BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29197_g1_i1 len=1975 path=[1:0-1974]

Length=1975
                                                                      Score     E

ref|XP_009593412.1|  PREDICTED: U-box domain-containing protein 9       624   0.0      
ref|XP_011089638.1|  PREDICTED: U-box domain-containing protein 9...    621   0.0      
ref|XP_009761949.1|  PREDICTED: U-box domain-containing protein 9       612   0.0      
ref|XP_011089033.1|  PREDICTED: U-box domain-containing protein 9...    606   0.0      
ref|XP_004247038.1|  PREDICTED: U-box domain-containing protein 9       603   0.0      
ref|XP_006361322.1|  PREDICTED: U-box domain-containing protein 9...    600   0.0      
ref|XP_002263607.1|  PREDICTED: U-box domain-containing protein 9       590   0.0      Vitis vinifera
emb|CDP03938.1|  unnamed protein product                                585   0.0      
ref|XP_008244686.1|  PREDICTED: U-box domain-containing protein 9...    583   0.0      
ref|XP_007199834.1|  hypothetical protein PRUPE_ppa005537mg             581   0.0      
ref|XP_007049638.1|  U-box domain-containing protein 9                  581   0.0      
ref|XP_002533499.1|  Spotted leaf protein, putative                     580   0.0      Ricinus communis
gb|KHG24446.1|  U-box domain-containing 9 -like protein                 579   0.0      
ref|XP_009334276.1|  PREDICTED: U-box domain-containing protein 9...    578   0.0      
ref|XP_008348973.1|  PREDICTED: U-box domain-containing protein 9...    578   0.0      
ref|XP_010100798.1|  U-box domain-containing protein 9                  577   0.0      
ref|XP_009372197.1|  PREDICTED: U-box domain-containing protein 9...    575   0.0      
ref|XP_006484813.1|  PREDICTED: U-box domain-containing protein 9...    573   0.0      
ref|XP_006437234.1|  hypothetical protein CICLE_v10031496mg             573   0.0      
gb|KDO60882.1|  hypothetical protein CISIN_1g012404mg                   572   0.0      
gb|KHG16436.1|  U-box domain-containing 9 -like protein                 572   0.0      
ref|XP_002301810.2|  armadillo/beta-catenin repeat family protein       571   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO60881.1|  hypothetical protein CISIN_1g012404mg                   571   0.0      
ref|XP_011024586.1|  PREDICTED: U-box domain-containing protein 9       567   0.0      
ref|XP_008346216.1|  PREDICTED: U-box domain-containing protein 9...    566   0.0      
ref|XP_008372545.1|  PREDICTED: U-box domain-containing protein 9       565   0.0      
gb|EYU40644.1|  hypothetical protein MIMGU_mgv1a005912mg                565   0.0      
ref|XP_008460394.1|  PREDICTED: U-box domain-containing protein 9       563   0.0      
ref|XP_004290155.1|  PREDICTED: U-box domain-containing protein 9...    563   0.0      
ref|XP_009340330.1|  PREDICTED: U-box domain-containing protein 9...    561   0.0      
ref|XP_002270882.1|  PREDICTED: U-box domain-containing protein 9       559   0.0      Vitis vinifera
ref|XP_010243171.1|  PREDICTED: U-box domain-containing protein 9       558   0.0      
gb|KDP45270.1|  hypothetical protein JCGZ_15135                         557   0.0      
ref|XP_004144394.1|  PREDICTED: U-box domain-containing protein 9...    557   0.0      
gb|KHG06294.1|  U-box domain-containing 9 -like protein                 555   0.0      
ref|XP_010036763.1|  PREDICTED: U-box domain-containing protein 9       550   0.0      
ref|XP_003532252.1|  PREDICTED: U-box domain-containing protein 9...    544   0.0      
gb|KHN37468.1|  U-box domain-containing protein 9                       543   0.0      
ref|XP_007140699.1|  hypothetical protein PHAVU_008G134400g             543   0.0      
ref|XP_010690013.1|  PREDICTED: U-box domain-containing protein 9       543   0.0      
ref|XP_003552093.1|  PREDICTED: U-box domain-containing protein 9...    541   0.0      
gb|AFK33972.1|  unknown                                                 540   0.0      
ref|XP_006371139.1|  hypothetical protein POPTR_0019s04500g             534   0.0      
ref|XP_010999455.1|  PREDICTED: U-box domain-containing protein 9...    533   1e-180   
ref|XP_009337943.1|  PREDICTED: U-box domain-containing protein 9...    530   5e-179   
ref|XP_008244688.1|  PREDICTED: U-box domain-containing protein 9...    523   7e-178   
ref|XP_008244689.1|  PREDICTED: U-box domain-containing protein 9...    522   3e-177   
ref|XP_004492261.1|  PREDICTED: U-box domain-containing protein 9...    521   1e-175   
gb|KEH22539.1|  plant U-box protein                                     520   1e-175   
ref|XP_009379719.1|  PREDICTED: U-box domain-containing protein 9...    518   1e-174   
gb|EYU21095.1|  hypothetical protein MIMGU_mgv1a005997mg                517   2e-174   
gb|EPS72799.1|  hypothetical protein M569_01957                         514   4e-173   
ref|XP_008388749.1|  PREDICTED: U-box domain-containing protein 9...    513   9e-173   
gb|KDP23775.1|  hypothetical protein JCGZ_23608                         508   7e-171   
ref|XP_007205152.1|  hypothetical protein PRUPE_ppa005364mg             506   4e-170   
ref|XP_006479026.1|  PREDICTED: U-box domain-containing protein 9...    506   7e-170   
ref|XP_008218380.1|  PREDICTED: U-box domain-containing protein 9...    503   8e-169   
ref|XP_008218381.1|  PREDICTED: U-box domain-containing protein 9...    502   1e-168   
gb|KDO42117.1|  hypothetical protein CISIN_1g012677mg                   501   3e-168   
ref|XP_009779917.1|  PREDICTED: U-box domain-containing protein 9...    498   7e-167   
ref|XP_007147242.1|  hypothetical protein PHAVU_006G107800g             496   3e-166   
ref|XP_009590562.1|  PREDICTED: U-box domain-containing protein 9...    491   4e-164   
ref|NP_566304.1|  ARM domain-containing protein                         490   7e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547136.1|  PREDICTED: U-box domain-containing protein 9...    490   8e-164   
ref|XP_004302119.1|  PREDICTED: U-box domain-containing protein 9...    488   4e-163   
ref|XP_010248085.1|  PREDICTED: U-box domain-containing protein 9...    488   4e-163   
emb|CDX74050.1|  BnaA03g29970D                                          488   6e-163   
ref|XP_002319132.2|  hypothetical protein POPTR_0013s04930g             489   1e-162   Populus trichocarpa [western balsam poplar]
ref|XP_003554736.1|  PREDICTED: U-box domain-containing protein 9...    485   3e-162   
emb|CDY08002.1|  BnaC03g35210D                                          486   3e-162   
ref|XP_006375873.1|  hypothetical protein POPTR_0013s04900g             484   2e-161   
ref|XP_010674205.1|  PREDICTED: U-box domain-containing protein 9...    484   2e-161   
emb|CDY71737.1|  BnaAnng38640D                                          484   2e-161   
ref|XP_002862652.1|  armadillo/beta-catenin repeat family protein       483   4e-161   
emb|CDY28059.1|  BnaC05g44610D                                          483   8e-161   
ref|XP_003520854.1|  PREDICTED: U-box domain-containing protein 9...    481   1e-160   
ref|XP_009147083.1|  PREDICTED: U-box domain-containing protein 9       480   5e-160   
ref|XP_004494763.1|  PREDICTED: U-box domain-containing protein 9...    480   7e-160   
ref|XP_010486284.1|  PREDICTED: U-box domain-containing protein 9       477   1e-158   
ref|XP_010464356.1|  PREDICTED: U-box domain-containing protein 9...    476   2e-158   
emb|CDP04252.1|  unnamed protein product                                476   4e-158   
ref|XP_010552019.1|  PREDICTED: U-box domain-containing protein 9       475   7e-158   
ref|XP_006297377.1|  hypothetical protein CARUB_v10013402mg             477   1e-157   
ref|XP_009124360.1|  PREDICTED: U-box domain-containing protein 9...    473   3e-157   
ref|XP_009134963.1|  PREDICTED: U-box domain-containing protein 9...    472   1e-156   
gb|AES82721.2|  plant U-box protein                                     469   1e-155   
ref|XP_011034441.1|  PREDICTED: U-box domain-containing protein 9...    466   1e-154   
gb|KFK38195.1|  hypothetical protein AALP_AA3G081600                    464   2e-153   
ref|XP_003626503.1|  U-box domain-containing protein                    466   3e-153   
ref|XP_006443314.1|  hypothetical protein CICLE_v10024335mg             456   6e-151   
ref|XP_008244691.1|  PREDICTED: U-box domain-containing protein 9...    451   2e-150   
ref|XP_004492262.1|  PREDICTED: U-box domain-containing protein 9...    452   2e-150   
gb|KHN35338.1|  U-box domain-containing protein 9                       447   2e-148   
ref|XP_008348974.1|  PREDICTED: U-box domain-containing protein 9...    443   1e-147   
gb|KDO60883.1|  hypothetical protein CISIN_1g012404mg                   441   1e-146   
ref|XP_009403611.1|  PREDICTED: U-box domain-containing protein 9...    446   2e-146   
ref|XP_010248086.1|  PREDICTED: U-box domain-containing protein 9...    439   2e-145   
ref|XP_008346217.1|  PREDICTED: U-box domain-containing protein 9...    437   2e-145   
ref|XP_010109324.1|  U-box domain-containing protein 9                  442   5e-145   
ref|XP_009415947.1|  PREDICTED: U-box domain-containing protein 9...    441   1e-144   
ref|XP_009340331.1|  PREDICTED: U-box domain-containing protein 9...    432   4e-143   
gb|EAZ23084.1|  hypothetical protein OsJ_06778                          427   5e-139   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD22116.1|  Avr9/Cf-9 rapidly elicited protein-like                424   8e-138   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001172966.1|  Os02g0488701                                       421   2e-137   
ref|XP_008778975.1|  PREDICTED: U-box domain-containing protein 9...    421   3e-137   
ref|XP_009379990.1|  PREDICTED: U-box domain-containing protein 9       422   7e-137   
ref|XP_006407844.1|  hypothetical protein EUTSA_v10020790mg             418   3e-136   
ref|XP_003574980.1|  PREDICTED: U-box domain-containing protein 9...    412   2e-133   
ref|XP_004495551.1|  PREDICTED: U-box domain-containing protein 9...    410   1e-132   
ref|XP_006648643.1|  PREDICTED: U-box domain-containing protein 9...    407   3e-132   
gb|EEC73195.1|  hypothetical protein OsI_07255                          405   5e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_002453828.1|  hypothetical protein SORBIDRAFT_04g019280          407   3e-131   Sorghum bicolor [broomcorn]
ref|XP_008811326.1|  PREDICTED: U-box domain-containing protein 9...    403   1e-129   
ref|XP_004952492.1|  PREDICTED: U-box domain-containing protein 9...    402   2e-129   
gb|ACU18266.1|  unknown                                                 395   8e-129   Glycine max [soybeans]
ref|NP_001150782.1|  LOC100284415                                       398   8e-128   Zea mays [maize]
gb|KHN04967.1|  U-box domain-containing protein 9                       395   5e-127   
ref|XP_003590900.1|  U-box domain-containing protein                    394   1e-126   
ref|XP_009379720.1|  PREDICTED: U-box domain-containing protein 9...    389   2e-126   
ref|XP_003555559.1|  PREDICTED: U-box domain-containing protein 9...    395   2e-126   
ref|XP_004237643.2|  PREDICTED: U-box domain-containing protein 9...    392   4e-126   
ref|XP_007030262.1|  U-box domain-containing protein 9                  394   9e-126   
ref|XP_010907242.1|  PREDICTED: U-box domain-containing protein 9...    392   2e-125   
ref|XP_007143945.1|  hypothetical protein PHAVU_007G115800g             390   7e-125   
ref|XP_004237642.1|  PREDICTED: U-box domain-containing protein 9...    383   1e-122   
ref|NP_850531.1|  ARM domain-containing protein                         375   6e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908320.1|  PREDICTED: U-box domain-containing protein 9...    376   1e-120   
gb|EEC77056.1|  hypothetical protein OsI_15442                          373   2e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_010418119.1|  PREDICTED: U-box domain-containing protein 9...    370   5e-118   
dbj|BAK01875.1|  predicted protein                                      372   9e-118   
ref|XP_006340482.1|  PREDICTED: U-box domain-containing protein 9...    369   2e-117   
ref|NP_001052522.2|  Os04g0348400                                       370   3e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010558729.1|  PREDICTED: putative U-box domain-containing ...    368   3e-116   
ref|XP_007030252.1|  U-box domain-containing protein 9                  367   7e-116   
ref|XP_006653286.1|  PREDICTED: U-box domain-containing protein 9...    363   2e-115   
ref|XP_011084722.1|  PREDICTED: uncharacterized protein LOC105166900    371   9e-113   
ref|XP_003579564.2|  PREDICTED: U-box domain-containing protein 9...    359   2e-112   
ref|XP_010550249.1|  PREDICTED: putative U-box domain-containing ...    357   5e-112   
gb|EYU39768.1|  hypothetical protein MIMGU_mgv1a023902mg                352   7e-111   
ref|XP_006340514.1|  PREDICTED: U-box domain-containing protein 9...    351   2e-110   
ref|XP_004975335.1|  PREDICTED: U-box domain-containing protein 9...    348   9e-109   
gb|EEE60783.1|  hypothetical protein OsJ_14363                          340   6e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008441805.1|  PREDICTED: U-box domain-containing protein 9...    341   3e-106   
gb|EMT06620.1|  U-box domain-containing protein 9                       339   6e-105   
ref|XP_010667713.1|  PREDICTED: U-box domain-containing protein 9...    337   1e-104   
emb|CAE02102.2|  OSJNBa0020I02.15                                       339   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EMS54565.1|  U-box domain-containing protein 9                       339   1e-103   
ref|XP_004152860.1|  PREDICTED: U-box domain-containing protein 9...    333   3e-103   
ref|XP_004155144.1|  PREDICTED: U-box domain-containing protein 9...    332   1e-102   
ref|XP_002873884.1|  predicted protein                                  323   3e-99    
ref|XP_010907243.1|  PREDICTED: U-box domain-containing protein 9...    318   4e-97    
ref|XP_009120984.1|  PREDICTED: putative U-box domain-containing ...    316   2e-96    
ref|XP_010668261.1|  PREDICTED: U-box domain-containing protein 9...    310   1e-95    
emb|CDY38506.1|  BnaA10g16520D                                          314   1e-95    
ref|NP_197333.2|  putative U-box domain-containing protein 46           314   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289884.1|  hypothetical protein CARUB_v10003498mg             313   2e-95    
ref|XP_010420580.1|  PREDICTED: putative U-box domain-containing ...    308   4e-93    
ref|XP_010454064.1|  PREDICTED: putative U-box domain-containing ...    307   5e-93    
ref|XP_010420583.1|  PREDICTED: putative U-box domain-containing ...    303   5e-91    
ref|XP_006400381.1|  hypothetical protein EUTSA_v10015380mg             297   1e-89    
ref|XP_007143751.1|  hypothetical protein PHAVU_007G098700g             296   4e-87    
emb|CDY68352.1|  BnaCnng58610D                                          289   3e-86    
