAAGKLSADRAVTREDAEGVVSAEMRNNPKLCTHPGGVAASLTVA  247

Query  809  aRLNER  826
            ARLNER
Sbjct  248  ARLNER  253



>ref|XP_007143265.1| hypothetical protein PHAVU_007G057900g [Phaseolus vulgaris]
 gb|ESW15259.1| hypothetical protein PHAVU_007G057900g [Phaseolus vulgaris]
Length=257

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 189/245 (77%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG LA KP+AP+DAAMMQSAET VLGQTQ GG A+ MQ+AAN N RAGLVS
Sbjct  16   IKYGDVFNVSGNLAKKPVAPEDAAMMQSAETRVLGQTQLGGAASVMQSAANQNERAGLVS  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ A + GVTV+ET VPG RIITE++ G+VV Q  E  P+   +A       +   
Sbjct  76   HLDVNDVASDGGVTVSETQVPGRRIITEAVGGKVVQQYTEPTPVQTGRA------RAVRG  129

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+AQ +G K VD+SDA+AIQAAEVRATG NV+ PGG+AA AQSAAA+N  
Sbjct  130  SAITIGEALEATAQTVGYKVVDQSDASAIQAAEVRATGNNVVAPGGLAAMAQSAAAHNAD  189

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              RD+DKVKL ++L+ AT KL ADK  T +DAEGVASA+ RNN D ++TPGG+AASVAAA
Sbjct  190  CSRDEDKVKLSDLLSGATAKLAADKAVTLQDAEGVASAEVRNNPDATATPGGIAASVAAA  249

Query  809  aRLNE  823
            AR+NE
Sbjct  250  ARINE  254



>ref|XP_002885506.1| ATECP31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61765.1| ATECP31 [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 176/246 (72%), Gaps = 5/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQSAET V G TQKGGPAA MQ+AA  N+R G V 
Sbjct  13   VKYGDVFEVSGELADKPIAPEDAKMMQSAETHVFGHTQKGGPAAVMQSAATTNIRGGFVH  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D +    E+G TV +T VP + + TE +AGQVVGQ VE    P            ALQ
Sbjct  73   PGDKTELVAERGATVEQT-VPATTVTTEFVAGQVVGQHVE----PRRIVAAARTDEEALQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ +  GNK VD+SDAAAIQAAE+RA+GTNVI   GVAA+AQSAA +N  
Sbjct  128  STITIGEALEATVKTAGNKPVDQSDAAAIQAAEMRASGTNVIALAGVAASAQSAADHNAT  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+ K+KL +VL  A  KL AD+  TREDAEGV SA+ RNN  + + PGGVAAS+  A
Sbjct  188  VDRDERKIKLSDVLTGAAGKLSADRAVTREDAEGVVSAEMRNNPKLCTHPGGVAASLTVA  247

Query  809  aRLNER  826
            ARLNER
Sbjct  248  ARLNER  253



>ref|NP_001237967.1| seed maturation protein PM26 [Glycine max]
 gb|AAF21312.1| seed maturation protein PM26 [Glycine max]
Length=257

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 191/247 (77%), Gaps = 9/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA KP+AP+DAAMMQSAET VLGQTQ GG A+ MQ+AA  N +AGLV 
Sbjct  15   IKYGDVFVVSGDLAQKPVAPEDAAMMQSAETRVLGQTQPGGAASVMQSAATRNEQAGLVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++  G++GVTVTET VPG RIITE++ GQVV Q VEA P+   +AG     +SA++
Sbjct  75   HRDVTDVTGDRGVTVTETKVPGRRIITEAVGGQVVEQYVEATPV---EAG----RSSAIK  127

Query  449  A-GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATG-TNVITPGGVaataqsaaaYN  622
               ITIG+ALEA+AQ +G KAVD+SDA AIQAA   + G  NVITPGG+AA AQSAAAYN
Sbjct  128  ENAITIGEALEATAQTVGQKAVDQSDAFAIQAAGGESNGEVNVITPGGLAAMAQSAAAYN  187

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
                 DQ KVKL ++LA AT KLPADK AT +DAEGVA A+ RNN D ++TPGGVAASVA
Sbjct  188  ADCKLDQAKVKLADILAGATAKLPADKAATLQDAEGVACAEVRNNPDATATPGGVAASVA  247

Query  803  aaaRLNE  823
            AAARLNE
Sbjct  248  AAARLNE  254



>ref|XP_010041766.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW44096.1| hypothetical protein EUGRSUZ_L02495 [Eucalyptus grandis]
Length=270

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 183/245 (75%), Gaps = 6/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG LA KPI+PQDAAMMQSAE AVLGQ Q+GGPA AM+AAA  N RAGLV 
Sbjct  27   IKYGDVFSVSGNLASKPISPQDAAMMQSAEAAVLGQPQRGGPADAMRAAAAWNERAGLVG  86

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A E+G+TVTET VPG RIITE +AGQVVGQ VE  P    +A          Q
Sbjct  87   RGDRTDVAAEEGITVTETGVPGGRIITERVAGQVVGQYVEGGPAAEAEA------QVVQQ  140

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+AQ+ G+K VDR+DAAAI  AE   TG+NV+ PGG+AA+AQ+AAAYNEG
Sbjct  141  SAITIGEALEATAQSAGDKPVDRADAAAIFVAEQCVTGSNVVVPGGLAASAQTAAAYNEG  200

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +RD  K+K+ +VL  AT KLPAD++A+R+DAE V +A+ R     ++ PGGV ASVAAA
Sbjct  201  TLRDDAKIKISDVLTGATAKLPADRVASRQDAEWVVNAEMRTGNKAAAHPGGVGASVAAA  260

Query  809  aRLNE  823
             R+NE
Sbjct  261  VRINE  265



>dbj|BAA11016.1| LEA protein in group 5 [Arabidopsis thaliana]
Length=256

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 176/246 (72%), Gaps = 5/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQSAET V G TQKGGPAA MQ+AA  N+R G V 
Sbjct  13   VKYGDVFEVSGELADKPIAPEDAKMMQSAETHVFGHTQKGGPAAVMQSAATTNIRGGFVH  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            PDD +    E+G TV +T VP + + TE + GQVVGQ VE    P            ALQ
Sbjct  73   PDDKTELVAERGATVEQT-VPAATVTTEFVGGQVVGQHVE----PRRVVAAARTDEEALQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ +  GNK VD+SDAAAIQAAE+RA+GTNVI   GVAA+AQSAA +N  
Sbjct  128  STITIGEALEATVKTAGNKPVDQSDAAAIQAAEMRASGTNVIALAGVAASAQSAADHNAT  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + R++ K+KL +VL  A  KL AD+  TREDAEGV SA+ RNN  + + PGGVAAS+  A
Sbjct  188  VDRNERKIKLRDVLTGAAGKLSADRAVTREDAEGVVSAEMRNNPKLCTHPGGVAASLTVA  247

Query  809  aRLNER  826
            ARLNER
Sbjct  248  ARLNER  253



>ref|XP_010256054.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=276

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 182/246 (74%), Gaps = 10/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELADKPIAPQDAAMMQ+AE  VLG+TQKGGPAA M +A+  N +AG+V 
Sbjct  36   IKYGDVFLVSGELADKPIAPQDAAMMQTAEHLVLGKTQKGGPAAKMLSASARNEKAGVVG  95

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL-PNYQAGGGINMNSAL  445
              D ++  G +GVTV+E DVPGSRI+TE++AGQVVGQ  E +PL P           +A 
Sbjct  96   HTDFTDITGNEGVTVSEIDVPGSRIVTEAVAGQVVGQYTEPLPLQPEL---------AAQ  146

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            Q  +TIG+ALEAS  A G+K VD+SDAAAIQAAEVRATG   I  GG+AA+AQSAA  N 
Sbjct  147  QGKLTIGEALEASVVAAGDKPVDKSDAAAIQAAEVRATGQKTIMSGGLAASAQSAANANA  206

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD+DK+KLG+VL  AT KLPADK  T +DAEG+ +A+ RNN + +  PGGVA SV A
Sbjct  207  QTTRDEDKIKLGDVLVVATAKLPADKPVTFQDAEGIINAEVRNNPNSTIYPGGVAESVIA  266

Query  806  aaRLNE  823
            AA LNE
Sbjct  267  AADLNE  272



>ref|XP_010917735.1| PREDICTED: late embryogenesis abundant protein D-34-like [Elaeis 
guineensis]
Length=269

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 184/246 (75%), Gaps = 8/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA +PIAP+DAAMMQSAE  VLGQTQKGG A+ MQ+AA+ N +AGLV 
Sbjct  25   IKYGDVFIVQGELAREPIAPRDAAMMQSAENQVLGQTQKGGAASVMQSAADRNEQAGLVD  84

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              +VS+   + GV VTETD+PG RI+TE++ GQVVG+  E  P+      G   M +A+Q
Sbjct  85   HREVSDLPADLGVAVTETDLPGRRIVTEAVGGQVVGKYEEPAPV------GTGTMPAAVQ  138

Query  449  AG--ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
             G  ITIG+ALE +A   G K V++SDAAAIQAAEVRAT TN + PGGV+A AQSAA  N
Sbjct  139  QGDAITIGEALETTAMTAGEKPVEQSDAAAIQAAEVRATRTNEVPPGGVSAQAQSAATAN  198

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
              ++R++DKVKL +VL+DAT +LPADK ATREDA+ V  A+ RNN DM++ PGGV  +VA
Sbjct  199  TCVMREEDKVKLRDVLSDATTRLPADKAATREDADRVGVAEMRNNPDMATHPGGVGENVA  258

Query  803  aaaRLN  820
             AARLN
Sbjct  259  EAARLN  264



>ref|XP_010096140.1| hypothetical protein L484_005419 [Morus notabilis]
 gb|EXB63456.1| hypothetical protein L484_005419 [Morus notabilis]
Length=358

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 167/209 (80%), Gaps = 10/209 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELA K +AP+DAAMMQSAET VLGQTQKGGPAA MQ+AA  N RAG+V 
Sbjct  145  VKYGDVFNVSGELASKTVAPRDAAMMQSAETTVLGQTQKGGPAATMQSAATQNERAGVVG  204

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D S+ A ++GV+VTETDVPG RI+TES+AGQVVGQ V+  P           M +A+ 
Sbjct  205  HVDASDAAEDRGVSVTETDVPGYRIVTESVAGQVVGQYVQPTPA----------MQAAVV  254

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+A+  G+K VD+SDAAAIQAAEVRATG+NVITPGG+AATAQSAA++N  
Sbjct  255  SAITIGEALEATAKTAGDKPVDQSDAAAIQAAEVRATGSNVITPGGLAATAQSAASFNAA  314

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATR  715
            + RD++K+KL ++L DAT KLPADK ATR
Sbjct  315  IERDENKIKLRDILTDATSKLPADKAATR  343



>ref|XP_004168899.1| PREDICTED: late embryogenesis abundant protein D-34-like, partial 
[Cucumis sativus]
Length=301

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 179/245 (73%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA  PIAP+DA MM SAET VLGQ  + GPA  M+AAA  NVR GL+S
Sbjct  26   IKYGDIFNVSGDLAANPIAPEDARMMASAETRVLGQMHETGPADVMRAAAARNVRVGLLS  85

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG+ ++ETDVPG+R++TE +AGQVVGQ ++           G+ M    Q
Sbjct  86   SRDISDVAKSQGINISETDVPGARVVTECVAGQVVGQYLDTT------MTSGVEMPE--Q  137

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIGQALEA+ Q +GNK V++SDAAAIQAAEV ATG N I PGG+ ATAQ+AA +N  
Sbjct  138  DVITIGQALEAACQMIGNKPVEQSDAAAIQAAEVCATGNNAINPGGLGATAQAAAIFNAR  197

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VL +AT+KL  DK  +R+D EGV SA+ RNN  M++ PGGVAAS+ AA
Sbjct  198  MDRDEDKIKLNYVLTEATEKLATDKAVSRQDVEGVVSAELRNNPSMTTHPGGVAASITAA  257

Query  809  aRLNE  823
            ARLNE
Sbjct  258  ARLNE  262



>gb|KGN56981.1| hypothetical protein Csa_3G146660 [Cucumis sativus]
Length=303

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 179/245 (73%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA  PIAP+DA MM SAET VLGQ  + GPA  M+AAA  NVR GL+S
Sbjct  26   IKYGDIFNVSGDLAANPIAPEDARMMASAETRVLGQMHETGPADVMRAAAARNVRVGLLS  85

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG+ ++ETDVPG+R++TE +AGQVVGQ ++           G+ M    Q
Sbjct  86   SRDISDVAKSQGINISETDVPGARVVTECVAGQVVGQYLDTT------MTSGVEMPE--Q  137

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIGQALEA+ Q +GNK V++SDAAAIQAAEV ATG N I PGG+ ATAQ+AA +N  
Sbjct  138  DVITIGQALEAACQMIGNKPVEQSDAAAIQAAEVCATGNNAINPGGLGATAQAAAIFNAR  197

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VL +AT+KL  DK  +R+D EGV SA+ RNN  M++ PGGVAAS+ AA
Sbjct  198  MDRDEDKIKLNYVLTEATEKLATDKAVSRQDVEGVVSAELRNNPSMTTHPGGVAASITAA  257

Query  809  aRLNE  823
            ARLNE
Sbjct  258  ARLNE  262



>ref|XP_010488281.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=256

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 179/246 (73%), Gaps = 5/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKP+AP+DA MMQ+AET V G TQKGG AA MQ+AA  N+R G V 
Sbjct  13   VKYGDVFEVSGELADKPVAPEDAKMMQAAETHVFGHTQKGGAAAIMQSAATSNIRGGFVH  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +T VP S + TE + GQVVGQ VE    P            ALQ
Sbjct  73   PGDKTDLAAERGVTVEQT-VPPSTVTTEFVGGQVVGQHVE----PRRVVAAARTDEPALQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ +  GNK VD+SDAAAIQAAE+RA+GTNVI   G+AATAQSAA +N  
Sbjct  128  SAITIGEALEAALKTAGNKPVDQSDAAAIQAAEMRASGTNVIALAGIAATAQSAADHNAT  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+ K+KL +VL  A +KL +D+  TR+DAEGV SA+ RNN  + + PGGVAAS+ AA
Sbjct  188  VDRDEKKIKLVDVLTGAAEKLSSDRPVTRQDAEGVVSAEMRNNPKLCTHPGGVAASLTAA  247

Query  809  aRLNER  826
            ARLNER
Sbjct  248  ARLNER  253



>ref|XP_006382740.1| hypothetical protein POPTR_0005s04950g [Populus trichocarpa]
 gb|ERP60537.1| hypothetical protein POPTR_0005s04950g [Populus trichocarpa]
Length=263

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 185/251 (74%), Gaps = 14/251 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA+KP+AP+DAAMMQ+AE A++GQ Q+GG A+ MQ+AA  N RAG V 
Sbjct  13   IKYGDVFSVEGELAEKPVAPRDAAMMQTAENALMGQIQRGGAASMMQSAAMRNERAGFVG  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL-----PNYQAGGGINM  433
              DV++ A  QGV+VTET++PG RIITE+I GQ+V    +  PL     P +Q       
Sbjct  73   HSDVNDVANYQGVSVTETEMPGRRIITEAIGGQIVRDFDQRAPLVQSPPPLFQQ------  126

Query  434  NSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
               + AGITIG+ALEA+A + G K V+ SDAAAIQAAEVRATG   ITPGGVAA AQSAA
Sbjct  127  ---VDAGITIGEALEATALSCGQKPVEWSDAAAIQAAEVRATGRTTITPGGVAAAAQSAA  183

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaa  793
              N  + +D+DK KL +VLADAT KLPADK ATR+DAEGV  A+ RN+  +++ P GVAA
Sbjct  184  TINARMTKDEDKTKLSDVLADATSKLPADKPATRKDAEGVTGAEMRNDPFLTTNPAGVAA  243

Query  794  svaaaaRLNER  826
            SVAAAARLN++
Sbjct  244  SVAAAARLNQQ  254



>ref|XP_010466535.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=256

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 180/246 (73%), Gaps = 5/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSG+LADKP+AP+DA MMQ+AET V G T+KGG AA MQ+AA  N+R G V 
Sbjct  13   VKYGDVFEVSGKLADKPVAPEDAKMMQAAETHVFGHTKKGGAAAIMQSAATSNIRGGFVH  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D ++ A E+GVTV +T VP S + TES+ GQVVGQ VE    P            ALQ
Sbjct  73   PGDKTDLAAERGVTVEQT-VPPSTVTTESVGGQVVGQHVE----PRRVVAAARTDEPALQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ +  GNK VD+SDAAAIQAAE+RA+GTNVI   G+AATAQSAA +N  
Sbjct  128  SKITIGEALEAALKTAGNKPVDQSDAAAIQAAEMRASGTNVIALAGIAATAQSAADHNAT  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+ K+KL +VL  A +KLP+D+  TR+DAEGV SA+ RNN  + +  GGVAAS+ AA
Sbjct  188  VDRDERKIKLVDVLTGAAEKLPSDRAVTRQDAEGVVSAEMRNNPKLCTHSGGVAASLTAA  247

Query  809  aRLNER  826
            AR+NER
Sbjct  248  ARVNER  253



>ref|XP_004134446.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
Length=506

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 179/245 (73%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA  PIAP+DA MM SAET VLGQ  + GPA  M+AAA  NVR GL+S
Sbjct  26   IKYGDIFNVSGDLAANPIAPEDARMMASAETRVLGQMHETGPADVMRAAAARNVRVGLLS  85

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG+ ++ETDVPG+R++TE +AGQVVGQ ++           G+ M    Q
Sbjct  86   SRDISDVAKSQGINISETDVPGARVVTECVAGQVVGQYLDTT------MTSGVEMPE--Q  137

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIGQALEA+ Q +GNK V++SDAAAIQAAEV ATG N I PGG+ ATAQ+AA +N  
Sbjct  138  DVITIGQALEAACQMIGNKPVEQSDAAAIQAAEVCATGNNAINPGGLGATAQAAAIFNAR  197

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VL +AT+KL  DK  +R+D EGV SA+ RNN  M++ PGGVAAS+ AA
Sbjct  198  MDRDEDKIKLNYVLTEATEKLATDKAVSRQDVEGVVSAELRNNPSMTTHPGGVAASITAA  257

Query  809  aRLNE  823
            ARLNE
Sbjct  258  ARLNE  262



>ref|XP_010932759.1| PREDICTED: late embryogenesis abundant protein D-34-like [Elaeis 
guineensis]
Length=267

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 184/249 (74%), Gaps = 13/249 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GEL  +PIAP+DAAMMQSAE  V+GQTQKGGPAA MQ+AAN N RAGLV 
Sbjct  24   IKYGDVFNVQGELGREPIAPRDAAMMQSAENLVMGQTQKGGPAAVMQSAANRNERAGLVG  83

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNS---  439
              DVS    +QGV+VTETD+PG R++TES+ GQVVG+         Y+A    +M +   
Sbjct  84   HRDVSGLPADQGVSVTETDLPGRRVVTESVGGQVVGR---------YEAPAPASMTTPAG  134

Query  440  ALQA-GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
            ALQ   ITIG+ALEA+A   G K VD+ DAAA+QAAEVRATG N + PGG+AA AQSAA 
Sbjct  135  ALQGDAITIGEALEATAMIAGGKPVDQGDAAALQAAEVRATGQNEVVPGGIAAEAQSAAD  194

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
             N  ++RD+D+VKL +V+ +AT KLPADK  TREDA+ V  A+ RN  DM++ P GVAA+
Sbjct  195  ANARVMRDEDRVKLRDVVTNATTKLPADKAVTREDADRVIGAEMRNRPDMATHPQGVAAN  254

Query  797  vaaaaRLNE  823
            +AAAARLN+
Sbjct  255  MAAAARLNQ  263



>ref|XP_008451333.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
melo]
Length=258

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 184/246 (75%), Gaps = 6/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA KPIAP+DAA +Q+AE  VLGQT +GGPAA MQ+AAN+N RAGLV 
Sbjct  17   IKYGDVFDVSGELASKPIAPRDAATLQAAENMVLGQTPRGGPAAVMQSAANLNERAGLVG  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ A  +GV VTET V G R + ES+ GQVVGQ V+   +P    G  ++ +S   
Sbjct  77   HSDVTDVAVNEGVNVTETVVDGQRFVVESVGGQVVGQFVQPN-VPMRSPGATLDKDS---  132

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              I+IG+ALEASA + G+K +D+SDAAAIQAAE+RATG N I PGG+ A AQSAA  N  
Sbjct  133  --ISIGEALEASAVSAGDKPIDQSDAAAIQAAELRATGENKIIPGGIGAEAQSAATLNTR  190

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +R++DK  LG++L DAT+KLP DK  T+EDAE V SA+ RN   M++TPGGVAASVAAA
Sbjct  191  AMRNEDKTTLGDILTDATRKLPGDKTVTKEDAERVISAEIRNAPTMATTPGGVAASVAAA  250

Query  809  aRLNER  826
            ARLN+R
Sbjct  251  ARLNQR  256



>ref|XP_008811249.1| PREDICTED: late embryogenesis abundant protein D-34-like [Phoenix 
dactylifera]
Length=268

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 179/245 (73%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA +PIAP+DAAMMQ+AE  V+GQTQKGGPAA MQ+AA  N RAGLV 
Sbjct  25   IKYGDVFNVQGELAREPIAPRDAAMMQAAENLVMGQTQKGGPAAVMQSAAKRNERAGLVG  84

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DVS    +QGV+VTETD+PG R++ ES+ GQ+VG+     P+      G +  ++   
Sbjct  85   HRDVSGLPADQGVSVTETDLPGRRVVAESVGGQMVGRYETPAPVSMTTPEGALRGDA---  141

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+AL A+A   G K VD SDAAA+QA EVRATG N + PGGVAA AQSAA  N  
Sbjct  142  --ITIGEALGATAMTAGGKPVDESDAAALQAVEVRATGRNEVLPGGVAAEAQSAADANAR  199

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            ++RD+DKVKL +V+ DAT KLPADK  TREDA+ V  A+ RN+ DM++ P GVAA+VAAA
Sbjct  200  VMRDEDKVKLRDVVTDATTKLPADKAVTREDADRVVGAEMRNSPDMATHPQGVAANVAAA  259

Query  809  aRLNE  823
            ARLN+
Sbjct  260  ARLNQ  264



>ref|XP_010277180.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=259

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 176/246 (72%), Gaps = 6/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSG+LA KPI PQDA++MQSAE  V+G+T KGG AA MQ+AA  N R G V 
Sbjct  17   VKYGDVFPVSGDLASKPIKPQDASLMQSAENLVIGRTPKGGVAATMQSAAATNERTGHVG  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQ-SVEAMPLPNYQAGGGINMNSAL  445
             DDV++   ++GVTVTETD+PG  IITE++  +VVGQ ++   P+     G G   +   
Sbjct  77   HDDVTDITKDRGVTVTETDLPGRSIITEAVGDEVVGQYTLPGAPMTTAAGGTGDGPHP--  134

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+A   G+K VD+SDAAAIQAAEVRATG NV  PGGV A AQSAA  NE
Sbjct  135  ---ITIGEALEATAMVSGDKPVDQSDAAAIQAAEVRATGLNVNIPGGVGAEAQSAANVNE  191

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              IRD+DKV LG VL DAT KL  DK ATR DAE V  A+ RNN ++S+ PGGVAA+V  
Sbjct  192  RAIRDEDKVTLGEVLTDATAKLVRDKPATRRDAERVVGAELRNNSNVSTHPGGVAAAVTE  251

Query  806  aaRLNE  823
            AARLN+
Sbjct  252  AARLNQ  257



>ref|XP_008438669.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X1 
[Cucumis melo]
Length=315

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 179/245 (73%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA  PIAP+DA MM SAET VLGQ  + GPA  M+AAA  NV+ G++S
Sbjct  38   IKYGDVFNVSGDLAANPIAPEDARMMASAETRVLGQMHEAGPADVMRAAAAHNVQVGVLS  97

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG+ ++ETDVPG+R+++E +AGQVVGQ ++           G+ M    Q
Sbjct  98   SRDISDVAKNQGINISETDVPGARVVSECVAGQVVGQYLDTT------TASGVEMPE--Q  149

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIGQALEA+ Q +GNK V++SDAAAI AAEV ATG N + PGG+ ATAQ+AA +N  
Sbjct  150  DVITIGQALEAACQIIGNKPVEQSDAAAIHAAEVCATGNNAMNPGGLGATAQAAAIFNAA  209

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VL  AT+KL  DK+ +R+D EGV SA+ RNN  M++ PGGVAAS++AA
Sbjct  210  MDRDEDKIKLNYVLTGATEKLATDKVVSRQDVEGVVSAELRNNPSMTTHPGGVAASISAA  269

Query  809  aRLNE  823
            ARLNE
Sbjct  270  ARLNE  274



>emb|CDY24310.1| BnaC03g42830D [Brassica napus]
Length=256

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 179/247 (72%), Gaps = 6/247 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELAD+PIAP+DA MMQ+ ET+VLG TQKGG AA MQ+AA  N RAG V 
Sbjct  14   VKYGDVFEVSGELADRPIAPEDARMMQAKETSVLGHTQKGGIAATMQSAATANRRAGFVE  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P   +    ++GV+V +TDV G+R+  E+I  Q VGQ VE  P P   A  G++    +Q
Sbjct  74   PGVATYLDPDRGVSVEQTDVAGARVTKETIGVQDVGQYVE--PRPVATAATGVS----VQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIGQALEA+    G K VD+SDAAAIQAAEVRA+  NVI PGGVAA+AQSAA YN  
Sbjct  128  SKITIGQALEATVHTAGKKPVDQSDAAAIQAAEVRASSNNVIAPGGVAASAQSAADYNAP  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +  D++K+KL +VLA A  KL  DK  T++DAEGV SA+ RNN ++S+ PGGVA SV AA
Sbjct  188  IEFDENKIKLADVLAGAAGKLQEDKAVTKQDAEGVVSAELRNNPNLSTYPGGVADSVTAA  247

Query  809  aRLNERG  829
            ARLN +G
Sbjct  248  ARLNAKG  254



>ref|XP_010552068.1| PREDICTED: late embryogenesis abundant protein D-34-like [Tarenaya 
hassleriana]
Length=246

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 177/250 (71%), Gaps = 23/250 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELADKP+AP DA MMQ+AET V G TQKGG AA MQ AA +N R+G V 
Sbjct  12   IKYGDVFNVSGELADKPVAPGDANMMQAAETRVFGHTQKGGTAAVMQYAAAINERSGFVH  71

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D ++ A ++G+TV +TDVPG+R+ TE + GQVVGQ VEA P        G+    A++
Sbjct  72   HGDTTDVAADRGITVAQTDVPGARVTTEFVGGQVVGQYVEAKP--------GVTAPEAVE  123

Query  449  AG----ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
            AG    ITIG+ALEA+     ++  +R D       ++RATG+N I  GG+AATAQSAA 
Sbjct  124  AGLQSAITIGEALEAAV----HRERERDD-------QIRATGSNTIVHGGLAATAQSAAT  172

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
            +N  + RD+DK+KLG VL  AT KLP DK ATREDAEGV SA+ RN+ ++S+ PGGVAAS
Sbjct  173  HNLTVARDEDKIKLGEVLTGATWKLPVDKEATREDAEGVVSAELRNSPNLSTHPGGVAAS  232

Query  797  vaaaaRLNER  826
            + AAARLNER
Sbjct  233  ITAAARLNER  242



>ref|XP_009370807.1| PREDICTED: late embryogenesis abundant protein D-34-like [Pyrus 
x bretschneideri]
Length=259

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/248 (59%), Positives = 183/248 (74%), Gaps = 10/248 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELAD+P+AP+DAA  Q+AE  VLG+  +GGPAA MQ+AA  N R GLV 
Sbjct  20   IKYGDVFNVSGELADRPVAPRDAATAQAAENLVLGENPRGGPAAVMQSAATYNERFGLVG  79

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              D +  A E+GVTVTET  P G+R++TE +AGQVV Q VE  P+P    GG ++ ++  
Sbjct  80   HLDSTKVAREEGVTVTETINPDGNRVVTEKVAGQVVAQYVEP-PVPMASPGGALDRDA--  136

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEASA   G+K +++SDAAAIQAAE+RATG N I PGGVAA AQ AA+ N 
Sbjct  137  ---ITIGEALEASALTAGDKPIEQSDAAAIQAAEMRATGRNEIAPGGVAAVAQYAASVNP  193

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD +K KLG+VL DAT+KLPADK  TREDA+ V  A+ RN+ +M++TPGGVA S+AA
Sbjct  194  ---RDVNKTKLGDVLEDATEKLPADKPVTREDAKAVIGAEIRNSPNMATTPGGVAESLAA  250

Query  806  aaRLNERG  829
            AA LN+ G
Sbjct  251  AAGLNQNG  258



>ref|XP_004146999.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 gb|KGN44800.1| hypothetical protein Csa_7G388330 [Cucumis sativus]
Length=259

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 186/246 (76%), Gaps = 6/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELA KPIAP+DAA +Q+AE  +LGQT +GGPAA MQ+AAN+N RAGLV 
Sbjct  18   VKYGDVFDVSGELASKPIAPRDAASLQAAENIILGQTPRGGPAAVMQSAANLNERAGLVG  77

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ A  +GV VTET V G R + ES+ GQ+VG+ V+   +P    G  ++ +S   
Sbjct  78   HSDVTDVALNEGVNVTETVVDGQRFVVESVGGQIVGRFVQPN-VPMRSPGATLDNDS---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              I+IG+ALEASA + G+K +++SDAAAIQAAEVRATG N I PGG+ A AQSAA  N  
Sbjct  134  --ISIGEALEASAVSAGDKPINQSDAAAIQAAEVRATGENNIIPGGIGAEAQSAATLNTR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            ++ +++K  LG++L DAT+KLP DK  T+EDAE V SA+ RN+L M++TPGGVAASVAAA
Sbjct  192  VMLNENKTTLGDILTDATRKLPGDKTVTKEDAERVISAEIRNDLKMATTPGGVAASVAAA  251

Query  809  aRLNER  826
            ARLN++
Sbjct  252  ARLNQQ  257



>gb|ADQ91842.1| late embryogenesis abundant protein group 5 protein [Arachis 
hypogaea]
Length=220

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 162/210 (77%), Gaps = 6/210 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA KP+ P+DAAMMQSAET VLG+TQ GG AAAMQ+AA +N +AGLV 
Sbjct  15   IKYGDVFNVSGELAQKPVKPEDAAMMQSAETRVLGKTQPGGAAAAMQSAATLNEQAGLVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV+  AG++GVTVT+   PG RI+TES+ GQVVGQ VE  P+ + +A      ++  +
Sbjct  75   HHDVNEVAGDRGVTVTDMQAPGRRIVTESVGGQVVGQYVEPTPVQSSRA------SAVRE  128

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+AQ +G+K V++SDAAAIQAAEVRATG+NVI PGG+AA AQSA A+N G
Sbjct  129  SAITIGEALEATAQTVGSKPVEQSDAAAIQAAEVRATGSNVIQPGGLAAMAQSAVAFNAG  188

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATRE  718
                +DK+KL ++L  AT KLPADK AT +
Sbjct  189  CRNPRDKIKLADILTGATAKLPADKAATHQ  218



>ref|XP_004169378.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
Length=259

