BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29200_g1_i1 len=311 path=[289:0-310]

Length=311
                                                                      Score     E

gb|ADV02771.1|  cysteine protease inhibitor                           57.4    3e-08   
ref|XP_009762060.1|  PREDICTED: cysteine proteinase inhibitor B-like  51.6    4e-06   
ref|XP_006358790.1|  PREDICTED: cysteine proteinase inhibitor B-like  50.1    1e-05   
ref|XP_003538534.1|  PREDICTED: cysteine proteinase inhibitor 4       49.7    2e-05   
ref|XP_006492987.1|  PREDICTED: cysteine proteinase inhibitor 2-like  49.7    2e-05   
gb|ACU17144.1|  unknown                                               49.3    2e-05   Glycine max [soybeans]
gb|KHN44464.1|  Cysteine proteinase inhibitor 2                       49.7    2e-05   
ref|XP_010926673.1|  PREDICTED: cysteine proteinase inhibitor 5       48.9    3e-05   
ref|XP_009589279.1|  PREDICTED: cysteine proteinase inhibitor B-like  48.9    3e-05   
ref|XP_010326957.1|  PREDICTED: cysteine proteinase inhibitor B       48.1    5e-05   
gb|AEQ54766.1|  cysteine proteinase inhibitor CPI-1                   47.8    7e-05   
ref|XP_002456830.1|  hypothetical protein SORBIDRAFT_03g043680        47.8    9e-05   Sorghum bicolor [broomcorn]
ref|XP_010101112.1|  Cysteine proteinase inhibitor 10                 47.8    9e-05   
ref|XP_010542782.1|  PREDICTED: cysteine proteinase inhibitor 2-like  47.4    1e-04   
emb|CDY62192.1|  BnaCnng39540D                                        47.0    1e-04   
dbj|BAA20464.1|  extracellular insoluble cystatin                     47.0    1e-04   Daucus carota [carrots]
emb|CAG38125.1|  cystatin Hv-CPI9                                     47.0    1e-04   Hordeum vulgare [barley]
ref|XP_009132828.1|  PREDICTED: cysteine proteinase inhibitor 2-like  47.0    2e-04   
ref|XP_003552894.1|  PREDICTED: cysteine proteinase inhibitor 4-like  46.6    2e-04   
ref|XP_007163791.1|  hypothetical protein PHAVU_001G264400g           46.2    2e-04   
emb|CDY42085.1|  BnaA05g11010D                                        46.2    2e-04   
ref|XP_009144029.1|  PREDICTED: cysteine proteinase inhibitor 2-like  46.2    2e-04   
gb|KHN24041.1|  Cysteine proteinase inhibitor 2                       46.6    3e-04   
gb|EYU28504.1|  hypothetical protein MIMGU_mgv1a016168mg              46.2    3e-04   
gb|EYU24293.1|  hypothetical protein MIMGU_mgv1a016063mg              46.2    3e-04   
ref|XP_006296241.1|  hypothetical protein CARUB_v10025408mg           46.2    3e-04   
gb|KDO52834.1|  hypothetical protein CISIN_1g035532mg                 45.8    3e-04   
ref|XP_009141203.1|  PREDICTED: cysteine proteinase inhibitor 2-like  45.8    3e-04   
gb|ACD85810.1|  cystcine proteinase inhibitor                         45.8    4e-04   Gossypium hirsutum [American cotton]
gb|ACK87021.1|  cysteine protease inhibitor                           45.4    4e-04   Gossypium hirsutum [American cotton]
ref|XP_006421050.1|  hypothetical protein CICLE_v10006584mg           45.4    4e-04   
ref|XP_011084146.1|  PREDICTED: cysteine proteinase inhibitor B       45.4    5e-04   
emb|CAJ20032.1|  putative cystatin                                    45.1    6e-04   Zea mays [maize]
ref|XP_007034159.1|  Cystatin                                         45.1    6e-04   
emb|CDX84749.1|  BnaA03g14810D                                        47.4    8e-04   
emb|CAG38126.1|  cystatin Hv-CPI5                                     45.1    8e-04   Hordeum vulgare [barley]
ref|XP_002516375.1|  Cysteine proteinase inhibitor B, putative        44.7    0.001   Ricinus communis
ref|XP_004160226.1|  PREDICTED: cysteine proteinase inhibitor B-like  44.7    0.001   
ref|XP_004138536.1|  PREDICTED: cysteine proteinase inhibitor B-like  44.7    0.001   



>gb|ADV02771.1| cysteine protease inhibitor [Ipomoea batatas]
Length=134

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K EV DV+ N EVQ +GR  V E+NKR+    +P + AK   RL F++V KAEKQVV
Sbjct  35   KTEVSDVKTNAEVQNLGRKAVMEFNKRLNVKVNPENNAK---RLVFTEVIKAEKQVV  88



>ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=138

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + ++ DV+ N E+Q +G++CV EYN+ +   K   +       LSFS+V +AEKQVV
Sbjct  36   RTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNNNGLLSFSEVVEAEKQVV  92



>ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=135

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + ++ DV+ N E+Q +G+YCV E+N+ +       S     S LSFSQV +AEKQVV
Sbjct  34   RTQIKDVKTNQEIQDLGKYCVEEHNRNLRKQNGALS-----SLLSFSQVVEAEKQVV  85



>ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 4 [Glycine max]
Length=126

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K EVPDV+ N EVQ++GR+ V EYN+ +   K+  S      +L+FS+V +A++QVV
Sbjct  27   KTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNNGS-----EQLNFSEVVEAQQQVV  78



>ref|XP_006492987.1| PREDICTED: cysteine proteinase inhibitor 2-like [Citrus sinensis]
Length=130

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = -1

Query  167  EVPDVQKNGEVQQMGRYCVTEYNK-RMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            EV DV+KN EVQ++G++CV E+N+ +    K  R+ A    RL FSQV +A+KQVV
Sbjct  33   EVKDVKKNKEVQELGKFCVEEFNRSQQRQGKVIRNVA--FGRLRFSQVLEAQKQVV  86



>gb|ACU17144.1| unknown [Glycine max]
Length=122

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K EVPDV+ N EVQ++GR+ V EYN+ +   K+  S      +L+FS+V +A++QVV
Sbjct  27   KTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNNGS-----EQLNFSEVVEAQQQVV  78



>gb|KHN44464.1| Cysteine proteinase inhibitor 2 [Glycine soja]
Length=169

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K EVPDV+ N EVQ++GR+ V EYN+ +   K+  S      +L+FS+V +A++QVV
Sbjct  27   KTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNNGS-----EQLNFSEVVEAQQQVV  78



>ref|XP_010926673.1| PREDICTED: cysteine proteinase inhibitor 5 [Elaeis guineensis]
Length=126

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 8/57 (14%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + EVP V+ + EVQ +G +CV EYN+R++  +S          L+F +V  AE+QVV
Sbjct  35   RTEVPHVESDKEVQDLGLFCVEEYNQRLHGGRS--------EALTFLRVVAAERQVV  83



>ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76376.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=136

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + ++ DV+ N E+Q +G++CV EYN+ +   K   +    L  LSFS+V +AEKQVV
Sbjct  36   RTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNGL--LSFSEVVEAEKQVV  90



>ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [Solanum lycopersicum]
Length=134

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + ++ +V+ N E+Q +G+YCV E+N+ +       S     S LSFSQV +AEKQVV
Sbjct  34   RTQIKNVKTNQEIQDLGKYCVEEHNRDLRHINGALS-----SLLSFSQVVEAEKQVV  85



>gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora]
Length=139

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -1

Query  164  VPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + DV+ N EVQ++G YCV+EYNK +   K+  SGA     + F+ V +AEKQVV
Sbjct  43   IEDVKSNKEVQELGEYCVSEYNKSL-RKKNNESGAP----IIFTSVVEAEKQVV  91



>ref|XP_002456830.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
 gb|EES01950.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
Length=155

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 34/57 (60%), Gaps = 8/57 (14%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + EV DV+ +GEVQ++GR+ V EYN+++              RL F +V  A++QVV
Sbjct  58   RTEVRDVESDGEVQELGRFSVAEYNRQLRGDGG--------GRLEFGRVVAAQRQVV  106



>ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|EXB87085.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|AJD79057.1| CPI-6 [Morus alba var. atropurpurea]
Length=143

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 4/61 (7%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKR----LSRLSFSQVTKAEKQV  6
            +  + DV+ N EVQ++GR+ V EYN+R        +G  R       LSFSQV +AEKQV
Sbjct  33   RTAISDVKTNEEVQELGRFSVEEYNRRSQKLIRRGNGGARDGYGDGELSFSQVVEAEKQV  92

Query  5    V  3
            V
Sbjct  93   V  93



>ref|XP_010542782.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=145

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKR---LSRLSFSQVTKAEKQVV  3
            K +VPDV+ N E+Q++GRYCV E+N +    +   SG +    L  L FS+V +A++QVV
Sbjct  37   KSDVPDVESNKELQELGRYCVEEFNLK-EGRREKGSGEEEEEVLGPLVFSRVVEAQRQVV  95



>emb|CDY62192.1| BnaCnng39540D [Brassica napus]
Length=142

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYN---KRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K ++P+VQ N E+Q++GRYCV ++N   +         +    L+ L+FS+V  A+KQVV
Sbjct  36   KADIPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIANTAVLNPLNFSRVVSAQKQVV  95