ref|XP_003556245.1|  PREDICTED: U-box domain-containing protein 1...    293   1e-85    
gb|KHN00867.1|  U-box domain-containing protein 14                      293   1e-85    
gb|KFK26070.1|  hypothetical protein AALP_AA8G199200                    285   5e-85    
ref|XP_010027134.1|  PREDICTED: U-box domain-containing protein 9...    286   6e-85    
ref|XP_002882523.1|  hypothetical protein ARALYDRAFT_896898             280   7e-85    
ref|XP_003535520.1|  PREDICTED: U-box domain-containing protein 1...    290   8e-85    
ref|XP_007204993.1|  hypothetical protein PRUPE_ppa003509mg             288   1e-84    
ref|XP_008448400.1|  PREDICTED: U-box domain-containing protein 13      290   2e-84    
ref|XP_002270524.1|  PREDICTED: U-box domain-containing protein 14      288   1e-83    Vitis vinifera
gb|ACN40705.1|  unknown                                                 284   1e-83    Picea sitchensis
gb|KHN37791.1|  U-box domain-containing protein 14                      287   2e-83    
ref|XP_006350763.1|  PREDICTED: U-box domain-containing protein 1...    285   2e-83    
ref|XP_006424806.1|  hypothetical protein CICLE_v10027966mg             284   4e-83    
ref|XP_004143106.1|  PREDICTED: U-box domain-containing protein 1...    286   9e-83    
ref|XP_004163228.1|  PREDICTED: U-box domain-containing protein 1...    286   1e-82    
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13      286   1e-82    
ref|XP_006436479.1|  hypothetical protein CICLE_v10030962mg             276   3e-82    
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...    285   3e-82    
ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13      285   3e-82    
ref|XP_011084290.1|  PREDICTED: U-box domain-containing protein 14      283   3e-82    
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg             284   4e-82    
ref|XP_010322360.1|  PREDICTED: U-box domain-containing protein 1...    281   4e-82    
gb|KHG05758.1|  U-box domain-containing 13 -like protein                284   5e-82    
ref|XP_004307361.1|  PREDICTED: U-box domain-containing protein 1...    282   8e-82    
ref|XP_007009958.1|  U-box domain-containing protein 14                 283   8e-82    
ref|XP_009368915.1|  PREDICTED: U-box domain-containing protein 14      282   1e-81    
ref|XP_004241233.1|  PREDICTED: U-box domain-containing protein 1...    282   2e-81    
ref|XP_004496239.1|  PREDICTED: U-box domain-containing protein 1...    281   3e-81    
ref|XP_009774572.1|  PREDICTED: U-box domain-containing protein 1...    279   4e-81    
gb|KDP44223.1|  hypothetical protein JCGZ_05690                         281   4e-81    
gb|KHG15771.1|  U-box domain-containing 14 -like protein                281   4e-81    
ref|XP_008233282.1|  PREDICTED: U-box domain-containing protein 14      280   4e-81    
ref|XP_009343828.1|  PREDICTED: U-box domain-containing protein 1...    281   5e-81    
gb|KDP30475.1|  hypothetical protein JCGZ_16154                         280   5e-81    
ref|XP_009353692.1|  PREDICTED: U-box domain-containing protein 1...    278   7e-81    
ref|XP_002986139.1|  ubiquitin-protein ligase, PUB13                    280   8e-81    
ref|XP_010504312.1|  PREDICTED: U-box domain-containing protein 14      280   8e-81    
ref|XP_002984952.1|  ubiquitin-protein ligase, PUB13                    280   9e-81    
ref|XP_008364702.1|  PREDICTED: U-box domain-containing protein 14      279   1e-80    
ref|XP_008789545.1|  PREDICTED: U-box domain-containing protein 1...    278   2e-80    
ref|XP_010940632.1|  PREDICTED: U-box domain-containing protein 12      279   2e-80    
gb|EMT21789.1|  U-box domain-containing protein 11                      277   2e-80    
ref|XP_008789544.1|  PREDICTED: U-box domain-containing protein 1...    278   3e-80    
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...    280   3e-80    
ref|XP_004984736.1|  PREDICTED: protein spotted leaf 11-like isof...    277   3e-80    
ref|XP_009774522.1|  PREDICTED: U-box domain-containing protein 1...    278   5e-80    
ref|XP_009391057.1|  PREDICTED: U-box domain-containing protein 12      278   6e-80    
ref|XP_006655674.1|  PREDICTED: U-box domain-containing protein 1...    275   6e-80    
gb|KDO48789.1|  hypothetical protein CISIN_1g006877mg                   275   7e-80    
ref|XP_010521829.1|  PREDICTED: U-box domain-containing protein 1...    273   7e-80    
ref|XP_006436478.1|  hypothetical protein CICLE_v10030962mg             275   8e-80    
ref|XP_008466866.1|  PREDICTED: U-box domain-containing protein 1...    274   9e-80    
ref|XP_004964257.1|  PREDICTED: U-box domain-containing protein 1...    276   1e-79    
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...    278   1e-79    
ref|XP_004142402.1|  PREDICTED: U-box domain-containing protein 1...    276   1e-79    
emb|CDP09042.1|  unnamed protein product                                277   1e-79    
ref|XP_004157535.1|  PREDICTED: U-box domain-containing protein 1...    276   1e-79    
ref|XP_003557288.1|  PREDICTED: U-box domain-containing protein 12      276   2e-79    
ref|XP_003537996.1|  PREDICTED: U-box domain-containing protein 1...    277   2e-79    
gb|EYU39871.1|  hypothetical protein MIMGU_mgv1a002720mg                276   2e-79    
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...    277   2e-79    
gb|KHG14011.1|  U-box domain-containing 13 -like protein                277   2e-79    
gb|KDO48788.1|  hypothetical protein CISIN_1g006877mg                   276   3e-79    
ref|XP_010106453.1|  U-box domain-containing protein 13                 276   3e-79    
gb|EAY99303.1|  hypothetical protein OsI_21270                          275   3e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_009629379.1|  PREDICTED: U-box domain-containing protein 1...    276   3e-79    
ref|XP_008446840.1|  PREDICTED: U-box domain-containing protein 14      276   3e-79    
dbj|BAK01935.1|  predicted protein                                      276   3e-79    
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                   276   3e-79    
ref|XP_002311996.1|  armadillo/beta-catenin repeat family protein       275   3e-79    Populus trichocarpa [western balsam poplar]
tpg|DAA44667.1|  TPA: putative ARM repeat-containing protein cont...    278   3e-79    
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 1...    276   4e-79    
ref|XP_011031687.1|  PREDICTED: U-box domain-containing protein 14      275   4e-79    
ref|XP_006436481.1|  hypothetical protein CICLE_v10030962mg             275   4e-79    
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g             276   4e-79    
ref|XP_010557715.1|  PREDICTED: U-box domain-containing protein 14      275   4e-79    
dbj|BAJ97560.1|  predicted protein                                      276   4e-79    
ref|XP_010920613.1|  PREDICTED: protein spotted leaf 11-like            276   4e-79    
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...    276   4e-79    
ref|NP_001056535.2|  Os06g0102700                                       275   5e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649017.1|  PREDICTED: U-box domain-containing protein 1...    275   5e-79    
ref|XP_006348996.1|  PREDICTED: U-box domain-containing protein 1...    276   5e-79    
sp|Q5VRH9.1|PUB12_ORYSJ  RecName: Full=U-box domain-containing pr...    275   5e-79    Oryza sativa Japonica Group [Japonica rice]
gb|KHN32120.1|  U-box domain-containing protein 13                      275   7e-79    
ref|XP_003539679.1|  PREDICTED: U-box domain-containing protein 1...    275   7e-79    
ref|XP_007016448.1|  Plant U-box 13 isoform 2                           275   7e-79    
gb|AGT17414.1|  hypothetical protein SHCRBa_140_J14_R_360               273   8e-79    
ref|XP_010253199.1|  PREDICTED: U-box domain-containing protein 1...    275   1e-78    
ref|XP_009131653.1|  PREDICTED: putative U-box domain-containing ...    270   1e-78    
ref|XP_010252136.1|  PREDICTED: U-box domain-containing protein 1...    271   1e-78    
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein       275   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_003573013.2|  PREDICTED: U-box domain-containing protein 1...    274   1e-78    
ref|XP_008647602.1|  PREDICTED: uncharacterized protein LOC100502...    277   2e-78    
ref|XP_010253985.1|  PREDICTED: U-box domain-containing protein 1...    273   2e-78    
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1       275   2e-78    
ref|NP_001145851.1|  uncharacterized protein LOC100279362               273   2e-78    Zea mays [maize]
ref|XP_010521828.1|  PREDICTED: U-box domain-containing protein 1...    273   3e-78    
ref|XP_002454334.1|  hypothetical protein SORBIDRAFT_04g028890          273   3e-78    Sorghum bicolor [broomcorn]
emb|CDX70810.1|  BnaC03g08940D                                          268   3e-78    
dbj|BAJ85388.1|  predicted protein                                      272   3e-78    
ref|XP_010241804.1|  PREDICTED: U-box domain-containing protein 14      272   4e-78    
ref|XP_002873887.1|  predicted protein                                  268   4e-78    
gb|ACG29722.1|  spotted leaf protein 11                                 272   5e-78    Zea mays [maize]
ref|XP_010666679.1|  PREDICTED: U-box domain-containing protein 14      272   6e-78    
gb|AFW86270.1|  putative ARM repeat-containing protein containing...    272   7e-78    
gb|AFW63815.1|  putative ARM repeat-containing protein containing...    270   7e-78    
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...    273   7e-78    
ref|XP_008784531.1|  PREDICTED: protein spotted leaf 11-like            273   8e-78    
ref|NP_001131869.1|  uncharacterized protein LOC100193248               271   1e-77    Zea mays [maize]
ref|XP_002313440.1|  armadillo/beta-catenin repeat family protein       272   1e-77    Populus trichocarpa [western balsam poplar]
gb|ACL52909.1|  unknown                                                 270   1e-77    Zea mays [maize]
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...    271   2e-77    
ref|XP_004150186.1|  PREDICTED: U-box domain-containing protein 1...    271   3e-77    
ref|XP_004167730.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    271   3e-77    
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...    271   3e-77    
ref|XP_008357448.1|  PREDICTED: U-box domain-containing protein 1...    271   3e-77    
ref|XP_011024385.1|  PREDICTED: U-box domain-containing protein 1...    270   3e-77    
ref|XP_009594953.1|  PREDICTED: U-box domain-containing protein 14      270   3e-77    
gb|EAZ24511.1|  hypothetical protein OsJ_08271                          270   3e-77    
emb|CDO99779.1|  unnamed protein product                                270   4e-77    
ref|XP_002436313.1|  hypothetical protein SORBIDRAFT_10g000280          269   4e-77    
ref|XP_010252135.1|  PREDICTED: U-box domain-containing protein 1...    270   4e-77    
gb|KFK34724.1|  hypothetical protein AALP_AA5G184200                    270   5e-77    
ref|XP_008802759.1|  PREDICTED: protein spotted leaf 11-like            271   5e-77    
gb|EEC73944.1|  hypothetical protein OsI_08816                          270   6e-77    
ref|XP_004953824.1|  PREDICTED: U-box domain-containing protein 1...    270   6e-77    
ref|XP_009760654.1|  PREDICTED: U-box domain-containing protein 14      269   6e-77    
ref|NP_001048024.1|  Os02g0732200                                       270   6e-77    
ref|XP_010922355.1|  PREDICTED: protein spotted leaf 11-like            270   7e-77    
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13      270   7e-77    
ref|XP_006290746.1|  hypothetical protein CARUB_v10016842mg             269   8e-77    
ref|XP_010066634.1|  PREDICTED: U-box domain-containing protein 11      270   1e-76    
ref|XP_010427209.1|  PREDICTED: U-box domain-containing protein 1...    269   1e-76    
gb|KHG02811.1|  U-box domain-containing 13 -like protein                270   1e-76    
dbj|BAJ94942.1|  predicted protein                                      268   1e-76    
gb|EMS51624.1|  E3 ubiquitin-protein ligase SPL11                       269   1e-76    
ref|XP_009357795.1|  PREDICTED: U-box domain-containing protein 1...    268   1e-76    
ref|XP_008362668.1|  PREDICTED: U-box domain-containing protein 1...    268   1e-76    
ref|XP_004250960.1|  PREDICTED: U-box domain-containing protein 13      269   2e-76    
emb|CDX78273.1|  BnaA09g34680D                                          268   2e-76    
ref|XP_009116165.1|  PREDICTED: U-box domain-containing protein 14      268   2e-76    
ref|XP_002873886.1|  hypothetical protein ARALYDRAFT_350938             263   2e-76    
ref|XP_011041060.1|  PREDICTED: U-box domain-containing protein 1...    268   3e-76    
gb|EMT15169.1|  Protein spotted leaf 11                                 267   3e-76    
ref|XP_010259497.1|  PREDICTED: U-box domain-containing protein 1...    267   4e-76    
ref|XP_010503261.1|  PREDICTED: U-box domain-containing protein 1...    268   4e-76    
gb|EMS57563.1|  U-box domain-containing protein 12                      264   5e-76    
gb|EPS71103.1|  hypothetical protein M569_03654                         266   5e-76    
ref|XP_010935714.1|  PREDICTED: U-box domain-containing protein 1...    266   6e-76    
ref|XP_010426083.1|  PREDICTED: U-box domain-containing protein 13      267   7e-76    
ref|XP_002534105.1|  Spotted leaf protein, putative                     267   7e-76    
ref|XP_010516027.1|  PREDICTED: U-box domain-containing protein 1...    266   9e-76    
ref|XP_002315320.1|  armadillo/beta-catenin repeat family protein       266   1e-75    
ref|XP_010033135.1|  PREDICTED: U-box domain-containing protein 1...    264   1e-75    
ref|XP_010935712.1|  PREDICTED: U-box domain-containing protein 1...    266   1e-75    
ref|XP_004250056.1|  PREDICTED: U-box domain-containing protein 1...    266   1e-75    
ref|XP_009399873.1|  PREDICTED: protein spotted leaf 11-like            267   1e-75    
ref|NP_191045.2|  U-box domain-containing protein 14                    266   2e-75    
ref|XP_009380658.1|  PREDICTED: protein spotted leaf 11-like            266   2e-75    
gb|KEH30893.1|  armadillo/beta-catenin repeat protein                   261   2e-75    
gb|EPS68981.1|  hypothetical protein M569_05787                         265   2e-75    
gb|EEC74963.1|  hypothetical protein OsI_10954                          267   2e-75    
ref|XP_010495278.1|  PREDICTED: putative U-box domain-containing ...    259   2e-75    
ref|XP_006833209.1|  hypothetical protein AMTR_s00072p00171260          265   3e-75    
ref|XP_006418891.1|  hypothetical protein EUTSA_v10002430mg             265   4e-75    
gb|EYU30050.1|  hypothetical protein MIMGU_mgv1a002663mg                265   4e-75    
ref|NP_190235.1|  U-box domain-containing protein 13                    265   4e-75    
gb|KFK33987.1|  hypothetical protein AALP_AA5G087000                    265   4e-75    