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 185/246 (75%), Gaps = 6/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELA KPIAP+DAA +Q+AE  +LGQT +GGPAA MQ+AAN+N RAGLV 
Sbjct  18   VKYGDVFDVSGELASKPIAPRDAASLQAAENIILGQTPRGGPAAVMQSAANLNERAGLVG  77

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++ A  +GV VTET V G R + ES+ GQ+VG+ V+   +P    G  ++ +S   
Sbjct  78   HSDVTDVALNEGVNVTETVVDGQRFVVESVGGQIVGRFVQPN-VPMRSPGATLDNDS---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              I+IG+ALEASA + G+K + +SDAAAIQAAEVRATG N I PGG+ A AQSAA  N  
Sbjct  134  --ISIGEALEASAVSAGDKPITQSDAAAIQAAEVRATGENNIIPGGIGAEAQSAATLNTR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            ++ +++K  LG++L DAT+KLP DK  T+EDAE V SA+ RN+L M++TPGGVAASVAAA
Sbjct  192  VMLNENKTTLGDILTDATRKLPGDKTVTKEDAERVISAEIRNDLKMATTPGGVAASVAAA  251

Query  809  aRLNER  826
            ARLN++
Sbjct  252  ARLNQQ  257



>ref|XP_010651983.1| PREDICTED: late embryogenesis abundant protein D-34 [Vitis vinifera]
Length=259

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 176/245 (72%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY DVF VSG LA KPIAPQDAA MQSAE  VLG TQKGGPAA M +AA  N RAGLVS
Sbjct  17   IKYSDVFPVSGSLASKPIAPQDAATMQSAENTVLGNTQKGGPAAVMNSAATKNERAGLVS  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             + V++     GVT+++ +V GSRIITE++  QVVG+     P+        ++ ++   
Sbjct  77   HEQVTDVVATDGVTISQANVAGSRIITEAVGDQVVGEYARPPPVAMTSPASALDRDA---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+AL+A+A + GNK VD+SDAAAIQ AE+RATG++ + PGG+AA AQSAA  N  
Sbjct  134  --ITIGEALQATALSAGNKPVDQSDAAAIQVAEMRATGSSEVVPGGIAAQAQSAATTNAR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            LI D++K KL ++L DAT KLP DK ATREDAE V  A+ RN+ +M + PGGVA SVAAA
Sbjct  192  LILDENKTKLSDILTDATAKLPDDKPATREDAERVIGAELRNDPNMVTYPGGVAESVAAA  251

Query  809  aRLNE  823
            ARLN+
Sbjct  252  ARLNQ  256



>emb|CBI28707.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 176/245 (72%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY DVF VSG LA KPIAPQDAA MQSAE  VLG TQKGGPAA M +AA  N RAGLVS
Sbjct  17   IKYSDVFPVSGSLASKPIAPQDAATMQSAENTVLGNTQKGGPAAVMNSAATKNERAGLVS  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             + V++     GVT+++ +V GSRIITE++  QVVG+     P+        ++ ++   
Sbjct  77   HEQVTDVVATDGVTISQANVAGSRIITEAVGDQVVGEYARPPPVAMTSPASALDRDA---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+AL+A+A + GNK VD+SDAAAIQ AE+RATG++ + PGG+AA AQSAA  N  
Sbjct  134  --ITIGEALQATALSAGNKPVDQSDAAAIQVAEMRATGSSEVVPGGIAAQAQSAATTNAR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            LI D++K KL ++L DAT KLP DK ATREDAE V  A+ RN+ +M + PGGVA SVAAA
Sbjct  192  LILDENKTKLSDILTDATAKLPDDKPATREDAERVIGAELRNDPNMVTYPGGVAESVAAA  251

Query  809  aRLNE  823
            ARLN+
Sbjct  252  ARLNQ  256



>emb|CAN76722.1| hypothetical protein VITISV_029641 [Vitis vinifera]
Length=259

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 139/245 (57%), Positives = 176/245 (72%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY DVF VSG LA KPIAPQDAA MQSAE  VLG TQKGGPAA M +AA  N RAGLVS
Sbjct  17   IKYSDVFPVSGSLASKPIAPQDAATMQSAENTVLGNTQKGGPAAVMNSAATKNERAGLVS  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             + V++     GVT+++ +V GSRIITE++  QVVG+     P+        ++ ++   
Sbjct  77   HEQVTDVVATDGVTISQANVAGSRIITEAVGDQVVGEYARPPPVAMTSPASALDRDA---  133

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+AL+A+A + GNK VD+SDAAAIQ AE+RATG++ + PGG+AA AQSAA  N  
Sbjct  134  --ITIGEALQATALSAGNKPVDQSDAAAIQVAEMRATGSSEVVPGGIAAQAQSAATTNAR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +I D++K KL ++L DAT KLP DK ATREDAE V  A+ RN+ +M + PGGVA SVAAA
Sbjct  192  VILDENKTKLSDILTDATAKLPDDKPATREDAERVIGAELRNDPNMVTYPGGVAESVAAA  251

Query  809  aRLNE  823
            ARLN+
Sbjct  252  ARLNQ  256



>ref|XP_010256052.1| PREDICTED: late embryogenesis abundant protein D-34 [Nelumbo 
nucifera]
Length=258

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 183/243 (75%), Gaps = 4/243 (2%)
 Frame = +2

Query  95   YGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSPD  274
            YGDVF VSGEL DKPI P+DAA MQ+AE  VLGQTQKGGPAA MQ+AA  N RAGL S D
Sbjct  18   YGDVFPVSGELEDKPILPKDAATMQAAENQVLGQTQKGGPAAMMQSAATQNERAGLFSKD  77

Query  275  DVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAG  454
            D ++  G Q VTV ETD+ G+R+ITES+ GQVVGQ ++  P+        ++ +      
Sbjct  78   DATDITGNQSVTVEETDILGNRVITESVGGQVVGQYMQPAPMQMRSPASAVDTDDP----  133

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEASA + G+K VD+SDAAAIQAAE RA+  N+  PGG+AATAQSAA+ N   +
Sbjct  134  ITIGEALEASAISAGDKPVDQSDAAAIQAAEARASRQNITAPGGIAATAQSAASMNARTM  193

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
            RD+DK+KLG+VL DAT +LP+DK A+REDAE V  A+ RNN++M++ PGGVAASV AAA 
Sbjct  194  RDEDKIKLGDVLTDATARLPSDKAASREDAERVVGAELRNNINMATHPGGVAASVVAAAS  253

Query  815  LNE  823
            LN+
Sbjct  254  LNQ  256



>ref|XP_008235307.1| PREDICTED: late embryogenesis abundant protein D-34-like [Prunus 
mume]
Length=259

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 180/246 (73%), Gaps = 10/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +P+AP+DAA  Q+AE  VLG+TQ+GGPAA M +AA  N RA LV 
Sbjct  19   LKYGDVFNVSGELASRPVAPRDAATAQAAENLVLGETQRGGPAAVMHSAATYNERARLVG  78

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              D +  A E+GV+VTE   P G+R++TE + GQVV Q VE  PLP    GG ++ ++  
Sbjct  79   HKDATEVAREEGVSVTEGINPDGNRVVTEKVGGQVVAQYVEP-PLPMGSPGGALDRDA--  135

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+A + G+K +D+SDAAAIQAAE++ATG   I PGGVAA A+ AA+ N 
Sbjct  136  ---ITIGEALEATALSAGDKPIDKSDAAAIQAAEMKATGRTEIAPGGVAAMAEYAASVNP  192

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD +K KLG+VL DATQKLPADK+ TREDA+ V  A+ RN+  MS+T GGVA S+AA
Sbjct  193  ---RDVNKTKLGDVLEDATQKLPADKVVTREDAKAVIGAEIRNSPTMSTTRGGVAESLAA  249

Query  806  aaRLNE  823
            A+RLN+
Sbjct  250  ASRLNQ  255



>ref|XP_004247564.2| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X1 [Solanum lycopersicum]
Length=279

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 201/261 (77%), Gaps = 4/261 (2%)
 Frame = +2

Query  44   KMSqeqprrqeqmepVKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaa  223
            KMSQ+QP+R E+ +P+KYGD F V G+LAD+PIAPQDAAMMQSAE  V G+ QKGGPA+ 
Sbjct  21   KMSQDQPQRPEREQPLKYGDCFNVKGDLADQPIAPQDAAMMQSAEAMVFGKNQKGGPASV  80

Query  224  mqaaanvnvraGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLP  403
            MQAAA  N R+G VS D  +  AG++G+TV ET +PG RIITES+AGQV+GQ VE +P+ 
Sbjct  81   MQAAAAKNERSGHVSHDATTQLAGDEGITVAETKLPGRRIITESVAGQVLGQYVEPLPVT  140

Query  404  NYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPG  583
               A GG       +A ITIG+AL A+A   G K V++SDAAAIQAAE RATG++V+TPG
Sbjct  141  AAAATGG----DVEEAPITIGEALAATALTAGEKPVEQSDAAAIQAAEARATGSSVVTPG  196

Query  584  GVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLD  763
            G+AATAQSAA+ NEGL +D DK+KL +VL  A  KLPADK  TR+DA+GV  A+ RNN  
Sbjct  197  GLAATAQSAASANEGLAQDVDKIKLNDVLTGAAAKLPADKATTRQDAQGVMEAELRNNPT  256

Query  764  MSSTPGGvaasvaaaaRLNER  826
            +++ PGGVAASVAAAARLNE+
Sbjct  257  LTAYPGGVAASVAAAARLNEK  277



>gb|KDO53322.1| hypothetical protein CISIN_1g046001mg [Citrus sinensis]
Length=256

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 182/252 (72%), Gaps = 16/252 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GE+A+  +AP+DAA+MQ+AE A+LGQ QKG  A+ MQ+AA  N + G V 
Sbjct  10   IKYGDVFSVEGEIAEMAVAPRDAALMQTAENAMLGQIQKGTAASMMQSAAERNEKGGFVG  69

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQ-----SVEAM--PLPNYQAGGGI  427
             DD+++ A  QGV++TET++PG RIITE I GQVVGQ     S++++  P  + +  GG 
Sbjct  70   HDDMADVAAGQGVSITETNLPGRRIITEEIGGQVVGQYSQPSSLQSLAPPSSHGEVKGG-  128

Query  428  NMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqs  607
                    GITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   ITPGGVAA AQS
Sbjct  129  --------GITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRINITPGGVAAAAQS  180

Query  608  aaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGv  787
            AA  N    RD+DK KL ++L DAT KLPADK  TR+DAEGVA+A+ RN+  +++ P GV
Sbjct  181  AATINARTTRDEDKTKLADILTDATAKLPADKQVTRKDAEGVAAAEMRNDPMLTTHPAGV  240

Query  788  aasvaaaaRLNE  823
            AASVAAAARLN+
Sbjct  241  AASVAAAARLNQ  252



>ref|XP_006433071.1| hypothetical protein CICLE_v10003643mg [Citrus clementina]
 ref|XP_006471852.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
 gb|ESR46311.1| hypothetical protein CICLE_v10003643mg [Citrus clementina]
Length=257

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 180/253 (71%), Gaps = 17/253 (7%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GE+A+  +AP+DAA+MQ+AE A+LGQ QKG  A+ MQ+AA  N + G V 
Sbjct  10   IKYGDVFSVEGEIAEMAVAPRDAALMQTAENAMLGQIQKGAAASMMQSAAERNEKGGFVG  69

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL-----PNYQA---GGG  424
             +D+++ A  QGV++TET++PG RIITE I GQVVGQ  +  PL     P+      GGG
Sbjct  70   HEDMTDVAAGQGVSITETNLPGRRIITEEIGGQVVGQYSQPSPLQSLAPPSSHGEVKGGG  129

Query  425  INMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataq  604
                     GITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   ITPGGVAA AQ
Sbjct  130  ---------GITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRINITPGGVAAAAQ  180

Query  605  saaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
            SAA  N    RD+DK KL ++L DAT KLPADK  TR+DAEGVA+A+ RN+  +++ P G
Sbjct  181  SAATINARTTRDEDKTKLADILTDATAKLPADKQVTRKDAEGVAAAEMRNDPMLTTHPAG  240

Query  785  vaasvaaaaRLNE  823
            VAASVAAAARLN+
Sbjct  241  VAASVAAAARLNQ  253



>ref|XP_008438670.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X2 
[Cucumis melo]
Length=311

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 175/245 (71%), Gaps = 12/245 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA  PIAP+DA MM SAET VLGQ  + GPA  M+AAA  NV+ G++S
Sbjct  38   IKYGDVFNVSGDLAANPIAPEDARMMASAETRVLGQMHEAGPADVMRAAAAHNVQVGVLS  97

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG+ ++ETDVPG+R+++E +AGQ +  +             G+ M    Q
Sbjct  98   SRDISDVAKNQGINISETDVPGARVVSECVAGQYLDTTT----------ASGVEMPE--Q  145

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIGQALEA+ Q +GNK V++SDAAAI AAEV ATG N + PGG+ ATAQ+AA +N  
Sbjct  146  DVITIGQALEAACQIIGNKPVEQSDAAAIHAAEVCATGNNAMNPGGLGATAQAAAIFNAA  205

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD+DK+KL  VL  AT+KL  DK+ +R+D EGV SA+ RNN  M++ PGGVAAS++AA
Sbjct  206  MDRDEDKIKLNYVLTGATEKLATDKVVSRQDVEGVVSAELRNNPSMTTHPGGVAASISAA  265

Query  809  aRLNE  823
            ARLNE
Sbjct  266  ARLNE  270



>emb|CDX92944.1| BnaA03g36660D [Brassica napus]
Length=256

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 175/247 (71%), Gaps = 6/247 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELAD+ IAP+DA MMQ+ ET+ LG TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADRRIAPEDARMMQAKETSALGHTQKGGIAATMQSAATANRRGGFVE  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P   +    ++GV+V +TDV G+R+  ESI  Q VGQ VE  P P   A  G++    +Q
Sbjct  74   PGVATYLDPDRGVSVDQTDVAGARVTKESIGVQDVGQYVE--PRPVSTAAMGVS----VQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIGQALEA+    G K VD+SDAAAIQAAEVRA+  NVI PGGVAA+AQSAA YN  
Sbjct  128  SKITIGQALEATVHTAGKKPVDQSDAAAIQAAEVRASSNNVIAPGGVAASAQSAADYNAP  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +  D++K+KL +VL  A  KL  DK  T++DAEGV SA+ RNN ++S+ PGGVA SV AA
Sbjct  188  IEFDENKIKLADVLTGAAGKLQEDKPVTKQDAEGVVSAELRNNPNLSTYPGGVADSVTAA  247

Query  809  aRLNERG  829
            ARLN +G
Sbjct  248  ARLNAKG  254



>ref|NP_001152643.1| late embryogenesis abundant protein D-34 [Zea mays]
 gb|ACG48700.1| late embryogenesis abundant protein D-34 [Zea mays]
 tpg|DAA51324.1| TPA: late embryogeneis abundant protein D-34 [Zea mays]
Length=266

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 178/245 (73%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VK+GDV  VSGELAD+P+AP+DAA +Q+AE +VLG TQKGGPAA +Q+AA VN RAG V 
Sbjct  22   VKFGDVLDVSGELADQPVAPRDAARLQAAEQSVLGGTQKGGPAAVLQSAATVNARAGHVG  81

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
                + P  + G TVTET++ G R++TES+ GQVVG+ V   P+      G +  ++   
Sbjct  82   RAQTACPVADAGATVTETELAGRRVVTESVGGQVVGKMVSPAPVAMTDPPGALEKDA---  138

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG+ALEA    +G++ V++SDAAA+Q AE+ ATG++   PGG+AA AQSAA  N  
Sbjct  139  --VTIGRALEAVGAMVGDRPVEQSDAAAVQVAELCATGSDSTVPGGLAAAAQSAADQNAR  196

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
              RD+DKVKL NVL++A +KLPADK ATREDAE V SA+ RN LDM++TPGGVA +V  A
Sbjct  197  ATRDEDKVKLRNVLSNAREKLPADKGATREDAERVVSAEIRNKLDMATTPGGVADAVTTA  256

Query  809  aRLNE  823
            ARLN+
Sbjct  257  ARLNQ  261



>gb|EYU40913.1| hypothetical protein MIMGU_mgv1a025482mg [Erythranthe guttata]
Length=256

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 145/247 (59%), Positives = 179/247 (72%), Gaps = 7/247 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSG+LA +PIAPQDAA +Q+AE  VLGQT  GGPA+ MQ+AA++N + G+V 
Sbjct  13   VKYGDVFDVSGQLASQPIAPQDAAALQAAENIVLGQTPHGGPASLMQSAADLNEQRGVVG  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D++    ++G TV E DV G RIITE++ GQVVG+    MP    + G     +S L 
Sbjct  73   HQDMTAAVMDKGATVAEADVGGYRIITEAVGGQVVGRY--GMPTTEVKTG---QPSSTLD  127

Query  449  A-GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            A  ITIG+ALEA+A + G+K VD+SDAAAIQAAEVRATG   + PGG+ A AQSAAAYN 
Sbjct  128  ADAITIGEALEATAISAGDKPVDQSDAAAIQAAEVRATGLGHVVPGGLGAQAQSAAAYNA  187

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNL-DMSSTPGGvaasva  802
               RD+DK KLG++L DAT K+  DK  TREDAEGV  A+ RN   DM++ PGGVAASVA
Sbjct  188  QTTRDEDKAKLGDILTDATLKMAGDKAVTREDAEGVIYAEIRNKQEDMATHPGGVAASVA  247

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  248  AAARLNQ  254



>ref|XP_006299455.1| hypothetical protein CARUB_v10015620mg [Capsella rubella]
 gb|EOA32353.1| hypothetical protein CARUB_v10015620mg [Capsella rubella]
Length=262

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 172/252 (68%), Gaps = 11/252 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKP+AP+DA MMQ+ ET V G TQKGGPAA MQ+AA  N+R G V 
Sbjct  13   VKYGDVFEVSGELADKPVAPEDAKMMQAEETRVFGHTQKGGPAAVMQSAATTNIRGGFVH  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D +  A E+GVTV +T VP S + TE + GQVVGQ VE    P     G      ALQ
Sbjct  73   RGDKTELAAERGVTVEQT-VPPSTVTTEFVGGQVVGQHVE----PRRVVAGARTDEEALQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIG+ALEA+ +  GNK VD+SDAAAIQAAE+RA+GTNVI   G+AA+AQSAA +N  
Sbjct  128  SSITIGEALEAAVKTAGNKPVDQSDAAAIQAAEMRASGTNVIPLAGIAASAQSAADHNAT  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKI------ATREDAEGVASAQQRNNLDMSSTPGGva  790
            + RD+ K+KL ++L           I       TR+DAEGV SA+ RNN  + + PGGVA
Sbjct  188  VDRDERKIKLADILTCLICFRTGWVIRVQRGTVTRQDAEGVVSAEMRNNPKLCTHPGGVA  247

Query  791  asvaaaaRLNER  826
            AS+ AAARLNER
Sbjct  248  ASLTAAARLNER  259



>ref|XP_007200102.1| hypothetical protein PRUPE_ppa019190mg [Prunus persica]
 gb|EMJ01301.1| hypothetical protein PRUPE_ppa019190mg [Prunus persica]
Length=259

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 181/246 (74%), Gaps = 10/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +P+AP+DAA  Q+AE  VLG+TQ+GGPAA MQ+AA  N RA LV 
Sbjct  19   LKYGDVFNVSGELASRPVAPRDAATAQAAENLVLGETQRGGPAAVMQSAATYNERARLVG  78

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              D +  A E+GV+VTE   P G+R++TE + GQVV + VE  PLP    GG ++ ++  
Sbjct  79   HRDATKVAREEGVSVTEGINPDGNRVVTEHVGGQVVAKYVEP-PLPMGSPGGALDRDA--  135

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+A + G+K +D+SDAAAIQAAE++ATG   I PGGVAA AQ AA+ N 
Sbjct  136  ---ITIGEALEATALSAGDKPIDKSDAAAIQAAEMKATGRTEIDPGGVAAMAQYAASVNP  192

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD +K KLG+VL DATQKLPADK+ TREDA+ V  A+ RN+  MS+T GGVA S+AA
Sbjct  193  ---RDVNKKKLGDVLEDATQKLPADKVVTREDAKAVIGAEIRNSPTMSTTRGGVAESLAA  249

Query  806  aaRLNE  823
            AARLN+
Sbjct  250  AARLNQ  255



>ref|XP_008355469.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=315

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 176/248 (71%), Gaps = 10/248 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELAD+P+AP+DAA  Q+AE  VLG+  +GGPAA MQ+AA  N R GLV 
Sbjct  20   IKYGDVFNVSGELADRPVAPRDAAXAQAAENLVLGENPRGGPAAVMQSAATYNERFGLVG  79

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              D +  A E+GVTVTET  P G+R++TE +AGQVV Q VE  P+P    GG ++ ++  
Sbjct  80   HLDSTKVAREEGVTVTETINPDGNRVVTEKVAGQVVAQYVEP-PVPMASPGGALDRDA--  136

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ LEASA   G+K +++SDAAAIQAAE+RATG N I PGGVA  AQ AA+ N 
Sbjct  137  ---ITIGETLEASALTAGDKPIEQSDAAAIQAAEMRATGRNEIAPGGVAGVAQYAASVNP  193

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD +K KLG+VL D T+KLPADK  TREDA+ V  A  RN+ +M++TP GV  S AA
Sbjct  194  ---RDVNKTKLGDVLEDTTEKLPADKPVTREDAKAVIGAXIRNSTNMATTPAGVTESQAA  250

Query  806  aaRLNERG  829
            AA LN+ G
Sbjct  251  AAGLNQNG  258



>ref|XP_002520716.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF41678.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=256

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 180/247 (73%), Gaps = 10/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V+YGDVF V G LA KPIAP+DAA MQSAE  VLG+TQ  GPAA MQ+AA VNVR G VS
Sbjct  16   VRYGDVFDVQGNLATKPIAPRDAASMQSAENQVLGETQITGPAAVMQSAATVNVRRGAVS  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEA-MPLPNYQAGGGINMNSAL  445
            P DV++   +QGVTVTE ++  +RI+TE +  +VVGQ V+  +P+  Y AG  ++     
Sbjct  76   PYDVTDVVRDQGVTVTEANIGSTRIVTERVGAEVVGQFVDTRVPVDAYPAGSDMD-----  130

Query  446  QAGITIGQALEASA-QALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
               ITIG+ALEA+A  A G+K +D+SDAAAI+AAEVRA  +N    GG+ A AQSAA  N
Sbjct  131  ---ITIGEALEATAYSAAGDKPIDQSDAAAIKAAEVRALRSNETPLGGIGAQAQSAADIN  187

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
              ++RD+DK  L +VL+DAT +LPAD+   REDAEGV SA+ RN  DM +TPGGVAAS+A
Sbjct  188  ARVMRDEDKTTLSDVLSDATAQLPADRAVRREDAEGVISAEIRNKPDMRTTPGGVAASMA  247

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  248  AAARLNQ  254



>emb|CAA63085.1| LEA D34 protein homologue type 1 [Arabidopsis thaliana]
Length=218

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 147/196 (75%), Gaps = 1/196 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VTYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINM-NSAL  445
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+      G   +   +L
Sbjct  74   PGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATAAVYGKQKLVGLSL  133

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            Q+ ITIG+ALEA+ Q  GNK VD+SDAAAIQAAEVRA GTNVI PGG+AA+AQSAA +N 
Sbjct  134  QSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRACGTNVIAPGGIAASAQSAANHNA  193

Query  626  GLIRDQDKVKLGNVLA  673
             + RD+DK+KL +VLA
Sbjct  194  TIDRDEDKIKLIDVLA  209



>ref|XP_009135809.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=256

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 174/247 (70%), Gaps = 6/247 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VK GDVF VSGELAD+ IAP+DA MMQ+ ET+ LG TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKNGDVFEVSGELADRRIAPEDARMMQAKETSALGHTQKGGIAATMQSAATANRRGGFVE  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P   +    ++GV+V +TDV G+R+  ESI  Q VGQ VE  P P   A  G++    +Q
Sbjct  74   PGVATYLDPDRGVSVEQTDVAGARVTKESIGVQDVGQYVE--PRPVSTAAMGVS----VQ  127

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + ITIGQALEA+    G K VD+SDAAAIQAAEVRA+  NVI PGGVAA+AQSAA YN  
Sbjct  128  SKITIGQALEATVHTAGKKPVDQSDAAAIQAAEVRASSNNVIAPGGVAASAQSAADYNAP  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +  D++K+KL +VL  A  KL  DK  T++DAEGV SA+ RNN ++S+ PGGVA SV AA
Sbjct  188  IEFDENKIKLADVLTGAAGKLQEDKPVTKQDAEGVVSAELRNNPNLSTYPGGVADSVTAA  247

Query  809  aRLNERG  829
            ARLN +G
Sbjct  248  ARLNAKG  254



>ref|XP_008218178.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X2 
[Prunus mume]
Length=266

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 152/251 (61%), Positives = 179/251 (71%), Gaps = 14/251 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF   GELADK +AP+DAA+MQ+AE AVLG+T KGG AA +QAAA  N +AG+V 
Sbjct  16   VKYGDVF-PGGELADKVVAPKDAAIMQAAENAVLGETIKGGAAATLQAAARQNEKAGVVG  74

Query  269  PDDVSN---PAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL--PN-YQAGGGIN  430
            PDD++       E GV+V E D+PG RIITESIAGQ VGQ  +  PL  PN  QAGG   
Sbjct  75   PDDMNANIVTGDEGGVSVKEADLPGRRIITESIAGQAVGQYSQRAPLAAPNTIQAGGPGG  134

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
                    ITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSA
Sbjct  135  Q-------ITIGEALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSA  187

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A  N    +D++K KL ++LADAT KLPADK ATR DAEGV  A+ RN+  +++ P GVA
Sbjct  188  ATLNARATKDEEKTKLADILADATSKLPADKPATRRDAEGVTGAEMRNDPFLTTHPTGVA  247

Query  791  asvaaaaRLNE  823
            ASVAAAARLN+
Sbjct  248  ASVAAAARLNQ  258



>ref|XP_006419946.1| hypothetical protein CICLE_v10005699mg [Citrus clementina]
 gb|ESR33186.1| hypothetical protein CICLE_v10005699mg [Citrus clementina]
Length=253

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 175/245 (71%), Gaps = 15/245 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY DVF VSG LA K +APQDAAMMQSAETA  G TQ GG A  M++AA +N RAGLVS
Sbjct  19   IKYDDVFNVSGGLASKAVAPQDAAMMQSAETAAFGSTQPGGQAEVMRSAARINERAGLVS  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D    A +QGVT+T T++P  RIITES+ GQVVGQ V+       Q           Q
Sbjct  79   RGDA---AADQGVTITGTEIPAGRIITESLDGQVVGQYVQVAAEATTQ-----------Q  124

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              IT+GQALEA+ Q +G+K V+ SDAAAI+ AE+RATG+N++T GG AA+AQSAAAYN G
Sbjct  125  GAITVGQALEATMQTIGDKPVELSDAAAIREAEMRATGSNIVTQGGYAASAQSAAAYNTG  184

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +I D+DK+KL +VLA A+  LPA K+ TR+DAE V +A++RN+  +++ PGGVA S+  A
Sbjct  185  MIGDEDKIKLRDVLAGASAALPA-KVVTRQDAEAVVNAERRNSPQLTTHPGGVAESMETA  243

Query  809  aRLNE  823
            A LNE
Sbjct  244  ATLNE  248



>ref|XP_007206587.1| hypothetical protein PRUPE_ppa020371mg [Prunus persica]
 gb|EMJ07786.1| hypothetical protein PRUPE_ppa020371mg [Prunus persica]
Length=268

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 152/254 (60%), Positives = 182/254 (72%), Gaps = 18/254 (7%)
 Frame = +2

Query  89   VKYGDVF-GVSG-ELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGL  262
            V YGDVF GV G ELADK +AP+DAA+MQ+ E AVLG+T KGG AA +Q AA  N +AG+
Sbjct  16   VTYGDVFPGVQGVELADKLVAPKDAAIMQAEENAVLGKTIKGGAAATLQTAARQNEKAGV  75

Query  263  VSPDDVSNP--AGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL--PN-YQAGGGI  427
            V PDD++     G++GV+V E ++PG RIITESIAGQ VGQ  +  PL  PN  QAGG  
Sbjct  76   VGPDDMNANIVTGDEGVSVKEAELPGRRIITESIAGQAVGQYSQRAPLAAPNTIQAGG--  133

Query  428  NMNSALQAG--ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaata  601
                   AG  ITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA A
Sbjct  134  -------AGGQITIGEALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAA  186

Query  602  qsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPG  781
            QSAA  N    +D++K KL ++LADAT KLPADK ATR DAEGV  A+ RN+  +++ P 
Sbjct  187  QSAATLNARATKDEEKTKLADILADATSKLPADKPATRRDAEGVTGAEMRNDPFLTTHPT  246

Query  782  GvaasvaaaaRLNE  823
            GVAASVAAAARLN+
Sbjct  247  GVAASVAAAARLNQ  260



>ref|XP_006489401.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
Length=253

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 174/245 (71%), Gaps = 15/245 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY DVF VSG LA K +APQDAAMMQSAETA  G TQ GG A  M++ A +N RAGLVS
Sbjct  19   IKYDDVFNVSGGLASKAVAPQDAAMMQSAETAAFGSTQPGGQAEVMRSTARINERAGLVS  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D    A +QGVT+T T++P  RIITES+ GQVVGQ V+       Q           Q
Sbjct  79   RGDA---AADQGVTITGTEIPAGRIITESLDGQVVGQYVQVAAEATTQ-----------Q  124

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              IT+GQALEA+ Q +G+K V+ SDAAAI+ AE+RATG+N++T GG AA+AQSAAAYN G
Sbjct  125  GAITVGQALEATMQTIGDKPVELSDAAAIREAEMRATGSNIVTQGGYAASAQSAAAYNTG  184

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +I D+DK+KL +VLA A+  LPA K+ TR+DAE V +A++RN+  +++ PGGVA S+  A
Sbjct  185  MIGDEDKIKLRDVLAGASAALPA-KVVTRQDAEAVVNAERRNSPQLTTHPGGVAESMETA  243

Query  809  aRLNE  823
            A LNE
Sbjct  244  ATLNE  248



>ref|XP_002520715.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF41677.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=257

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 161/234 (69%), Gaps = 8/234 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            ++YGDVF V G+LA K IAP DA+ MQSAE  VLG+T+KGGPA+ MQ+AA VNVR GLV 
Sbjct  16   IRYGDVFNVHGDLASKVIAPVDASTMQSAENTVLGETRKGGPASVMQSAARVNVRQGLVD  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P   +  AG+ G  VTE +V G RIITE+IAGQVV Q +E         GG ++  S   
Sbjct  76   PHQATEVAGDPGTKVTEENVGGDRIITETIAGQVVAQYIEPR-AERTTPGGALDPRS---  131

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEA+A + G K +D+SDAAAIQAAEVRATG   + PGG+ A AQSAA  N  
Sbjct  132  --ITIGEALEATALSSGEKPIDQSDAAAIQAAEVRATGIAEVLPGGIGAEAQSAATRNPR  189

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDM--SSTPGG  784
              RDQDK KL +VL DAT KLPADK  TREDA  V  A+ RN  DM  ++TPGG
Sbjct  190  APRDQDKTKLSDVLMDATLKLPADKPVTREDAHAVIEAEVRNKPDMHANATPGG  243