>dbj|BAA20464.1| extracellular insoluble cystatin [Daucus carota]
Length=133

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 1/57 (2%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + E+PDV+ N E+QQ+G Y V +YN++ +      S       L F +V  AEKQVV
Sbjct  35   RTEIPDVESNEEIQQLGEYSVEQYNQQHHNGDGGDS-TDSAGDLKFVKVVAAEKQVV  90



>emb|CAG38125.1| cystatin Hv-CPI9 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=143

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + E+ DV KN  VQ +GR+ V E+N+R+    S  +G     +L+F+ V  A+KQV+
Sbjct  41   RTEISDVGKNKLVQSLGRFAVAEHNRRLGHGGSGNNGDPVQVQLAFTAVAAAQKQVI  97



>ref|XP_009132828.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10747.1| phytocystatin 2-2 [Brassica rapa subsp. pekinensis]
Length=141

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGA---KRLSRLSFSQVTKAEKQVV  3
            K +VP+VQ N EVQ++GRYCV ++N    + K   + +     L+ L+FS+V  A++QVV
Sbjct  35   KSDVPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVV  94



>ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=142

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K E+P+V+KN +VQ++GR+ V EYN  +   K+      R  +L+FS V +A++QVV
Sbjct  27   KTEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGR-EQLNFSAVVEAQQQVV  82



>ref|XP_007163791.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
 gb|ESW35785.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
Length=130

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K E+PDV+ N EVQ++GR+ V EYN  +       +      +L+FS+V +A++QVV
Sbjct  27   KTEIPDVRTNREVQELGRFSVEEYNNGLKLYNDSDN-----EKLTFSEVVEAQQQVV  78



>emb|CDY42085.1| BnaA05g11010D [Brassica napus]
Length=136

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 5/62 (8%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYN-----KRMYATKSPRSGAKRLSRLSFSQVTKAEKQ  9
            K +V +V+ N E+Q++GRYCV ++N     K+     + R+ A  LS L FS+V  A+KQ
Sbjct  32   KSDVGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQ  91

Query  8    VV  3
            VV
Sbjct  92   VV  93



>ref|XP_009144029.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ABB97037.1| cystatin-like protein [Brassica rapa]
Length=136

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 5/62 (8%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYN-----KRMYATKSPRSGAKRLSRLSFSQVTKAEKQ  9
            K +V +V+ N E+Q++GRYCV ++N     K+     + R+ A  LS L FS+V  A+KQ
Sbjct  32   KSDVGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQ  91

Query  8    VV  3
            VV
Sbjct  92   VV  93



>gb|KHN24041.1| Cysteine proteinase inhibitor 2, partial [Glycine soja]
Length=151

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K E+P+V+KN +VQ++GR+ V EYN  +   K+      R  +L+FS V +A++QVV
Sbjct  36   KTEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGR-EQLNFSAVVEAQQQVV  91



>gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata]
Length=132

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 6/57 (11%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + EV +V+ N +VQ +GRYCV EYN+++   +   +G K    L FSQV  AE QVV
Sbjct  31   RTEVKNVKANKDVQDLGRYCVQEYNRQL---QQKANGTK---LLVFSQVVAAETQVV  81



>gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata]
Length=135

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 6/57 (11%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + EV +V+ N +VQ +GRYCV EYN+++      +  A     L FSQV  AE QVV
Sbjct  35   RTEVKNVKANKDVQDLGRYCVQEYNRQL------QQKANGTKLLVFSQVVAAETQVV  85



>ref|XP_006296241.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
 gb|EOA29139.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
Length=144

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (62%), Gaps = 11/65 (17%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSR--------LSFSQVTKA  18
            K +VP+V+ N E+QQ+GRYCV ++N+R    +S     + +++        L FS+V  A
Sbjct  36   KSDVPNVKANREIQQLGRYCVEQFNQR---EQSEEGNVESIAKTDTDMSNPLMFSRVVSA  92

Query  17   EKQVV  3
            +KQVV
Sbjct  93   QKQVV  97



>gb|KDO52834.1| hypothetical protein CISIN_1g035532mg, partial [Citrus sinensis]
Length=112

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = -1

Query  167  EVPDVQKNGEVQQMGRYCVTEYNK-RMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            EV DV+KN EVQ++G++ V E+N+ +    K  R+ A    RL FSQV +A+KQVV
Sbjct  33   EVKDVKKNKEVQELGKFSVEEFNRSQQRQGKVIRNVA--FGRLRFSQVLEAQKQVV  86



>ref|XP_009141203.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10746.1| phytocystatin 2-1 [Brassica rapa subsp. pekinensis]
 emb|CDY60964.1| BnaA04g28930D [Brassica napus]
Length=142