ref|XP_011038670.1|  PREDICTED: U-box domain-containing protein 1...    263   4e-75    
ref|NP_001049711.1|  Os03g0275900                                       266   4e-75    
ref|XP_002876275.1|  armadillo/beta-catenin repeat family protein       264   5e-75    
gb|KEH43492.1|  armadillo/beta-catenin repeat protein                   259   5e-75    
ref|XP_002877490.1|  armadillo/beta-catenin repeat family protein       265   5e-75    
ref|XP_008800544.1|  PREDICTED: U-box domain-containing protein 1...    264   6e-75    
gb|KDO64708.1|  hypothetical protein CISIN_1g006669mg                   261   7e-75    
ref|XP_011070638.1|  PREDICTED: U-box domain-containing protein 1...    264   8e-75    
gb|EYU36264.1|  hypothetical protein MIMGU_mgv1a002554mg                264   9e-75    
ref|XP_006290265.1|  hypothetical protein CARUB_v10016804mg             264   1e-74    
ref|XP_010033134.1|  PREDICTED: U-box domain-containing protein 1...    264   1e-74    
ref|XP_006403526.1|  hypothetical protein EUTSA_v10010199mg             263   1e-74    
ref|XP_006361678.1|  PREDICTED: U-box domain-containing protein 1...    263   1e-74    
ref|XP_008339570.1|  PREDICTED: U-box domain-containing protein 1...    263   2e-74    
ref|XP_011038668.1|  PREDICTED: U-box domain-containing protein 1...    263   2e-74    
ref|XP_006495051.1|  PREDICTED: U-box domain-containing protein 1...    262   2e-74    
ref|XP_003561780.1|  PREDICTED: protein spotted leaf 11-like            265   2e-74    
ref|XP_009105771.1|  PREDICTED: U-box domain-containing protein 1...    258   2e-74    
ref|XP_009150335.1|  PREDICTED: U-box domain-containing protein 13      263   2e-74    
dbj|BAJ85648.1|  predicted protein                                      264   2e-74    
ref|XP_001753438.1|  predicted protein                                  262   3e-74    
gb|KHN32252.1|  U-box domain-containing protein 10                      263   3e-74    
ref|XP_006841267.1|  hypothetical protein AMTR_s00135p00108920          262   3e-74    
ref|XP_003578975.1|  PREDICTED: protein spotted leaf 11-like            263   3e-74    
emb|CDY51234.1|  BnaA03g07040D                                          272   4e-74    
ref|XP_010112203.1|  U-box domain-containing protein 14                 261   4e-74    
ref|XP_003607915.1|  U-box domain-containing protein                    261   4e-74    
ref|XP_006649845.1|  PREDICTED: protein spotted leaf 11-like            264   4e-74    
emb|CBI26916.3|  unnamed protein product                                261   5e-74    
ref|XP_009140947.1|  PREDICTED: U-box domain-containing protein 12      262   5e-74    
emb|CDX68379.1|  BnaC01g24570D                                          262   5e-74    
ref|XP_006448286.1|  hypothetical protein CICLE_v10014584mg             261   5e-74    
ref|XP_003555889.1|  PREDICTED: U-box domain-containing protein 1...    262   5e-74    
ref|XP_008454770.1|  PREDICTED: U-box domain-containing protein 1...    262   5e-74    
gb|KFK44389.1|  hypothetical protein AALP_AA1G251200                    261   6e-74    
emb|CDY31736.1|  BnaA04g16720D                                          261   7e-74    
ref|XP_009421341.1|  PREDICTED: protein spotted leaf 11-like            261   9e-74    
ref|XP_002280520.1|  PREDICTED: U-box domain-containing protein 11      261   9e-74    
gb|KEH30892.1|  armadillo/beta-catenin repeat protein                   261   1e-73    
ref|XP_002890550.1|  armadillo/beta-catenin repeat family protein       260   1e-73    
gb|KDO64707.1|  hypothetical protein CISIN_1g006669mg                   260   1e-73    
ref|XP_004140474.1|  PREDICTED: U-box domain-containing protein 1...    260   1e-73    
ref|XP_010105768.1|  U-box domain-containing protein 11                 261   1e-73    
emb|CDY04746.1|  BnaC05g18430D                                          259   2e-73    
gb|AAO00878.1|  unknown protein                                         259   2e-73    
emb|CDX73439.1|  BnaC08g25640D                                          265   2e-73    
gb|AAB72157.1|  hypothetical protein                                    259   2e-73    
ref|XP_002315888.2|  hypothetical protein POPTR_0010s12410g             260   2e-73    
emb|CDY21412.1|  BnaA09g30150D                                          259   2e-73    
ref|NP_173716.1|  ARM repeat superfamily protein                        259   2e-73    
gb|KHN43042.1|  U-box domain-containing protein 10                      259   3e-73    
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13      260   3e-73    
ref|XP_009115567.1|  PREDICTED: U-box domain-containing protein 11      259   3e-73    
ref|XP_004161193.1|  PREDICTED: U-box domain-containing protein 1...    260   4e-73    
ref|NP_001117582.1|  ARM repeat superfamily protein                     255   4e-73    
ref|XP_004984735.1|  PREDICTED: protein spotted leaf 11-like isof...    259   4e-73    
ref|XP_009417655.1|  PREDICTED: U-box domain-containing protein 10      260   4e-73    
gb|KEH43493.1|  armadillo/beta-catenin repeat protein                   259   4e-73    
ref|XP_009415649.1|  PREDICTED: U-box domain-containing protein 1...    259   6e-73    
ref|XP_003528526.1|  PREDICTED: U-box domain-containing protein 1...    259   7e-73    
emb|CDX86080.1|  BnaC03g55950D                                          259   7e-73    
gb|KFK41527.1|  hypothetical protein AALP_AA2G141100                    258   7e-73    
emb|CAB41099.1|  putative protein                                       258   9e-73    
ref|XP_004505257.1|  PREDICTED: U-box domain-containing protein 1...    259   9e-73    
ref|XP_002968976.1|  hypothetical protein SELMODRAFT_231208             258   9e-73    
ref|XP_009149975.1|  PREDICTED: U-box domain-containing protein 1...    258   1e-72    
ref|XP_010067333.1|  PREDICTED: U-box domain-containing protein 14      258   1e-72    
ref|XP_010274639.1|  PREDICTED: U-box domain-containing protein 1...    258   1e-72    
ref|XP_009105769.1|  PREDICTED: U-box domain-containing protein 1...    258   1e-72    
ref|XP_010552723.1|  PREDICTED: U-box domain-containing protein 11      257   1e-72    
gb|AAD55500.1|AC008148_10  Unknown protein                              255   1e-72    
gb|EMT11433.1|  Protein spotted leaf 11                                 256   1e-72    
sp|Q9ZV31.1|PUB12_ARATH  RecName: Full=U-box domain-containing pr...    258   2e-72    
emb|CDY51235.1|  BnaA03g07030D                                          254   2e-72    
ref|XP_010477585.1|  PREDICTED: U-box domain-containing protein 1...    257   2e-72    
ref|XP_009103205.1|  PREDICTED: U-box domain-containing protein 1...    256   2e-72    
ref|XP_008243346.1|  PREDICTED: U-box domain-containing protein 11      257   2e-72    
ref|XP_002526006.1|  E3 ubiquitin ligase PUB14, putative                257   3e-72    
ref|XP_007157719.1|  hypothetical protein PHAVU_002G092600g             257   3e-72    
ref|XP_004298462.1|  PREDICTED: U-box domain-containing protein 1...    256   3e-72    
ref|XP_006416130.1|  hypothetical protein EUTSA_v10007104mg             256   4e-72    
ref|XP_010460079.1|  PREDICTED: U-box domain-containing protein 11      256   4e-72    
ref|XP_010498796.1|  PREDICTED: U-box domain-containing protein 1...    256   4e-72    
gb|AAK59543.1|  unknown protein                                         257   5e-72    
gb|ABG22055.1|  Spotted leaf protein 11, putative, expressed            254   5e-72    
gb|ABA99652.1|  Spotted leaf protein 11, putative, expressed            254   5e-72    
emb|CDX96295.1|  BnaA07g29060D                                          256   5e-72    
ref|XP_010916174.1|  PREDICTED: U-box domain-containing protein 1...    256   5e-72    
emb|CDY25764.1|  BnaA07g10180D                                          255   6e-72    
gb|KDP38040.1|  hypothetical protein JCGZ_04683                         256   6e-72    
ref|XP_011075713.1|  PREDICTED: U-box domain-containing protein 1...    256   7e-72    
ref|XP_009785565.1|  PREDICTED: U-box domain-containing protein 1...    256   8e-72    
ref|XP_007045104.1|  U-box domain-containing protein 10                 256   8e-72    
ref|XP_002990024.1|  hypothetical protein SELMODRAFT_184959             256   9e-72    
emb|CDP00753.1|  unnamed protein product                                256   1e-71    
gb|EMS63526.1|  E3 ubiquitin-protein ligase SPL11                       258   1e-71    
ref|XP_002965709.1|  ubiquitin-protein ligase, PUB12                    255   1e-71    
gb|EEC69528.1|  hypothetical protein OsI_38799                          255   1e-71    
ref|NP_177258.3|  ARM repeat superfamily protein                        255   1e-71    
ref|XP_009630244.1|  PREDICTED: U-box domain-containing protein 1...    255   2e-71    
ref|XP_006664118.1|  PREDICTED: protein spotted leaf 11-like            253   2e-71    
ref|NP_001067077.2|  Os12g0570000                                       254   2e-71    
ref|XP_004236974.1|  PREDICTED: U-box domain-containing protein 1...    254   3e-71    
ref|XP_011023140.1|  PREDICTED: U-box domain-containing protein 1...    254   4e-71    
ref|XP_011023132.1|  PREDICTED: U-box domain-containing protein 1...    254   5e-71    
sp|A2ZLU6.2|SL11_ORYSI  RecName: Full=Protein spotted leaf 11; Al...    254   6e-71    
ref|XP_006360416.1|  PREDICTED: U-box domain-containing protein 1...    253   1e-70    
ref|XP_006306975.1|  hypothetical protein CARUB_v10008550mg             253   1e-70    
ref|NP_565676.4|  U-box E3 ubiquitin ligase                             258   1e-70    
ref|XP_002311496.2|  hypothetical protein POPTR_0008s12760g             253   1e-70    
ref|XP_002873885.1|  hypothetical protein ARALYDRAFT_909843             248   1e-70    
ref|XP_006300861.1|  hypothetical protein CARUB_v10019954mg             252   2e-70    
gb|EAZ20925.1|  hypothetical protein OsJ_36575                          254   2e-70    
gb|ADB85351.1|  putative spotted leaf protein 11                        257   3e-70    
ref|XP_002971622.1|  ubiquitin-protein ligase, PUB12                    251   3e-70    
ref|XP_007221973.1|  hypothetical protein PRUPE_ppa002756mg             251   3e-70    
gb|KFK26673.1|  hypothetical protein AALP_AA8G277900                    251   3e-70    
ref|XP_010427916.1|  PREDICTED: U-box domain-containing protein 10      250   6e-70    
ref|XP_006409917.1|  hypothetical protein EUTSA_v10016364mg             248   6e-70    
ref|XP_009402317.1|  PREDICTED: protein spotted leaf 11-like            251   8e-70    
ref|XP_010470044.1|  PREDICTED: U-box domain-containing protein 1...    251   8e-70    
ref|XP_006390814.1|  hypothetical protein EUTSA_v10018269mg             250   8e-70    
emb|CDY12497.1|  BnaC07g13370D                                          249   9e-70    
ref|XP_010510574.1|  PREDICTED: U-box domain-containing protein 12      251   9e-70    
ref|XP_004962703.1|  PREDICTED: protein spotted leaf 11-like            251   1e-69    
ref|XP_008775205.1|  PREDICTED: U-box domain-containing protein 1...    250   1e-69    
ref|XP_008672017.1|  PREDICTED: uncharacterized protein LOC100191...    249   2e-69    
ref|XP_010471108.1|  PREDICTED: U-box domain-containing protein 1...    249   2e-69    
ref|XP_010415797.1|  PREDICTED: U-box domain-containing protein 1...    249   3e-69    
ref|XP_009797524.1|  PREDICTED: U-box domain-containing protein 1...    249   3e-69    
ref|XP_002881013.1|  armadillo/beta-catenin repeat family protein       249   3e-69    
ref|XP_010681970.1|  PREDICTED: U-box domain-containing protein 11      249   4e-69    
ref|XP_006409918.1|  hypothetical protein EUTSA_v10016364mg             248   5e-69    
emb|CDX99112.1|  BnaA06g18030D                                          247   1e-68    
gb|KEH22840.1|  armadillo/beta-catenin repeat protein                   246   2e-68    
emb|CDX77213.1|  BnaC04g40080D                                          246   2e-68    
ref|XP_001772932.1|  predicted protein                                  244   2e-68    
gb|KFK26071.1|  hypothetical protein AALP_AA8G199300                    242   2e-68    
emb|CDX70805.1|  BnaC03g08890D                                          254   4e-68    
ref|XP_007218867.1|  hypothetical protein PRUPE_ppa003139mg             245   4e-68    
ref|XP_004238849.1|  PREDICTED: U-box domain-containing protein 11      246   4e-68    
ref|XP_004515619.1|  PREDICTED: U-box domain-containing protein 1...    245   5e-68    
ref|NP_197335.1|  U-box domain-containing protein 48                    240   9e-68    
ref|XP_009407488.1|  PREDICTED: protein spotted leaf 11-like            244   2e-67    
ref|XP_006293619.1|  hypothetical protein CARUB_v10022571mg             249   2e-67    
ref|XP_002888814.1|  armadillo/beta-catenin repeat family protein       244   2e-67    
ref|XP_006344225.1|  PREDICTED: U-box domain-containing protein 1...    243   5e-67    
gb|KFK26132.1|  hypothetical protein AALP_AA8G207700                    238   6e-67    
gb|KCW85583.1|  hypothetical protein EUGRSUZ_B02378                     243   1e-66    
emb|CBI31426.3|  unnamed protein product                                239   1e-66    
ref|XP_003550969.1|  PREDICTED: U-box domain-containing protein 1...    234   1e-66    
ref|NP_197334.1|  putative U-box domain-containing protein 47           236   1e-66    
ref|XP_010414478.1|  PREDICTED: U-box domain-containing protein 1...    245   2e-66    
ref|XP_009596674.1|  PREDICTED: U-box domain-containing protein 1...    241   3e-66    
ref|XP_001772291.1|  predicted protein                                  240   4e-66    
ref|XP_010535503.1|  PREDICTED: U-box domain-containing protein 13      239   2e-65    
gb|KHG01616.1|  U-box domain-containing 15 -like protein                237   5e-65    
emb|CDX72769.1|  BnaC06g32170D                                          236   7e-65    
ref|XP_009131652.1|  PREDICTED: putative U-box domain-containing ...    233   8e-65    
ref|XP_009131651.1|  PREDICTED: putative U-box domain-containing ...    234   8e-65    
dbj|BAD94341.1|  hypothetical protein                                   228   1e-64    
ref|XP_002280063.2|  PREDICTED: U-box domain-containing protein 1...    235   2e-64    
ref|XP_002970194.1|  hypothetical protein SELMODRAFT_61948              226   6e-64    
emb|CBI19855.3|  unnamed protein product                                235   6e-64    
ref|XP_009334185.1|  PREDICTED: U-box domain-containing protein 1...    232   6e-64    
gb|KHN29326.1|  U-box domain-containing protein 15                      232   1e-63    
ref|XP_002313587.2|  hypothetical protein POPTR_0009s16740g             233   2e-63    
ref|XP_006287690.1|  hypothetical protein CARUB_v10000898mg             229   2e-63    
ref|XP_006289822.1|  hypothetical protein CARUB_v10003427mg             228   2e-63    
ref|XP_011000894.1|  PREDICTED: U-box domain-containing protein 1...    233   2e-63    