>ref|XP_003559428.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=271

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 183/248 (74%), Gaps = 8/248 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG--QTQKGGPaaamqaaanvnvraGL  262
            VKYGDVF VSG LA +P+AP+DAA+MQSAE +VLG  QTQKGGPAAAMQ+AA VN RAG 
Sbjct  26   VKYGDVFDVSGSLAAQPVAPRDAALMQSAEDSVLGLGQTQKGGPAAAMQSAATVNARAGH  85

Query  263  VSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
            V    +S  A ++GV VTET +PG R++TES+AGQ VGQ V   P+     GG +  ++ 
Sbjct  86   VGRGQLSGLAADEGVAVTETQLPGRRVVTESVAGQTVGQFVAPEPVAATAPGGALGKDA-  144

Query  443  LQAGITIGQALEASAQAL-GNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaY  619
                +TIG+ALEA+A +  G K VD+SDAAAI AAE RATG++   PGGVAATAQSAA  
Sbjct  145  ----VTIGRALEAAAASAAGGKPVDQSDAAAIMAAETRATGSDETVPGGVAATAQSAADM  200

Query  620  NEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasv  799
            N+  + D +KVKL +VL+DA  KLPADK ATREDAE V SA+ RN  +MS+TPGGVA +V
Sbjct  201  NDRTMCDANKVKLRDVLSDARSKLPADKGATREDAERVVSAEIRNKPNMSTTPGGVADAV  260

Query  800  aaaaRLNE  823
              AARLN+
Sbjct  261  TTAARLNQ  268



>ref|XP_006360786.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=259

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 187/247 (76%), Gaps = 5/247 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY D F V GELAD+PIAPQDAAMMQSAE+ V G+ QKGGPA+ MQ AA  N R+G VS
Sbjct  15   LKYRDFFNVKGELADQPIAPQDAAMMQSAESMVFGKNQKGGPASVMQTAAAKNERSGHVS  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             +D +  AG++GVTV ET +PG RIITES+AGQV+G+ VE  PLP   A          +
Sbjct  75   HEDTTQLAGDEGVTVAETKLPGRRIITESVAGQVLGRYVE--PLPATAAA--TTEGDVEE  130

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A ITIG+AL A+A   G K V++SDAAAIQAAE RATG++V+TPGG+AATAQSAA+ NEG
Sbjct  131  APITIGEALAATALTAGEKPVEQSDAAAIQAAEARATGSSVVTPGGLAATAQSAASANEG  190

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSST-PGGvaasvaa  805
            L +D DK+KL +VL  A  KLPADK ATR+DA+GV  A+ RNN  +++  PGGVAASVAA
Sbjct  191  LTQDVDKIKLNDVLTGAAAKLPADKAATRQDAQGVMEAELRNNPSLTTAYPGGVAASVAA  250

Query  806  aaRLNER  826
            AARLNER
Sbjct  251  AARLNER  257



>ref|XP_008797343.1| PREDICTED: late embryogenesis abundant protein D-34-like [Phoenix 
dactylifera]
Length=268

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 174/245 (71%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA +P+AP DAAMMQSAE  ++GQTQKGGPA+ MQ+AA  N RAGLV 
Sbjct  25   IKYGDVFNVQGELAREPVAPGDAAMMQSAENQIIGQTQKGGPASVMQSAAARNERAGLVG  84

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DVS+   +QGV VTETD+ G RI+ ES+ GQVVG+   A P+      G      A  
Sbjct  85   RRDVSDVPADQGVIVTETDLAGHRIVAESVGGQVVGRYETAAPVSTTTPTG-----VAYG  139

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
               TIG+ALEA+A   G K VD+SDAAAIQAAE RATG N + PGGV A AQSAA  N  
Sbjct  140  DAFTIGEALEATAMTAGEKPVDQSDAAAIQAAEARATGLNEVLPGGVGAEAQSAANANTR  199

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L R++DK+KL +VL D T KLP DK+ TREDA+ VA A+ RN LD+S+ P GVA +VA+A
Sbjct  200  LTREEDKIKLRDVLTDVTTKLPEDKVVTREDADRVAGAEMRNRLDVSTHPRGVAENVASA  259

Query  809  aRLNE  823
            ARLN+
Sbjct  260  ARLNQ  264



>ref|XP_003536910.2| PREDICTED: late embryogenesis abundant protein D-34-like [Glycine 
max]
Length=262

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 171/246 (70%), Gaps = 7/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VS ELA KPIAP+DAA+MQ+ E   LGQTQKGGPA+ MQ+AA  N+RAG+V 
Sbjct  16   IKYGDVFKVSDELAFKPIAPRDAALMQATENQALGQTQKGGPASVMQSAATENLRAGVVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  +GV+VTET V   R+ITE +   VVGQ VE   +P    G  +  ++   
Sbjct  76   RQDISDVARNEGVSVTETKVGCHRVITEFVGRHVVGQFVEP-DVPMNTPGTALERDA---  131

Query  449  AGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              ITIG+ALEASA A   +K VD SDAAAIQAAE+RATG N   PGG+ A AQSAA  N 
Sbjct  132  --ITIGEALEASAIAGASDKPVDESDAAAIQAAEMRATGKNETEPGGLGARAQSAATRNT  189

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              +    K  L +VL DA +KLPADK  TREDAEGV  A+ RN LDM +TPGGVAAS+AA
Sbjct  190  RTVSHSHKTTLSDVLTDAKEKLPADKAVTREDAEGVIGAELRNKLDMRTTPGGVAASMAA  249

Query  806  aaRLNE  823
            AA LN+
Sbjct  250  AATLNQ  255



>gb|KDP21437.1| hypothetical protein JCGZ_21908 [Jatropha curcas]
Length=260

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 174/245 (71%), Gaps = 8/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + YGD+F V G LA  P+AP DAA MQ+AE  VLG+T++GGPA+AMQ+AANVN+R G V 
Sbjct  18   ITYGDIFNVHGNLASTPVAPVDAATMQAAENRVLGETRRGGPASAMQSAANVNLREGFVD  77

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
            PD+ SN A +  + V+E+D P G R+ITE+IAGQVV Q +E  P       G I    A 
Sbjct  78   PDEASNVARDDQIEVSESDGPGGDRVITETIAGQVVAQYIE--PRAERTTPGSI----AN  131

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            +  +TIG+ALEA++ + G K V++SDAAAIQAAEVRATG N + PGG+ A AQSAA  N 
Sbjct  132  RDAVTIGEALEATSLSAGEKPVEQSDAAAIQAAEVRATGINEVLPGGIGAEAQSAATRNR  191

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
             L  D+DK+ L  VL DA+ KLPADK  TREDA+ V  A+ RN  DM +TPGGV AS+AA
Sbjct  192  AL-SDRDKITLSEVLEDASLKLPADKAVTREDADRVIQAEVRNRPDMHATPGGVTASMAA  250

Query  806  aaRLN  820
            AAR+N
Sbjct  251  AARMN  255



>ref|XP_004495777.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X2 [Cicer arietinum]
Length=263

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 176/248 (71%), Gaps = 4/248 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G++  + +AP DAAMMQ AET  LG+TQKGG A+ M +AA  N R G+V 
Sbjct  13   IKYGDVFNVQGDIGRRTVAPVDAAMMQKAETETLGKTQKGGAASVMMSAAMKNERDGIVG  72

Query  269  PDDVSNPAGEQGVTVT-ETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
             DDVS  A + GV+VT ETD  G+++I+ESI GQVVGQ  +   + N  A   +   +  
Sbjct  73   HDDVSEVAADGGVSVTDETDDSGNKVISESIGGQVVGQFSQKGAM-NTMATASLVEETGT  131

Query  446  QAG--ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaY  619
             AG  ITIG+ALEA+    GNKAV+ SDAAAIQAAEVRATG   I PGGVAA AQSAA  
Sbjct  132  GAGRGITIGEALEATVLTAGNKAVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATL  191

Query  620  NEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasv  799
            N    +D+DK KL +VLADAT KLPAD+ ATR DAEGV  A+ RN+  +++ PGGV+ASV
Sbjct  192  NARTTKDEDKTKLADVLADATSKLPADRAATRRDAEGVTGAEMRNDPYLTTHPGGVSASV  251

Query  800  aaaaRLNE  823
            AAAARLN+
Sbjct  252  AAAARLNQ  259



>dbj|BAD86645.1| ECP31 protein [Daucus carota]
Length=256

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 175/245 (71%), Gaps = 7/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+L+ +P+AP DA+ MQ+AE  VLG+TQKGGPA+ MQ+AA  N++ G+V 
Sbjct  15   IKYGDVFDVSGQLSSQPVAPNDASAMQAAENMVLGKTQKGGPASVMQSAAAANLQRGVVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              + +  A EQGVT++E ++ G+RIITE++ GQVVGQ +E          G +  +S   
Sbjct  75   RHEGTPIASEQGVTISEAEIAGTRIITEAVGGQVVGQYLEPGKFKMTSPAGALGSDS---  131

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALE +A   G+K VD+SDAAAIQAAEVRA+G     PGGVAA AQSAA YN  
Sbjct  132  --ITIGEALETTALTAGDKPVDQSDAAAIQAAEVRASG--YAHPGGVAAAAQSAADYNAR  187

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +    K KLG+VLADA+ +L  DK  TREDAEGV  A+ RNN +M + PGGVA+S+AAA
Sbjct  188  TMNVASKTKLGDVLADASIRLAEDKAVTREDAEGVVGAEVRNNPEMMTYPGGVASSMAAA  247

Query  809  aRLNE  823
            ARLN+
Sbjct  248  ARLNQ  252



>gb|KHN03807.1| Late embryogenesis abundant protein D-34 [Glycine soja]
Length=284

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 171/246 (70%), Gaps = 7/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VS ELA KPIAP+DAA+MQ+ E   LGQTQKGGPA+ MQ+AA  N+RAG+V 
Sbjct  16   IKYGDVFKVSDELAFKPIAPRDAALMQATENQALGQTQKGGPASVMQSAATENLRAGVVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  +GV+VTET V   R+ITE +   VVGQ VE   +P    G  +  ++   
Sbjct  76   RQDISDVARNEGVSVTETKVGCHRVITEFVGRHVVGQFVEP-DVPMNTPGTALERDA---  131

Query  449  AGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              ITIG+ALEASA A   +K VD SDAAA+QAAE+RATG N   PGG+ A AQSAA  N 
Sbjct  132  --ITIGEALEASAIAGASDKPVDESDAAALQAAEMRATGKNETEPGGLGARAQSAATRNT  189

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              +    K  L +VL DA +KLPADK  TREDAEGV  A+ RN LDM +TPGGVAAS+AA
Sbjct  190  RTVSHSHKTTLSDVLTDAKEKLPADKAVTREDAEGVIGAELRNKLDMRTTPGGVAASMAA  249

Query  806  aaRLNE  823
            AA LN+
Sbjct  250  AATLNQ  255



>emb|CAA43046.1| embryonic cell protein [Daucus carota]
Length=256

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 178/249 (71%), Gaps = 15/249 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+L+ +P+AP DA+ MQ+AE  VLG+TQKGGPA+ MQ+AA  N++ G+V 
Sbjct  15   IKYGDVFDVSGQLSSQPVAPNDASAMQAAENMVLGKTQKGGPASVMQSAAAANLQRGVVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVE----AMPLPNYQAGGGINMN  436
            P + +  A EQGVT++E ++ G+RIITE++ GQVVGQ +E     MP P     G +  +
Sbjct  75   PHEGTPIASEQGVTISEAEIAGTRIITEAVGGQVVGQYLEPGKFKMPSP----AGVLGSD  130

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
            S     ITIG+ALE +A   G+K VD+SDAAAIQAAEVRA+G     PGGVAA AQSAA 
Sbjct  131  S-----ITIGEALETTALTAGDKPVDQSDAAAIQAAEVRASG--YAYPGGVAAAAQSAAD  183

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
            YN   +    K KLG+VLAD + +L  DK  TREDAEGV  A+ RNN +M + PGGVA+S
Sbjct  184  YNARTMNVASKTKLGDVLADRSIRLAEDKAVTREDAEGVVGAEVRNNPEMMTYPGGVASS  243

Query  797  vaaaaRLNE  823
            +AAAARLN+
Sbjct  244  MAAAARLNQ  252



>ref|XP_010326670.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X2 [Solanum lycopersicum]
Length=276

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 160/261 (61%), Positives = 199/261 (76%), Gaps = 7/261 (3%)
 Frame = +2

Query  44   KMSqeqprrqeqmepVKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaa  223
            KMSQ+QP+R E+ +P+KYGD F V G+LAD+PIAPQDAAMMQSAE  V G+ QKGGPA+ 
Sbjct  21   KMSQDQPQRPEREQPLKYGDCFNVKGDLADQPIAPQDAAMMQSAEAMVFGKNQKGGPASV  80

Query  224  mqaaanvnvraGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLP  403
            MQAAA  N R+G VS D  +  AG++G+TV ET +PG RIITES+AGQV+GQ VE +P+ 
Sbjct  81   MQAAAAKNERSGHVSHDATTQLAGDEGITVAETKLPGRRIITESVAGQVLGQYVEPLPVT  140

Query  404  NYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPG  583
               A GG       +A ITIG+AL A+A   G K V++SDAAAIQAAE RATG++V+TPG
Sbjct  141  AAAATGG----DVEEAPITIGEALAATALTAGEKPVEQSDAAAIQAAEARATGSSVVTPG  196

Query  584  GVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLD  763
            G+AATAQSAA+ NEGL +D DK+KL +    A  KLPADK  TR+DA+GV  A+ RNN  
Sbjct  197  GLAATAQSAASANEGLAQDVDKIKLND---GAAAKLPADKATTRQDAQGVMEAELRNNPT  253

Query  764  MSSTPGGvaasvaaaaRLNER  826
            +++ PGGVAASVAAAARLNE+
Sbjct  254  LTAYPGGVAASVAAAARLNEK  274



>gb|KDO74560.1| hypothetical protein CISIN_1g035654mg [Citrus sinensis]
Length=243

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 167/245 (68%), Gaps = 25/245 (10%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KY DVF VSG LA K +APQDAAMMQSAETA  G TQ GG             RAGLVS
Sbjct  19   IKYDDVFNVSGGLASKAVAPQDAAMMQSAETAAFGSTQPGG----------QAERAGLVS  68

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D    A +QGVT+T T++P  RIITES+ GQVVGQ V+       Q           Q
Sbjct  69   RGDA---AADQGVTITGTEIPAGRIITESLDGQVVGQYVQVAAEATTQ-----------Q  114

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              IT+GQALEA+ Q +G+K V+ SDAAAI+ AE+RATG+N++T GG AA+AQSAAAYN G
Sbjct  115  GAITVGQALEATMQTIGDKPVELSDAAAIREAEMRATGSNILTQGGYAASAQSAAAYNTG  174

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            +I D+DK+KL +VLA A+  LPA K+ TR+DAE V +A++RN+  +++ PGGVA S+  A
Sbjct  175  MIGDEDKIKLRDVLAGASAALPA-KVVTRQDAEAVVNAERRNSPQLTTHPGGVAESMETA  233

Query  809  aRLNE  823
            A LNE
Sbjct  234  ATLNE  238



>ref|XP_010917736.1| PREDICTED: late embryogenesis abundant protein D-34-like [Elaeis 
guineensis]
Length=261

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 175/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA +P+APQDAAMMQSAE  ++GQTQ+GGPAA MQ+AA  N  AGLV 
Sbjct  17   IKYGDVFNVQGELACEPVAPQDAAMMQSAENQIIGQTQRGGPAAVMQSAAARNETAGLVG  76

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DVS+   +QGV VTETD+ G RI+TES+ GQVVG    A P+       G     A  
Sbjct  77   HRDVSDVPADQGVAVTETDLTGHRIVTESVGGQVVGSYETAAPVSTTALPTGGMYGDAF-  135

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
               TIG ALEA+A   G K VD+SDAAAIQAAE RATG N + PGGV A AQSAA  N  
Sbjct  136  ---TIGDALEATAMTAGGKPVDQSDAAAIQAAEARATGLNEVLPGGVGAEAQSAATANTR  192

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L+R+++K+KL +VL+DAT KLP DK+ TREDA+ VA A+ RN  D+S+   GVAA+VAAA
Sbjct  193  LMREENKIKLRDVLSDATTKLPGDKVVTREDADRVAGAEMRNRPDVSTHTQGVAANVAAA  252

Query  809  aRLNE  823
            ARLN+
Sbjct  253  ARLNQ  257



>ref|XP_004290610.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=254

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 179/246 (73%), Gaps = 13/246 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA KPIAP+ AA MQ+AE  VLG+TQKGGPAA MQ+AA  N RAGLV 
Sbjct  18   IKYGDVFNVSGELASKPIAPRVAATMQAAENVVLGETQKGGPAAVMQSAATYNERAGLVG  77

Query  269  PDDVSNPAGEQGVTVTE-TDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              D +    E+GVTV+E  D+ G+++ITES+AGQVVGQ VE +P P       +  + A 
Sbjct  78   QRDATVADREEGVTVSELIDLDGNKVITESVAGQVVGQYVE-LPEPGASPAAVVLEDDA-  135

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+A + G+K +D+SDAAAIQAAE+RATG++ I+PGG+AA AQ A + N 
Sbjct  136  ---ITIGEALEATALSAGDKQIDQSDAAAIQAAEMRATGSSEISPGGLAAVAQYAVSAN-  191

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
                 + + KL +VL DATQK+ ADK  TREDA+ +  A+ RN   MS+TPGG+A S+AA
Sbjct  192  ---AREAETKLADVLEDATQKMGADKAVTREDAKAIIGAEVRN---MSTTPGGIAESMAA  245

Query  806  aaRLNE  823
            AARLN+
Sbjct  246  AARLNQ  251



>gb|ADQ91843.1| late embryogenesis abundant protein group 5 protein [Arachis 
hypogaea]
Length=265

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGD+F VSG+LA +PI PQDAA+MQ+ E   LGQTQKGGPA+ MQ+AA  NV AGLV 
Sbjct  21   IKYGDIFNVSGDLASEPIMPQDAALMQATENQALGQTQKGGPASVMQSAAVTNVSAGLVG  80

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DVS+ A +QG+ V E+ +  +R+ITES+  QVVG+ VE   +P    G  ++ ++   
Sbjct  81   RGDVSSVAKDQGICVLESKIGVNRVITESVGEQVVGEFVEPN-VPMKTPGSALDKDA---  136

Query  449  AGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              ITIG+ALEA+  A   +K VD+SDAAAIQAAE+RATG N I PGG+AA AQSAA  N 
Sbjct  137  --ITIGEALEATTLAPASDKPVDQSDAAAIQAAEMRATGKNEIQPGGLAAVAQSAATKNL  194

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              + D  K  L +VL DA +KLP+DK  TREDAEGV  A+ RN  DM +TPGGVAAS+AA
Sbjct  195  RTMGDFQKTTLSDVLTDAKEKLPSDKAVTREDAEGVIGAEIRNKADMKTTPGGVAASLAA  254

Query  806  aaRLNE  823
            AA LN+
Sbjct  255  AATLNQ  260



>ref|XP_010041757.1| PREDICTED: late embryogenesis abundant protein D-34 [Eucalyptus 
grandis]
 gb|KCW84905.1| hypothetical protein EUGRSUZ_B01734 [Eucalyptus grandis]
Length=262

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 174/247 (70%), Gaps = 2/247 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            ++YGD+F V GELA+KP+ P+DAAMMQ+AE  + GQTQ+G  AAAMQ+AA  N RAGLV 
Sbjct  14   IRYGDIFAVDGELAEKPVTPRDAAMMQTAENEMFGQTQRGHAAAAMQSAAARNERAGLVG  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV+  A + GVT+TETD+PG R+ITES+ GQVV Q     P+P         +++   
Sbjct  74   HSDVTEVASKDGVTITETDLPGRRVITESVGGQVVSQFSRRSPIPTMTPSSIYQIDAGKD  133

Query  449  A--GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
                ITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQ+AA  N
Sbjct  134  GIGSITIGEALEAAALTAGQKPVEWSDAAAIQAAEVRATGRTTIVPGGVAAAAQAAATLN  193

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
                R +DK  L ++L DAT KLP+DK A+R DAEGVA A+ RN+  +++ P G+AASVA
Sbjct  194  ARTPRAEDKTTLADILGDATSKLPSDKPASRRDAEGVAGAEMRNDPRLNTHPAGIAASVA  253

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  254  AAARLNQ  260



>ref|XP_002463881.1| hypothetical protein SORBIDRAFT_01g008210 [Sorghum bicolor]
 gb|EER90879.1| hypothetical protein SORBIDRAFT_01g008210 [Sorghum bicolor]
Length=268

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 173/245 (71%), Gaps = 5/245 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKY DV  VSGELA + +AP+DAA++Q+AE +VLG TQ+GGPAA +Q+AA VN RAG V 
Sbjct  24   VKYSDVLDVSGELAQRRVAPRDAALLQAAEQSVLGGTQRGGPAAVLQSAATVNARAGHVG  83

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
               ++ P  + G TV E ++ G R++TES+ GQVV + V    +      G ++ ++   
Sbjct  84   RAQITGPVADAGATVVEAELGGRRVVTESVGGQVVSKMVTPPHVAMTDPPGALDKDA---  140

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG+ALEA     G++ VD+SDAAAIQ AE  ATG++   PGGVAA AQSAA  N  
Sbjct  141  --VTIGRALEAVVAMAGDRPVDQSDAAAIQVAETCATGSHATIPGGVAAAAQSAADQNAR  198

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +RD+DKVKL NVL++A ++LPADK ATREDAE V SA+ RN LDM++TPGGVA +V  A
Sbjct  199  AVRDEDKVKLRNVLSNARERLPADKGATREDAERVVSAEIRNKLDMTTTPGGVADAVTTA  258

Query  809  aRLNE  823
            ARLN+
Sbjct  259  ARLNQ  263



>ref|XP_003590628.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES60879.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=264

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +PI P+DAA+MQ+ E   LGQTQKG PA+ MQ+AA VN  AGLVS
Sbjct  20   IKYGDVFNVSGELASQPIKPRDAALMQATENQALGQTQKGSPASVMQSAAAVNTAAGLVS  79

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG++V++T V  +R+ITES+  QVVGQ VE   +P    G  ++ N+   
Sbjct  80   HGDISDIAKNQGMSVSKTKVGANRVITESVGSQVVGQFVEP-DVPMNDPGLVLDKNA---  135

Query  449  AGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              ITIG+ALEASA +  G+K +D+SDAAAIQAAE+RATG N   PGG+ A AQSAA  N 
Sbjct  136  --ITIGEALEASALSQAGDKPLDQSDAAAIQAAEMRATGKNHTEPGGLGAIAQSAATRNT  193

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              + D  K  LG+V++ A +KL +DK  TREDAEGV  A+ RN  DM + PGGVAAS+AA
Sbjct  194  RTMPDLQKTTLGDVVSGAREKLGSDKAVTREDAEGVIGAELRNKADMRTKPGGVAASMAA  253

Query  806  aaRLNE  823
            AA LN+
Sbjct  254  AATLNQ  259



>ref|XP_003590627.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
Length=292

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +PI P+DAA+MQ+ E   LGQTQKG PA+ MQ+AA VN  AGLVS
Sbjct  20   IKYGDVFNVSGELASQPIKPRDAALMQATENQALGQTQKGSPASVMQSAAAVNTAAGLVS  79

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG++V++T V  +R+ITES+  QVVGQ VE   +P    G  ++ N+   
Sbjct  80   HGDISDIAKNQGMSVSKTKVGANRVITESVGSQVVGQFVEP-DVPMNDPGLVLDKNA---  135

Query  449  AGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              ITIG+ALEASA +  G+K +D+SDAAAIQAAE+RATG N   PGG+ A AQSAA  N 
Sbjct  136  --ITIGEALEASALSQAGDKPLDQSDAAAIQAAEMRATGKNHTEPGGLGAIAQSAATRNT  193

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              + D  K  LG+V++ A +KL +DK  TREDAEGV  A+ RN  DM + PGGVAAS+AA
Sbjct  194  RTMPDLQKTTLGDVVSGAREKLGSDKAVTREDAEGVIGAELRNKADMRTKPGGVAASMAA  253

Query  806  aaRLNE  823
            AA LN+
Sbjct  254  AATLNQ  259



>ref|XP_004495192.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cicer 
arietinum]
Length=263

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 179/247 (72%), Gaps = 10/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +PI P+DAA+MQ+ E   LGQTQKGGPA+ MQ+AA VN  AGLV+
Sbjct  20   IKYGDVFNVSGELATQPIKPKDAALMQATENQALGQTQKGGPASVMQSAAAVNTAAGLVN  79

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEA-MPLPNYQAGGGINMNSAL  445
             +D+S+ A  QGV+V+   V G+R+ITES+  QV+GQ VE  +P+ +     G+ ++   
Sbjct  80   REDISDIAKNQGVSVSNMKVGGNRVITESVGSQVLGQFVEPDVPMNDP----GLVLDP--  133

Query  446  QAGITIGQALEASAQAL-GNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
               ITIG+ALEASA +  GNKA+D+SDAAAIQAAE+RATG N   PGG+ A AQ+AA  N
Sbjct  134  -EAITIGEALEASALSRAGNKALDQSDAAAIQAAEMRATGRNHTEPGGLGANAQAAATRN  192

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
               +  Q K  LG+V++ A +KLP DK  TREDAEGV  A+ RN  +M +TPGGVAAS+A
Sbjct  193  ARTMPLQ-KTTLGDVVSGAREKLPEDKAVTREDAEGVIGAELRNKPNMRTTPGGVAASLA  251

Query  803  aaaRLNE  823
            AAA LN+
Sbjct  252  AAATLNQ  258



>ref|XP_011079873.1| PREDICTED: late embryogenesis abundant protein D-34-like [Sesamum 
indicum]
Length=259

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 173/250 (69%), Gaps = 12/250 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGD+F VSGELA KP+AP+DAA  Q+AE+ VLGQTQKGGPAA MQ+AA++NVR G++ 
Sbjct  16   VTYGDIFQVSGELASKPVAPKDAAAAQAAESIVLGQTQKGGPAAVMQSAADMNVRRGVLG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSV----EAMPLPNYQAGGGINMN  436
            PDDV+    E GV++++ DV G R+ITE +AG+VVG+      E    P   A   I+M 
Sbjct  76   PDDVTEATREHGVSISQDDVGGHRVITECVAGEVVGRYAVAGEEGPAAPPLSALNPISM-  134

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
                   TIGQALE+ A + G K VD SDAAAIQA E RATG N + PGGVA+ AQSAA 
Sbjct  135  -------TIGQALESVALSAGVKPVDESDAAAIQAVESRATGRNQVIPGGVASEAQSAAK  187

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
            +N   + +  K+KL +VLA AT KLP D+  T+EDA+    A+ RN  DMS+ PGGVA S
Sbjct  188  HNARTMAEDKKIKLRDVLAGATWKLPDDRAVTKEDADAAVGAEIRNKADMSTYPGGVAES  247

Query  797  vaaaaRLNER  826
            + AAARLN++
Sbjct  248  MVAAARLNQQ  257



>ref|XP_004495776.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X1 [Cicer arietinum]
Length=280

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 177/266 (67%), Gaps = 23/266 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G++  + +AP DAAMMQ AET  LG+TQKGG A+ M +AA  N R G+V 
Sbjct  13   IKYGDVFNVQGDIGRRTVAPVDAAMMQKAETETLGKTQKGGAASVMMSAAMKNERDGIVG  72

Query  269  PDDVSNPAGEQGVTVT-ETDVPGSRIITESIAGQVV----------GQSVEAMPLPNYQA  415
             DDVS  A + GV+VT ETD  G+++I+ESI GQV+          G+ VE   +  +  
Sbjct  73   HDDVSEVAADGGVSVTDETDDSGNKVISESIGGQVLHKVDEKERKTGKLVEV--VGQFSQ  130

Query  416  GGGINMNSALQ----------AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGT  565
             G +N  +              GITIG+ALEA+    GNKAV+ SDAAAIQAAEVRATG 
Sbjct  131  KGAMNTMATASLVEETGTGAGRGITIGEALEATVLTAGNKAVEWSDAAAIQAAEVRATGR  190

Query  566  NVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQ  745
              I PGGVAA AQSAA  N    +D+DK KL +VLADAT KLPAD+ ATR DAEGV  A+
Sbjct  191  TNIVPGGVAAAAQSAATLNARTTKDEDKTKLADVLADATSKLPADRAATRRDAEGVTGAE  250

Query  746  QRNNLDMSSTPGGvaasvaaaaRLNE  823
             RN+  +++ PGGV+ASVAAAARLN+
Sbjct  251  MRNDPYLTTHPGGVSASVAAAARLNQ  276



>gb|KDP21438.1| hypothetical protein JCGZ_21909 [Jatropha curcas]
Length=254

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 173/246 (70%), Gaps = 10/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G++A +PIAP DAA MQSAE+ VLG+ Q+GGPA+ MQ+AANVNVR G V 
Sbjct  16   IKYGDVFNVGGDVASQPIAPVDAANMQSAESQVLGEPQRGGPASVMQSAANVNVRTGAVE  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             DDVS+   EQG+ V E D+ G+R+ITE + G+VVGQ V+      Y   G         
Sbjct  76   RDDVSDVVREQGINVAEIDIGGTRVITEKVGGEVVGQYVQPRVPATYPMPG---------  126

Query  449  AGITIGQALEASA-QALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              IT+G+ALEA+A  A G+K +D+SDAAAI+AAEVRA  +     GG+ A AQSAA  N 
Sbjct  127  MDITMGEALEATAYSAAGDKPIDQSDAAAIKAAEVRALRSTQTPAGGIGAEAQSAADRNT  186

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
             ++ D+DK  L +VLADAT KLP DK  TR+DAEGV  A+ RN  +M +TPGGVAASVAA
Sbjct  187  RVMLDEDKTTLSDVLADATAKLPRDKTVTRDDAEGVIGAEIRNKPNMRTTPGGVAASVAA  246

Query  806  aaRLNE  823
            AARLN+
Sbjct  247  AARLNQ  252



>ref|XP_008218177.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X1 
[Prunus mume]
Length=288

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 179/273 (66%), Gaps = 36/273 (13%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF   GELADK +AP+DAA+MQ+AE AVLG+T KGG AA +QAAA  N +AG+V 
Sbjct  16   VKYGDVF-PGGELADKVVAPKDAAIMQAAENAVLGETIKGGAAATLQAAARQNEKAGVVG  74

Query  269  PDDVSN---PAGEQGVTVTETDVPGSRIITESIAGQ----------------------VV  373
            PDD++       E GV+V E D+PG RIITESIAGQ                       V
Sbjct  75   PDDMNANIVTGDEGGVSVKEADLPGRRIITESIAGQGLDSNTRNVDHEKQRKIYELVEAV  134

Query  374  GQSVEAMPL--PN-YQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAA  544
            GQ  +  PL  PN  QAGG           ITIG+ALEA+A   G K V+ SDAAAIQAA
Sbjct  135  GQYSQRAPLAAPNTIQAGGPGGQ-------ITIGEALEATAMTAGQKPVEWSDAAAIQAA  187

Query  545  EVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDA  724
            EVRATG   I PGGVAA AQSAA  N    +D++K KL ++LADAT KLPADK ATR DA
Sbjct  188  EVRATGRTNIVPGGVAAAAQSAATLNARATKDEEKTKLADILADATSKLPADKPATRRDA  247