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 9/61 (15%)
 Frame = -1

Query  167  EVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKR------LSRLSFSQVTKAEKQV  6
            ++P+VQ N E+Q++GRYCV ++N      +S +  A+       L+ L+FS+V  A+KQV
Sbjct  38   DIPNVQTNIEIQELGRYCVEQFN---LMEESEQGNAESIADTAVLNPLNFSRVVSAQKQV  94

Query  5    V  3
            V
Sbjct  95   V  95



>gb|ACD85810.1| cystcine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 13/64 (20%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKR-------MYATKSPRSGAKRLSRLSFSQVTKAE  15
            ++ + DV+KN EVQ++GR+ V EYN+R         A   P +       L FSQV  AE
Sbjct  25   RMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTA------LVFSQVVGAE  78

Query  14   KQVV  3
            KQVV
Sbjct  79   KQVV  82



>gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum]
Length=119

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 13/64 (20%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKR-------MYATKSPRSGAKRLSRLSFSQVTKAE  15
            ++ + DV+KN EVQ++GR+ V EYN+R         A   P +       L FSQV  AE
Sbjct  19   RMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTA------LVFSQVVGAE  72

Query  14   KQVV  3
            KQVV
Sbjct  73   KQVV  76



>ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
 gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
Length=130

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = -1

Query  167  EVPDVQKNGEVQQMGRYCVTEYNK-RMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            EV DV+KN EVQ++G++ V E+N+ +    K  R+ A    RL FSQV +A+KQVV
Sbjct  33   EVKDVKKNKEVQELGKFSVEEFNRSQQRQGKVIRNVA--FGRLRFSQVLEAQKQVV  86



>ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum]
Length=131

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 6/57 (11%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + +V +V++N E+Q++GRYCV EYN ++      +  A   + L FSQV  AE QV+
Sbjct  31   RTQVKNVKQNQEIQELGRYCVGEYNHQL------QLKANGSTALVFSQVVAAETQVI  81



>emb|CAJ20032.1| putative cystatin [Zea mays]
Length=120

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 34/57 (60%), Gaps = 7/57 (12%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + EV DV+ +GEVQ++GR+ V EYN+++              RL F +V  A++QVV
Sbjct  21   RTEVRDVEGDGEVQELGRFSVAEYNRQL-------RDGGGGGRLEFGRVVAAQRQVV  70



>ref|XP_007034159.1| Cystatin [Theobroma cacao]
 gb|EOY05085.1| Cystatin [Theobroma cacao]
Length=127

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 5/57 (9%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            K E+ DV+ N EVQ++GR+ V E+N+     +S  +G    + L FSQV +A+KQVV
Sbjct  33   KTEINDVKTNKEVQELGRFSVEEFNRSRGGLRS--NGG---TELVFSQVVEAQKQVV  84



>emb|CDX84749.1| BnaA03g14810D [Brassica napus]
Length=757

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATK-SPRSGAKR--LSRLSFSQVTKAEKQVV  3
            K +VP+VQ N EVQ++GRYCV ++N    + K +  S  +R  L+ L+FS+V  A++QVV
Sbjct  651  KSDVPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIERAVLNPLTFSRVVSAQQQVV  710



>emb|CAG38126.1| cystatin Hv-CPI5 [Hordeum vulgare subsp. vulgare]
 dbj|BAK02746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 2/55 (4%)
 Frame = -1

Query  167  EVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            EV DV+ + EVQ++GRY V E+N+R    +    G     RL F++V  A++QVV
Sbjct  48   EVRDVEGDREVQELGRYSVEEHNRRR--EEGCEGGGAVCGRLEFARVVSAQRQVV  100



>ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
 gb|EEF45992.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
Length=138

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            + +V DV+ N  VQ++GR+CV E+NK+    +   S       L FS+V  AE QVV
Sbjct  30   RTQVRDVKSNEAVQELGRFCVKEFNKQQLRQQHGGSNGGGGELLMFSEVVAAETQVV  86



>ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
Length=128

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 10/57 (18%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            ++EV DV++N EVQ++GR+ V EYN+RM               + F+ V  AE+QVV
Sbjct  31   RMEVKDVRRNEEVQRLGRFSVEEYNRRMGGG----------GEVKFTAVVAAERQVV  77



>ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
 gb|KGN45922.1| Cystatin [Cucumis sativus]
Length=128

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 10/57 (18%)
 Frame = -1

Query  173  KVEVPDVQKNGEVQQMGRYCVTEYNKRMYATKSPRSGAKRLSRLSFSQVTKAEKQVV  3
            ++EV DV++N EVQ++GR+ V EYN+RM               + F+ V  AE+QVV
Sbjct  31   RMEVKDVRRNEEVQRLGRFSVEEYNRRMGGG----------GEVKFTAVVAAERQVV  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 526541221390