>ref|XP_009593412.1| PREDICTED: U-box domain-containing protein 9 [Nicotiana tomentosiformis]
Length=458

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/436 (71%), Positives = 364/436 (83%), Gaps = 14/436 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLH---------PEQNNNSFPAEFRCPLS  154
             ELQR VKA++SED +N +AID+  Q L AL+ L          P  +    P EFRCPLS
Sbjct  26    ELQRLVKAILSEDEINVDAIDKTHQTLFALKDLKLKRQSSFRTPPDSARVLPDEFRCPLS  85

Query  155   GELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKV  334
              ELM+DPV+VS+GQTYDRPFIQKWLN+GNR CP+TQQVLSHTILTPNHLIR MIS WCK 
Sbjct  86    KELMRDPVIVSTGQTYDRPFIQKWLNAGNRTCPRTQQVLSHTILTPNHLIREMISQWCKN  145

Query  335   NGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRA  514
             NGI  PDP VQ LN++G+ T+ADR  F  LLEKMSS    Q+ AARELRLLTK+MPSFRA
Sbjct  146   NGIQMPDP-VQYLNDEGL-TEADRDLFFSLLEKMSSILSDQKVAARELRLLTKKMPSFRA  203

Query  515   LFGESMGAAMPKLLSPFSRVD--VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLI  688
             LFGES   A+P+L+ P SR +  VHP+LQEDIITT+LNLSIHD+NKKLVAETP V+ +L+
Sbjct  204   LFGES-ADAIPQLMRPLSRSNSGVHPNLQEDIITTLLNLSIHDNNKKLVAETPMVVPLLM  262

Query  689   DSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIF  868
             D+LRSG IETRSNAAAA+FTLSALDSNK LIGKSGALKPL++LL+EG+ +AMKDVASAIF
Sbjct  263   DALRSGTIETRSNAAAALFTLSALDSNKELIGKSGALKPLVELLDEGNPVAMKDVASAIF  322

Query  869   VLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSL  1048
              LC++H+NKARA+RDGAVRV+++KIMN VHVDELLAILAMLS+N +AIEEMG+LGAVP L
Sbjct  323   SLCIIHDNKARAVRDGAVRVILKKIMNNVHVDELLAILAMLSTNQKAIEEMGDLGAVPCL  382

Query  1049  LSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
             +++IR+TSCAR+KENCI ILY IC  DRTK K I+DEE ++GTISQLAQNGT+RAKRKA+
Sbjct  383   VNIIRETSCARSKENCIAILYTICYTDRTKWKIIRDEEKTYGTISQLAQNGTARAKRKAN  442

Query  1229  GVLDRLNRGVGFIHTA  1276
             G+LDRLNR V   HTA
Sbjct  443   GILDRLNRAVNLTHTA  458



>ref|XP_011089638.1| PREDICTED: U-box domain-containing protein 9-like [Sesamum indicum]
Length=463

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/444 (69%), Positives = 369/444 (83%), Gaps = 22/444 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQN---------------NNSFPAE  136
             ELQ+ VKAV  +D VN EA++RAQ+ LCAL+    +++                 + P E
Sbjct  23    ELQKLVKAVADDDDVNLEAVERAQRMLCALKDFKLKKSVSLNLRDHHYGQGMVAGTVPEE  82