Query  725  EGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            EGV  A+ RN+  +++ P GVAASVAAAARLN+
Sbjct  248  EGVTGAEMRNDPFLTTHPTGVAASVAAAARLNQ  280



>gb|AIA57962.1| late embryogenesis abundant protein 1 [Jatropha curcas]
Length=254

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 172/246 (70%), Gaps = 10/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G++A +PIAP DAA MQSAE+ VLG+ Q+GGPA+ MQ+AANVNVR G V 
Sbjct  16   IKYGDVFNVGGDVASQPIAPVDAANMQSAESQVLGEPQRGGPASVMQSAANVNVRTGAVE  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             DDVS+   EQG+ V E D+ G+R+ITE + G+VVGQ V+      Y   G         
Sbjct  76   RDDVSDVVREQGINVAEIDIGGTRVITEKVGGEVVGQYVQPRVPATYPMPG---------  126

Query  449  AGITIGQALEASA-QALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              IT+G+ALEA+A  A G+K +D+SDAAAI+AAEVRA  +     GG+ A AQSAA  N 
Sbjct  127  MDITMGEALEATAYSAAGDKPIDQSDAAAIKAAEVRALRSTQTPAGGIGAEAQSAADRNT  186

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
             ++ D+DK  L +VLADAT KLP DK  TR+DAEGV   + RN  +M +TPGGVAASVAA
Sbjct  187  RVMLDEDKTTLSDVLADATAKLPRDKTVTRDDAEGVIGEEIRNKPNMRTTPGGVAASVAA  246

Query  806  aaRLNE  823
            AARLN+
Sbjct  247  AARLNQ  252



>emb|CDP12311.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 135/252 (54%), Positives = 172/252 (68%), Gaps = 6/252 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V  +LA K IAP+DAA MQ+AE  VLGQT +GGPA+ MQ+AA+VN   G+V 
Sbjct  18   IKYGDVFDVKEDLASKNIAPRDAAAMQAAENRVLGQTPRGGPASVMQSAADVNQSLGVVG  77

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGG----INMN  436
             DD+++   +QGV V E    G R+I E++ GQVVG               G    I+ +
Sbjct  78   HDDITDITRDQGVNVAERAADGRRVIAEAVGGQVVGGYATRGGGAAAGGRAGQGQDISSS  137

Query  437  SALQAG--ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
             A+ AG  ITIG+ALEA+A   GNK VD SDAAAIQAAEV+ATG   + PGG+ A AQ+A
Sbjct  138  PAIVAGGGITIGEALEATALTSGNKPVDMSDAAAIQAAEVKATGRGQVMPGGIGAEAQAA  197

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A  N G+ RD+DK KLG+VL DAT +LP DK  TR+DA+ V +A+ RN+ + S  PGGVA
Sbjct  198  ADLNPGIWRDEDKTKLGDVLGDATDRLPDDKTVTRDDAKRVVAAEVRNDPNASPHPGGVA  257

Query  791  asvaaaaRLNER  826
            AS AAAARLN++
Sbjct  258  ASTAAAARLNQK  269



>gb|KHG19384.1| Late embryogenesis abundant D-34 [Gossypium arboreum]
Length=261

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 179/250 (72%), Gaps = 10/250 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G+LA+KP+AP+DAAMMQ A  A+LG+T+KG  AAAM +AA  N +AG V 
Sbjct  15   IKYGDVFDVQGKLAEKPVAPKDAAMMQMAGNALLGETKKGCAAAAMVSAAMKNEKAGFVG  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             +DV+    + GVTV ET + G RIITESI  +V+GQ  +A PL    +G   +   + +
Sbjct  75   HEDVNV---DSGVTVEETQLAGKRIITESIENEVIGQYSQAAPL---TSGPYSSCEQSEE  128

Query  449  AG----ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
             G    ITIG+ALEA+A   GNK V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA 
Sbjct  129  DGGGGPITIGEALEATALTAGNKPVEWSDAAAIQAAEVRATGRTSIMPGGVAAAAQSAAT  188

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
             N    R+++K KL +VL++AT++L +DK ATR DAEGVA A+ RN+  +++ P GV+AS
Sbjct  189  LNARASREEEKTKLCDVLSNATERLGSDKAATRRDAEGVAVAELRNDPTLTTHPAGVSAS  248

Query  797  vaaaaRLNER  826
            VAAAARLN++
Sbjct  249  VAAAARLNDQ  258



>ref|XP_007144645.1| hypothetical protein PHAVU_007G173100g [Phaseolus vulgaris]
 gb|ESW16639.1| hypothetical protein PHAVU_007G173100g [Phaseolus vulgaris]
Length=260

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 170/247 (69%), Gaps = 9/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +PIAP+DAA+MQ+ E   LGQ QKGGPA+ MQ+AA VNVR G V 
Sbjct  16   IKYGDVFVVSGELASQPIAPKDAALMQAKENQTLGQAQKGGPASIMQSAATVNVRDGEVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMP-LPNYQAGGGINMNSAL  445
              + S+ A EQGV+V E  V G R+ITES+   VVGQ V  +P +P    G  +  ++  
Sbjct  76   RGEFSDVAREQGVSVFEGKVDGQRVITESVGRHVVGQFV--VPEIPMETPGTALERDA--  131

Query  446  QAGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
               ITIG+ALEA+  A   +K VD SDAAAIQAAE+RATG N    GG+ A AQSAA +N
Sbjct  132  ---ITIGEALEATGVAGAFDKPVDESDAAAIQAAEMRATGKNETESGGLGARAQSAATHN  188

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
               +   +K  L +VL DA  KL ADK+ TREDAEGV  A+ RN LDM +TPGGVAAS+A
Sbjct  189  TRTVPQSNKTTLSDVLRDARVKLQADKVVTREDAEGVIGAELRNKLDMKTTPGGVAASMA  248

Query  803  aaaRLNE  823
            AAA LN+
Sbjct  249  AAATLNQ  255



>ref|XP_011091039.1| PREDICTED: LOW QUALITY PROTEIN: late embryogenesis abundant protein 
D-34, partial [Sesamum indicum]
Length=197

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 146/191 (76%), Gaps = 10/191 (5%)
 Frame = +2

Query  257  GLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMN  436
            GLV   DV++ AG++GVTV ET++PG+RIITES+ GQVVGQ VE+ P+   +A GG   +
Sbjct  16   GLVGHRDVTDVAGKEGVTVAETNLPGTRIITESVGGQVVGQYVESKPVMQTEATGGAVRH  75

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
             ++            SA+A G+K VD SDAAAIQAAE RATG+N+ITPGG+AATAQSAAA
Sbjct  76   YSVTX----------SARAAGDKPVDHSDAAAIQAAECRATGSNMITPGGLAATAQSAAA  125

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
            +NEGL+ D+ KV+L N+L  AT KLPADK ATREDAEG+ SA+ RN+ ++ + PGGVA S
Sbjct  126  FNEGLVGDEGKVRLANILTGATTKLPADKAATREDAEGILSAEVRNDPNLKTHPGGVAES  185

Query  797  vaaaaRLNERG  829
            VAAAAR+NERG
Sbjct  186  VAAAARINERG  196



>ref|XP_003633664.1| PREDICTED: late embryogenesis abundant protein D-34 [Vitis vinifera]
 emb|CBI34228.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 171/246 (70%), Gaps = 8/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G+L  KP+AP DA+MMQ+AET VLG+T KG  A+ MQ+AA  N RAG V 
Sbjct  16   IKYGDVFNVQGDLGMKPVAPADASMMQAAETVVLGKTGKGAAASTMQSAAAKNERAGFVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL-PNYQAGGGINMNSAL  445
             +  ++ AG+QGV + E  +PG R ITESI  QVVG+   A PL P   AGG +      
Sbjct  76   HNQGTDVAGDQGVAIAEIQLPGRRTITESIGDQVVGEYSAAAPLTPPSAAGGRVG-----  130

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEA+A A G K V+ SDAAA+QAAEVRA G     PGGV A AQSAA  N 
Sbjct  131  --AITIGEALEAAALAAGGKPVEWSDAAAVQAAEVRAAGRTTTAPGGVGAAAQSAATLNA  188

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               R++DK KL +VL DA++KLP DK ATR DAEGV  A+ RN+ ++++ PGGVAA+VAA
Sbjct  189  RTSRNEDKTKLADVLTDASEKLPRDKAATRRDAEGVVRAEVRNDPNLTTYPGGVAAAVAA  248

Query  806  aaRLNE  823
            AARLN+
Sbjct  249  AARLNQ  254



>ref|XP_010090423.1| hypothetical protein L484_025090 [Morus notabilis]
 gb|EXB39393.1| hypothetical protein L484_025090 [Morus notabilis]
Length=247

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 133/248 (54%), Positives = 165/248 (67%), Gaps = 28/248 (11%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAET-AVLGQTQKGGPaaamqaaanvnvraGLV  265
            +K GDVF VSG LA KP+AP+DAA MQ+AE+ A LG+ ++                   V
Sbjct  20   IKNGDVFNVSGSLASKPVAPRDAAAMQAAESMAFLGRHERA------------------V  61

Query  266  SP--DDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNS  439
             P   D +N A EQG TV+E  V G+R+ITE++ GQVVG+ VE  P    +  GG+    
Sbjct  62   QPLSGDATNVAREQGATVSEKIVEGTRVITEAVGGQVVGEYVE--PQVRARTLGGVLDRD  119

Query  440  ALQAGITIGQALEASAQALGNKAVDR-SDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
            A    ITIG+ALEA+A ++ +K VD   DAAAIQAAEVRATG N+  PGGV ATAQSAA 
Sbjct  120  A----ITIGEALEATALSVPDKPVDHLGDAAAIQAAEVRATGINLTLPGGVGATAQSAAT  175

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
            +N  LI D+    + +V+ DATQKLPADK  TREDA+GV  A+ RN  DMS+TPGGVAAS
Sbjct  176  FNAQLIADEYMTTISDVIGDATQKLPADKAVTREDAQGVIGAEVRNKPDMSTTPGGVAAS  235

Query  797  vaaaaRLN  820
            +AAAARLN
Sbjct  236  MAAAARLN  243



>dbj|BAK04960.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 174/247 (70%), Gaps = 7/247 (3%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            V+YGDVF  V+G LA KP+APQDAA MQSAE  V G+T KGGPAA MQ+AA  N R G+V
Sbjct  62   VRYGDVFPAVAGGLAQKPVAPQDAATMQSAENLVFGETIKGGPAATMQSAAMRNERMGVV  121

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
              D  ++   EQGV+V+ET VPG RI+TE +AGQ VGQ +     P+  AG G       
Sbjct  122  GHDQATDATAEQGVSVSETRVPGGRIVTEFVAGQAVGQYL----APDDAAGAGGAGGDDT  177

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            +  ITIG+ALEA+  + G + V+RSDAAAIQAAEVRATG +V  PGG+AA AQSAA  N 
Sbjct  178  K--ITIGEALEAAGYSAGGRPVERSDAAAIQAAEVRATGLDVNIPGGLAAQAQSAADANA  235

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD++K KLG+VL +A+ KL ADK A  +DA  VASA+ RN  D +  PGGVAASVAA
Sbjct  236  WAARDEEKAKLGDVLTNASTKLVADKEAEADDAARVASAEIRNKDDKTVRPGGVAASVAA  295

Query  806  aaRLNER  826
            AARLN++
Sbjct  296  AARLNKQ  302



>gb|EYU46567.1| hypothetical protein MIMGU_mgv1a012107mg [Erythranthe guttata]
Length=261

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 175/246 (71%), Gaps = 4/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGD+F VSGELA KP+AP+DAA  Q+AE+ +LGQ QKGGPAA MQ+AA+VNV  G++ 
Sbjct  16   VKYGDIFQVSGELASKPVAPRDAATAQAAESIILGQVQKGGPAAVMQSAADVNVSRGVLH  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             DDV+    + GV +++TD  G RIITE++AG+VVG+ V A      +   G  +++   
Sbjct  76   RDDVTEATRQHGVLISQTDAGGQRIITEAVAGEVVGKYVVA----GEEETTGPPLSALSP  131

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIGQALE+   + G+K VD SDAAAIQA E RA+G + + PGGVAA AQSAA +N  
Sbjct  132  GAVTIGQALESVVLSAGDKPVDESDAAAIQAVESRASGLDKVVPGGVAAAAQSAAKHNAR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             + D+ K+KL +VL  A  KLP D+  T+EDAE   +A+ RN LDM++ PGGVAAS+A A
Sbjct  192  TMADEKKIKLRDVLGGAISKLPDDRAVTKEDAEAAVAAELRNKLDMTTYPGGVAASLATA  251

Query  809  aRLNER  826
            ARLN++
Sbjct  252  ARLNQQ  257



>ref|XP_010679058.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 173/249 (69%), Gaps = 3/249 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VS ++ADKPIAP DAA MQSAE  VLG TQKGGPAA MQ+AA  NV+AG + 
Sbjct  19   IKYGDVFLVSEKIADKPIAPLDAAAMQSAENQVLGHTQKGGPAAVMQSAATKNVQAGALP  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL-  445
                ++    QG+TVTE+ V G R+ITES+  QVV +   A P PN      +   SAL 
Sbjct  79   RGSATDVGRNQGMTVTESIVDGQRVITESVGDQVVARY--ANPDPNPIPEKMVAPPSALD  136

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            +  +TIG+ALEA+  + G+K + ++DAAAIQAAE+RATG     PGG+ A AQSAA  NE
Sbjct  137  RDAVTIGEALEATVISAGDKPITQTDAAAIQAAEMRATGRTDTPPGGLGAEAQSAATRNE  196

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
             ++RD++K  LG VLADAT KL  DK AT +DAE V +A+ RN+  M++  GGV  SVAA
Sbjct  197  RIMRDENKTTLGEVLADATTKLGDDKPATIQDAEKVIAAEMRNDPKMATNLGGVGESVAA  256

Query  806  aaRLNERGL  832
            AARLN++ L
Sbjct  257  AARLNQQKL  265



>ref|XP_009802733.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
sylvestris]
Length=260

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 162/245 (66%), Gaps = 0/245 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VS +LA KP+APQD  +MQSAET  LG   +GGPA+ MQ+AA  N   G VS
Sbjct  15   IKYGDVFEVSSQLASKPVAPQDVTIMQSAETIALGHVPRGGPASIMQSAAAQNEHLGAVS  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             DD+++   ++GVTV++ +V G+R+++E++AG+VVGQ +      + +         A  
Sbjct  75   RDDMTDITRDEGVTVSQAEVGGTRLVSEAVAGEVVGQYIYPSEAGDGERAARYPTTGAQS  134

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
               TIG+ALEA A   G+K +++SDAAAIQAAEVRATG   + PGG+ A AQ AAA N  
Sbjct  135  ESTTIGEALEAVALTAGDKPIEQSDAAAIQAAEVRATGLAEVMPGGIGAEAQHAAAINAR  194

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
               + DK  L +VL DAT +L  DK   +EDAEGV  A+ R   D+++ PGGVAAS+A A
Sbjct  195  TTPEDDKTSLSDVLTDATSRLIGDKAVKKEDAEGVVGAEIRAKRDLATHPGGVAASMAVA  254

Query  809  aRLNE  823
            + LNE
Sbjct  255  SSLNE  259



>ref|XP_006382741.1| seed maturation protein PM26 [Populus trichocarpa]
 gb|ERP60538.1| seed maturation protein PM26 [Populus trichocarpa]
Length=206

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 143/200 (72%), Gaps = 14/200 (7%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA+KP+AP+DAAMMQ+AE A++GQ Q+GG A+ MQ+AA  N RAG V 
Sbjct  13   IKYGDVFSVEGELAEKPVAPRDAAMMQTAENALMGQIQRGGAASMMQSAAMRNERAGFVG  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL-----PNYQAGGGINM  433
              DV++ A  QGV+VTET++PG RIITE+I GQ+V    +  PL     P +Q       
Sbjct  73   HSDVNDVANYQGVSVTETEMPGRRIITEAIGGQIVRDFDQRAPLVQSPPPLFQ-------  125

Query  434  NSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
               + AGITIG+ALEA+A + G K V+ SDAAAIQAAEVRATG   ITPGGVAA AQSAA
Sbjct  126  --QVDAGITIGEALEATALSCGQKPVEWSDAAAIQAAEVRATGRTTITPGGVAAAAQSAA  183

Query  614  aYNEGLIRDQDKVKLGNVLA  673
              N  + +D+DK KL +VLA
Sbjct  184  TINARMTKDEDKTKLSDVLA  203



>ref|XP_008797392.1| PREDICTED: late embryogenesis abundant protein D-34-like [Phoenix 
dactylifera]
Length=259

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 170/245 (69%), Gaps = 7/245 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF V G L D+PIAP+ AAMMQSAE  VLG T  GGPAA M ++A+ N +A  V 
Sbjct  19   VKYGDVFNVQGGLEDQPIAPKAAAMMQSAENLVLGHTPTGGPAAVMMSSASRNEQASFVG  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV +    QGV+V E  +PG R++TESIAGQV  + ++A P            +    
Sbjct  79   HQDVGDGPASQGVSVAEIHLPGCRVLTESIAGQVR-EYLQAFPSGFGGG------SRGRD  131

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            + I+IGQALEA+A+  GNK VDRSDAAAIQAAE RATGTN++  GGVAATAQ+AA  N  
Sbjct  132  SAISIGQALEATARTAGNKPVDRSDAAAIQAAEARATGTNMVASGGVAATAQAAADANAR  191

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            + RD++K KL +VL++AT KLPADK  TR DAE V  A+ RN+ +M++ PGGVAAS+  A
Sbjct  192  ITRDENKTKLADVLSNATAKLPADKAVTRADAERVTGAEMRNDPEMATRPGGVAASIVEA  251

Query  809  aRLNE  823
            AR N+
Sbjct  252  ARCNQ  256



>ref|XP_008370878.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=294

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 176/277 (64%), Gaps = 38/277 (14%)
 Frame = +2

Query  89   VKYGDVF-GVSG-ELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGL  262
            VKYGDVF GV G ELA+K + P+DAA+MQ+AE AVLG T KGG A+ MQ+AA  N +AG+
Sbjct  16   VKYGDVFPGVQGAELAEKVVTPKDAAIMQAAENAVLGHTLKGGAASFMQSAATENEKAGV  75

Query  263  VSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQ-------------------------  367
            V   DV+      GV+V E D+PG RII+ESI GQ                         
Sbjct  76   VGSSDVNADVVGDGVSVKEADLPGRRIISESIGGQGPNSNQRKVDHEKQRNKILEKYCQN  135

Query  368  --VVGQSVEAMPL--PN-YQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAA  532
               VGQ  +  PL  PN  Q  GG    SA Q  ITIG+ALEA+A   G K V+ SDAAA
Sbjct  136  PYXVGQYSQRAPLAAPNTIQPVGG----SAGQ--ITIGEALEATAMTAGQKPVEYSDAAA  189

Query  533  IQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIAT  712
            IQAAEVRATG   I PGGVAA AQSAA  N    +D++K KL ++LADA  KLPADK AT
Sbjct  190  IQAAEVRATGRTNIVPGGVAAAAQSAATLNARATKDEEKTKLABILADAXSKLPADKPAT  249

Query  713  REDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            R DAEGV  A+ RN+  +++ P GVAASVAAAARLNE
Sbjct  250  RRDAEGVTGAEMRNDPFLTTHPTGVAASVAAAARLNE  286



>ref|XP_011032498.1| PREDICTED: late embryogenesis abundant protein D-34-like [Populus 
euphratica]
Length=206

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 141/200 (71%), Gaps = 14/200 (7%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GELA+KP+AP+DAAMMQ+AE A++GQ Q+GG A+ MQ+AA  N RAG V 
Sbjct  13   IKYGDVFSVEGELAEKPVAPRDAAMMQTAENALMGQIQRGGAASMMQSAAMRNERAGFVG  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQ-----SVEAMPLPNYQAGGGINM  433
              DV++ A  QGV+VTET++PG RIITE+I GQ+V        +E  P P +Q       
Sbjct  73   HSDVNDVANYQGVSVTETEMPGRRIITEAIGGQIVRDFDQRAPLEPSPPPLFQ-------  125

Query  434  NSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
               + AGITIG+ALEA+A + G K V+ SDAAAIQAAEVRA G   ITPGGVAA AQSAA
Sbjct  126  --QVDAGITIGEALEATALSCGQKPVEWSDAAAIQAAEVRAIGRTTITPGGVAAAAQSAA  183

Query  614  aYNEGLIRDQDKVKLGNVLA  673
              N  + +D DK KL +VLA
Sbjct  184  TINARMTKDDDKTKLSDVLA  203



>ref|XP_008364056.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=224

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 150/214 (70%), Gaps = 11/214 (5%)
 Frame = +2

Query  89   VKYGDVF-GVSG-ELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGL  262
            VKYGDVF GV G ELA+K + P+DAA+MQ+AE AVLG T KGG A+ MQ+AA  N +AG+
Sbjct  16   VKYGDVFPGVQGAELAEKVVTPKDAAIMQAAENAVLGHTLKGGAASXMQSAATENEKAGV  75

Query  263  VSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL--PN-YQAGGGINM  433
            V   DV+      GV+V E D+PG RII+ESI GQVVGQ  +  PL  PN  Q  GG   
Sbjct  76   VGSSDVNADVVGDGVSVKEADLPGRRIISESIGGQVVGQYSQRAPLAAPNTIQPVGG---  132

Query  434  NSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
             SA Q  ITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA
Sbjct  133  -SAGQ--ITIGEALEATAMTAGQKPVEYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAA  189

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATR  715
              N    +D++K KL N+LADAT KLPADK ATR
Sbjct  190  TLNARATKDEEKTKLANILADATSKLPADKPATR  223



>ref|XP_004986236.1| PREDICTED: late embryogenesis abundant protein D-34-like [Setaria 
italica]
Length=266

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 177/246 (72%), Gaps = 6/246 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G+LAD+P+AP+DAA++QSAE AVLG+TQ+GGPAA +Q+AA +N RAG V 
Sbjct  23   IKYGDVFDVTGDLADRPVAPRDAALLQSAEQAVLGRTQRGGPAAVLQSAAALNARAGHVG  82

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
               ++ PA + G TVTE ++PG R++TES+ GQ V + V   P+      G  + ++   
Sbjct  83   KGQITGPAADAGATVTEAELPGLRVVTESVGGQAVAKLVTPAPVVATDPSGAADQDA---  139

Query  449  AGITIGQ-ALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              +TIG+     +A A G K VD+SDAAA+QAAE+ AT ++   PGGVAA AQ+AA +N 
Sbjct  140  --VTIGRALEAVAATAAGGKPVDQSDAAAVQAAEMCATASSATAPGGVAAAAQAAADHNA  197

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD+DKVKL +VL++A +K+PAD+ AT EDAE V SA+ RN LDM++T GGVA +V  
Sbjct  198  RAARDEDKVKLRDVLSNAREKMPADRGATGEDAERVVSAEIRNKLDMATTLGGVAEAVTT  257

Query  806  aaRLNE  823
            AARLN+
Sbjct  258  AARLNQ  263



>gb|KHG05102.1| Late embryogenesis abundant D-34 [Gossypium arboreum]
Length=258

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 165/236 (70%), Gaps = 14/236 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+GELA KPI P+DAA MQSAE  +LG+T KGG AAAMQ+AA  N RAG+VS
Sbjct  16   IKYGDVFNVTGELASKPIGPKDAAAMQSAENKILGETPKGGAAAAMQSAAIANERAGVVS  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQ----SVEAMPLPNYQAGGGINMN  436
              + ++ AG+QGV V ++D  G  +ITE++AGQ+VGQ     V A+  P      G    
Sbjct  76   -HNQADVAGDQGVAVIKSDADGDVMITEAVAGQIVGQYRQPDVSAVTTPAMLVDPG----  130

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
                  ITIG+ALEA+A +  +K +D+SDAAAIQAAE+RATG++ ITPGG+A+ AQSAA 
Sbjct  131  -----SITIGEALEAAAISAADKPIDQSDAAAIQAAEMRATGSSEITPGGIASEAQSAAT  185

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
             N    R +D+  L +VL+DAT  LP DK  TREDAE V +A+ RNN  MS+TPGG
Sbjct  186  RNARTQRFEDQATLSDVLSDATAMLPKDKAVTREDAERVVAAEVRNNPGMSTTPGG  241



>ref|XP_010070193.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW58827.1| hypothetical protein EUGRSUZ_H01465 [Eucalyptus grandis]
Length=256

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 172/246 (70%), Gaps = 8/246 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGEL  KPIAP+DAA MQ+AE  VLG T++GG AA MQ+AA+VNVR G V 
Sbjct  16   IKYGDVFDVSGELKGKPIAPRDAATMQAAENMVLGGTRQGGVAAVMQSAADVNVRTGAVR  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMP-LPNYQAGGGINMNSAL  445
            P  VS+ A +QGVT+++ ++   R+++E  A           P +   + GG ++ N+  
Sbjct  76   PGQVSDVARDQGVTISQANIGSRRVVSE--AVGGQVVGGYVQPAVDTGKPGGALDRNA--  131

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
               ITIG+ALEASA + G+K +++SDAAAIQAAEVRATG+N   PGG+A+ AQ+AA  N 
Sbjct  132  ---ITIGEALEASALSAGDKPLEQSDAAAIQAAEVRATGSNGTMPGGIASLAQAAATRNA  188

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
                D+DK KL +VL  AT  LP DK  TREDA+ V  A+ RN ++M++TPGGVA S+AA
Sbjct  189  RTAADEDKTKLADVLTIATDVLPGDKAVTREDADRVIVAEMRNKVEMTTTPGGVAESMAA  248

Query  806  aaRLNE  823
            AARLN+
Sbjct  249  AARLNQ  254



>ref|XP_007030655.1| Seed maturation protein, putative [Theobroma cacao]
 gb|EOY11157.1| Seed maturation protein, putative [Theobroma cacao]
Length=229

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 161/229 (70%), Gaps = 4/229 (2%)
 Frame = +2

Query  137  PIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSPDDVSNPAGEQGVTVT  316
            P+AP+D AMMQ+AE A+LG   KG  A+AMQ+AA  N  AG V  +D++    E GVT+ 
Sbjct  2    PVAPKDVAMMQTAENAMLGHNPKGYAASAMQSAAMQNEGAGFVCHEDLN---AESGVTIK  58

Query  317  ETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQAL  496
            ET++PG R+ITES+  +VVGQ  +A PL + Q        S   A ITIG+ALEA+A   
Sbjct  59   ETELPGKRVITESVGDEVVGQYSQAAPLSSGQFSASQQGGSTGDA-ITIGEALEATALTA  117

Query  497  GNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLAD  676
            G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA  N    RD+DK KLG++L++
Sbjct  118  GKKPVEWSDAAAIQAAEVRATGRTSIMPGGVAAAAQSAATLNARATRDEDKTKLGDILSN  177

Query  677  ATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            AT KLP+DK ATR DAE V  A+ RN+ ++++ P GVAASVAAAARLN+
Sbjct  178  ATTKLPSDKPATRRDAERVTGAEMRNDPNLTTHPAGVAASVAAAARLNQ  226



>ref|XP_009364553.1| PREDICTED: late embryogenesis abundant protein D-34-like [Pyrus 
x bretschneideri]
Length=291

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 147/275 (53%), Positives = 176/275 (64%), Gaps = 37/275 (13%)
 Frame = +2

Query  89   VKYGDVF-GVSG-ELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGL  262
            V YGDVF GV G +LADK + P+DAAM+Q+AE AVLGQT KGG AA +Q+AA  N +A +
Sbjct  16   VTYGDVFPGVQGAQLADKVVTPKDAAMIQAAENAVLGQTVKGGAAAIIQSAATQNEKAAV  75

Query  263  VSPDDVS--NPAGEQGVTVTETDVPGSRIITESIAG----------------------QV  370
            V   DV         GV+V E D+PG RIITESI G                      +V
Sbjct  76   VGSSDVKADVGGDGGGVSVKEADLPGRRIITESIGGKGSDSNQMHVDQEKQRKIHELVEV  135

Query  371  VGQSVEAMPL--PN--YQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQ  538
            VGQ  +  PL  PN  +  GG     SA+Q  ITIG+ALEA+A   G K V+ SDAAAIQ
Sbjct  136  VGQYSQRAPLAPPNTMHPVGG-----SAVQ--ITIGEALEATAMTAGQKPVEWSDAAAIQ  188

Query  539  AAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATRE  718
            AAEVRATG   I PGGVA  AQSAA  N    +D++K KL ++LA+AT KLPADK ATR 
Sbjct  189  AAEVRATGRTNIVPGGVAGAAQSAATLNARATKDEEKTKLADILANATSKLPADKPATRR  248

Query  719  DAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            DAEGV  A+ RN+  +++ P GVAASVAAAARLNE
Sbjct  249  DAEGVTGAEMRNDPYLTTHPTGVAASVAAAARLNE  283



>ref|XP_007144794.1| hypothetical protein PHAVU_007G184800g [Phaseolus vulgaris]
 gb|ESW16788.1| hypothetical protein PHAVU_007G184800g [Phaseolus vulgaris]
Length=281

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 174/263 (66%), Gaps = 18/263 (7%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDV  V G+L  KP+AP DAA+MQ AE+ + G+T+KGG AAAMQ+AA  N R G+V 
Sbjct  16   IKYGDVLDVQGDLRSKPVAPVDAAIMQKAESQMFGKTEKGGAAAAMQSAAAKNERDGVVG  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMP---------LPNYQAGG  421
             +D+SN A   G +VTET  PG ++ +ES+  QV  +SVE            +  +    
Sbjct  76   HNDMSNAAAGGGASVTETGTPGRQVTSESVGDQVGQKSVEEKEKKVNKLVEVVEQFSKKA  135

Query  422  GIN-MNSAL--------QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVI  574
             +N M S            GITIG+ALEA+    G K V+ SDAAAIQAAEVRATG   I
Sbjct  136  PVNSMTSPSLVQDMGDGSGGITIGEALEATVLTAGKKPVEWSDAAAIQAAEVRATGRTNI  195

Query  575  TPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRN  754
             PGGVAA AQSAA  N  + +++DK KL ++LADAT KLP+D+ ATR DAEGV  A+ RN
Sbjct  196  VPGGVAAAAQSAATLNARVTKEEDKTKLADILADATSKLPSDRPATRRDAEGVTGAEMRN  255

Query  755  NLDMSSTPGGvaasvaaaaRLNE  823
            + ++++ PGGV+ASVAAAAR+N+
Sbjct  256  DPNLTTHPGGVSASVAAAARINQ  278



>ref|XP_004304720.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 169/249 (68%), Gaps = 15/249 (6%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            +K+ DVF  V GELADK +AP+DAA MQ+AE+ V+GQ  K G AA MQ+AA  N RAG V
Sbjct  17   MKFSDVFPAVQGELADKAVAPKDAATMQTAESDVVGQNLKRGAAATMQSAAAQNQRAGYV  76

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL--PNY-QAGGGINMN  436
              +D++    E  VT+TETD+PG RIITES+ GQVVG+ ++  PL  P+  QAG G    
Sbjct  77   GLNDMN--IVEDDVTITETDLPGRRIITESVGGQVVGEYIQRTPLAAPSIVQAGDG----  130

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
                  ITIG+ALE +      K V+ SDAAAIQAAE+RATG   I PGGVAA AQSAA 
Sbjct  131  -----HITIGEALETTVMTARKKPVEWSDAAAIQAAEIRATGRPRIVPGGVAAEAQSAAT  185

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
             N   +R++DK  LG++LA A  KLP DK  T +DA+GV  A+ RN+   ++ P GVAAS
Sbjct  186  LNARTMRNEDKTTLGDILAGAASKLPDDKPTTLQDAKGVTDAEMRNDRYQTTHPTGVAAS  245

Query  797  vaaaaRLNE  823
            VAAAARLN+
Sbjct  246  VAAAARLNQ  254



>ref|XP_006589172.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X1 [Glycine max]
Length=284

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 173/266 (65%), Gaps = 23/266 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GE+  KP AP DA MMQ AET   G+TQK    AAMQ+AA  N R G+  
Sbjct  16   IKYGDVFNVKGEMKSKPEAPVDAGMMQKAETETTGKTQKA--GAAMQSAAAKNERGGMAG  73

Query  269  PDDVSNPAGEQGVTVTETD--VPGSRIITESIAGQVVGQSVEAMPLPN--YQAGGGINMN  436
              D +N A + GV+VTET+  + GS++I+ES+AGQVV +  E     N   +     N  
Sbjct  74   HKDKNNVAADGGVSVTETEAHLSGSQVISESVAGQVVNRLEEKKRKVNKLVEVVKQFNQK  133

Query  437  SALQ-----------------AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGT  565
            + L                  +GITIG+ALEA+    G K V+ SDAAAIQAAEVRATG 
Sbjct  134  APLNTMTPPSIVQEMGAGGAGSGITIGEALEATVLTAGKKPVEWSDAAAIQAAEVRATGR  193

Query  566  NVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQ  745
              I PGGVAA AQSAA  N  + +D++K+KL ++LADAT KLP+D+ ATR DAEGV  A+
Sbjct  194  TNIVPGGVAAAAQSAATLNARVTKDEEKIKLADILADATSKLPSDRAATRRDAEGVTGAE  253

Query  746  QRNNLDMSSTPGGvaasvaaaaRLNE  823
             RN+ ++++ PGGV+ASVAAAARLN+
Sbjct  254  MRNDPNLTTHPGGVSASVAAAARLNK  279



>ref|XP_008388644.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=291

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 176/274 (64%), Gaps = 35/274 (13%)
 Frame = +2

Query  89   VKYGDVF-GVSG-ELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGL  262
            V YGDVF GV G +LADK + P+DAAM+Q+AE AVLGQT KGG AA +Q+AA  N +A +
Sbjct  16   VTYGDVFPGVQGAQLADKVVTPKDAAMIQAAENAVLGQTVKGGAAAIIQSAATQNEKAAV  75

Query  263  VSPDDVS--NPAGEQGVTVTETDVPGSRIITESIAGQ----------------------V  370
                DV         GV+V E D+PG RI+TESI GQ                      V
Sbjct  76   XGSSDVKADVGGDGGGVSVKEADLPGRRILTESIGGQGSDSNQMQVDHEKQRKIHELIEV  135

Query  371  VGQSVEAMPL--PN-YQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQA  541
            VGQ  +  PL  PN  Q  GG    SA+Q  ITIG+ALEA+A   G K V+ SDAAAIQA
Sbjct  136  VGQYSQRAPLAPPNTMQLVGG----SAVQ--ITIGEALEATAMTAGQKPVEWSDAAAIQA  189

Query  542  AEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATRED  721
            AEVRATG   I PGGVAA AQSAA  N    +D++K KL ++LA+AT KLPADK ATR D
Sbjct  190  AEVRATGRTNIVPGGVAAAAQSAATLNARATKDEEKTKLADILANATSKLPADKPATRRD  249

Query  722  AEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            AEGV  A+ RN+  +++ P GVAASVAAAARLNE
Sbjct  250  AEGVTGAEMRNDPYLTTHPTGVAASVAAAARLNE  283



>ref|XP_011091040.1| PREDICTED: late embryogenesis abundant protein D-34-like [Sesamum 
indicum]
Length=332

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 139/188 (74%), Gaps = 9/188 (5%)
 Frame = +2

Query  257  GLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMN  436
            GLV   +V+  AGEQGVTV ETD+PG+RIITES+ GQV+GQ V+  P+    A G +   
Sbjct  150  GLVGSREVTVVAGEQGVTVAETDLPGTRIITESVGGQVLGQFVQPTPV----AAGAVP--  203

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
               Q  ITIG+ALE S +A G+K V+ SD AAIQ AE RATG+++ITPGG+ ATAQSAAA
Sbjct  204  ---QGAITIGEALEVSGRAAGDKPVEFSDVAAIQVAECRATGSDLITPGGLTATAQSAAA  260

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
            YN+ +  D+ KV+L +VL  AT KLPADK ATREDAE + +A+ RN+ D+ + PGGVA +
Sbjct  261  YNQAVAEDEGKVRLADVLTGATAKLPADKAATREDAEEIINAELRNDPDLKTHPGGVAET  320

Query  797  vaaaaRLN  820
            VAAAARLN
Sbjct  321  VAAAARLN  328



>ref|XP_003562052.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=302

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 166/247 (67%), Gaps = 17/247 (7%)
 Frame = +2

Query  89   VKYGDVF--GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGL  262
            ++YGDVF   V G LA+KP++PQDAA MQSAE  V G T KGGPAAAMQ+AA+ N R G 
Sbjct  68   IRYGDVFPGAVHGGLAEKPVSPQDAATMQSAENLVFGATLKGGPAAAMQSAASRNERTGA  127

Query  263  VSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
            V+ D  +    +QGV V     PG+R++TE +AGQ VGQ +              + + A
Sbjct  128  VAHDQAT--VQKQGVCV-----PGARVVTEFVAGQAVGQYLAPDAD--------ADADDA  172

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
              + ITIG+ALEA++ A G + V+RSDAAAIQAAEVRATG +V  PGG+AA AQ AA  N
Sbjct  173  APSKITIGEALEAASFAAGRRPVERSDAAAIQAAEVRATGLDVNVPGGLAAQAQKAADAN  232

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
            E    D+DK  LG+VL++AT+KL ADK    EDA  VA A+ RN  D ++ PGGVAAS+A
Sbjct  233  ERAASDRDKTMLGDVLSNATEKLLADKAVESEDAARVAFAEARNKEDATARPGGVAASMA  292

Query  803  aaaRLNE  823
            AAAR+N 
Sbjct  293  AAARINR  299



>ref|XP_009620120.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
tomentosiformis]
Length=262

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 164/260 (63%), Gaps = 20/260 (8%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VS +LA KP+APQDA +MQSAE+  LG   KGGPA+ MQ+A   N R G VS
Sbjct  7    IKYGDVFEVSSQLASKPVAPQDATIMQSAESIALGHVPKGGPASIMQSATAQNERIGAVS  66

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITE----------SIAGQVVGQSVEAMPLPNYQAG  418
             DD+++ A ++GVTV++ +V G+R I            S+A  VVGQ +     P+ +AG
Sbjct  67   RDDMTDIARDEGVTVSQAEVGGTRSILAGLTLALFQKLSVARYVVGQYI----YPS-EAG  121

Query  419  GGINMNSALQAGI-----TIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPG  583
             G         G+     TIG+ALEA A   G+K +++SDAAAIQAAEVRATG   + PG
Sbjct  122  DGERAARYPTTGVQSESTTIGEALEAVALTAGDKPIEQSDAAAIQAAEVRATGLGEVMPG  181

Query  584  GVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLD  763
            G+ A AQ AAA N     + DK  L +VL DAT +L  DK   +EDAEGV  A+ R   D
Sbjct  182  GIGAEAQHAAAINARTTPEDDKTTLSDVLTDATSRLIGDKAVKKEDAEGVVGAEIRTKSD  241

Query  764  MSSTPGGvaasvaaaaRLNE  823
            +++ PGGVAAS+A A+ LNE
Sbjct  242  LATHPGGVAASMAVASSLNE  261



>ref|XP_010025078.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW61664.1| hypothetical protein EUGRSUZ_H04398 [Eucalyptus grandis]
Length=277

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 164/251 (65%), Gaps = 9/251 (4%)
 Frame = +2

Query  89   VKYGDVFG-VSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            VKYGDVF  V GELA KP+AP DAA+MQ+AE  +LGQ QKG  A+ MQ+AA  N  AG+V
Sbjct  14   VKYGDVFASVEGELAGKPVAPNDAALMQTAENLMLGQVQKGAAASVMQSAATQNEDAGVV  73

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL------PNYQAGGGI  427
              D ++    EQGV V      G  +ITESI GQV+GQ  +  PL      P  +     
Sbjct  74   GHDSMNEIVAEQGVNVAA--FRGGHVITESIGGQVLGQYSQRAPLVSGPVVPENKNKPSG  131

Query  428  NMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqs  607
            + +      ITIG+ALEA+A  +G+K V+RSDAAAIQAAEVRATG   I PGGVAA AQS
Sbjct  132  DDDGIGGGPITIGEALEATALTIGDKPVERSDAAAIQAAEVRATGRTTIAPGGVAAAAQS  191

Query  608  aaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGv  787
            AA  N    R ++K K+ +VL  A+ KLP+DK  TR D EGV  A+ RN+  +++ P GV
Sbjct  192  AATLNARTTRPEEKTKMADVLWGASSKLPSDKPVTRADVEGVTVAEIRNDPFLTTHPAGV  251

Query  788  aasvaaaaRLN  820
            +A+VAAAARLN
Sbjct  252  SATVAAAARLN  262



>gb|KEH43047.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=241

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 161/247 (65%), Gaps = 22/247 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V G++  + +AP DAAMMQ AET + G+TQKGG AA+MQ+AA  N R G+V 
Sbjct  13   IKYGDVFNVEGDIGSRTVAPVDAAMMQKAETQMHGKTQKGGAAASMQSAAMKNERDGIVG  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGI-NMNSAL  445
             +D+S  A + GV                     V Q  +  P+        + +M++  
Sbjct  73   HNDMSENAADGGV---------------------VEQLSQNAPMNTMTPASLVKDMSAGA  111

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              G+TIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA  N 
Sbjct  112  DGGVTIGEALEATALTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNA  171

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               +++DK KLG++LADAT KLPAD+ ATR DAEGV  A+ RN+  +++ PGGV+AS+AA
Sbjct  172  RTTKEEDKTKLGDILADATTKLPADRAATRRDAEGVTGAEMRNDPYLTTHPGGVSASMAA  231

Query  806  aaRLNER  826
            AARLN++
Sbjct  232  AARLNQK  238



>ref|XP_006480098.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
Length=330

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 171/247 (69%), Gaps = 9/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + YGDVF VSGELA +P+A +DAA MQ+AE   LG+TQ+GGPAA MQ+AA  N RAG  S
Sbjct  89   INYGDVFDVSGELASQPVAQRDAAAMQAAENMALGKTQRGGPAAVMQSAAEANERAGFTS  148

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMP-LPNYQAGGGINMNSA  442
                ++ A +QGVTV+E+ V  G+RIITE+I  QV+ Q   A P +P   +G  +  + +
Sbjct  149  HSTATHIARDQGVTVSESTVADGNRIITEAIGDQVLAQY--ATPEVPTRASGAALGRDQS  206

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
                 TIG+ALEA+A + G+KAVD+SDAAAI AAE RA+ TN I PGG+ + AQSAA  N
Sbjct  207  -----TIGEALEATALSAGDKAVDQSDAAAIYAAEARASATNEIKPGGIGSRAQSAATQN  261

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
            E      DK+ + +V  DAT KL  DK  TREDAEG+ S + RN  DM +TPGGVA+S+A
Sbjct  262  ERTTFFSDKITISDVSGDATTKLSDDKPVTREDAEGIISPEIRNKPDMRTTPGGVASSMA  321

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  322  AAARLNQ  328



>ref|XP_006444042.1| hypothetical protein CICLE_v10023775mg [Citrus clementina]
 gb|ESR57282.1| hypothetical protein CICLE_v10023775mg [Citrus clementina]
Length=335

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 171/247 (69%), Gaps = 9/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + YGDVF VSGELA +P+A +DAA MQ+AE   LG+TQ+GGPAA MQ+AA  N RAG  S
Sbjct  94   INYGDVFDVSGELASQPVAQRDAAAMQAAENMALGKTQRGGPAAVMQSAAEANERAGFTS  153

Query  269  PDDVSNPAGEQGVTVTETDVP-GSRIITESIAGQVVGQSVEAMP-LPNYQAGGGINMNSA  442
                ++ A +QGVTV+E+ V  G+RIITE+I  QV+ Q   A P +P   +G  +  + +
Sbjct  154  HSTATHIARDQGVTVSESTVADGNRIITEAIGDQVLAQY--ATPEVPTRASGAALGRDQS  211

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
                 TIG+ALEA+A + G+KAVD+SDAAAI AAE RA+ TN I PGG+ + AQSAA  N
Sbjct  212  -----TIGEALEATALSAGDKAVDQSDAAAIYAAEARASATNEIKPGGIGSRAQSAATQN  266

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
            E      DK+ + +V  DAT KL  DK  TREDAEG+ S + RN  DM +TPGGVA+S+A
Sbjct  267  ERTTFFSDKITISDVSGDATTKLSDDKPVTREDAEGIISPEIRNKPDMRTTPGGVASSMA  326

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  327  AAARLNQ  333



>gb|AFK36784.1| unknown [Medicago truncatula]
Length=241

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 160/247 (65%), Gaps = 22/247 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V  ++  + +AP DAAMMQ AET + G+TQKGG AA+MQ+AA  N R G+V 
Sbjct  13   IKYGDVFNVEDDIGSRTVAPVDAAMMQKAETQMHGKTQKGGAAASMQSAAMKNERDGIVG  72

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGI-NMNSAL  445
             +D+S  A + GV                     V Q  +  P+        + +M++  
Sbjct  73   HNDMSENAADGGV---------------------VEQLSQNAPMNTMTPASLVKDMSAGA  111

Query  446  QAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              G+TIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA  N 
Sbjct  112  DGGVTIGEALEATALTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNA  171

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               +++DK KLG+VLADAT KLPAD+ ATR DAEGV  A+ RN+  +++ PGGV+AS+AA
Sbjct  172  RTTKEEDKTKLGDVLADATTKLPADRAATRRDAEGVTGAEMRNDPYLTTHPGGVSASMAA  231

Query  806  aaRLNER  826
            AARLN++
Sbjct  232  AARLNQK  238



>ref|XP_002512261.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF49713.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=242

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 162/254 (64%), Gaps = 37/254 (15%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAP-QDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            +KY D+F +  + A+K +AP ++AAM+Q++                              
Sbjct  14   IKYDDLFSIQADTANKAVAPPREAAMIQASAVQS-------------------------A  48

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPN-------YQAGGG  424
            +  ++++ A E GV V ETD+ G R+ITESIAGQ+VGQ+ + +   N       YQ GG 
Sbjct  49   AAKNMNDAAEEVGVRVKETDMHGRRMITESIAGQIVGQNSQRVAPTNSLGSSGAYQQGGS  108

Query  425  INMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataq  604
             N++     GITIG+ALEA+A   G KAV+ SDAAAIQAAEVRATG   I+PGGVAA AQ
Sbjct  109  GNVS----GGITIGEALEATALTAGQKAVEWSDAAAIQAAEVRATGRTTISPGGVAAAAQ  164

Query  605  saaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
            SAA  N    RD+DK KL ++LADAT KLPAD+ ATR+DAEGV  A+ RN+  +++ P G
Sbjct  165  SAATLNARATRDEDKTKLADILADATSKLPADRPATRKDAEGVTGAEMRNDPYLTTHPAG  224

Query  785  vaasvaaaaRLNER  826
            VAAS+AAAARLN++
Sbjct  225  VAASIAAAARLNQQ  238



>ref|XP_007050564.1| Late embryogenesis abundant protein D-34, putative isoform 2 
[Theobroma cacao]
 gb|EOX94721.1| Late embryogenesis abundant protein D-34, putative isoform 2 
[Theobroma cacao]
Length=284

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 158/251 (63%), Gaps = 24/251 (10%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G LA KP+AP+D   M+ AE  VLG+T   G AA MQ+AA+VNV +G+V 
Sbjct  20   IKYGDVFDVTGGLASKPVAPRDTETMRIAENQVLGKTLDAGAAAVMQSAADVNVMSGVVC  79

Query  269  PDDVSNPAGEQGVTVTET-DVPGSRIITESIAGQVVGQ-------SVEAMPLPNYQAG--  418
            P   +     +GV V ++ D+ G  ++TE+IAGQ+VGQ        +   P P    G  
Sbjct  80   PSPGNKMVEREGVAVPKSRDLQGKVVVTEAIAGQIVGQYTPSDVRGITPFPSPTPVRGDV  139

Query  419  ---------GGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNV  571
                     G ++ N     GITIG+ALEA+A ++G+K VD+ DAAAI+ AEVRA G+NV
Sbjct  140  GWTTSPTPTGAVDHN-----GITIGEALEATAISVGDKPVDQGDAAAIRVAEVRAAGSNV  194

Query  572  ITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQR  751
                G+ ATAQ+AA +N+ +  D +K+ + NVL+DA+ K P DK  T EDA+GV  A+ R
Sbjct  195  TQRNGLGATAQAAATFNDRVSYDYNKMTISNVLSDASSKFPQDKAVTSEDADGVRGAELR  254

Query  752  NNLDMSSTPGG  784
            N LDM  TPGG
Sbjct  255  NKLDMIPTPGG  265



>ref|XP_009764712.1| PREDICTED: uncharacterized protein LOC104216384 [Nicotiana sylvestris]
Length=856

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 167/246 (68%), Gaps = 2/246 (1%)
 Frame = +2

Query  92   KYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSP  271
            KYGDVF VS ++A KPIAP+DAA +QSAE   LG   KGGPA+ MQ+AA +N R G V  
Sbjct  610  KYGDVFEVSEKIASKPIAPKDAASIQSAENKELGHIPKGGPASIMQSAAVLNQRFGGVGR  669

Query  272  DDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVE-AMPLPNYQAGGGINMNSALQ  448
            +D+++ A ++GVTV++T++ G+ I+TE++ G+V+ Q    +        G  +    +L 
Sbjct  670  NDMTDIARDKGVTVSQTEIEGTPIVTEAVGGEVLAQYTHPSTGGGGGGGGSTVEATLSLD  729

Query  449  AGI-TIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
            A + TIG+ALE +A + G+K VD SDAAAIQAAEVRATG   + PGGV A AQ AAA N 
Sbjct  730  ADVVTIGEALELAALSAGDKPVDESDAAAIQAAEVRATGLGHVVPGGVGAEAQRAAAVNI  789

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
               RD+ K KL +VL DAT KL   K  T+EDA GV  A+ RN  D+++ PGGVAAS+AA
Sbjct  790  RTTRDEQKTKLSDVLTDATSKLVDYKPVTKEDALGVVGAEIRNKPDLATHPGGVAASMAA  849

Query  806  aaRLNE  823
            AA LN+
Sbjct  850  AANLNK  855



>ref|XP_006589173.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X2 [Glycine max]
Length=275

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 170/257 (66%), Gaps = 14/257 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V GE+  KP AP DA MMQ AET   G+TQK    AAMQ+AA  N R G+  
Sbjct  16   IKYGDVFNVKGEMKSKPEAPVDAGMMQKAETETTGKTQKA--GAAMQSAAAKNERGGMAG  73

Query  269  PDDVSNPAGEQGVTVTETD--VPGSRIITE-SIAGQVVGQSVEAMPLPNYQAG-GGINMN  436
              D +N A + GV+VTET+  + GS+++       + V + VE +   N +A    +   
Sbjct  74   HKDKNNVAADGGVSVTETEAHLSGSQVVNRLEEKKRKVNKLVEVVKQFNQKAPLNTMTPP  133

Query  437  SALQ--------AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVa  592
            S +Q        +GITIG+ALEA+    G K V+ SDAAAIQAAEVRATG   I PGGVA
Sbjct  134  SIVQEMGAGGAGSGITIGEALEATVLTAGKKPVEWSDAAAIQAAEVRATGRTNIVPGGVA  193

Query  593  ataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSS  772
            A AQSAA  N  + +D++K+KL ++LADAT KLP+D+ ATR DAEGV  A+ RN+ ++++
Sbjct  194  AAAQSAATLNARVTKDEEKIKLADILADATSKLPSDRAATRRDAEGVTGAEMRNDPNLTT  253

Query  773  TPGGvaasvaaaaRLNE  823
             PGGV+ASVAAAARLN+
Sbjct  254  HPGGVSASVAAAARLNK  270



>emb|CDO99067.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 147/214 (69%), Gaps = 33/214 (15%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +K GDVF V+GELA KPIAP DAAMMQ+AET VLGQTQ+GGPAAAMQ+A  +N RAGL S
Sbjct  16   IKDGDVFSVTGELAGKPIAPGDAAMMQAAETRVLGQTQRGGPAAAMQSAVTINERAGLAS  75

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              DV++                 R+ITE++AGQV        P    +  GG    +   
Sbjct  76   HTDVTD-----------------RMITEAVAGQV-------FPGGFGRERGGYGQQARAG  111

Query  449  AG--------ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataq  604
            AG        ITIG+ALEA+AQ  GNK  ++SDAAAIQAA+VRATG+NVI PGGVAATAQ
Sbjct  112  AGGGGAVTGAITIGEALEATAQTAGNKPGEQSDAAAIQAAQVRATGSNVIIPGGVAATAQ  171

Query  605  saaaYNE-GLIRDQDKVKLGNVLADATQKLPADK  703
            SAA+ NE G +RD+DK+KLG+VL DAT +LPADK
Sbjct  172  SAASSNEAGQLRDEDKIKLGHVLTDATVELPADK  205



>ref|NP_001051258.2| Os03g0747400 [Oryza sativa Japonica Group]
 dbj|BAF13172.2| Os03g0747400 [Oryza sativa Japonica Group]
Length=257

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 159/248 (64%), Gaps = 19/248 (8%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGDVF VSGELA +P+AP+DAA +QSAE AVLG+ QKGGPAAAMQ+AA +N RAG V 
Sbjct  19   VMYGDVFDVSGELAGQPVAPRDAAKLQSAEEAVLGEAQKGGPAAAMQSAAAINARAGHVG  78

Query  269  PDDVSNPAGEQG--VTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
               V+    ++G  V V ET++PG R++TES+AGQVV +      +   Q  G ++ ++ 
Sbjct  79   RAQVTGAIADEGVAVAVAETELPGRRVVTESVAGQVVARLATPPRVVATQPSGSLDKDA-  137

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGV-aataqsaaaY  619
                +TIG+ALE   +               +AAE+ ATG  V  PGGV AA   +A   
Sbjct  138  ----VTIGRALEWRPR-----------PPRRRAAEMLATGRTVTVPGGVAAAAQAAADHN  182

Query  620  NEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasv  799
                 RD+D++KL +VL  A  KLPADK ATREDAE V SA+ RN  DM++TPGGVA +V
Sbjct  183  AAPAARDEDRIKLRDVLTGARGKLPADKAATREDAERVPSAEVRNRPDMATTPGGVADAV  242

Query  800  aaaaRLNE  823
             AAARLN+
Sbjct  243  TAAARLNQ  250



>ref|XP_007050563.1| Late embryogenesis abundant protein D-34, putative isoform 1 
[Theobroma cacao]
 gb|EOX94720.1| Late embryogenesis abundant protein D-34, putative isoform 1 
[Theobroma cacao]
Length=287

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 168/269 (62%), Gaps = 29/269 (11%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G LA KP+AP+D   M+ AE  VLG+T   G AA MQ+AA+VNV +G+V 
Sbjct  20   IKYGDVFDVTGGLASKPVAPRDTETMRIAENQVLGKTLDAGAAAVMQSAADVNVMSGVVC  79

Query  269  PDDVSNPAGEQGVTVTET-DVPGSRIITESIAGQV-----VGQ-------SVEAMPLPNY  409
            P   +     +GV V ++ D+ G  ++TE+IAGQV     VGQ        +   P P  
Sbjct  80   PSPGNKMVEREGVAVPKSRDLQGKVVVTEAIAGQVKYILIVGQYTPSDVRGITPFPSPTP  139

Query  410  QAG-----------GGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRA  556
              G           G ++ N     GITIG+ALEA+A ++G+K VD+ DAAAI+ AEVRA
Sbjct  140  VRGDVGWTTSPTPTGAVDHN-----GITIGEALEATAISVGDKPVDQGDAAAIRVAEVRA  194

Query  557  TGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVA  736
             G+NV    G+ ATAQ+AA +N+ +  D +K+ + NVL+DA+ K P DK  T EDA+GV 
Sbjct  195  AGSNVTQRNGLGATAQAAATFNDRVSYDYNKMTISNVLSDASSKFPQDKAVTSEDADGVR  254

Query  737  SAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
             A+ RN LDM  TPGGVA ++A AAR+N 
Sbjct  255  GAELRNKLDMIPTPGGVADTMATAARVNR  283



>ref|XP_009396738.1| PREDICTED: late embryogenesis abundant protein D-34-like [Musa 
acuminata subsp. malaccensis]
Length=279

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 167/257 (65%), Gaps = 12/257 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G+LA + IAP+DAAMM +AE   LG T KGGPA+ M++AA  N + GLV 
Sbjct  21   IKYGDVFPVAGDLAGQTIAPRDAAMMHAAENRALGLTPKGGPASVMESAATRNEQRGLVG  80

Query  269  PDDVSNPAGEQGVTVTETDV---PGSRIITESIAGQVVGQSVEAMPLPNYQAGGG-----  424
             D  S     QGV++T+T++   PG R++TE +AGQ VGQ V      +  A GG     
Sbjct  81   HDQFSPIPANQGVSITQTEIHGLPGQRLVTEFVAGQAVGQYVVDAESGDGGAPGGRRGVE  140

Query  425  ----INMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVa  592
                +   S+    +TIG+ALEA+ +A G++ ++ SDAAA++AAE  ATG N +  GG+A
Sbjct  141  RGQSLGGVSSWTDKMTIGEALEAAGRAAGDEPIEMSDAAAVEAAESAATGLNTVLRGGIA  200

Query  593  ataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSS  772
            A AQSAA  N  + RD+DK KLG+VL DA  +L  D+ ATR DAE V  A+ RN+ D+  
Sbjct  201  AAAQSAATLNARITRDEDKTKLGDVLQDAAMRLLDDREATRVDAERVVRAEMRNSPDVCV  260

Query  773  TPGGvaasvaaaaRLNE  823
             PGGVA S+ +AAR N+
Sbjct  261  RPGGVADSMVSAARFNQ  277



>ref|XP_003590629.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES60880.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=215

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGELA +PI P+DAA+MQ+ E   LGQTQKG PA+ MQ+AA VN  AGLVS
Sbjct  20   IKYGDVFNVSGELASQPIKPRDAALMQATENQALGQTQKGSPASVMQSAAAVNTAAGLVS  79

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D+S+ A  QG++V++T V  +R+ITES+  QVVGQ VE   +P    G  ++ N+   
Sbjct  80   HGDISDIAKNQGMSVSKTKVGANRVITESVGSQVVGQFVEP-DVPMNDPGLVLDKNA---  135

Query  449  AGITIGQALEASAQA-LGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNE  625
              ITIG+ALEASA +  G+K +D+SDAAAIQAAE+RATG N   PGG+ A AQSAA  N 
Sbjct  136  --ITIGEALEASALSQAGDKPLDQSDAAAIQAAEMRATGKNHTEPGGLGAIAQSAATRNT  193

Query  626  GLIRDQDKVKLGNVLA  673
              + D  K  LG+V++
Sbjct  194  RTMPDLQKTTLGDVVS  209



>ref|XP_007034768.1| Late embryogenesis abundant protein D-34 isoform 1 [Theobroma 
cacao]
 gb|EOY05694.1| Late embryogenesis abundant protein D-34 isoform 1 [Theobroma 
cacao]
Length=173

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 133/178 (75%), Gaps = 10/178 (6%)
 Frame = +2

Query  290  AGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQ  469
            AG+Q V+ +ETDV G RIITES    V+GQ V+A P+P  Q G         Q  ITIG+
Sbjct  2    AGDQVVSFSETDVSGRRIITES----VLGQYVQATPVPTTQIG------VIQQTAITIGE  51

Query  470  ALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDK  649
            ALEA+AQ   +K VD+SDAAAIQAAEVRATG+NVI PGG+AATAQSAAA N  + R+++K
Sbjct  52   ALEATAQTTRDKPVDQSDAAAIQAAEVRATGSNVIIPGGLAATAQSAAAQNASVNRNEEK  111

Query  650  VKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            ++L  VL  AT KLPADK  TR+D EGV SA+ RNN ++++ PGGVAAS+AAAARLNE
Sbjct  112  IRLNEVLTGATAKLPADKAVTRQDDEGVVSAELRNNPNVATRPGGVAASIAAAARLNE  169



>ref|XP_004965453.1| PREDICTED: late embryogenesis abundant protein D-34-like [Setaria 
italica]
Length=288

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 157/251 (63%), Gaps = 15/251 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG-QTQKGG-----Paaamqaaanvnv  250
            ++YG VF V+G LA +PIAP+DAA M+SAE +V G Q  +G       A AM+ AA  N 
Sbjct  40   IRYGHVFAVTGYLAGQPIAPRDAAAMRSAEDSVPGVQVPEGAGGGFSAATAMETAAAYNQ  99

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGIN  430
              G V P   S+ A  QG+TVT+T VPG R++TE +AGQVVGQ   A P P  +      
Sbjct  100  AVGAVRPGQASDAAAVQGITVTQTAVPGGRVVTEFVAGQVVGQYSVADPPPAAE------  153

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
               A +  ITIG+ALEA+A+A G + +DR+DA AI+AAE+ A   +V  PGG+   AQ+A
Sbjct  154  -EDATK--ITIGEALEATARAGGGRPIDRADAEAIRAAEMSAHRADVAMPGGLGDQAQAA  210

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A  N    RD DKVKLG+VL+DAT KL  DK A  EDA  V  A+  N+ +  +  GGV 
Sbjct  211  ARANAQATRDGDKVKLGDVLSDATAKLAGDKAAGAEDATRVIQAETFNDAEAHARAGGVG  270

Query  791  asvaaaaRLNE  823
            A+V  AARLNE
Sbjct  271  AAVTTAARLNE  281



>ref|XP_002453796.1| hypothetical protein SORBIDRAFT_04g017790 [Sorghum bicolor]
 gb|EES06772.1| hypothetical protein SORBIDRAFT_04g017790 [Sorghum bicolor]
Length=283

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 154/251 (61%), Gaps = 15/251 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG----QTQKGG--Paaamqaaanvnv  250
            ++YG VF VSG+LA +PI P+DAA M+SAE +V G    Q   GG   A AM+ AA  N 
Sbjct  34   IRYGHVFAVSGDLAGQPIGPRDAAAMRSAEDSVAGVQVPQGAGGGFSAATAMETAAAYNQ  93

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGIN  430
              G V P   S+ A   G+ VT+T VPG RI+TE +AGQVVGQ   A P P  +      
Sbjct  94   AVGAVHPGQASDTAAMHGIAVTQTAVPGGRIVTEFVAGQVVGQYSVADPPPPAE------  147