Query  137   FRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMI  316
             F+CPLS ELM+DPV+++SGQT+DRPFIQKWL +GNR CP+TQQVLSHTILTPNHLIR MI
Sbjct  83    FKCPLSKELMRDPVIIASGQTFDRPFIQKWLKAGNRTCPRTQQVLSHTILTPNHLIREMI  142

Query  317   SNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKR  496
             + WCK +GI  PD  V  +NE+G+ T+ADR +FL LL+KMSS+   Q+ AA++LRLLTKR
Sbjct  143   AEWCKNHGIKLPDS-VHYINEEGL-TEADRDHFLSLLKKMSSTLADQKEAAKDLRLLTKR  200

Query  497   MPSFRALFGESMGAAMPKLLSPFS----RVDVHPDLQEDIITTILNLSIHDSNKKLVAET  664
             MPSFRALF ES+GA +P+LLSPFS    + ++HPDLQED+ITT+LNLSIHD+NKKLVAET
Sbjct  201   MPSFRALFSESLGA-IPQLLSPFSQSKCKSELHPDLQEDLITTLLNLSIHDNNKKLVAET  259

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
             P VI +L+D+LRSG IETRSNAAAA+FTLSALDSNKALIGKSGALKPLIDLLEEGH LAM
Sbjct  260   PMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKALIGKSGALKPLIDLLEEGHPLAM  319

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KDVASAIF LC++HENK RA+RDGAVRV+++KI +RVHVDELLAILAMLS++ +AIEEMG
Sbjct  320   KDVASAIFSLCIIHENKVRAVRDGAVRVVLKKITSRVHVDELLAILAMLSTSQKAIEEMG  379

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             ELGAVP L S+IR+TSCARNKENCI ILY IC  DR+K KE+++EES+H TISQLAQNGT
Sbjct  380   ELGAVPCLFSIIRETSCARNKENCIAILYTICFNDRSKWKEMREEESTHHTISQLAQNGT  439

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRAKRKASG+LDRLNR V   HTA
Sbjct  440   SRAKRKASGILDRLNRVVNLTHTA  463



>ref|XP_009761949.1| PREDICTED: U-box domain-containing protein 9 [Nicotiana sylvestris]
Length=458

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/436 (69%), Positives = 362/436 (83%), Gaps = 14/436 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNN---------SFPAEFRCPLS  154
             ELQR VKA++SED +N +AID+  Q L AL+ L  ++ ++           P EFRC LS
Sbjct  26    ELQRLVKAILSEDDINVDAIDKTHQTLFALKDLKLKRQSSFRTSPDSARVLPDEFRCSLS  85

Query  155   GELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKV  334
              ELM+DPV+VS+GQTYDRPFIQKWL +GNR CP+TQQVLSHTILTPNHLIR MIS WCK 
Sbjct  86    KELMRDPVIVSTGQTYDRPFIQKWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCKN  145

Query  335   NGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRA  514
             NGI  PDP VQ LN++G  T+ADR  F  LLEKMSS    Q+ AARELRLLTK+MPSFRA
Sbjct  146   NGIQMPDP-VQYLNDEGS-TEADRDLFFSLLEKMSSILSDQKVAARELRLLTKKMPSFRA  203

Query  515   LFGESMGAAMPKLLSPFSRVD--VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLI  688
             LFGES   A+P+LL P SR +  VHP+LQEDIITT+LNLSIHD+NKKLVAETP V+ +L+
Sbjct  204   LFGES-ADAIPQLLRPLSRSNSGVHPNLQEDIITTLLNLSIHDNNKKLVAETPMVVPLLM  262

Query  689   DSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIF  868
             D+LRSG IETRSNAAAA+FTLSALDSNK LIGKSGALKPL++L++EG+ +AMKDVASAIF
Sbjct  263   DALRSGTIETRSNAAAALFTLSALDSNKELIGKSGALKPLVELVDEGNPVAMKDVASAIF  322

Query  869   VLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSL  1048
              LC++H+NKARA+RDGAVRV+++ IMN VHVDELLAILAMLS+N +AIEEMG+LGAVP L
Sbjct  323   SLCIIHDNKARAVRDGAVRVILKNIMNNVHVDELLAILAMLSTNQKAIEEMGDLGAVPCL  382

Query  1049  LSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
             L++IR+TSCAR+KENCI ILY IC  DRTK K I+DEE ++GT+SQLA+NGT+RAKRKA+
Sbjct  383   LNIIRETSCARSKENCIAILYTICYTDRTKWKIIRDEEKTYGTVSQLAENGTARAKRKAN  442

Query  1229  GVLDRLNRGVGFIHTA  1276
             G+LDRLNR V   HTA
Sbjct  443   GILDRLNRAVNLTHTA  458



>ref|XP_011089033.1| PREDICTED: U-box domain-containing protein 9-like [Sesamum indicum]
 ref|XP_011089034.1| PREDICTED: U-box domain-containing protein 9-like [Sesamum indicum]
 ref|XP_011089035.1| PREDICTED: U-box domain-containing protein 9-like [Sesamum indicum]
Length=463

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/444 (68%), Positives = 362/444 (82%), Gaps = 22/444 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR----------GLHPEQNNN-----SFPAE  136
             ELQR V+A+V ED VN EA+D+AQQ L ALR           LH    +N     + P E
Sbjct  23    ELQRMVRAIVDEDDVNLEALDKAQQMLFALRELKLKKTVSLKLHNHHYDNEMASGTVPEE  82

Query  137   FRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMI  316
             F+CPLS ELM+DPV++++GQTYD+PFIQKWL +GNR CP TQQVLSHTILTPNHLIR MI
Sbjct  83    FKCPLSKELMRDPVIIATGQTYDKPFIQKWLKAGNRTCPLTQQVLSHTILTPNHLIREMI  142

Query  317   SNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKR  496
               WCK +GI  PD  V  ++E+G+ T ADR +FL LL KMS +   Q+ AA+ELRLLTKR
Sbjct  143   MQWCKNHGIKLPDS-VSYMSEEGL-TGADRDHFLSLLGKMSLTLSEQKEAAKELRLLTKR  200

Query  497   MPSFRALFGESMGAAMPKLLSPFSRV----DVHPDLQEDIITTILNLSIHDSNKKLVAET  664
             MPSFRALFGES+ A +P+LLSP S+     +VHPDLQED+ITT+LNLSIHD+NKKLVAET
Sbjct  201   MPSFRALFGESVDA-IPQLLSPLSQSNCESEVHPDLQEDVITTLLNLSIHDNNKKLVAET  259

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
             P VI +LID+L++G IETRSNAAA +FTLSALDSNKALIGKSGALKPLIDLL+EGH LAM
Sbjct  260   PTVIPLLIDALKTGTIETRSNAAATLFTLSALDSNKALIGKSGALKPLIDLLDEGHPLAM  319

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KDVASAIF LC++HENK RA+RDGAVRV+++KIM+R+HVDELL+ILAMLS+N +AIEEMG
Sbjct  320   KDVASAIFNLCIIHENKVRAVRDGAVRVILKKIMSRLHVDELLSILAMLSTNQKAIEEMG  379

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             EL AVP LLS+IR+TSC RNKENCI ILY IC +DR+K K +++EES + TISQLAQNGT
Sbjct  380   ELEAVPCLLSIIRETSCDRNKENCIAILYTICFSDRSKWKVMREEESMYRTISQLAQNGT  439

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRAKRKASG+L+RLNR V   HTA
Sbjct  440   SRAKRKASGILERLNRAVNLTHTA  463



>ref|XP_004247038.1| PREDICTED: U-box domain-containing protein 9 [Solanum lycopersicum]
Length=449

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/431 (68%), Positives = 365/431 (85%), Gaps = 9/431 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS----FPAEFRCPLSGELMK  169
             ELQR VKA++S++ +N +AID+ QQ L  L+ L  +++ +S    FP EFRCPLS +LM 
Sbjct  22    ELQRLVKAILSQEEINVDAIDKTQQILLDLKELKIKRSPSSLDLPFPDEFRCPLSKQLMT  81

Query  170   DPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWF  349
             DPV+++SGQTYDRPFIQKWL +GNR CPQTQQVLSHTILTPNHLIR MIS WCK NGI  
Sbjct  82    DPVMLASGQTYDRPFIQKWLKAGNRTCPQTQQVLSHTILTPNHLIRNMISQWCKNNGIQM  141

Query  350   PDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGES  529
             PD  VQ LN++G+ T+ADR  FL LLEKMSS+   Q+ AARELRLLTK+MPSFR+LFGES
Sbjct  142   PDS-VQYLNDEGL-TEADRDLFLSLLEKMSSTLSDQKVAARELRLLTKKMPSFRSLFGES  199

Query  530   MGAAMPKLLSPFSRVD--VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRS  703
                A+P+L+ P S+ +  V+P+LQEDIITT+LNLSIHD+NKKLVAETP+VI +L+++LRS
Sbjct  200   -ADAIPQLVRPLSQSNSNVNPNLQEDIITTLLNLSIHDNNKKLVAETPKVIPLLVEALRS  258

Query  704   GAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVL  883
             G IETRSNAAAA+FTLSALDSNK LIGKSGALKPL++LL+EG+ +AMKDVASA+F LC++
Sbjct  259   GTIETRSNAAAALFTLSALDSNKELIGKSGALKPLVELLDEGNPVAMKDVASALFSLCII  318

Query  884   HENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIR  1063
              +NKARA+RDGAVR +++KIM+ VHVDELLAILAMLS+N +A+EEMG+LGAV  LL++IR
Sbjct  319   QDNKARAVRDGAVRAILKKIMSNVHVDELLAILAMLSNNQKAVEEMGDLGAVTCLLNIIR  378

Query  1064  DTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDR  1243
             +TSC R+KENCI +LY IC +DRTK K ++DEE ++GTISQLAQNGT+RAKRKA+G+LDR
Sbjct  379   ETSCGRSKENCIAVLYTICYSDRTKWKTLRDEEKTYGTISQLAQNGTARAKRKANGILDR  438

Query  1244  LNRGVGFIHTA  1276
             LNR +   HTA
Sbjct  439   LNRAINLTHTA  449



>ref|XP_006361322.1| PREDICTED: U-box domain-containing protein 9-like [Solanum tuberosum]
Length=449

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/431 (69%), Positives = 368/431 (85%), Gaps = 9/431 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF----PAEFRCPLSGELMK  169
             ELQR VKA++S++ +N +AID+ QQ L AL+ L  ++ ++SF    P EFRCPLS +LM+
Sbjct  22    ELQRLVKAILSQEEINVDAIDKTQQILLALKELKLKRRSSSFDLPFPEEFRCPLSKQLMR  81

Query  170   DPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWF  349
             DPV+++SGQTYDRPFIQKWL +GNR CPQTQQVLSHTILTPNHLIR MIS WCK NGI  
Sbjct  82    DPVMLASGQTYDRPFIQKWLKAGNRTCPQTQQVLSHTILTPNHLIRDMISQWCKNNGIQM  141

Query  350   PDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGES  529
             PD  VQ LN++G+ T+ADR  FL LLEKMSS+   Q+ AARELRLLTK+MPSFR+LFGES
Sbjct  142   PDS-VQFLNDEGL-TEADRDLFLSLLEKMSSTLSDQKVAARELRLLTKKMPSFRSLFGES  199

Query  530   MGAAMPKLLSPFSRVD--VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRS  703
                A+P+L+ P S+ +  V+P+LQEDIITT+LNLSIHD+NKKLVAETP+VI +L+D+LRS
Sbjct  200   -ADAIPQLVRPLSQSNSNVNPNLQEDIITTLLNLSIHDNNKKLVAETPKVIPLLVDALRS  258

Query  704   GAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVL  883
             G IETRSNAAAA+FTLSALDSNK LIGKSGALKPL++LL+EG+ +AMKDVASA+F LC++
Sbjct  259   GTIETRSNAAAALFTLSALDSNKELIGKSGALKPLVELLDEGNPVAMKDVASALFSLCII  318

Query  884   HENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIR  1063
              +NKARA+RDGAVR +++KIM+ VHVDELLAILAMLS+N +A+EEMG+LGAV  LL++IR
Sbjct  319   QDNKARAVRDGAVRAILKKIMSNVHVDELLAILAMLSNNQKAVEEMGDLGAVTCLLNIIR  378