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
               A +  ITIG+ALEA+A+A G + +DR+DA AI+AAE+ A G +V  PGG+   A++A
Sbjct  148  -EDATK--ITIGEALEATARAGGGRPIDRADAEAIRAAEMSAHGADVAMPGGLGDQARAA  204

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A  N    RD DKVKLG+VL+D T KL  DK A  EDA  V   +  N+ +  +  GGV 
Sbjct  205  ARANAQATRDGDKVKLGDVLSDVTAKLAGDKAARTEDATRVVQTETFNDAEARAKAGGVG  264

Query  791  asvaaaaRLNE  823
            A++  AARLNE
Sbjct  265  AALTTAARLNE  275



>ref|XP_009411288.1| PREDICTED: late embryogenesis abundant protein D-34-like [Musa 
acuminata subsp. malaccensis]
Length=266

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 171/253 (68%), Gaps = 13/253 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            ++YGDVF VSG LA + I+P+DAAMMQSAE   LGQT +GG A+ M++AA  N + GLV 
Sbjct  17   IRYGDVFAVSGSLAGEAISPRDAAMMQSAENRALGQTPQGGAASVMESAAMWNEQCGLVG  76

Query  269  PDDVSNPAGEQGVTVTETDVPGS---RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNS  439
             +  S+  G QGV+VT+TD+PG    R++TE +AGQ VGQ        N   GGG +   
Sbjct  77   HEQFSDTPGRQGVSVTQTDIPGCPGQRLVTEFVAGQAVGQY-----FFNTAPGGGADEAG  131

Query  440  ALQA-----GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataq  604
             +        ++IG+ALEA+A   GNK VD SDAAAIQAAE  A G N +TPGGVAA AQ
Sbjct  132  GVAVEMWTDKVSIGEALEAAATTAGNKPVDASDAAAIQAAEATAAGANAVTPGGVAAAAQ  191

Query  605  saaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
            +AAA N    RD +K KLG+V+ADA+  +  DK ATREDAE V +A+ RNN ++ + PGG
Sbjct  192  AAAAANALKYRDDEKTKLGDVVADASVWMAMDKEATREDAERVVAAEMRNNPELRAHPGG  251

Query  785  vaasvaaaaRLNE  823
            V AS+ AAARLN+
Sbjct  252  VGASMVAAARLNQ  264



>ref|XP_006349691.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=257

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 170/254 (67%), Gaps = 16/254 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V Y DVF VS EL  + IAP+DAA+MQSAE+  LG   +GGPA+ MQ+AA+ N R G+V+
Sbjct  10   VTYTDVFSVSSELGSEIIAPEDAAIMQSAESIALGHVPRGGPASLMQSAASQNERIGVVA  69

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL-  445
             +D+++ A + GVTV++ +V G+R+++ES+ G+VV Q +     P+   GGG +   +  
Sbjct  70   TNDITDFARKHGVTVSQVEVGGTRVVSESVGGEVVAQYI----YPSEAGGGGDDEERSAR  125

Query  446  -------QAGITIGQALEASA-QALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaata  601
                   +  +T+G+ALEA A +  G+K +++SDAAAIQAAE RATG + + PGGV A A
Sbjct  126  YPTTGVQEEAVTVGEALEAVALKPAGDKPIEQSDAAAIQAAEARATGRSEVVPGGVGAEA  185

Query  602  qsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPG  781
            Q AA+ N    +  DK  LG+VL DAT KL  DK   +EDAEGV +A+ RN  D+++ PG
Sbjct  186  QRAASIN---AQTDDKTTLGDVLRDATSKLIDDKAVKKEDAEGVVAAEIRNTPDLATHPG  242

Query  782  GvaasvaaaaRLNE  823
            GVAAS+  A+ LN+
Sbjct  243  GVAASITTASNLNK  256



>gb|AFW67487.1| hypothetical protein ZEAMMB73_891670 [Zea mays]
Length=207

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 142/245 (58%), Gaps = 50/245 (20%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VK+GDV  VSGEL D+P+AP+DAA +Q+AE +V G TQKGGPAA +Q+ A VN RAG V 
Sbjct  8    VKFGDVLDVSGELDDQPVAPRDAARLQAAEQSVPGGTQKGGPAAVLQSVATVNARAGHVG  67

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
                + P  + G T+TET++ G R++TES+ GQVVG+ V   P+      G +  ++   
Sbjct  68   RAQTACPVADAGATITETELAGRRVVTESVGGQVVGKMVTPAPVAMTDPPGALEKDA---  124

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG+ALEA    +G++ V++SDAAA+Q                              
Sbjct  125  --VTIGRALEAVGAMVGDRPVEQSDAAAVQ------------------------------  152

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
                           +A +KLPADK AT EDAE V SA+ RN LDM++TPGG+A +V  A
Sbjct  153  ---------------NAREKLPADKGATWEDAERVVSAEIRNKLDMATTPGGMADAVTTA  197

Query  809  aRLNE  823
            ARLN+
Sbjct  198  ARLNQ  202



>gb|AJA33580.1| late embryogenesis abundant protein LEA7-1 [Pinus tabuliformis]
Length=270

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 153/247 (62%), Gaps = 10/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + YGD+F VSG LA + I PQDAA+MQSAET  LG+T K G AA MQAAA +N  AGL++
Sbjct  28   ITYGDIFDVSGSLAAQAITPQDAALMQSAETRALGKTLKVGAAAVMQAAAEMNESAGLLN  87

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
                 +  GEQGVTV E  +PG  + TE +AGQ +  ++   P          +  +A  
Sbjct  88   SRAEDSVVGEQGVTVAEAQLPGVNVTTEYVAGQAIRSAIRPAP---------ADYPTAAT  138

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A +TIG+ALEA+A   G+K V+ SDA A+QAAE +ATGT  I+ GGVA+ AQ+AA  N  
Sbjct  139  ADVTIGEALEAAAMRAGDKPVELSDAVAVQAAERQATGTGEISKGGVASAAQAAADVNAR  198

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L     K  LG+VL+ AT+ LP DK  T EDA  +   +  +     + PGGV  ++ AA
Sbjct  199  LPYSM-KTTLGDVLSTATEDLPVDKAVTAEDARRIKELEASHTETGEAYPGGVGDAMEAA  257

Query  809  aRLNERG  829
            AR+NE+G
Sbjct  258  ARVNEQG  264



>ref|XP_010277174.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=238

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 154/245 (63%), Gaps = 27/245 (11%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYG      G L   P        MQSAE  VLGQTQKG PA+ MQ+AA  N RAG   
Sbjct  16   IKYGTYPQFPGNLQPNP----SHLKMQSAENRVLGQTQKGSPASVMQSAAARNERAGHGD  71

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D++     +G+TV E D  G+RI+ ESIA QVVGQ  +  P                 
Sbjct  72   DTDITT---NEGLTVAENDGAGNRIVNESIADQVVGQ-FKRDP-----------------  110

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              ITIG+ALEA+A  +G+ +VD+SDAAAI+AAE+RATG + I+ GGVAA AQSAA  N  
Sbjct  111  --ITIGEALEATAVTVGDISVDKSDAAAIRAAELRATGGDTISQGGVAAAAQSAATVNAQ  168

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             +R ++K+K+G+VL DA  KLP D+ ATREDAE VA A+ R N   ++ P GVAASVAAA
Sbjct  169  TMRHEEKIKIGDVLMDAAIKLPGDRPATREDAEEVAGAEMRENPKSATHPSGVAASVAAA  228

Query  809  aRLNE  823
            ARLN+
Sbjct  229  ARLNK  233



>emb|CAA41854.1| rab28 [Zea mays]
Length=278

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 160/249 (64%), Gaps = 6/249 (2%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            V+YGDVF  VSG LA+KP+A +  A MQSAE  V GQT KGGPAAAMQ+AA  N R G V
Sbjct  24   VRYGDVFPAVSGGLAEKPVA-RRTATMQSAENLVFGQTLKGGPAAAMQSAATTNERMGAV  82

Query  266  SPDDVSNPAGEQGVTVTETDVPGS-RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
              D  ++    QGVTV+ET VPG  RI+TE +AGQ VGQ +           G       
Sbjct  83   GHDQATDATAVQGVTVSETRVPGGGRIVTEFVAGQAVGQYLARDDDGGGGIAGPGAGAGV  142

Query  443  LQAGIT---IGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
                IT   IG+ALEA+A A G+  V+RSDAA IQAAE RATG +   PGG+A  AQSAA
Sbjct  143  AGKDITKVTIGEALEATALAAGDAPVERSDAARIQAAEARATGLDANVPGGLARQAQSAA  202

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaa  793
            A N     D+DK  LG+VLA+AT +L ADK     DA GVA A+ RN  D ++ PGGVAA
Sbjct  203  AANSWAWGDEDKATLGDVLANATARLVADKPVESADALGVAGAENRNRNDGTARPGGVAA  262

Query  794  svaaaaRLN  820
            S+AAAARLN
Sbjct  263  SMAAAARLN  271



>ref|NP_001049030.1| Os03g0159600 [Oryza sativa Japonica Group]
 gb|AAN06848.1| Putative abscisic acid-induced protein [Oryza sativa Japonica 
Group]
 gb|ABF94089.1| Seed maturation protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10944.1| Os03g0159600 [Oryza sativa Japonica Group]
 dbj|BAG97815.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 170/249 (68%), Gaps = 5/249 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            ++YGDVF V+G LA KPIAP+DAA MQSAE  VLG+T KGGPAAAM++AA+ N   G+V 
Sbjct  23   IRYGDVFPVTGSLAAKPIAPRDAATMQSAENLVLGKTVKGGPAAAMESAASRNEEMGVVG  82

Query  269  PDDVSNPAGEQGVTVTETDVPGS-RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
             D  ++ A EQGV V++T VPG  RI+TE +AGQ VG  VE        AG       A+
Sbjct  83   HDQATDAAAEQGVNVSDTLVPGGGRIVTEFVAGQAVGHYVEQDDGAAVVAGVVGAAPGAV  142

Query  446  Q----AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
            +    A ITIG+ALEA+A A G   V+RSDAAAIQAAE +ATGT+   PGG+AA AQSAA
Sbjct  143  RVEEPAKITIGEALEAAALAAGGTPVERSDAAAIQAAEAKATGTDTYMPGGLAAQAQSAA  202

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaa  793
              N    RD DK KLG+VL++AT KL ADK     DA  VA A+ RN    ++ PGGVAA
Sbjct  203  VANLWTARDADKTKLGDVLSNATAKLAADKEVESGDAARVAGAEMRNKPGAAARPGGVAA  262

Query  794  svaaaaRLN  820
            S+AAAARLN
Sbjct  263  SMAAAARLN  271



>ref|XP_004135801.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 gb|KGN66161.1| hypothetical protein Csa_1G574780 [Cucumis sativus]
Length=259

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 165/247 (67%), Gaps = 14/247 (6%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            +KYGDVF  V G+LA+KP+ P+DAA +Q+AET +LG+T  GG AA +Q+AA  N RAGLV
Sbjct  19   IKYGDVFPHVEGDLANKPVTPEDAAALQAAETVLLGKTLHGGAAATIQSAAAKNERAGLV  78

Query  266  SP-DDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
                DV +    + V +T TD+ G        A +VV +  E +P+        +N +  
Sbjct  79   GRGKDVGDQIVAEDV-ITNTDLVG--------AQEVVTEHRERVPIGPLST---LNPHEE  126

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
               GITIG+ALEA+A  +G K V+ SDAAAIQAAEVRATG   I PGG+AATAQSAA  N
Sbjct  127  GGGGITIGEALEATALTVGEKIVEWSDAAAIQAAEVRATGRMNIAPGGIAATAQSAATMN  186

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
              + +D+DK KL +VL DA  KL ADK ATR DAEGV  A+ RN+  +++ P GVAAS+A
Sbjct  187  ARVTQDEDKTKLADVLKDARTKLSADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASIA  246

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  247  AAARLNQ  253



>gb|EAY88627.1| hypothetical protein OsI_10103 [Oryza sativa Indica Group]
Length=276

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 170/249 (68%), Gaps = 5/249 (2%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            ++YGDVF V+G LA KPIAP+DAA MQSAE  VLG+T KGGPAAAM++AA+ N   G+V 
Sbjct  23   IRYGDVFPVTGSLAAKPIAPRDAATMQSAENLVLGKTVKGGPAAAMESAASRNEEMGVVG  82

Query  269  PDDVSNPAGEQGVTVTETDVPGS-RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
             D  ++ A EQGV V++T VPG  RI+TE +AGQ VG  VE        AG       A+
Sbjct  83   HDQATDAAAEQGVNVSDTLVPGGGRIVTEFVAGQAVGHYVEQDDGAAVVAGVVGAAPGAV  142

Query  446  Q----AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
            +    A ITIG+ALEA+A A G   V+RSDAAAIQAAE +ATGT+   PGG+AA AQSAA
Sbjct  143  RVEEPAKITIGEALEAAALAAGGTPVERSDAAAIQAAEAKATGTDTYMPGGLAAQAQSAA  202

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaa  793
              N    RD DK KLG+VL++AT KL ADK     DA  VA A+ RN    ++ PGGVAA
Sbjct  203  VANLWTARDADKTKLGDVLSNATAKLAADKEVESGDAARVAGAETRNKPGAAARPGGVAA  262

Query  794  svaaaaRLN  820
            S+AAAARLN
Sbjct  263  SMAAAARLN  271



>ref|XP_004165760.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
Length=259

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 165/247 (67%), Gaps = 14/247 (6%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            +KYGD+F  V G+LA+KP+ P+DAA +Q+AET +LG+T  GG AA +Q+AA  N RAGLV
Sbjct  19   IKYGDIFPHVEGDLANKPVTPEDAAALQAAETVLLGKTLHGGAAATIQSAAARNERAGLV  78

Query  266  SP-DDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
                DV +    + V +T TD+ G        A +VV +  E +P+        +N +  
Sbjct  79   GRGKDVGDQIVAEDV-ITNTDLVG--------AQEVVTEHSERVPIGPLST---LNPHEE  126

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
               GITIG+ALEA+A  +G K V+ SDAAAIQAAEVRATG   I PGG+AATAQSAA  N
Sbjct  127  GGGGITIGEALEATALTVGEKIVEWSDAAAIQAAEVRATGRMNIAPGGIAATAQSAATMN  186

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
              + +D+DK KL +VL DA  KL ADK ATR DAEGV  A+ RN+  +++ P GVAAS+A
Sbjct  187  ARVTQDEDKTKLADVLKDARTKLSADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASIA  246

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  247  AAARLNQ  253



>gb|AJA33583.1| late embryogenesis abundant protein LEA7-4 [Pinus tabuliformis]
Length=261

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 152/247 (62%), Gaps = 10/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + YGD+F VSG LA + I PQDAA+MQSAET  LG+T   G AA MQAAA +N  AGLV+
Sbjct  19   ITYGDIFDVSGSLAAQAITPQDAALMQSAETRALGKTLNLGAAAVMQAAAEMNESAGLVN  78

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
                 +  GEQ VTV E  +PG  ++TES+AGQ +  ++   P          +  +A  
Sbjct  79   SRAEDSVVGEQSVTVAEAQLPGVNVLTESVAGQAIRFAIRPAP---------ADYPTAAT  129

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
            A +TIG+ALEA+A   G+K V+ SDA A+QAAE +ATGT  I+ GGVA+ AQSAA  N  
Sbjct  130  ADVTIGEALEAAAIRAGDKPVELSDAVAVQAAERQATGTGEISKGGVASAAQSAADVNAR  189

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
            L     K  LG+VL+ AT+ L  DK  T EDA  +   +  +     + PGGV  ++ AA
Sbjct  190  LPYSM-KTTLGDVLSTATEDLLVDKAVTAEDAWRIKELEASHTETGEAYPGGVGDAMEAA  248

Query  809  aRLNERG  829
            AR+NE+G
Sbjct  249  ARVNEQG  255



>ref|XP_003599533.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES69784.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=269

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 164/259 (63%), Gaps = 24/259 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraG--L  262
            +KYG+VF VSG+LA + I+PQ AA M +AE  VLGQ Q G PAAAMQAAA +N  +G  L
Sbjct  19   IKYGEVFNVSGDLASETISPQAAANMAAAEFNVLGQAQPGSPAAAMQAAALINEASGQCL  78

Query  263  VSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVE--AMPLPNYQAGGGINMN  436
            V    ++    + G+ VTET     R++TE++ GQ++G+ VE  A  +P       +NM 
Sbjct  79   VGRHGIAEMVKDHGIRVTETTAANRRVVTEAVDGQIIGRRVEPDAHFVP-------MNMG  131

Query  437  SALQAG--ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
            SA   G  ITIG+ALEA+  ++G+K VD++DA AI AAE+RATG   + P GV ATAQSA
Sbjct  132  SAAIDGDPITIGEALEAAGISVGDKPVDQNDADAISAAEIRATGERCVRPDGVGATAQSA  191

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSST-----  775
            A  N    R ++  KL +VL DAT KL AD+  T EDAE V  A+   N   SST     
Sbjct  192  ATLNSHANRIEEMTKLSDVLTDATDKLAADRAVTIEDAEAVYDAEVHKN---SSTQQMMN  248

Query  776  ---PGGvaasvaaaaRLNE  823
               PGG+AAS+A AA+LN+
Sbjct  249  IAEPGGIAASMATAAKLNQ  267



>ref|XP_004985623.1| PREDICTED: late embryogenesis abundant protein D-34-like [Setaria 
italica]
Length=280

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 171/250 (68%), Gaps = 6/250 (2%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLG--QTQKGGPaaamqaaanvnvraG  259
            V+YGDVF  VSG LA+KP+APQDAA MQSAE+ V G  QT +GGP A MQ+AA  N R G
Sbjct  23   VRYGDVFPAVSGGLAEKPVAPQDAATMQSAESLVFGFGQTIRGGPGATMQSAATTNERMG  82

Query  260  LVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSV---EAMPLPNYQAGGGIN  430
            +V  D  ++    QGVTV+ET VPG R++TE +AGQ VGQ +   +A       AGG   
Sbjct  83   VVGHDQATDATAVQGVTVSETRVPGGRLVTEFVAGQAVGQYLAPDDATAGGAAGAGGVAA  142

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
                    +TIG+ALEA+A A G++ V+RSDAAAIQAAE RATG +   PGG+AA AQSA
Sbjct  143  AGVVDNTKVTIGEALEATALAAGDEPVERSDAAAIQAAEARATGLHANVPGGLAAQAQSA  202

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            AA NE   RD+DK  +G+VLA+AT KL ADK     DA  VA A+ RN  D ++ PGGVA
Sbjct  203  AAANEWAARDEDKTTIGDVLANATAKLVADKTVESADALRVAGAENRNKGDATARPGGVA  262

Query  791  asvaaaaRLN  820
            AS+AAAA+LN
Sbjct  263  ASMAAAAKLN  272



>gb|EAZ00817.1| hypothetical protein OsI_22847 [Oryza sativa Indica Group]
Length=277

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 155/251 (62%), Gaps = 17/251 (7%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG----QTQKGGPaa--amqaaanvnv  250
            +KYG VF V+GELA +PIAP+DAA M+SAE +V G    Q   GG +A  AM+ AA  N 
Sbjct  28   IKYGHVFAVTGELAGQPIAPRDAAAMRSAEESVPGVPVPQDIGGGYSAGVAMETAAAYNQ  87

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGIN  430
              G V P   S+ A  QG+ VT+T VPG RIITE +AGQVVGQ         Y       
Sbjct  88   AVGAVRPGQASDAATNQGIAVTQTSVPGGRIITEFVAGQVVGQ---------YSVADQAV  138

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
               A +  IT+G+ALEA+A A G + VDR+D  AI+AAE+ A G++V  PGG+A  AQ+A
Sbjct  139  EQDATK--ITVGEALEATALAAGERPVDRTDVEAIRAAEMAAQGSDVTMPGGLADQAQAA  196

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A  N    RD DK+ +G+VL DAT KL  DK+A  EDA  V  A+  ++    +  GGV 
Sbjct  197  ARSNADADRDDDKITVGDVLTDATAKLAGDKVAGAEDAAKVVQAEAYSDAAARTRAGGVG  256

Query  791  asvaaaaRLNE  823
            A+V+ AARLN+
Sbjct  257  AAVSTAARLNQ  267



>dbj|BAK03375.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=263

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 157/251 (63%), Gaps = 10/251 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG----QTQKGG--Paaamqaaanvnv  250
            ++YG VF V+G+LA + IAP+DA  M++AE +V G    Q   GG   A AM+ AA  N 
Sbjct  11   IQYGHVFAVAGDLAVQAIAPRDAEAMRTAEESVQGVQVPQASGGGFSAAVAMETAAAYNQ  70

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGIN  430
              G V P   S+ A +QG+TVT+T VPG RI+TE +AGQVVGQ      + +        
Sbjct  71   AVGAVRPGQASDAATKQGITVTQTAVPGGRIVTEFVAGQVVGQ----YSVADQAMMQQQQ  126

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
            +     + +TIG+A+EA+A + G++ ++ +DAAAI+AAE +A G + + PGG+A  A +A
Sbjct  127  LVEEDASKVTIGEAMEAAALSAGDRPLEETDAAAIRAAETQAQGEDKVMPGGLADQAWAA  186

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A+ N    RD+DK+ +G+VL+DAT KL  DK A REDA  V  A+  ++    +  GGV 
Sbjct  187  ASANAWAERDEDKITVGDVLSDATTKLADDKPAAREDAARVVQAETYSDAGARTKAGGVG  246

Query  791  asvaaaaRLNE  823
            A+V  AARLN+
Sbjct  247  AAVTTAARLNK  257



>dbj|BAJ96619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 157/251 (63%), Gaps = 10/251 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG----QTQKGG--Paaamqaaanvnv  250
            ++YG VF V+G+LA + IAP+DA  M++AE +V G    Q   GG   A AM+ AA  N 
Sbjct  22   IQYGHVFAVTGDLAVQAIAPRDAEAMRTAEESVQGVQVPQASGGGFSAAVAMETAAAYNQ  81

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGIN  430
              G V P   S+ A +QG+TVT+T VPG RI+TE +AGQVVGQ      + +        
Sbjct  82   AVGAVRPGQASDAATKQGITVTQTAVPGGRIVTEFVAGQVVGQ----YSVADQAMMQQQQ  137

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
            +     + +TIG+A+EA+A + G++ ++ +DAAAI+AAE +A G + + PGG+A  A +A
Sbjct  138  LVEEDASKVTIGEAMEAAALSAGDRPLEETDAAAIRAAETQAQGEDKVMPGGLADQAWAA  197

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A+ N    RD+DK+ +G+VL+DAT KL  DK A REDA  V  A+  ++    +  GGV 
Sbjct  198  ASANAWAERDEDKITVGDVLSDATTKLADDKPAAREDAARVVQAETYSDAGARTKAGGVG  257

Query  791  asvaaaaRLNE  823
            A+V  AARLN+
Sbjct  258  AAVTTAARLNK  268



>ref|NP_001057565.1| Os06g0341300 [Oryza sativa Japonica Group]
 dbj|BAD61548.1| putative Late embryogenesis abundant protein D-34 [Oryza sativa 
Japonica Group]
 dbj|BAD61622.1| putative Late embryogenesis abundant protein D-34 [Oryza sativa 
Japonica Group]
 dbj|BAF19479.1| Os06g0341300 [Oryza sativa Japonica Group]
 dbj|BAG98114.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 154/251 (61%), Gaps = 17/251 (7%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG----QTQKGGPaa--amqaaanvnv  250
            +KYG VF V+GELA +PIAP+DAA M+SAE +V G    Q   GG +A  AM+ AA  N 
Sbjct  28   IKYGHVFAVTGELAGQPIAPRDAAAMRSAEESVPGVPVPQDIGGGYSAGVAMETAAAYNQ  87

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGIN  430
                V P   S+ A  QG+ VT+T VPG RIITE +AGQVVGQ         Y       
Sbjct  88   AVAAVRPGQASDAATNQGIAVTQTSVPGGRIITEFVAGQVVGQ---------YSVADQAV  138

Query  431  MNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsa  610
               A +  IT+G+ALEA+A A G + VDR+D  AI+AAE+ A G++V  PGG+A  AQ+A
Sbjct  139  EQDATK--ITVGEALEATALAAGERPVDRTDVEAIRAAEMAAQGSDVTMPGGLADQAQAA  196

Query  611  aaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            A  N    RD DK+ +G+VL DAT KL  DK+A  EDA  V  A+  ++    +  GGV 
Sbjct  197  ARSNADADRDDDKITVGDVLTDATAKLAGDKVAGAEDAAKVVQAETYSDAAARTRAGGVG  256

Query  791  asvaaaaRLNE  823
            A+V+ AARLN+
Sbjct  257  AAVSTAARLNQ  267



>ref|XP_006826269.1| hypothetical protein AMTR_s00004p00042590 [Amborella trichopoda]
 gb|ERM93506.1| hypothetical protein AMTR_s00004p00042590 [Amborella trichopoda]
Length=238

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 149/257 (58%), Gaps = 42/257 (16%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaan-vnvraGLV  265
            +KYGD F VSG+ A++ +AP+DAAMMQSAE  VLG TQKGG AAA   +A   N   G V
Sbjct  10   IKYGDAFPVSGDHANQTVAPRDAAMMQSAEGLVLGLTQKGGAAAATMHSAADRNEAVGAV  69

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMP---------LPNYQAG  418
            + ++ S     QGVTV E ++P  R++ ES+ GQVV    +A+            + Q G
Sbjct  70   AHEEFSAVGEGQGVTVAEAELPDRRVVVESVGGQVVRLFAQALSQGVGQLRERTGDVQGG  129

Query  419  GGINMNSA-LQAG-ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVa  592
            G +   +  L  G +TIG+ALEA+    G+K V++SDA+AI+ AE+RA+G          
Sbjct  130  GELRQGAGDLGEGKLTIGEALEATGLTAGHKVVEQSDASAIEEAEMRASG----------  179

Query  593  ataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSS  772
                                + G   A AT+KLPADK  T EDAE +A+A+ RNN  +++
Sbjct  180  --------------------RSGGRSAAATEKLPADKPVTWEDAERIAAAEMRNNPKLTT  219

Query  773  TPGGvaasvaaaaRLNE  823
             PGGVAASV AAAR+NE
Sbjct  220  HPGGVAASVDAAARINE  236



>ref|XP_002465829.1| hypothetical protein SORBIDRAFT_01g046490 [Sorghum bicolor]
 gb|EER92827.1| hypothetical protein SORBIDRAFT_01g046490 [Sorghum bicolor]
Length=283

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 165/254 (65%), Gaps = 9/254 (4%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            V+YGDVF  V+G LA+KP+APQDAA MQSAE  V GQT +GGPAAAMQ+AA  N R G V
Sbjct  23   VRYGDVFPAVAGGLAEKPVAPQDAATMQSAENLVFGQTLRGGPAAAMQSAATANERMGAV  82

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSV--------EAMPLPNYQAGG  421
              D  ++    QGVTV+ET VPG RI+TE +AGQ VGQ +                  G 
Sbjct  83   GHDQATDATAVQGVTVSETRVPGGRIVTEFVAGQAVGQYLARDDDAGGGGGGAGAGARGA  142

Query  422  GINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaata  601
                       +TIG+ALEA+A A G+  V+RSDAAAIQAAE RATG +   PGG+AA A
Sbjct  143  SAGGVGKDMTKVTIGEALEATALAAGDAPVERSDAAAIQAAEARATGLDANVPGGLAARA  202

Query  602  qsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPG  781
            QSAAA N    RD+DK  LG+VLA+A  +L ADK     DA GVA A+ RN  D ++ PG
Sbjct  203  QSAAAANAWASRDEDKATLGDVLANAATRLVADKPVESGDALGVAGAENRNRDDGTARPG  262

Query  782  GvaasvaaaaRLNE  823
            GVAAS+AAAARLN 
Sbjct  263  GVAASMAAAARLNR  276



>ref|XP_006656949.1| PREDICTED: late embryogenesis abundant protein D-34-like [Oryza 
brachyantha]
Length=273

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 142/230 (62%), Gaps = 19/230 (8%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG---QTQKGG---Paaamqaaanvnv  250
            +KYG VF V+GELAD+PIAP+DAA M+SAE +V G   Q + GG      AM+ AA  N 
Sbjct  26   IKYGHVFAVTGELADQPIAPRDAAAMRSAEDSVPGVLVQQEIGGGYSAGVAMETAAAYNQ  85

Query  251  raGLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQ-SVEAMPLPNYQAGGGI  427
              G V P   S+ A  QG+ VT+T VPG RIITE +AGQVVGQ SV   P+    +    
Sbjct  86   AVGAVRPGQASDAATNQGIAVTQTAVPGGRIITEFVAGQVVGQYSVADQPVEQDASK---  142

Query  428  NMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqs  607
                     IT+G+ALEA+A A  N+ VDR+D  AI+AAE+ A  ++V  PGG+   AQ+
Sbjct  143  ---------ITVGEALEATALAADNRPVDRTDVEAIRAAEMMAQESDVTMPGGLTDQAQA  193

Query  608  aaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNN  757
            AA  N    RD DK+ +G +L DAT KL  DK+A  EDA  VA A++ N+
Sbjct  194  AARANAVAERDDDKITVGELLTDATAKLAGDKVAGMEDAARVAQAEKYND  243



>ref|XP_003571800.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=267

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 161/248 (65%), Gaps = 16/248 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V+YGDVF V GELA  PIAPQDAA MQ+AE+AVLG+T K GPA+ MQ+AA  NVRAG V+
Sbjct  28   VRYGDVFAVHGELAGAPIAPQDAATMQAAESAVLGRTPKSGPASVMQSAAARNVRAGAVA  87

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              + +  A E GVTV+ET VPG RI TE +AGQ VGQ                +  ++L 
Sbjct  88   HGEATGAAAELGVTVSETRVPGGRIFTEFVAGQHVGQEF---------VSAAADEEASLA  138

Query  449  AG--ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
             G  IT+G+ALEA+A + G + V+ SDAAAI+AAE R  G    TP   +  A++ AA +
Sbjct  139  DGTKITMGEALEATAFSAGEEPVEASDAAAIEAAEARVNGA---TPAAGSLAARARAAAD  195

Query  623  EGLI--RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
               +  R++DK +L +VLADAT KL ADK   REDA  V  A+ R   D ++ PGGV AS
Sbjct  196  ANAVAEREEDKTRLRDVLADATVKLGADKEVEREDAARVVGAEVRGKPDATARPGGVGAS  255

Query  797  vaaaaRLN  820
            VAAAARLN
Sbjct  256  VAAAARLN  263



>ref|XP_009394613.1| PREDICTED: late embryogenesis abundant protein D-34-like [Musa 
acuminata subsp. malaccensis]
Length=280

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 160/247 (65%), Gaps = 8/247 (3%)
 Frame = +2

Query  92   KYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSP  271
            + GDV  V+G  A + I P+ A MM SAE  VLG+T   GPA+ M++AA  N + G+VS 
Sbjct  37   RCGDVLPVAGGHAGEAITPRAADMMPSAENRVLGRTPNDGPASGMESAATRNKQRGVVS-  95

Query  272  DDVSNPAGEQGVTVTETDVPGS---RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
                N  G Q V+VT+TD+PGS   R++T+ +AGQ VG+ V          GGG    + 
Sbjct  96   ----NAPGLQDVSVTQTDIPGSPGQRLVTKFVAGQAVGRYVIYRGEGGDDQGGGGCSVAM  151

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
                +TIG+ALEA+A   G+K V+ SDAAAIQAAE  ATG N + PGGVAA AQ+AAA N
Sbjct  152  WTDKVTIGEALEATATTAGDKTVEASDAAAIQAAEATATGVNAVMPGGVAAAAQAAAAAN  211

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
                R+ DK +LG V+ DA  +LP DK+ATR DAE V +A+ RNN D+ + PGGV AS+ 
Sbjct  212  ASRDRNDDKTRLGQVVKDAAIRLPVDKVATRRDAERVLAAEMRNNPDLLTYPGGVGASMV  271

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  272  AAARLNQ  278



>gb|KDO68693.1| hypothetical protein CISIN_1g027886mg [Citrus sinensis]
Length=217

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 150/222 (68%), Gaps = 9/222 (4%)
 Frame = +2

Query  164  MQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSPDDVSNPAGEQGVTVTETDVP-GSR  340
            MQ+AE   LG+TQ+GGPAA MQ+AA  N RAG  S    ++ A +QGVTV+E+ V  G+R
Sbjct  1    MQAAENMALGKTQRGGPAAVMQSAAEANERAGFTSHSTATHIARDQGVTVSESTVADGNR  60

Query  341  IITESIAGQVVGQSVEAMP-LPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDR  517
            IITE+I  QV+ Q   A P +P   +G  +  + +     TIG+ALEA+A + G+KAVD+
Sbjct  61   IITEAIGDQVLAQY--ATPEVPTRASGAALGRDQS-----TIGEALEATALSAGDKAVDQ  113

Query  518  SDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPA  697
             DAAAI AAE RA+ TN I PGG+ + AQSAA  NE      DK+ + +V  DAT KL  
Sbjct  114  RDAAAIYAAEARASATNEIKPGGIGSRAQSAATQNERTTFFSDKITISDVSGDATTKLSD  173

Query  698  DKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            DK  TREDAEG+ S + RN  DM +TPGGVA+S+AAAARLN+
Sbjct  174  DKPVTREDAEGIISPEIRNKPDMRTTPGGVASSMAAAARLNQ  215



>gb|AFW67486.1| hypothetical protein ZEAMMB73_891670 [Zea mays]
Length=178

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VK+GDV  VSGEL D+P+AP+DAA +Q+AE +V G TQKGGPAA +Q+ A VN RAG V 
Sbjct  8    VKFGDVLDVSGELDDQPVAPRDAARLQAAEQSVPGGTQKGGPAAVLQSVATVNARAGHVG  67

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
                + P  + G T+TET++ G R++TES+ GQVVG+ V   P+      G +  ++   
Sbjct  68   RAQTACPVADAGATITETELAGRRVVTESVGGQVVGKMVTPAPVAMTDPPGALEKDA---  124

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGV  589
              +TIG+ALEA    +G++ V++SDAAA+Q AE+ ATG++   PGG+
Sbjct  125  --VTIGRALEAVGAMVGDRPVEQSDAAAVQVAELCATGSDSTVPGGL  169



>ref|XP_007034769.1| Late embryogenesis abundant protein D-34 isoform 2 [Theobroma 
cacao]
 gb|EOY05695.1| Late embryogenesis abundant protein D-34 isoform 2 [Theobroma 
cacao]
Length=187

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 115/152 (76%), Gaps = 6/152 (4%)
 Frame = +2

Query  368  VVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAE  547
            V+GQ V+A P+P  Q G         Q  ITIG+ALEA+AQ   +K VD+SDAAAIQAAE
Sbjct  38   VLGQYVQATPVPTTQIG------VIQQTAITIGEALEATAQTTRDKPVDQSDAAAIQAAE  91

Query  548  VRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAE  727
            VRATG+NVI PGG+AATAQSAAA N  + R+++K++L  VL  AT KLPADK  TR+D E
Sbjct  92   VRATGSNVIIPGGLAATAQSAAAQNASVNRNEEKIRLNEVLTGATAKLPADKAVTRQDDE  151

Query  728  GVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            GV SA+ RNN ++++ PGGVAAS+AAAARLNE
Sbjct  152  GVVSAELRNNPNVATRPGGVAASIAAAARLNE  183



>ref|XP_009774312.1| PREDICTED: late embryogenesis abundant protein D-34 [Nicotiana 
sylvestris]
Length=203

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 115/162 (71%), Gaps = 8/162 (5%)
 Frame = +2

Query  338  RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDR  517
            + + ESI GQV+GQ  +A PL +     G       +  ITIG+ALEA+A   GN+ VD 
Sbjct  30   KAVAESIGGQVLGQDKKA-PLSSESVSSG-------KTNITIGEALEATALTAGNRPVDY  81

Query  518  SDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPA  697
            SDAAAIQAAEVRATG   I PGGVAA AQSAA  N  + ++++K KL  +LADA+ KLPA
Sbjct  82   SDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARVTKEEEKTKLAEILADASAKLPA  141

Query  698  DKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            DK+ TR+DAEGV  A+ RN+ ++ + PGGVAAS+AAAARLN+
Sbjct  142  DKLVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  183



>ref|XP_008651207.1| PREDICTED: late embryogenesis abundant protein D-34-like [Zea 
mays]
 tpg|DAA43457.1| TPA: rab28 protein [Zea mays]
Length=291

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 168/261 (64%), Gaps = 17/261 (7%)
 Frame = +2

Query  89   VKYGDVF-GVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            V+YGDVF  VSG LA+KP+APQDAA MQSAE  V GQT KGGPAAAMQ+AA  N R G V
Sbjct  24   VRYGDVFPAVSGGLAEKPVAPQDAATMQSAENLVFGQTLKGGPAAAMQSAATANERMGAV  83

Query  266  SPDDVSNPAGEQGVTVTETDVPGS-RIITESIAGQVVGQSV---------------EAMP  397
              D  ++    QGVTV+ET VPG  RI+TE +AGQ VGQ +                A P
Sbjct  84   GHDQATDATAVQGVTVSETRVPGGGRIVTEFVAGQAVGQYLARDDDDGAAATAGGGIAGP  143

Query  398  LPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVIT  577
                  G    +       +TIG+ALEA+A A G+  V+RSDAAAIQAAE RATG +   
Sbjct  144  GAGAGGGASAGVAGKDITKVTIGEALEATALAAGDAPVERSDAAAIQAAEARATGLDANV  203

Query  578  PGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNN  757
            PGG+AA AQSAAA N     D+DK  LG+VLA+AT +L ADK     DA GVA A+ RN 
Sbjct  204  PGGLAAQAQSAAAANSWAWGDEDKATLGDVLANATARLVADKPVESADALGVAGAENRNR  263

Query  758  LDMSSTPGGvaasvaaaaRLN  820
             D ++ PGGVAAS+AAAARLN
Sbjct  264  NDGTARPGGVAASMAAAARLN  284



>gb|KDP23618.1| hypothetical protein JCGZ_23451 [Jatropha curcas]
Length=205

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 11/175 (6%)
 Frame = +2

Query  323  DVPGSRIITESIAGQ--VVGQ-----SVEAMPLPNYQAGGGINMNSALQAGITIGQALEA  481
            D P  R+I ESIAGQ  +  Q      ++++P       GG++       GITIG+ALEA
Sbjct  31   DKPEKRLIKESIAGQMQIAEQYSNRAQIQSLPTTITFPQGGVSGC----GGITIGEALEA  86

Query  482  SAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLG  661
            +A   G K V+ SDAAAIQAAEVRATG   I+PGGVAA AQSAA  N    RD+DK KL 
Sbjct  87   TALTAGQKPVEWSDAAAIQAAEVRATGRTTISPGGVAAAAQSAATLNARATRDEDKTKLA  146

Query  662  NVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNER  826
            ++LADAT KLPAD+ ATR+DAEGV  A+ RN+  +++ P GVAAS+AAAARLN++
Sbjct  147  DILADATSKLPADRPATRKDAEGVTGAEMRNDPYLTTHPAGVAASIAAAARLNQQ  201



>ref|XP_010679056.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=260

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 162/249 (65%), Gaps = 15/249 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGE-LADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            +KYGDVF VSG+ LA+KPI P+DAA M++ E  V+GQ     PA+ M+AAA +NV++G V
Sbjct  18   IKYGDVFYVSGQVLANKPILPEDAAAMEAGERTVMGQIPLCSPASVMEAAAAINVQSGSV  77

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSAL  445
            SP+  S P   +G+ V ETD+ G RI+TE++  +VVGQ VE    PN+    G+N+    
Sbjct  78   SPN--SGPIN-KGIQVVETDMNGIRIVTETVDDEVVGQYVE----PNFT---GVNLTPPA  127

Query  446  QA----GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
            Q      +TIG+ALEA A + G+ AVD +DAAAI+AAE RA GT+ +  G +A  A  AA
Sbjct  128  QTPERESVTIGEALEAVALSAGDHAVDSADAAAIEAAEKRALGTDTLPHGSLAEEAHHAA  187

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaa  793
            A+N  ++R + +  + ++L DA+ KLP D+  T EDA+ +  A+ +N+   + T GGV  
Sbjct  188  AWNAQILRCEIRTTMDDILRDASDKLPHDRPVTHEDAKAILEAEAQNDPANAITAGGVGE  247

Query  794  svaaaaRLN  820
             ++AAA LN
Sbjct  248  MMSAAASLN  256



>ref|XP_009597797.1| PREDICTED: late embryogenesis abundant protein D-34 [Nicotiana 
tomentosiformis]
Length=208

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = +2

Query  338  RIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDR  517
            + + ESI GQV+GQ  +A PL +     G       +  ITIG+ALEA+A   GN+ VD 
Sbjct  34   KAVAESIGGQVLGQDKKA-PLSSESVSSG-------KTNITIGEALEATALTAGNRPVDY  85

Query  518  SDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPA  697
            SDAAAIQAAEVRATG   I PGGVAA AQSAA  N  + ++++K KL  +LADA+ KLPA
Sbjct  86   SDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARVTKEEEKTKLAEILADASTKLPA  145

Query  698  DKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            DK  TR+DAEGV  A+ RN+ ++ + PGGVAAS+AAAARLN+
Sbjct  146  DKPVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  187



>ref|XP_002965692.1| hypothetical protein SELMODRAFT_84789 [Selaginella moellendorffii]
 gb|EFJ33112.1| hypothetical protein SELMODRAFT_84789 [Selaginella moellendorffii]
Length=248

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 150/246 (61%), Gaps = 11/246 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGD+F VSGE+  + I  +DA++MQSAET   GQTQK G A+ MQAAA+ NV+ G +S
Sbjct  5    VTYGDIFNVSGEMGKQAITSEDASLMQSAETQAFGQTQKHGAASLMQAAADHNVKTGALS  64

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P D  +P  + GVTV ET VPG+ I TE +A   V   V   PLP        N      
Sbjct  65   P-DAHSPVADIGVTVRETVVPGAAIDTEFVANVPVTGVVR--PLPTAPEVASAN------  115

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG+ALEA+A    ++ ++ SDA AIQ+AE RATG  V + GG+++TAQSAA  N  
Sbjct  116  -AVTIGEALEAAALGAIDQPIEHSDACAIQSAETRATGAPVTSKGGLSSTAQSAAELNP-  173

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             + D  K  +G++L DAT  L  DK+ T+EDA  V  A+ R+       PGGV A++  A
Sbjct  174  RVDDFAKTTIGDLLTDATTYLATDKVVTQEDAIKVIEAEARHTPTGLPRPGGVGAAMQTA  233

Query  809  aRLNER  826
            A LNER
Sbjct  234  ADLNER  239



>emb|CDP08585.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +2

Query  410  QAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGV  589
            Q  G I +   L++ ITIG+ALEA+    GNK VD SDAAAIQAAEVRATG   I PGGV
Sbjct  24   QQDGQIALPHELRSSITIGEALEAAVLTAGNKPVDYSDAAAIQAAEVRATGRTNIVPGGV  83

Query  590  aataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMS  769
            AA AQSAA  N  + RD+DK KL +VL++A  KLPADK  TR DAEGV  A+ RN+ +++
Sbjct  84   AAAAQSAATRNARVTRDEDKTKLADVLSEACTKLPADKPVTRRDAEGVIGAELRNDPNLT  143

Query  770  STPGGvaasvaaaaRLNE  823
            + PGGVAAS+AAAARLN+
Sbjct  144  TRPGGVAASLAAAARLNQ  161



>ref|XP_011082573.1| PREDICTED: late embryogenesis abundant protein D-34 [Sesamum 
indicum]
Length=197

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 132/193 (68%), Gaps = 11/193 (6%)
 Frame = +2

Query  257  GLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVG---QSVEAMPLPNYQAGGGI  427
            G+V   D+++   +QG TV+E D+ G R+ITE+I GQVVG   Q  E    P   +G   
Sbjct  12   GVVGHGDMTDIVMDQGATVSEADISGYRVITETIGGQVVGRYGQPTEDTKTPAPTSG---  68

Query  428  NMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqs  607
             M+      ITIG+ALEA+A + G+K +D SDAAAIQAAEVRATG   +  GG+AA AQS
Sbjct  69   EMDP-----ITIGEALEATALSAGDKPIDASDAAAIQAAEVRATGLGHVVHGGIAAEAQS  123

Query  608  aaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGv  787
            AAA N    RD+DK KL +VL DAT KL  DK  TREDAEGV SA+ RN  ++++ PGGV
Sbjct  124  AAARNVLTTRDEDKTKLADVLVDATAKLTVDKPVTREDAEGVISAEIRNKPELATHPGGV  183

Query  788  aasvaaaaRLNER  826
            AA+VAAAARLNE+
Sbjct  184  AAAVAAAARLNEQ  196



>ref|XP_010468377.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=124

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            VKYGDVF VSGELADKPIAP+DA MMQ+AET V G TQKGG AA MQ+AA  N R G V 
Sbjct  14   VKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVH  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPL  400
            P D ++ A E+GVTV +TDVPG+R+ TE + GQVVGQ VE  P+
Sbjct  74   PADTTDVAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPV  117



>emb|CDP08584.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +2

Query  410  QAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGV  589
            Q  G I +   L++ ITIG+ALEA+    GNK VD SDAAAIQAAEVRATG   I PGGV
Sbjct  37   QQDGQIALPHELRSSITIGEALEAAVLTAGNKPVDYSDAAAIQAAEVRATGRTNIVPGGV  96

Query  590  aataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMS  769
            AA AQSAA  N  + RD+DK KL +VL++A  KLPADK  TR DAEGV  A+ RN+ +++
Sbjct  97   AAAAQSAATRNARVTRDEDKTKLADVLSEACTKLPADKPVTRRDAEGVIGAELRNDPNLT  156

Query  770  STPGGvaasvaaaaRLNE  823
            + PGGVAAS+AAAARLN+
Sbjct  157  TRPGGVAASLAAAARLNQ  174



>ref|XP_010679057.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=260

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 163/247 (66%), Gaps = 8/247 (3%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSGE A+KPI P+DAA M+SAE  ++G +  GGPA+ M++AA+ NV+AGLV 
Sbjct  19   IKYGDVFYVSGEAAEKPILPEDAAAMKSAEEIIMGHSPLGGPASLMRSAADSNVQAGLVD  78

Query  269  PDDVSNPAGEQGVTVTETDVP--GSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
            P+  S  A E G+ VTE +    G+R++TES+  +VVGQ VE   +      G   +N  
Sbjct  79   PN--SRQATE-GIRVTEFEPKNHGTRVVTESVNDEVVGQYVEPKFVGVPPTEGATTVN--  133

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
             + G+TIG+ L+A A+  G++ +DR+DAAAI+AAE RA G ++    G+ A A  AA +N
Sbjct  134  -KGGVTIGETLDAVARCAGDQPIDRADAAAIEAAEKRAVGNDLPPGWGLGAEAHHAACWN  192

Query  623  EGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasva  802
                ++     + +VL DA+ KL  DKI TREDA+ V  A+ +N+ +M++T GGV   ++
Sbjct  193  ARAPQEGYMTTIDDVLKDASHKLVRDKIVTREDAKEVLEAEVKNDPEMATTIGGVGEMMS  252

Query  803  aaaRLNE  823
            AAARLN+
Sbjct  253  AAARLNQ  259



>ref|XP_002971638.1| hypothetical protein SELMODRAFT_172144 [Selaginella moellendorffii]
 gb|EFJ27387.1| hypothetical protein SELMODRAFT_172144 [Selaginella moellendorffii]
Length=253

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 149/247 (60%), Gaps = 11/247 (4%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGD+F VSGE+  + I  +DAA+MQSAET   GQTQK G A+ MQAAA+ NV+ G +S
Sbjct  10   VTYGDIFNVSGEMGKQAITSEDAALMQSAETQAFGQTQKHGAASLMQAAADHNVKTGALS  69

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D  +P  + GVTV ET VPG+ I TE +A   V   +   PLP        N      
Sbjct  70   A-DAHSPVADIGVTVRETVVPGAAIDTEFVANVPVTGVIR--PLPTAPEVASAN------  120

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG+ALEA+A    ++ ++ SDA AIQ+AE RATG  V + GG+++TAQSAA  N  
Sbjct  121  -AVTIGEALEAAALGAIDQPIEHSDACAIQSAETRATGAPVTSKGGLSSTAQSAAELNP-  178

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             + D  K  +G++L DAT  L  DK+ T+EDA  V  A+ R+       PGGV A++  A
Sbjct  179  RVDDFAKTTIGDLLTDATTYLATDKVVTQEDAIKVIEAEARHTPTGLPRPGGVGAAMQTA  238

Query  809  aRLNERG  829
            A LNER 
Sbjct  239  ADLNERA  245



>ref|XP_011091892.1| PREDICTED: late embryogenesis abundant protein D-34 [Sesamum 
indicum]
Length=227

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 113/165 (68%), Gaps = 4/165 (2%)
 Frame = +2

Query  341  IITESIAGQVVGQSVEAMPL----PNYQAGGGINMNSALQAGITIGQALEASAQALGNKA  508
            +I++S A  VV    E + +    P+ Q  G +      +  ITIG+ALEA+A   G++ 
Sbjct  41   LISQSNAHNVVANPTEIIGVQVVKPDSQTTGPLGSQPEQRGDITIGEALEATALTAGHRP  100

Query  509  VDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQK  688
            VD SDAAAIQAAEVRATG   I PGGVAA AQSAA  N  + RD+DK KLG +L+DA+ K
Sbjct  101  VDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRNARVPRDEDKTKLGEILSDASSK  160

Query  689  LPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            LP+DK  TR DAEGV  A+ RN+ ++ + PGGVAASVAAAARLN+
Sbjct  161  LPSDKPVTRRDAEGVIGAELRNDPNLCTRPGGVAASVAAAARLNQ  205



>ref|XP_010679062.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=254

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 148/264 (56%), Gaps = 45/264 (17%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF +SGE+A++PI+P+DAA M+SAE    G+T KGGPA+ M  AA  NV AG+V 
Sbjct  14   IKYGDVFEMSGEMAEQPISPRDAAAMRSAENRAFGKTIKGGPASIMLEAAKKNVEAGIVG  73

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P+        QG+                         VE  P    Q      M SAL 
Sbjct  74   PESDDAHTSHQGL-------------------------VEGNPWHESQPSHA-QMESALS  107

Query  449  ---------AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaata  601
                      G+T+G+ALEA+A+A+G+K VD SDAAAIQ AE+ ATGTN     G+ A A
Sbjct  108  VEGMGDIGATGVTMGEALEAAAEAVGDKPVDHSDAAAIQVAEMIATGTNAALGSGLGAEA  167

Query  602  qsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNN--------  757
            Q+AA  NE ++ D+DK KL +++  AT  L  DK  T+ DAE V +A+ R +        
Sbjct  168  QAAATVNEQMMYDEDKTKLSDIIGGATNSLTDDKPVTKWDAERVKAAELRGSAEGVIGSH  227

Query  758  --LDMSSTPGGvaasvaaaaRLNE  823
              +  S+TPGGVA +V  AAR+N+
Sbjct  228  RGVKQSTTPGGVAEAVETAARINQ  251



>gb|EPS67127.1| hypothetical protein M569_07649, partial [Genlisea aurea]
Length=140

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+A   G++ VD SDAAAIQAAEVRATG   I PGGVAA AQSAA  N  L 
Sbjct  4    ITIGEALEATALTAGHRPVDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRNARLP  63

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
            RD+DK KLG +L DA+ KLP+DK  TR DAEGV  A+ RN+ ++ + PGGVAAS+AAAAR
Sbjct  64   RDEDKTKLGEILTDASSKLPSDKPVTRRDAEGVIGAEVRNDPNLCTRPGGVAASLAAAAR  123

Query  815  LNE  823
            LN+
Sbjct  124  LNQ  126



>gb|AJA33581.1| late embryogenesis abundant protein LEA7-2 [Pinus tabuliformis]
Length=262

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 128/216 (59%), Gaps = 11/216 (5%)
 Frame = +2

Query  104  VFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSPDDVS  283
             F VS +L  +PI  +DAA+MQSAET   G++ KGG AA MQ+AA +N R GLV P   +
Sbjct  4    FFRVSYDLGKEPITVKDAALMQSAETRAAGRSLKGGAAAIMQSAAEINERLGLVDPKRET  63

Query  284  NPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITI  463
              A E G+ V ET +PG  + TE +AGQ V   ++ +             + A    +TI
Sbjct  64   IAAAE-GMAVIETQIPGQVVSTEFVAGQPVHSEIKPV---------STQHSVAATDAMTI  113

Query  464  GQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQ  643
            GQALEA+A   G K +D +DA AIQ+AE RATG  V   GG+AATAQ+AA  N   + D 
Sbjct  114  GQALEAAAMKEGEKPIDPNDARAIQSAEKRATGNPVTQKGGIAATAQAAAELNP-RVNDV  172

Query  644  DKVKLGNVLADATQKLPADKIATREDAEGVASAQQR  751
             K  L N+L  AT  LPADK  TREDAE +  A+ R
Sbjct  173  GKTTLSNILLAATTDLPADKAVTREDAEKIVEAEAR  208



>ref|XP_010041765.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
Length=209

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = +2

Query  368  VVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAE  547
            V+GQS+E        A GG    +  Q+ ITIG+ALEA+AQ+ G+K VD SDAAAI  AE
Sbjct  58   VIGQSLE-----GASATGGAETQATQQSAITIGEALEAAAQSAGDKPVDPSDAAAILVAE  112

Query  548  VRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAE  727
             R TG+NV+ PGG+A +AQ+AAAYN+G  RD+ K+++  VL  AT KLPAD+ A R DAE
Sbjct  113  RRVTGSNVVIPGGLADSAQTAAAYNKGTRRDEAKIRISEVLTGATLKLPADRAANRHDAE  172

Query  728  GVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
             V  A+ R     ++ PGGVAASVAAA RLNE
Sbjct  173  WVMDAELRTGGKKAAHPGGVAASVAAAVRLNE  204



>ref|XP_008369302.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=141

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 98/129 (76%), Gaps = 2/129 (2%)
 Frame = +2

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
            SA+Q  ITIG+ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA 
Sbjct  7    SAVQ--ITIGEALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAAT  64

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
             N    +D++K KL ++LA+AT KLPADK ATR DAEGV  A+ RN+  +++ P GVAAS
Sbjct  65   LNARATKDEEKTKLADILANATSKLPADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAAS  124

Query  797  vaaaaRLNE  823
            VAAAARLNE
Sbjct  125  VAAAARLNE  133



>gb|EYU45247.1| hypothetical protein MIMGU_mgv1a013828mg [Erythranthe guttata]
Length=209

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 98/148 (66%), Gaps = 14/148 (9%)
 Frame = +2

Query  347  TESIAGQVVGQSVEAM--PLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRS  520
            TE I  QV+ Q  +++  PL +++              ITIG+ALEA+A   G++ VD S
Sbjct  42   TEPIGLQVLKQESQSLSGPLGSHRGE------------ITIGEALEATALTAGHRPVDYS  89

Query  521  DAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPAD  700
            DAAAIQAAEVRATG   I PGGVAA AQSAA  N  L RD+DK KLG +L+DA+ KLP+D
Sbjct  90   DAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRNARLPRDEDKTKLGEILSDASSKLPSD  149

Query  701  KIATREDAEGVASAQQRNNLDMSSTPGG  784
            K  TR DAEGV  A+ RN+ ++ + PGG
Sbjct  150  KPVTRRDAEGVIGAELRNDPNLCTRPGG  177



>ref|XP_006347861.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=206

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 115/171 (67%), Gaps = 10/171 (6%)
 Frame = +2

Query  311  VTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQ  490
            V E+ +   + + ESI GQV G+  +   + +    G +N        ITIG+ALEA+  
Sbjct  27   VQESSLARKKAVAESIGGQVHGK--DRKQVSSESVSGRVN--------ITIGEALEATVV  76

Query  491  ALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVL  670
              G+K VD SDAAAIQAAEVRATG   I PGGVAA AQSAA  N  L ++++K KL  +L
Sbjct  77   TAGSKPVDYSDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARLTKEEEKTKLAEIL  136

Query  671  ADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            A+A+ KLP+DK  TR+DAEGV  A+ RN+ ++ + PGGVAAS+AAAARLN+
Sbjct  137  AEASSKLPSDKPVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  187



>ref|XP_010326383.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
lycopersicum]
Length=216

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 143/221 (65%), Gaps = 7/221 (3%)
 Frame = +2

Query  164  MQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSPDDVSNPAGEQGVTVTETDVPGSRI  343
            MQS E+  LG   +GGPA+ MQ+AA+ N R G+V   D  + A E+GVTV++ +V G+R+
Sbjct  1    MQSVESVALGHVPRGGPASLMQSAASQNERMGVV---DTKDFATERGVTVSQVEVGGTRL  57

Query  344  ITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASA-QALGNKAVDRS  520
            ++ES+ G+VV Q +      + +           +  +T+G+ALEA A +  GNK +++S
Sbjct  58   VSESVGGEVVAQYIYPSGAADEERSTRYPTTGVQEDAVTVGEALEAVALKPEGNKPIEQS  117

Query  521  DAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPAD  700
            DAAAIQAAE RATG + + PGGV A AQ AA+ N    +  DK  L +VL DAT KL  D
Sbjct  118  DAAAIQAAEARATGRSEVVPGGVGAEAQCAASIN---AQTDDKTTLRDVLKDATSKLIED  174

Query  701  KIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K A REDAEGV  A+ RN LD+++ PGGVAAS+  A+ LNE
Sbjct  175  KAAKREDAEGVVGAEIRNTLDLATHPGGVAASITTASDLNE  215



>ref|XP_004230131.1| PREDICTED: late embryogenesis abundant protein D-34 [Solanum 
lycopersicum]
Length=200

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = +2

Query  311  VTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQ  490
            V E+ +   + + ESI GQV G+  + +   +             +A ITIG+ALEA+  
Sbjct  21   VQESSLARKKAVAESIGGQVHGKDRKQVSSESVSG----------RANITIGEALEATVV  70

Query  491  ALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVL  670
              G++ VD SDAAAIQAAEVRATG   I PGGVAA AQSAA  N  L ++++K KL  +L
Sbjct  71   TAGSRPVDYSDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARLTKEEEKTKLAEIL  130

Query  671  ADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            A+A+ KLP+DK  TR+DAEGV  A+ RN+ ++ + PGGVAAS+AAAARLN+
Sbjct  131  AEASSKLPSDKPVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  181



>gb|AIA57965.1| late embryogenesis abundant protein 6, partial [Jatropha curcas]
Length=143

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +2

Query  452  GITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGL  631
             +TIG+ALEA++ + G K V++SDAAAIQAAEVRATG N + PGG+ A AQSAA  N  L
Sbjct  17   AVTIGEALEATSLSAGEKPVEQSDAAAIQAAEVRATGINEVLPGGIGAEAQSAATRNRAL  76

Query  632  IRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaa  811
              D+D++ L  VL DA+ KLPADK  TREDA+ V  A+ RN  DM +TPGGV AS+AAAA
Sbjct  77   -SDRDRITLSEVLEDASLKLPADKAVTREDADRVIQAEVRNRPDMHATPGGVTASMAAAA  135

Query  812  RLN  820
            R+N
Sbjct  136  RMN  138



>ref|XP_008338157.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=147

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 92/128 (72%), Gaps = 2/128 (2%)
 Frame = +2

Query  440  ALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaY  619
            A Q  ITIG+A EA AQ  G++ +D+SDAA IQAA VR TG+NVI+PG +   AQ AAAY
Sbjct  18   AQQNSITIGEAREALAQTAGDRPIDQSDAAVIQAAXVRVTGSNVISPGWLVTMAQGAAAY  77

Query  620  NEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasv  799
            N G  R+QDK+KL ++L+ A  KLP+DK ATR+D E + SA+ R N  M + PGG  ASV
Sbjct  78   NAGTEREQDKIKLTDILSGAAAKLPSDKAATRQDGEVIVSAELRKN--MGTRPGGAVASV  135

Query  800  aaaaRLNE  823
             AAA+LNE
Sbjct  136  MAAAKLNE  143



>ref|XP_003575514.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=278

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 135/224 (60%), Gaps = 13/224 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAV----LGQTQKGGPaaamqaaanvnvra  256
            ++YG VF V+G+LA +PIAP+DAA M+SAE +V             A AM+ AA  N   
Sbjct  31   IQYGHVFAVTGDLAVQPIAPRDAAAMRSAEESVQGGAHAGGGGFRAATAMETAAAYNQAV  90

Query  257  GLVSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQ-SVEAMPLPNYQAGGGINM  433
            G V P   S+ A  QG+ VT+T VPG  ++TE +AGQVVGQ SV   P+        +  
Sbjct  91   GAVRPGQASHAAYGQGIAVTQTPVPGGCVVTEFVAGQVVGQYSVADQPM--------VME  142

Query  434  NSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaa  613
                 + +TIG+A+EA+A + G++ VD +DA AI+AAE +A G     PGG+A  AQ+AA
Sbjct  143  EEDASSKVTIGEAMEAAALSAGDRPVDEADAQAIRAAEAQAQGAGKTMPGGLADQAQAAA  202

Query  614  aYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQ  745
              N     D+DK+ +G+VL+DAT KL  D+ A REDA  V  A+
Sbjct  203  RANLRAQSDRDKIMVGDVLSDATTKLAGDRAAGREDAARVVEAE  246



>ref|NP_171811.1| responsive to abscisic acid 28 [Arabidopsis thaliana]
 gb|AAD25796.1|AC006550_4 Similar to rab28 protein gb|X59138 from Zea mays. EST gb|AA042774 
comes from this gene [Arabidopsis thaliana]
 gb|AEE27533.1| responsive to abscisic acid 28 [Arabidopsis thaliana]
Length=182

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALEA+A +LG+K VDR DAAAIQAAE RATG +   PGG+A  AQ+AA  NE  +
Sbjct  58   VTIGEALEATALSLGDKPVDRRDAAAIQAAETRATGESKGRPGGLAVAAQAAATTNEQTV  117

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++DKV + ++L DA ++LP DK+ T EDAE V  A+ R++ +M +TPGGVA S++A AR
Sbjct  118  SEEDKVNIADILTDAAERLPGDKVVTSEDAEAVVGAELRSSSEMKTTPGGVADSMSAGAR  177