Query  1064  DTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDR  1243
             +TSCAR+KENCI +LY IC +DRTK K ++DEE ++GTISQLAQNGT+RAKRKA+G+LDR
Sbjct  379   ETSCARSKENCIAVLYTICYSDRTKWKTLRDEEKTYGTISQLAQNGTARAKRKANGILDR  438

Query  1244  LNRGVGFIHTA  1276
             LNR +   HTA
Sbjct  439   LNRAINLTHTA  449



>ref|XP_002263607.1| PREDICTED: U-box domain-containing protein 9 [Vitis vinifera]
 emb|CBI23501.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/434 (66%), Positives = 363/434 (84%), Gaps = 12/434 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQN-------NNSFPAEFRCPLSGE  160
             ELQR VK++V +D  + E +DRA++ALC+++ L  +++        +SFP EFRCPLS E
Sbjct  19    ELQRLVKSIVEDDDYSVEVMDRAREALCSIKDLKVKRSMSLKLHGPHSFPEEFRCPLSRE  78

Query  161   LMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNG  340
             +M+DPV++++GQTYDRPFIQKWL +GNR CP TQQVLSHT+LTPNHLIR MIS WC+ +G
Sbjct  79    MMRDPVILATGQTYDRPFIQKWLKAGNRTCPLTQQVLSHTMLTPNHLIREMISQWCQSHG  138

Query  341   IWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALF  520
             I   DP  Q  NED ++ DADR  F+ LLEKMSSS+  Q+ AA+ELRLLTKRMPSFRALF
Sbjct  139   IELTDPD-QYSNEDQIM-DADRSRFIDLLEKMSSSALEQKEAAKELRLLTKRMPSFRALF  196

Query  521   GESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDS  694
             GES+ A +P+LL+PFS  +  +HPDLQED+ITT+LNLSIHD+NKKLVAETP VI +L+D+
Sbjct  197   GESLDA-IPQLLNPFSQNKGGIHPDLQEDLITTLLNLSIHDNNKKLVAETPMVIPLLMDA  255

Query  695   LRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVL  874
             L+SG IETRSNAAA IFTLSALDSNKALIGKSG LKPLIDLLEEGH   MKDVASAIF L
Sbjct  256   LKSGTIETRSNAAATIFTLSALDSNKALIGKSGVLKPLIDLLEEGHPSVMKDVASAIFNL  315

Query  875   CVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLS  1054
             C++HENK+RA+ +GAV+VL++KIMN+ HVDELLAILAMLS++ +AIEEMG+LGAV  LL+
Sbjct  316   CIIHENKSRAVHEGAVKVLMKKIMNQTHVDELLAILAMLSTHQKAIEEMGDLGAVSCLLT  375

Query  1055  LIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGV  1234
             +IR++SC RNKENCI IL+++C  DRTKL+E+++EE+++ TIS+L+Q GT+RAKRKA+G+
Sbjct  376   IIRESSCDRNKENCIAILHSVCLNDRTKLRELREEENTYRTISKLSQTGTARAKRKANGI  435

Query  1235  LDRLNRGVGFIHTA  1276
             L+RL R +   HTA
Sbjct  436   LERLRRALNITHTA  449



>emb|CDP03938.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/439 (69%), Positives = 360/439 (82%), Gaps = 17/439 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS----------FPAEFRCPL  151
             ELQ+ VKA+   D VN +A+D+A + LCAL+ L  ++ + S           P EFRCPL
Sbjct  28    ELQKIVKAIAEGDDVNLDALDKAHRLLCALKELKIKKRSLSSKIHDSSSLTVPDEFRCPL  87

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             S ELM+DPV+V++GQTYDRPFIQKWL  GNR CP+TQQVLSHTILTPNHLIR MIS WCK
Sbjct  88    SEELMRDPVIVATGQTYDRPFIQKWLKGGNRTCPRTQQVLSHTILTPNHLIREMISQWCK  147

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
              NGI  PDP  Q   +DG  T+ADR  F+ LL KMSSS   Q+ +AR+LRLLTKRMPSFR
Sbjct  148   NNGIQLPDP-TQYSEDDGP-TEADRDRFISLLSKMSSSLSDQKESARDLRLLTKRMPSFR  205

Query  512   ALFGESMGAAMPKLLSPFSRV----DVHPDLQEDIITTILNLSIHDSNKKLVAETPRVIS  679
             ALFGES+ A +P+LLSP S+     D+HPD+QEDIITT+LNLSIHD+NKKLVAETP VI 
Sbjct  206   ALFGESLDA-IPQLLSPISKSKSPSDIHPDMQEDIITTLLNLSIHDNNKKLVAETPMVIP  264

Query  680   VLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVAS  859
             +L+D+LRSG IETRSNAAAA+FTLSALDSNKALIGKSGALKPLIDLL+EGH++AMKDVAS
Sbjct  265   LLMDALRSGTIETRSNAAAALFTLSALDSNKALIGKSGALKPLIDLLDEGHNIAMKDVAS  324

Query  860   AIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAV  1039
             AIF LC+LHENKARA+RDGAV+V+++KI NRV VDELLAILAMLS+N +A+EEM E  AV
Sbjct  325   AIFNLCILHENKARAVRDGAVKVILKKITNRVLVDELLAILAMLSNNQKAVEEMVEFEAV  384

Query  1040  PSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKR  1219
             P L S++R+T+CARNKENCI ILY IC +DRTK KE+++E+ ++GTISQL QNGTSRAKR
Sbjct  385   PCLFSIMRETACARNKENCIAILYTICFSDRTKWKEMREEDRTYGTISQLVQNGTSRAKR  444

Query  1220  KASGVLDRLNRGVGFIHTA  1276
             KASG+L+RLNR V   HTA
Sbjct  445   KASGILERLNRAVNLTHTA  463



>ref|XP_008244686.1| PREDICTED: U-box domain-containing protein 9 isoform X1 [Prunus 
mume]
 ref|XP_008244687.1| PREDICTED: U-box domain-containing protein 9 isoform X1 [Prunus 
mume]
Length=456

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/437 (67%), Positives = 359/437 (82%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR V+A+V ++  + + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVRAIVDDEDFSTQTIDQAKDTLSALKELKFKKRSLSLKLNDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDRPFIQK L +GNRICP+TQQVLSHTILTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRPFIQKGLKAGNRICPRTQQVLSHTILTPNHLVREMISQWCKNR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP V  +NEDG+ T+++R +FL LL+KMSS    Q+ AA+ELR LTKRMPSFRAL
Sbjct  143   GIELSDP-VLLVNEDGI-TESERDHFLSLLQKMSSGLPEQKEAAKELRSLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES+ A +P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVAE+P VI +L
Sbjct  201   FGESIHA-IPQLLSPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKLVAESPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAI
Sbjct  260   IEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDGAVR +++KI NR+HVDELLAILAMLSS+ +A+EEMGELGAVP 
Sbjct  320   FNLCITHENKARAVRDGAVRTILKKIRNRMHVDELLAILAMLSSHPKAVEEMGELGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LAQNGTSR+KRKA
Sbjct  380   LLCVIRETNCGRNKENCIAVLHTICLNDRTKWKEIREEENTYGTISELAQNGTSRSKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRTVNLTHTA  456



>ref|XP_007199834.1| hypothetical protein PRUPE_ppa005537mg [Prunus persica]
 gb|EMJ01033.1| hypothetical protein PRUPE_ppa005537mg [Prunus persica]
Length=456

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/437 (67%), Positives = 358/437 (82%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR V+A+V ++  + + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVRAIVDDEDFSTQTIDQAKDTLSALKELKFKKRSLSLKLNDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDRPFIQK L +GNRICP+TQQVLSHTILTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRPFIQKGLKAGNRICPRTQQVLSHTILTPNHLVREMISQWCKNR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP V  +NEDG+ T+++R +FL LL+KMSS    Q+ AA+ELR LTKRMPSFRAL
Sbjct  143   GIELSDP-VLLVNEDGI-TESERDHFLSLLQKMSSGLPEQKEAAKELRSLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES+ A +P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKK VAE+P VI +L
Sbjct  201   FGESIHA-IPQLLSPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKHVAESPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAI
Sbjct  260   IEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDGAVR +++KI NR+HVDELLAILAMLSS+ +A+EEMGELGAVP 
Sbjct  320   FNLCITHENKARAVRDGAVRTILKKIRNRMHVDELLAILAMLSSHPKAVEEMGELGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LAQNGTSR+KRKA
Sbjct  380   LLRVIRETNCGRNKENCIAVLHTICLNDRTKWKEIREEENTYGTISELAQNGTSRSKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRTVNLTHTA  456



>ref|XP_007049638.1| U-box domain-containing protein 9 [Theobroma cacao]
 gb|EOX93795.1| U-box domain-containing protein 9 [Theobroma cacao]
Length=462

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/443 (65%), Positives = 358/443 (81%), Gaps = 21/443 (5%)
 Frame = +2

Query  2     ELQRAVKAVVS-EDGVNAEAIDRAQQALCALRGLHPEQNNN-------------SFPAEF  139
             ELQR V+ +V  ED  + +AID+A+ ALCALR L   + +              S P EF
Sbjct  23    ELQRLVRTIVDDEDYYSVDAIDQAKDALCALRELKFNKQSTATTTSSLKFHEAVSCPEEF  82

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
             RCPLS ELM+DP++++SGQTYDRPFIQKWLN+GNR CP+TQQVLSHT LTPNHL+R MIS
Sbjct  83    RCPLSKELMRDPIILASGQTYDRPFIQKWLNAGNRTCPRTQQVLSHTALTPNHLVREMIS  142

Query  320   NWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRM  499
              WCK  G+   +P VQ   E+GV T A+  +F  LLEK+S++   Q+ AA+ELRLLTK+M
Sbjct  143   QWCKSQGLELRNP-VQYGKEEGV-TKAEHDHFFSLLEKLSATLPEQKEAAKELRLLTKKM  200

Query  500   PSFRALFGESMGAAMPKLLSPFS----RVDVHPDLQEDIITTILNLSIHDSNKKLVAETP  667
             PSFRALFGES+ A +P+LL+P S    +  VHPDLQED+ITT+LNLSIHDSNKKLVAETP
Sbjct  201   PSFRALFGESVDA-IPQLLTPLSGSKSQSGVHPDLQEDVITTLLNLSIHDSNKKLVAETP  259

Query  668   RVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMK  847
              VI +L+++LRS  IETRSNAAAA+FTLSALDSNKALIGKSGALKPLIDLL+EGH LAMK
Sbjct  260   MVIPLLMEALRSETIETRSNAAAALFTLSALDSNKALIGKSGALKPLIDLLDEGHPLAMK  319

Query  848   DVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGE  1027
             DVASAIF LC++HENKARA+RDGAVRV++EKIM+ VHVDELLAILAMLS++ RA+EE+GE
Sbjct  320   DVASAIFNLCIIHENKARAVRDGAVRVIIEKIMDGVHVDELLAILAMLSTHQRAVEEIGE  379

Query  1028  LGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTS  1207
             L AVP LL ++R+++C RNKENCI IL+ +C  DRTK K +++EE+++GTIS+LAQ+GTS
Sbjct  380   LEAVPCLLRIVRESTCERNKENCIAILHTVCLNDRTKWKALREEENTYGTISKLAQDGTS  439

Query  1208  RAKRKASGVLDRLNRGVGFIHTA  1276
             RAKRKA+G+L+RL R V   HTA
Sbjct  440   RAKRKATGILERLRRAVNITHTA  462



>ref|XP_002533499.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF28886.1| Spotted leaf protein, putative [Ricinus communis]
Length=456