Query  815  LNER  826
            LN++
Sbjct  178  LNQQ  181



>ref|WP_033581568.1| hypothetical protein, partial [Dickeya zeae]
Length=116

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  488  QALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNV  667
            Q  GNK VD+SDAAAIQAAEVRA+GT+ I PGG+AA+AQSAA +N  + RD++K+KL +V
Sbjct  2    QTAGNKPVDQSDAAAIQAAEVRASGTSGIAPGGIAASAQSAAIHNATVDRDEEKIKLVDV  61

Query  668  LADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNER  826
            LA AT KL ADK  TR+DAEGV SA+ RNN ++++ PGGVAASV AAARLNE+
Sbjct  62   LAGATGKLRADKAVTRQDAEGVVSAELRNNPNLTTHPGGVAASVTAAARLNEK  114



>gb|EEE65653.1| hypothetical protein OsJ_21239 [Oryza sativa Japonica Group]
Length=263

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 107/245 (44%), Positives = 142/245 (58%), Gaps = 19/245 (8%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYG VF V+GELA +PIAP+DAA M+SAE + +G     G   AM+ AA  N     V 
Sbjct  28   IKYGHVFAVTGELAGQPIAPRDAAAMRSAEESDIGGGYSAG--VAMETAAAYNQAVAAVR  85

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
            P   S+ A  QG+ VT+T VPG RIITE +AGQVVGQ         Y          A +
Sbjct  86   PGQASDAATNQGIAVTQTSVPGGRIITEFVAGQVVGQ---------YSVADQAVEQDATK  136

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              IT+G+ALEA+A A G + VDR+D  AI+AAE+ A G++V  PGG+A   Q+AA     
Sbjct  137  --ITVGEALEATALAAGERPVDRTDVEAIRAAEMAAQGSDVTMPGGLADQGQAAARSK--  192

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
                 D  +  + + DAT KL  DK+A  EDA  V  A+  ++    +  GGV A+V+ A
Sbjct  193  ----ADADRDDDKITDATAKLAGDKVAGAEDAAKVVQAETYSDAAARTRAGGVGAAVSTA  248

Query  809  aRLNE  823
            ARLN+
Sbjct  249  ARLNQ  253



>ref|XP_001781683.1| predicted protein [Physcomitrella patens]
 gb|EDQ53496.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 143/247 (58%), Gaps = 12/247 (5%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + YG++FG  G+L    + P+DAA+MQSAE    GQTQK G A+ MQAAA +NV+AG V 
Sbjct  12   ITYGNIFGAVGKLGSDSVLPEDAALMQSAEARTFGQTQKDGAASVMQAAAELNVKAGFVE  71

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
             D  S    E+GV   E  VPG+ I  E IAGQ V  +V+  P+  +            Q
Sbjct  72   KDAHSQ-VAEKGVMAQEILVPGAEIDVEYIAGQPVIANVKPTPVDPFLVA---------Q  121

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEG  628
              +TIG ALEA+A   G + V+ SDA AIQ+A  RATG    T G +AA A SAA  N  
Sbjct  122  DAVTIGDALEAAAVGSGQRPVEDSDARAIQSAVARATGAPP-TAGSLAAAAMSAAELNP-  179

Query  629  LIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaa  808
             + + DK  L ++L DAT  L ADK  T+EDA  V  A+ R +      PGGVAA++ AA
Sbjct  180  RVPNADKTTLADILMDATIDLEADKTVTQEDAAKVLDAEMRGSPTGEPLPGGVAAAMQAA  239

Query  809  aRLNERG  829
            A +NER 
Sbjct  240  ADINERA  246



>ref|XP_009119571.1| PREDICTED: late embryogenesis abundant protein D-34 [Brassica 
rapa]
 emb|CDX89910.1| BnaA10g01720D [Brassica napus]
Length=177

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALE +A +LG+K VDR DAAAIQAAE RATG +   PGG+A  AQ AAA NE   
Sbjct  53   VTIGEALEVTALSLGDKPVDRKDAAAIQAAETRATGDSKTRPGGLAEAAQEAAATNERTA  112

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++ KV + ++L DAT+KLP DK+ T EDAE V  A+ RN+ +M +TPGGVA S++A AR
Sbjct  113  LEEAKVTIADILTDATEKLPGDKVVTSEDAEAVVGAELRNSPEMKTTPGGVADSMSAGAR  172

Query  815  LNE  823
            LN+
Sbjct  173  LNQ  175



>gb|KFK42672.1| hypothetical protein AALP_AA1G024900 [Arabis alpina]
Length=170

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALEA+A + G+K VDR DAAAIQAAE RATG     PGG+AA AQ AAA NE  +
Sbjct  46   VTIGEALEATALSFGDKPVDRQDAAAIQAAETRATGEFKTCPGGLAAAAQLAAATNERTV  105

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++ KV + ++L DA++KLP DK+ T EDAE V  A+ +N+ +M +TPGGVA S++A AR
Sbjct  106  LEEGKVTIADILTDASEKLPGDKVVTSEDAEAVVGAELKNSPEMKTTPGGVADSMSAGAR  165

Query  815  LNER  826
            LN++
Sbjct  166  LNQQ  169



>ref|XP_010045839.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
Length=208

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 115/188 (61%), Gaps = 15/188 (8%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF VSG+LA KPIAPQDAAM+QSAE AVLGQ Q+GGPA  M+AAA  N RAGLVS
Sbjct  26   IKYGDVFSVSGDLASKPIAPQDAAMLQSAEAAVLGQPQRGGPADTMRAAAAWNERAGLVS  85

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQ--VVGQSVEAMP---LPNYQAGGGINM  433
              DV++ AG++G+TV        R ITE +AGQ  V G +V  +P     + Q     N 
Sbjct  86   RGDVTDVAGKEGLTV-------ERTITERVAGQRRVTGSNV-VIPGGLADSAQTAAAYNK  137

Query  434  NSAL-QAGITIGQALEASAQAL-GNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqs  607
             +   +A I I + L  +   L  ++A +R DA  +  AE+R  G     PGGVAA+  +
Sbjct  138  GTRRDEAKIRISEVLTGATLKLPADRAANRHDAEWVMDAELRTGGKKAAHPGGVAASVAA  197

Query  608  aaaYNEGL  631
            A   NEG+
Sbjct  198  AVRLNEGV  205


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  539  AAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATRE  718
            A + R TG+NV+ PGG+A +AQ+AAAYN+G  RD+ K+++  VL  AT KLPAD+ A R 
Sbjct  109  AGQRRVTGSNVVIPGGLADSAQTAAAYNKGTRRDEAKIRISEVLTGATLKLPADRAANRH  168

Query  719  DAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            DAE V  A+ R     ++ PGGVAASVAAA RLNE
Sbjct  169  DAEWVMDAELRTGGKKAAHPGGVAASVAAAVRLNE  203



>ref|XP_008374066.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=130

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 93/125 (74%), Gaps = 8/125 (6%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEASA   GNK +++SDAAAIQAAE+RATG N I PGGVAA AQ AA+ N    
Sbjct  13   ITIGEALEASALTAGNKPIEQSDAAAIQAAEMRATGPNEIAPGGVAAVAQYAASVNP---  69

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
            RD +K KL     DAT+KLPADK  TREDA+ V  A+ RN+ +M++TPGGV  S+AAAA 
Sbjct  70   RDVNKTKL-----DATEKLPADKPVTREDAKAVIGAEIRNSPNMATTPGGVVESLAAAAG  124

Query  815  LNERG  829
            LN+ G
Sbjct  125  LNQNG  129



>ref|XP_010481583.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
 ref|XP_010481591.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=182

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALEA+A +LG+K VDR DAAAIQAAE RA+G     PGG+AA AQ+AAA NE  +
Sbjct  58   VTIGEALEATALSLGDKPVDRKDAAAIQAAETRASGEFKTRPGGLAAAAQAAAAANEQTV  117

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++DKV + ++L DA ++LP DK+ T EDA+ V  A+ R++ +M +TPGGVA S++A AR
Sbjct  118  SEEDKVTIEDILTDAAERLPGDKVVTSEDADAVVGAELRSSSEMKTTPGGVADSMSAGAR  177

Query  815  LNER  826
            LN+ 
Sbjct  178  LNQH  181



>ref|XP_004304719.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  467  QALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQD  646
            +ALEA+A   G K V+ SDAAAIQAAEVRATG   I PGGVAA AQSAA  N    RD+D
Sbjct  131  EALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARATRDED  190

Query  647  KVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K KL ++LADAT KLPADK ATR DAEGV  A+ RN+  +++ P GVAASVAAAARLN+
Sbjct  191  KTKLADILADATSKLPADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASVAAAARLNQ  249



>ref|XP_010474918.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=182

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALEA+A +LG+K V R DAAAIQAAE RATG     PGG+AA AQ+AAA NE  +
Sbjct  58   VTIGEALEATALSLGDKPVGRKDAAAIQAAETRATGEFKTRPGGLAAAAQAAAASNEQTV  117

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++DKV + ++L DA ++LP DK+ T EDAE V  A+ R++ +M +TPGGVA S++A AR
Sbjct  118  SEEDKVTIEDILTDAAERLPGDKVVTSEDAEAVVGAELRSSSEMKTTPGGVADSMSAGAR  177

Query  815  LNER  826
            LN+ 
Sbjct  178  LNQH  181



>gb|ABF98858.1| Seed maturation protein [Oryza sativa Japonica Group]
 gb|EAY91850.1| hypothetical protein OsI_13495 [Oryza sativa Indica Group]
Length=211

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 116/191 (61%), Gaps = 17/191 (9%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            V YGDVF VSGELA +P+AP+DAA +QSAE AVLG+ QKGGPAAAMQ+AA +N RAG V 
Sbjct  19   VMYGDVFDVSGELAGQPVAPRDAAKLQSAEEAVLGEAQKGGPAAAMQSAAAINARAGHVG  78

Query  269  PDDVSNPAGEQG--VTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
               V+    ++G  V V ET++PG R++TES+AGQVV +      +   Q  G ++ ++ 
Sbjct  79   RAQVTGAIADEGVAVAVAETELPGRRVVTESVAGQVVARLATPPRVVATQPSGSLDKDA-  137

Query  443  LQAGITIGQALE----------ASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVa  592
                +TIG+ALE          A  +   +KA  R DA  + +AEVR       TPGGVA
Sbjct  138  ----VTIGRALEWRPRPPRRRGARGKLPADKAATREDAERVPSAEVRNRPDMATTPGGVA  193

Query  593  ataqsaaaYNE  625
                +AA  N+
Sbjct  194  DAVTAAARLNQ  204


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 46/71 (65%), Gaps = 9/71 (13%)
 Frame = +2

Query  638  DQDKVKLGNVL---------ADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGva  790
            D+D V +G  L           A  KLPADK ATREDAE V SA+ RN  DM++TPGGVA
Sbjct  134  DKDAVTIGRALEWRPRPPRRRGARGKLPADKAATREDAERVPSAEVRNRPDMATTPGGVA  193

Query  791  asvaaaaRLNE  823
             +V AAARLN+
Sbjct  194  DAVTAAARLNQ  204



>gb|AIA57964.1| late embryogenesis abundant protein 4 [Jatropha curcas]
Length=148

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            +KYGDVF V+G+LA +PIAP+DA MMQSAET V GQTQKGG AA+MQAAA VN R+GLV 
Sbjct  33   IKYGDVFNVTGDLAKEPIAPEDANMMQSAETRVFGQTQKGGAAASMQAAATVNERSGLVG  92

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQV  370
              + ++ A E+GVTV E DVPG+RI+TE +AGQV
Sbjct  93   HREATDAASERGVTVMEADVPGARIVTERVAGQV  126



>gb|KFK26460.1| hypothetical protein AALP_AA8G252100 [Arabis alpina]
Length=181

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 111/174 (64%), Gaps = 14/174 (8%)
 Frame = +2

Query  323  DVPGSRIITESIAGQVVGQSVEAMPLPN-YQAGGGINMNSAL----QAG--ITIGQALEA  481
            DV G   +TE     VV       P P+  QA G +N    +     AG  ITIG+ALEA
Sbjct  13   DVKGEAQVTEDKEKNVV-------PEPSAEQAEGQLNRKKVVANPPDAGGSITIGEALEA  65

Query  482  SAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLG  661
            +    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N  +  D +K  L 
Sbjct  66   AVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVTSDDEKTTLA  125

Query  662  NVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  126  DVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  179



>ref|XP_006394999.1| hypothetical protein EUTSA_v10004958mg [Eutrema salsugineum]
 gb|ESQ32285.1| hypothetical protein EUTSA_v10004958mg [Eutrema salsugineum]
Length=191

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 109/179 (61%), Gaps = 11/179 (6%)
 Frame = +2

Query  287  PAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIG  466
            PA E G+   E    G  ++ E   GQ  G+  +   + N  A  G          ITIG
Sbjct  22   PATEGGINAAEVKDKG--VVAEVSGGQAEGELNQKKVVGNPPASEGC---------ITIG  70

Query  467  QALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQD  646
            +ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N     D D
Sbjct  71   EALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARATSDDD  130

Query  647  KVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K  L  VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  131  KTTLAEVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  189



>ref|XP_006289560.1| hypothetical protein CARUB_v10003106mg [Capsella rubella]
 gb|EOA22458.1| hypothetical protein CARUB_v10003106mg [Capsella rubella]
Length=193

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N  + 
Sbjct  69   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVT  128

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             + DK  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  129  SEDDKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  188

Query  815  LNE  823
            +N+
Sbjct  189  INQ  191



>ref|XP_010474927.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=182

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALEA+A +LG+K V+R DAAAIQAAE RATG     PGG+AA AQ+AA  NE  +
Sbjct  58   VTIGEALEATALSLGDKPVNRKDAAAIQAAESRATGEFKTRPGGLAAAAQAAAVANEQTV  117

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++DKV + ++L DA  +LP DK+ T EDAE V  A+ R++ +M +TPGGVA S++A AR
Sbjct  118  LEEDKVTIEDILTDAAGRLPGDKVVTSEDAEAVVGAELRSSSEMKTTPGGVADSMSAGAR  177

Query  815  LNER  826
            LN+ 
Sbjct  178  LNQH  181



>ref|XP_010455160.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=189

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  437  SALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaa  616
            SA +  ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA 
Sbjct  59   SASEGTITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAAT  118

Query  617  YNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaas  796
             N  +  + +K  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAAS
Sbjct  119  LNSRVTSEDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAAS  178

Query  797  vaaaaRLNE  823
            VAAAAR+N+
Sbjct  179  VAAAARINQ  187



>gb|EMT23291.1| hypothetical protein F775_14150 [Aegilops tauschii]
Length=191

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 106/181 (59%), Gaps = 15/181 (8%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLG--QTQKGGPaaamqaaanvnvraGL  262
            +KYGDVF VSGELA +P+AP+DAAM+QSAE  VLG  QTQKGGPAA MQ+AA +N RAG 
Sbjct  21   IKYGDVFDVSGELAAQPVAPRDAAMLQSAENEVLGLGQTQKGGPAAVMQSAATLNARAGH  80

Query  263  VSPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSA  442
            V    ++ P  + GVTVTE D+PG R+ITES+AGQ      E       +    + +   
Sbjct  81   VGRGQLTGPVADAGVTVTEADLPGRRVITESVAGQAAADQNERAAREEDK----VKLRDV  136

Query  443  LQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN  622
            L          +A ++   +K   R DA  + +AE+R       TPGGVA    +AA  N
Sbjct  137  LS---------DARSKLPADKGATREDAERVVSAEMRNKLDLTTTPGGVAEAVTTAARLN  187

Query  623  E  625
            +
Sbjct  188  Q  188


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  620  NEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasv  799
            NE   R++DKVKL +VL+DA  KLPADK ATREDAE V SA+ RN LD+++TPGGVA +V
Sbjct  121  NERAAREEDKVKLRDVLSDARSKLPADKGATREDAERVVSAEMRNKLDLTTTPGGVAEAV  180

Query  800  aaaaRLNE  823
              AARLN+
Sbjct  181  TTAARLNQ  188



>ref|XP_006305695.1| hypothetical protein CARUB_v10010425mg [Capsella rubella]
 gb|EOA38593.1| hypothetical protein CARUB_v10010425mg [Capsella rubella]
Length=178

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALEA+A +LG+K VDR DAAAIQAAE RATG +   PGG+AA AQ+AAA NE  +
Sbjct  54   VTIGEALEATALSLGDKPVDRKDAAAIQAAETRATGESDTRPGGLAAAAQAAAATNEQAL  113

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++ KV + ++L DA +KL  DK+ T EDAE V  A+ R++ +M +TPGGVA S++A AR
Sbjct  114  SEEGKVTIADILTDAAEKLRGDKVVTSEDAEAVVGAELRSSPEMKTTPGGVADSMSAGAR  173

Query  815  LNE  823
            LN+
Sbjct  174  LNQ  176



>emb|CDY18152.1| BnaC05g01750D [Brassica napus]
Length=177

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            +TIG+ALE +A +LG+K VDR DAAAIQAAE RATG +   PGG+A  AQ AAA NE   
Sbjct  53   VTIGEALEVTALSLGDKPVDRKDAAAIQAAETRATGDSKTRPGGLAEAAQEAAATNERTA  112

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             ++ KV + ++L DAT+KL  DK+ T EDAE V  A+ +N+ +M +TPGGVA S++A AR
Sbjct  113  LEEAKVTIADILTDATEKLQGDKVVTSEDAEAVVGAELKNSPEMKTTPGGVADSMSAGAR  172

Query  815  LNE  823
            LN+
Sbjct  173  LNQ  175



>ref|XP_010249416.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=194

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+A   G+K V++SDAAA+QA EVRATG NV   GGV A AQ A   NE  +
Sbjct  70   ITIGEALEATAMVAGDKPVNQSDAAAVQAVEVRATGLNVNITGGVGAEAQFAVNVNEQAM  129

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
            RD+DKV LG+V+ DAT KL  +K ATR DAE V   + R N ++S+ P GVAA+V  AAR
Sbjct  130  RDEDKVTLGDVITDATAKLVRNKPATRRDAERVVGVELRINSNVSTHPRGVAAAVTEAAR  189

Query  815  LNE  823
            LN+
Sbjct  190  LNQ  192



>ref|XP_008450758.1| PREDICTED: late embryogenesis abundant protein D-34 [Cucumis 
melo]
Length=161

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +2

Query  470  ALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDK  649
            ALEA+A A+G K V+ SDAAAIQAAEVRATG   I PGG+AATAQSAA  N  + +D+DK
Sbjct  38   ALEATALAVGEKPVEWSDAAAIQAAEVRATGRMNIAPGGIAATAQSAATMNARITQDEDK  97

Query  650  VKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
             KL +VL DA  +L AD+ ATR DAEGVA A+ RN+  +++ P GVAAS+AAAARLN+
Sbjct  98   TKLADVLKDARSRLSADRPATRRDAEGVAGAEMRNDPSLTTHPTGVAASIAAAARLNQ  155



>ref|XP_001773842.1| predicted protein [Physcomitrella patens]
 gb|EDQ61332.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 140/246 (57%), Gaps = 14/246 (6%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQSAETAVLGQTQKGGPaaamqaaanvnvraGLVS  268
            + Y D+ G  G+L   P+ P+DAA+MQSAET   G+TQK G A+ MQAAA  NV+AG V 
Sbjct  15   ITYRDIVGAEGKLGSDPVTPEDAALMQSAETRTYGKTQKDGAASVMQAAAEENVKAGFVQ  74

Query  269  PDDVSNPAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQ  448
              D S    E+GV   +  +PG+ +  E IAGQ V  +V+  P  ++ A           
Sbjct  75   KSDHSQ-VAEEGVAAQKILLPGAAVGMEYIAGQPVMVAVKPTPTDSFFATAD--------  125

Query  449  AGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYN-E  625
              +TIG ALEA+A    ++ V  +DA AIQ+A +RATG     P      A + +A +  
Sbjct  126  -AVTIGDALEAAAVGASDRPVGENDARAIQSAVMRATGA---PPRAGGVAAAAMSAADLN  181

Query  626  GLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaa  805
              +   DK  L ++L DAT  + ADK+AT+EDA  V +A+ R   +   TPGGVAA++ A
Sbjct  182  PRVPSADKTTLADLLVDATITMEADKVATQEDAAKVLAAEMRAPHEGEVTPGGVAAAIQA  241

Query  806  aaRLNE  823
            AA +NE
Sbjct  242  AADMNE  247



>ref|XP_010421659.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=189

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N  + 
Sbjct  65   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNSRVT  124

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             + +K  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  125  SEDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  184

Query  815  LNE  823
            +N+
Sbjct  185  INQ  187



>ref|XP_010494063.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
 ref|XP_010494064.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=189

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N  + 
Sbjct  65   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNSRVT  124

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             + +K  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  125  SEDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  184

Query  815  LNE  823
            +N+
Sbjct  185  INQ  187



>ref|XP_010674900.1| PREDICTED: late embryogenesis abundant protein D-34 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  425  INMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataq  604
            +N      + ITIG+AL+A+    G KAVDRSDAAAIQAAEVRATG   I PGG+AATAQ
Sbjct  83   VNATGQKHSPITIGEALQATVLTAGQKAVDRSDAAAIQAAEVRATGQTNIMPGGLAATAQ  142

Query  605  saaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGG  784
            SAA  N      + K+ L +VL+DA  KLP D+  TR+DAEGV  A+ RNN ++S+ PGG
Sbjct  143  SAAQINARSTTSK-KITLADVLSDAASKLPKDRPVTRQDAEGVLGAEFRNNPNISTYPGG  201

Query  785  vaasvaaaaRLNE  823
            VAASV  AAR+N+
Sbjct  202  VAASVVEAARMNQ  214



>emb|CDX86185.1| BnaA06g29020D [Brassica napus]
Length=191

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 105/161 (65%), Gaps = 9/161 (6%)
 Frame = +2

Query  341  IITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRS  520
            ++TE+  GQ  G+  +   + N  A  G          ITIG+ALEA+    GNK V+ S
Sbjct  38   VVTEASGGQAEGEVNQKNVVANPPASEGT---------ITIGEALEAAVLTAGNKPVEWS  88

Query  521  DAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPAD  700
            DAAAIQAAEVRATG   I PGGVAA+AQSAA  N     D++K  L +VL  A  KLP+D
Sbjct  89   DAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARANSDEEKTTLADVLTGARGKLPSD  148

Query  701  KIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  149  KPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  189



>emb|CDX80679.1| BnaC07g27650D [Brassica napus]
Length=191

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 105/161 (65%), Gaps = 9/161 (6%)
 Frame = +2

Query  341  IITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRS  520
            ++TE+  GQ  G+  +   + N  A  G          ITIG+ALEA+    GNK V+ S
Sbjct  38   VVTEASGGQAEGEVNQKNVVANPPASEGT---------ITIGEALEAAVLTAGNKPVEWS  88

Query  521  DAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPAD  700
            DAAAIQAAEVRATG   I PGGVAA+AQSAA  N  +  D +K  L +VL  A  KLP+D
Sbjct  89   DAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVNSDDEKTTLADVLTGARGKLPSD  148

Query  701  KIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  149  KPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  189



>emb|CDY50578.1| BnaC02g39520D [Brassica napus]
Length=184

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N    
Sbjct  60   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGKTNIMPGGVAASAQSAATLNARAN  119

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             + DK  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  120  SEDDKTTLADVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  179

Query  815  LNE  823
            +N+
Sbjct  180  INQ  182



>ref|XP_009151232.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=192

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 106/165 (64%), Gaps = 16/165 (10%)
 Frame = +2

Query  341  IITESIAGQVVGQ----SVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKA  508
            ++TE+  GQ  G+    +V A P P            A +  ITIG+ALEA+    GNK 
Sbjct  38   VVTEASGGQAEGEVNQKNVVANPPP------------ASEGTITIGEALEAAVLTAGNKP  85

Query  509  VDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQK  688
            V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N     D +K  L +VL  A  K
Sbjct  86   VEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARANSDDEKTTLADVLTGARGK  145

Query  689  LPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            LP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  146  LPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  190



>ref|XP_009129849.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=181

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N    
Sbjct  57   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGKTNIMPGGVAASAQSAATLNARAN  116

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             + DK  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  117  SEDDKTTLADVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  176

Query  815  LNE  823
            +N+
Sbjct  177  INQ  179



>emb|CDY52497.1| BnaAnng11440D [Brassica napus]
Length=183

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N    
Sbjct  59   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGKTNIMPGGVAASAQSAATLNARAN  118

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             + DK  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  119  SEDDKTTLADVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  178

Query  815  LNE  823
            +N+
Sbjct  179  INQ  181



>ref|NP_198150.1| Seed maturation protein [Arabidopsis thaliana]
 dbj|BAC43241.1| putative embryonic abundant protein [Arabidopsis thaliana]
 gb|AED93755.1| Seed maturation protein [Arabidopsis thaliana]
Length=192

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N  + 
Sbjct  68   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARIG  127

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             D  K  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  128  SDDTKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  187

Query  815  LNE  823
            +N+
Sbjct  188  INQ  190



>ref|XP_002874409.1| seed maturation family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50668.1| seed maturation family protein [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N  + 
Sbjct  68   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVG  127

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaR  814
             D  K  L +VL  A+ KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR
Sbjct  128  SDDTKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  187

Query  815  LNE  823
            +N+
Sbjct  188  INQ  190



>ref|XP_003538057.1| PREDICTED: late embryogenesis abundant protein D-34-like [Glycine 
max]
Length=179

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 100/160 (63%), Gaps = 5/160 (3%)
 Frame = +2

Query  359  AGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSDAAAIQ  538
             G V G S  A P        GI   +     ITIG+ALEA+A ++G+K VD++DA AI 
Sbjct  18   CGDVFGVSTAAEPHAAPVVSAGIGSAAIDGDPITIGEALEAAAISIGDKPVDQNDADAIG  77

Query  539  AAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADKIATRE  718
             AE+RATG N +  GGV  TAQ AA +N  ++R QD  KL ++L DA +KLP DK  T+E
Sbjct  78   VAEIRATGENKVRSGGVGETAQEAATFNSHVMRVQDMTKLSDILTDAAEKLPVDKAVTKE  137

Query  719  DAEGVASAQ-----QRNNLDMSSTPGGvaasvaaaaRLNE  823
            DAE V +A+     QR+  ++ + PGGVAAS+A AA LNE
Sbjct  138  DAEAVYTAEVQFPWQRDAAEVVAEPGGVAASMATAANLNE  177



>ref|XP_009111929.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=191

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +2

Query  287  PAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIG  466
            PA E+     E    G  ++ ++  GQ  G+  E   + N  A  G          ITIG
Sbjct  22   PATEKSSEAAEDKEKG--VVADASGGQAEGEVNEKKVVANPPASEGT---------ITIG  70

Query  467  QALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQD  646
            +ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N     + D
Sbjct  71   EALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARANSEDD  130

Query  647  KVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K  L  VL  A  KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  131  KTTLAVVLTGARSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  189



>emb|CDY19705.1| BnaA09g03580D [Brassica napus]
Length=191

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +2

Query  287  PAGEQGVTVTETDVPGSRIITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIG  466
            PA E+     E    G  ++ ++  GQ  G+  E   + N  A  G          ITIG
Sbjct  22   PATEKSSEAAEDKEKG--VVADASGGQAEGEVNEKKIVANPPASEGT---------ITIG  70

Query  467  QALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQD  646
            +ALEA+    GNK V+ SDAAAIQAAEVRATG   I PGGVAA+AQSAA  N     + D
Sbjct  71   EALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARANSEDD  130

Query  647  KVKLGNVLADATQKLPADKIATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNE  823
            K  L  VL  A  KLP+DK ATR+DAEGV  A+ RN+  +++ P GVAASVAAAAR+N+
Sbjct  131  KTTLAVVLTGARSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAARINQ  189



>gb|AJA33582.1| late embryogenesis abundant protein LEA7-3 [Pinus tabuliformis]
Length=282

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  164  MQSAETAVLGQTQKGGPaaamqaaanvnvraGLVSPDDVSNPAGEQGVTVTETDVPGSRI  343
            MQSAE   LGQTQKGG AA MQ AA+ N R+G ++ D+     G   + VT+T V G  +
Sbjct  1    MQSAEAHALGQTQKGGAAAVMQCAADANERSGKLNLDEDQAAGGYLDMAVTKTAVTGQLL  60

Query  344  ITESIAGQVVGQSVEAMPLPNYQAGGGINMNSALQAGITIGQALEASAQALGNKAVDRSD  523
             T+ + GQ V  +++ MP          N   A    +TIGQAL+A     G K V+  D
Sbjct  61   ETQYVGGQAVRSTLKFMP---------TNHEIAASEAVTIGQALQAVVLKAGEKPVEGRD  111

Query  524  AAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLIRDQDKVKLGNVLADATQKLPADK  703
            A AIQ+A  RATG   +  G +AATAQ+AA  N  L  +  +  L ++L +A +KLP DK
Sbjct  112  ARAIQSAVKRATGKPALEKGSMAATAQAAAELNPRL-DEVAQTTLSDILVNAPEKLPRDK  170

Query  704  IATREDAEGVASAQQRNNLDMSSTPGGvaasvaaaaRLNER  826
            + TREDAE V  A+ R N     TPGGVA ++ A ARLNE+
Sbjct  171  VLTREDAEKVLEAEARANRYGFPTPGGVAEALMAGARLNEQ  211



>ref|XP_002314696.1| hypothetical protein POPTR_0010s09710g [Populus trichocarpa]
 gb|EEF00867.1| hypothetical protein POPTR_0010s09710g [Populus trichocarpa]
Length=172

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +2

Query  89   VKYGDVFGVSGELADKPIAPQDAAMMQ-SAETAVLGQTQKGGPaaamqaaanvnvraGLV  265
            ++YGDVF VSGELA + +AP+DA MMQ SAE+ VL Q QKGGPAA MQ+AA  N +AG V
Sbjct  58   LRYGDVFNVSGELATRKVAPEDANMMQISAESTVLRQNQKGGPAATMQSAATRNEQAGFV  117

Query  266  SPDDVSNPAGEQGVTVTETDVPGSRIITESIAGQV  370
            S    S+ A +QGVTVTE D+PG+R +TES+A Q 
Sbjct  118  SHWLASDAAADQGVTVTENDIPGARFVTESVAEQC  152



>ref|XP_007149042.1| hypothetical protein PHAVU_005G035800g [Phaseolus vulgaris]
 gb|ESW21036.1| hypothetical protein PHAVU_005G035800g [Phaseolus vulgaris]
Length=188

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 93/129 (72%), Gaps = 5/129 (4%)
 Frame = +2

Query  455  ITIGQALEASAQALGNKAVDRSDAAAIQAAEVRATGTNVITPGGVaataqsaaaYNEGLI  634
            ITIG+ALE+ A ++G+KAVD++DAAAI AAE+RA+G  ++  GGV  TAQ+AA +N  ++
Sbjct  59   ITIGEALESVAISVGDKAVDQTDAAAISAAEIRASGGTILRSGGVGETAQAAATFNSHVM  118

Query  635  RDQDKVKLGNVLADATQKLPADKIATREDAEGVASAQ-----QRNNLDMSSTPGGvaasv  799
            R QD  KL ++L DAT+KLP DK  T+EDAE V +A+     +R   ++ +   GVAAS+
Sbjct  119  RAQDMKKLSDILTDATEKLPVDKAVTKEDAEAVHAAEVQFPRRREAAEVVAESVGVAASM  178

Query  800  aaaaRLNER  826
            A AA LNER
Sbjct  179  ATAADLNER  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2642147839648