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/437 (67%), Positives = 357/437 (82%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ VK++V +D    E ID+A++ LCALR L  ++ + S         P EF+CPLS 
Sbjct  23    ELQKFVKSIVDDDDYRIETIDQAKETLCALRDLKIKKRSLSLKLRETVSCPDEFKCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELMKDPV++++GQTYDRPFIQKWL +GNR CP TQQVLSHT+LTPNHLIR MIS WCK  
Sbjct  83    ELMKDPVILATGQTYDRPFIQKWLRAGNRTCPLTQQVLSHTVLTPNHLIREMISQWCKNQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             G+  PDP V+  N +G+ T+A+R  FL L+ KMSS    QR+AA+ELR LTKRMPSFRAL
Sbjct  143   GLELPDP-VRQGNGEGI-TEAERDQFLSLVGKMSSELPEQRAAAKELRRLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPF----SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES+ A +P+LL+P     S  +V  DLQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FGESVDA-IPQLLNPLLASKSASEVQADLQEDVITTLLNLSIHDNNKKLVAETPAVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I++LRSG I+TR+NAAAA+FTLSALDSNK+LIGKSGALKPLIDLLEEGH LAMKDVASAI
Sbjct  260   IEALRSGTIDTRTNAAAALFTLSALDSNKSLIGKSGALKPLIDLLEEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC +HENKARA+RDGAVRVL++KIM+ + VDELLA+LA+LSS+H+AIEEMGELGAVP 
Sbjct  320   FTLCFVHENKARAVRDGAVRVLLKKIMDGMLVDELLAMLAILSSHHKAIEEMGELGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+ SC RNKENCI IL+ ICS DRTK K +++EE+++GTIS+LA+ GTSRAKRKA
Sbjct  380   LLRIIRENSCERNKENCIAILHTICSNDRTKWKTVREEENAYGTISKLAREGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L++LNR V   HTA
Sbjct  440   NGILEKLNRIVNLTHTA  456



>gb|KHG24446.1| U-box domain-containing 9 -like protein [Gossypium arboreum]
Length=459

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/440 (65%), Positives = 357/440 (81%), Gaps = 18/440 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGL---HPEQNNNSF--------PAEFRCP  148
             ELQR V+ +V +D  +  AIDRA+ ALCALRGL   +   +  +F        P EF+CP
Sbjct  23    ELQRLVRTIVDDDEYSIHAIDRAKDALCALRGLIMFNKRSSPATFKLREAVPCPEEFKCP  82

Query  149   LSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWC  328
             LS ELM+DPV+++SGQTYDRPFIQKWLN+GNR CP+TQQVLSHTILTPNHLIR MIS WC
Sbjct  83    LSNELMRDPVILASGQTYDRPFIQKWLNAGNRTCPRTQQVLSHTILTPNHLIREMISQWC  142

Query  329   KVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSF  508
             K  GI   +P  QC  E+G+ T+A+   F  LL+K+S++   Q+ AA+ELRLLTK++PSF
Sbjct  143   KSQGIELSNPE-QCGREEGI-TEAECDRFFSLLDKLSAAVPEQKEAAKELRLLTKKVPSF  200

Query  509   RALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             RALFGES+ A + +LL+P SR +    VHPDLQED+ITT+LNLSIHDSNKKLVAETP V+
Sbjct  201   RALFGESVDA-ITQLLTPLSRCNSQSGVHPDLQEDVITTLLNLSIHDSNKKLVAETPMVV  259

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +L+++LRSG IETRSNAAA +FTLSALDSNK LIGKSG LKPLIDLL+EGH L MKDVA
Sbjct  260   PLLMEALRSGTIETRSNAAATLFTLSALDSNKVLIGKSGVLKPLIDLLDEGHPLTMKDVA  319

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF LC++HENKARA++DGAV+V+++KIM+ VHVDELLAILAMLS++ RAIEEMGELGA
Sbjct  320   SAIFNLCIIHENKARALKDGAVKVILKKIMDGVHVDELLAILAMLSTHQRAIEEMGELGA  379

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             VP LL ++R+++C RNKENCI IL+ +C  DRTK K +K+EE S+GTIS+LAQ+GTSR+K
Sbjct  380   VPCLLRIVRESNCERNKENCIAILHTVCLNDRTKWKALKEEEISYGTISKLAQDGTSRSK  439

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKA+G+L+RL R +   HTA
Sbjct  440   RKANGILERLRRAINITHTA  459



>ref|XP_009334276.1| PREDICTED: U-box domain-containing protein 9-like [Pyrus x bretschneideri]
Length=456

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/437 (66%), Positives = 355/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR VKA+V ++    + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVKAIVDDEDFTTQTIDQARDTLSALKELKLKKRSLSLKLKDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDRPFIQK L +GNRICP+TQQVL+HTILTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRPFIQKGLKAGNRICPRTQQVLTHTILTPNHLVREMISQWCKDQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP V  +NEDG+ T++DR +FL LL+KMSS+   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDP-VLLVNEDGI-TESDRDHFLSLLKKMSSTFPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES  A +P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FSESTHA-IPQLLSPLSEGKFGDGIHPELQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAI
Sbjct  260   MEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RD AV+ +++KI NRVHVDELLAILAMLSS+ +A+EEMGELG V  
Sbjct  320   FNLCITHENKARAVRDRAVKTILKKIANRVHVDELLAILAMLSSHPKAVEEMGELGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C RNKENCI IL+ IC  DRTK +EI++EE+++GTI++LAQNGTSRAKRKA
Sbjct  380   LLHVIRETNCGRNKENCIAILHTICLNDRTKWREIREEENAYGTITELAQNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRAVNLTHTA  456



>ref|XP_008348973.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Malus domestica]
Length=456

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/437 (66%), Positives = 354/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR VKA+V ++    + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVKAIVDDEDFTTQTIDQARDTLSALKELKLKKRSLSLKLKDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDRPFIQK L +GNRICP+TQQVL+HTILTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRPFIQKGLKAGNRICPRTQQVLTHTILTPNHLVREMISQWCKDR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP V  +NEDG+ T++DR +FL LL+KMSS+   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDP-VLLVNEDGI-TESDRDHFLSLLKKMSSTFPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES  A +P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FSESTHA-IPQLLSPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++LRSG I+TRSNAAAA+FTLSALDSNKALIGKSGAL PLI LL+EGH L MKDVASAI
Sbjct  260   MEALRSGTIQTRSNAAAALFTLSALDSNKALIGKSGALXPLIALLDEGHPLVMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+R+GAV+ +++KI NRVHVDELLAILAMLSS+ +A+EEMGELG V  
Sbjct  320   FNLCITHENKARAVREGAVKTILKKIANRVHVDELLAILAMLSSHPKAVEEMGELGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C RNKENCI IL+ IC  DRTK +EI++EE+++GTI++LAQNGTSRAKRKA
Sbjct  380   LLRVIRETNCGRNKENCIAILHTICLNDRTKWREIREEENAYGTITELAQNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRAVNLTHTA  456



>ref|XP_010100798.1| U-box domain-containing protein 9 [Morus notabilis]
 gb|EXB84496.1| U-box domain-containing protein 9 [Morus notabilis]
Length=456

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/437 (66%), Positives = 353/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR V+A+V ++  + E +D+A+ AL AL+ L   + + S         P EFRCPLS 
Sbjct  23    ELQRLVRAIVDDEDYSTETVDQAKDALFALKELKLRKRSVSLKLHDTLSSPPEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPVVVS+GQTYDRPFIQKWL +GNR CP T+QVLSHT L PNHLIR MIS WCK  
Sbjct  83    ELMRDPVVVSTGQTYDRPFIQKWLKAGNRTCPLTKQVLSHTNLIPNHLIREMISQWCKCR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP +  +NE+G+ T+ADR +FL LL KMSSS   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDP-LHYINEEGI-TEADRDHFLSLLGKMSSSLPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFS----RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES+ A +P+LL P S    +  + P++QED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FGESLDA-IPQLLRPLSEGKSQSGIQPEIQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++LRSG IETR+NAAAA+FTLSALDSNKALIGKSGALKPLIDLLEEGH +AMKDVASAI
Sbjct  260   VEALRSGTIETRTNAAAALFTLSALDSNKALIGKSGALKPLIDLLEEGHPMAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC++HENK R +RDGAV V++ KI NR+HVDELLAILAM++++ +A+EEMG+LGAVP 
Sbjct  320   FNLCIIHENKERVVRDGAVGVILRKITNRMHVDELLAILAMIATHQKAVEEMGDLGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL++IR+++C R+KEN I ILYAIC  DRTK KE+++EE   GTIS+LAQNGTSRAKRKA
Sbjct  380   LLNIIRESTCDRSKENGIAILYAICLNDRTKWKEMREEEKKFGTISKLAQNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+L+RLNR V   HTA
Sbjct  440   SGILERLNRAVNLTHTA  456



>ref|XP_009372197.1| PREDICTED: U-box domain-containing protein 9-like [Pyrus x bretschneideri]
Length=456

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/437 (66%), Positives = 354/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ  VKA+V ++    + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQWLVKAIVDDEDFTTQTIDQARDTLSALKELKLKKRSLSLKLKDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDRPFIQK L +GNRICP+TQQVL+HTILTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRPFIQKGLKAGNRICPRTQQVLTHTILTPNHLVREMISQWCKDQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP V  +NEDG+ T++DR +FL LL+KMSS+   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDP-VLLVNEDGI-TESDRDHFLSLLKKMSSTFPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES  A +P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FSESTHA-IPQLLSPLSEGKFGDGIHPELQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAI
Sbjct  260   MEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RD AV+ +++KI NRVHVDELLAILAMLSS+ +A+EEMGELG V  
Sbjct  320   FNLCITHENKARAVRDRAVKTILKKIANRVHVDELLAILAMLSSHPKAVEEMGELGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C RNKENCI IL+ IC  DRTK +EI++EE+++GTI++LAQNGTSRAKRKA
Sbjct  380   LLHVIRETNCGRNKENCIAILHTICLNDRTKWREIREEENAYGTITELAQNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRAVNLTHTA  456



>ref|XP_006484813.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Citrus sinensis]
Length=456

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/437 (65%), Positives = 354/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ V+ +V +     E ID+A+  LCAL+ L  ++ + S         P EF+CPLS 
Sbjct  23    ELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+++SGQT+DRP+IQ+WL +GNR CP+TQQVLSHTILTPNHLIR MIS WC+  
Sbjct  83    ELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI  P+  VQ +NE+G+ T+ADR +FL LL+KMS++   Q  AA+ELRLLTKRMPSFRAL
Sbjct  143   GIELPNS-VQYINEEGI-TEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES  A +P+LLSP S       ++P+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FGESRDA-IPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +D+LRSG IETRSNAAAA+FTLSALDSNK +IGKSGALKPLIDLL+EGH  AMKDVASAI
Sbjct  260   MDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDG V V+++KIM+ VHVDELLAILAMLS+NHRA+EE+G+LG V  
Sbjct  320   FNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             +L +IR+++C RNKENCI IL+ IC +DRTK K +++EES+HGTIS+LAQ+GT+RAKRKA
Sbjct  380   MLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L+RL R V   HTA
Sbjct  440   TGILERLKRTVNLTHTA  456



>ref|XP_006437234.1| hypothetical protein CICLE_v10031496mg [Citrus clementina]
 ref|XP_006437235.1| hypothetical protein CICLE_v10031496mg [Citrus clementina]
 gb|ESR50474.1| hypothetical protein CICLE_v10031496mg [Citrus clementina]
 gb|ESR50475.1| hypothetical protein CICLE_v10031496mg [Citrus clementina]
Length=456

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/437 (65%), Positives = 354/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ V+ +V +     E ID+A+  LCAL+ L  ++ + S         P EF+CPLS 
Sbjct  23    ELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+++SGQT+DRP+IQ+WL +GNR CP+TQQVLSHTILTPNHLIR MIS WC+  
Sbjct  83    ELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI  P+  VQ +NE+G+ T+ADR +FL LL+KMS++   Q  AA+ELRLLTKRMPSFRAL
Sbjct  143   GIELPNS-VQYINEEGI-TEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES  A +P+LLSP S       ++P+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FGESRDA-IPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +D+LRSG IETRSNAAAA+FTLSALDSNK +IGKSGALKPLIDLL+EGH  AMKDVASAI
Sbjct  260   MDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDG V V+++KIM+ VHVDELLAILAMLS+NHRA+EE+G+LG V  
Sbjct  320   FNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             +L +IR+++C RNKENCI IL+ IC +DRTK K +++EES+HGTIS+LAQ+GT+RAKRKA
Sbjct  380   MLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L+RL R V   HTA
Sbjct  440   TGILERLKRTVNLTHTA  456



>gb|KDO60882.1| hypothetical protein CISIN_1g012404mg [Citrus sinensis]
Length=456

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/437 (65%), Positives = 354/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ V+ +V +     E ID+A+  LCAL+ L  ++ + S         P EF+CPLS 
Sbjct  23    ELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+++SGQT+DRP+IQ+WL +GNR CP+TQQVLSHTILTPNHLIR MIS WC+  
Sbjct  83    ELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI  P+  VQ +NE+G+ T+ADR +FL LL+KMS++   Q  AA+ELRLLTKRMPSFRAL
Sbjct  143   GIELPNS-VQYINEEGI-TEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES  A +P+LLSP S       ++P+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FGESHDA-IPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +D+LRSG IETRSNAAAA+FTLSALDSNK +IGKSGALKPLIDLL+EGH  AMKDVASAI
Sbjct  260   MDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDG V V+++KIM+ VHVDELLAILAMLS+NHRA+EE+G+LG V  
Sbjct  320   FNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             +L +IR+++C RNKENCI IL+ IC +DRTK K +++EES+HGTIS+LAQ+GT+RAKRKA
Sbjct  380   MLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L+RL R V   HTA
Sbjct  440   TGILERLKRTVNLTHTA  456



>gb|KHG16436.1| U-box domain-containing 9 -like protein [Gossypium arboreum]
Length=464

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/445 (64%), Positives = 352/445 (79%), Gaps = 23/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNN----------------SFPA  133
             ELQR VK +V ++      +D+A+ ALCALR L   + +                 S P 
Sbjct  23    ELQRLVKTIVDDEDYTIRTVDQAKDALCALRELKFNKRSTVPTTTTTSSLKLHEALSCPE  82

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EF+CPLS ELM+DPV+++SGQTYDRPFIQKWLN+GNR CPQT+QVLSHTILTPNHLIR M
Sbjct  83    EFKCPLSKELMRDPVILASGQTYDRPFIQKWLNAGNRTCPQTEQVLSHTILTPNHLIRDM  142

Query  314   ISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTK  493
             IS WCK  GI  P+P V    E+GV T+A+R  F  LL+K+ ++   Q+ AA+ELR+LTK
Sbjct  143   ISQWCKSQGIELPNP-VMDGKEEGV-TEAERDRFFSLLDKLCAALPQQKEAAKELRMLTK  200

Query  494   RMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAE  661
             +MPSFRALFGES+ A +P+LL+P S       VHPDLQED+ITT+LNLSIHDSNKKLVAE
Sbjct  201   KMPSFRALFGESIDA-IPQLLTPLSGSKSESCVHPDLQEDVITTLLNLSIHDSNKKLVAE  259

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
             TP VI +L+++LRSG IETRSNAAA +FTLSALDSNKALIGKSGALKPLIDLL++GH LA
Sbjct  260   TPMVIPLLMEALRSGTIETRSNAAATLFTLSALDSNKALIGKSGALKPLIDLLDDGHPLA  319

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
             MKDVASAIF LC++HENKARA+RD AV V+++KIM+ V VDELLAILAMLS++ RAIEE+
Sbjct  320   MKDVASAIFNLCIIHENKARAVRDSAVSVILKKIMDGVLVDELLAILAMLSTHQRAIEEI  379

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             GELG VP LL +IR+++C RNKENCI IL+ +C  DRTK K +++EES+HGTIS+LAQ+G
Sbjct  380   GELGGVPCLLHIIRESTCERNKENCIAILHTVCLNDRTKWKALREEESTHGTISKLAQDG  439

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRAKRKA+G+L+RL R V   HTA
Sbjct  440   TSRAKRKANGILERLRRAVNITHTA  464



>ref|XP_002301810.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE81083.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=456

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/437 (65%), Positives = 355/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ V+ +V ++    E ID+A++ L AL+GL  ++ ++S         P EF+CPLS 
Sbjct  23    ELQKLVRNIVDDEDYRTELIDQARETLFALKGLKVKRRSSSLKLRETVLCPEEFKCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPVV+++GQTYDRPFIQKWL +GNR CP TQQVLSHTILTPN LIR MIS WCK  
Sbjct  83    ELMRDPVVLATGQTYDRPFIQKWLKAGNRTCPLTQQVLSHTILTPNLLIREMISQWCKSQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             G+  PD   Q +NE+G+ T+ADR +FL LLEKMS +   Q+ AARELRLLTKRMPSFRAL
Sbjct  143   GLELPDLS-QNVNEEGI-TEADRDHFLSLLEKMSLTLPEQKDAARELRLLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSR----VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES+  A+P+LL P S       ++PDLQEDIITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FSESL-EAIPQLLRPLSEGKSGSSMYPDLQEDIITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++LRSG+IETR+NAAAA+FTLSALDSNK LIGKSGALKPLIDLLEEGH  AMKDVASAI
Sbjct  260   MEALRSGSIETRTNAAAALFTLSALDSNKTLIGKSGALKPLIDLLEEGHPSAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC++HENKARA+RDGA++V++ KIMN +HVDELLAILA+L+S+ + +EE+G+ GAVP 
Sbjct  320   FNLCIIHENKARAVRDGALKVILTKIMNGMHVDELLAILAVLASHQKVVEELGDSGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+++C RNKENCI IL+ IC  DRTK K ++DEESS+GTIS+LA++GTSRAKRKA
Sbjct  380   LLRIIRESTCDRNKENCIAILHTICLNDRTKWKVMRDEESSYGTISKLARHGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L+RLNR V   HTA
Sbjct  440   NGILERLNRAVNLTHTA  456



>gb|KDO60881.1| hypothetical protein CISIN_1g012404mg [Citrus sinensis]
Length=464

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/437 (65%), Positives = 354/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ V+ +V +     E ID+A+  LCAL+ L  ++ + S         P EF+CPLS 
Sbjct  31    ELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSK  90

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+++SGQT+DRP+IQ+WL +GNR CP+TQQVLSHTILTPNHLIR MIS WC+  
Sbjct  91    ELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQ  150

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI  P+  VQ +NE+G+ T+ADR +FL LL+KMS++   Q  AA+ELRLLTKRMPSFRAL
Sbjct  151   GIELPNS-VQYINEEGI-TEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRAL  208

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES  A +P+LLSP S       ++P+LQED+ITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  209   FGESHDA-IPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLL  267

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +D+LRSG IETRSNAAAA+FTLSALDSNK +IGKSGALKPLIDLL+EGH  AMKDVASAI
Sbjct  268   MDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAI  327

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDG V V+++KIM+ VHVDELLAILAMLS+NHRA+EE+G+LG V  
Sbjct  328   FNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSC  387

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             +L +IR+++C RNKENCI IL+ IC +DRTK K +++EES+HGTIS+LAQ+GT+RAKRKA
Sbjct  388   MLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKA  447

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L+RL R V   HTA
Sbjct  448   TGILERLKRTVNLTHTA  464



>ref|XP_011024586.1| PREDICTED: U-box domain-containing protein 9 [Populus euphratica]
Length=456

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/437 (65%), Positives = 353/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQ+ V+ +V ++    E ID+A++ L AL+ L  ++ ++S         P EF+CPLS 
Sbjct  23    ELQKLVRNIVDDEDYRTELIDQARETLFALKELKVKRRSSSLKLRETVLCPEEFKCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPVV+++GQTYDRPFIQKWL +GNR CP TQQVLSHTILTPN LIR MIS WCK  
Sbjct  83    ELMRDPVVLATGQTYDRPFIQKWLKAGNRTCPLTQQVLSHTILTPNLLIREMISQWCKSQ  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             G+  PD   Q +NE+G+ T+ADR +FL LLEKMS +   Q+ AARELRLLTKRMPSFRAL
Sbjct  143   GLKLPDL-AQHVNEEGI-TEADRDHFLSLLEKMSLTLPEQKDAARELRLLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSR----VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES   A+P+LL P S       ++PDLQEDIITT+LNLSIHD+NKKLVAETP VI +L
Sbjct  201   FSES-PEAIPQLLRPLSEGKSGSSMYPDLQEDIITTLLNLSIHDNNKKLVAETPMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++LRSG+IETR+NAAAA+FTLSALDSNK LIGKSGALKPLIDLLEEGH  AMKDVASAI
Sbjct  260   MEALRSGSIETRTNAAAALFTLSALDSNKTLIGKSGALKPLIDLLEEGHPSAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC++HENKARA+RDGA++V++ KIMN +HVDELLAILA+L+S+ + +EE+G+ GAVP 
Sbjct  320   FNLCIIHENKARAVRDGALKVILTKIMNGMHVDELLAILAVLASHQKVVEELGDSGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+++C RNKENCI IL+ IC  DRTK K ++DEESS+GTIS+LA++GTSRAKRKA
Sbjct  380   LLRIIRESTCDRNKENCIAILHTICLNDRTKWKVMRDEESSYGTISKLARHGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+L+RLNR V   HTA
Sbjct  440   NGILERLNRAVNLTHTA  456



>ref|XP_008346216.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Malus domestica]
Length=456

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/437 (65%), Positives = 352/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR VKA+V ++    + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVKAIVDDEDFTTQTIDQARDTLSALKELKLKKRSLSLKLKDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDR FI+K L +GNRICP+TQQVL+HT+LTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRAFIEKGLKAGNRICPRTQQVLTHTVLTPNHLVREMISQWCKNR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP +  +NEDG+ T++DR +FL LL KMSS+   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDPVLH-VNEDGI-TESDRDHFLSLLRKMSSTFPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES+ A +P+LLSP S       + P+LQEDIITT+LNLSIHD+NKKLVAET  VI +L
Sbjct  201   FSESIHA-IPQLLSPLSEGKFEDGIDPELQEDIITTLLNLSIHDNNKKLVAETLMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LLEEGH LAMKDVASAI
Sbjct  260   MEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLEEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDGAVR +++KI N +HVDELLAILAM+SS+ +A+EEMGELG V  
Sbjct  320   FNLCITHENKARAVRDGAVRTILKKIANGMHVDELLAILAMISSHPKAVEEMGELGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C+RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LA NGTSRAKRKA
Sbjct  380   LLGVIRETNCSRNKENCIAVLHTICLNDRTKWKEIREEENAYGTISELANNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRAVNLTHTA  456



>ref|XP_008372545.1| PREDICTED: U-box domain-containing protein 9 [Malus domestica]
Length=456

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/437 (65%), Positives = 351/437 (80%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR VKA+V ++    + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVKAIVDDEDFTTQTIDQARDTLSALKELKLKKRSLSLKLKDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDR FI+K L  GNRICP+TQQVL+HT+LTPNHL+R MIS WCK  
Sbjct  83    ELMRDPVIVSTGETYDRAFIEKGLKXGNRICPRTQQVLTHTVLTPNHLVREMISQWCKNR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP +  +NEDG+ T++DR +FL LL KMSS+   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDPVLH-VNEDGI-TESDRDHFLSLLRKMSSTFPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES+ A +P+LLSP S       + P+LQEDIITT+LNLSIHD+NKKLVAET  VI +L
Sbjct  201   FSESIHA-IPQLLSPLSEGKFEDGIDPELQEDIITTLLNLSIHDNNKKLVAETLMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LLEEGH LAMKDVASAI
Sbjct  260   MEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLEEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDGAVR +++KI N +HVDELLAILAM+SS+ +A+EEMGELG V  
Sbjct  320   FNLCITHENKARAVRDGAVRTILKKIANGMHVDELLAILAMISSHPKAVEEMGELGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C+RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LA NGTSRAKRKA
Sbjct  380   LLGVIRETNCSRNKENCIAVLHTICLNDRTKWKEIREEENAYGTISELANNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNR V   HTA
Sbjct  440   SGILDRLNRAVNLTHTA  456



>gb|EYU40644.1| hypothetical protein MIMGU_mgv1a005912mg [Erythranthe guttata]
Length=465

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/442 (63%), Positives = 353/442 (80%), Gaps = 19/442 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ---------NNNS--------FP  130
             ELQ+ V  +V  D +N + IDRAQ  LC L+ L  ++         N+NS         P
Sbjct  26    ELQKLVAEIVDLDDINLDEIDRAQYVLCNLKELKLKKSVSLKVRSSNHNSGHEIVSGAVP  85

Query  131   AEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRG  310
              EF+CPLS ELM+DPV+++SGQT+D+PFI+KWL +GN+ CP+TQQVLSHTILTPNHLIR 
Sbjct  86    EEFKCPLSKELMRDPVIIASGQTFDKPFIRKWLQAGNKTCPRTQQVLSHTILTPNHLIRT  145

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MI+ WCK +G+  PD  V   +E+G+ T AD+ +F+ LL+KMSS+   Q+ +A+ELRLLT
Sbjct  146   MIAQWCKNHGVKLPDS-VNRTDEEGL-TKADKDHFVSLLKKMSSTLPHQKESAKELRLLT  203

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPR  670
             KR+PSFRALFGE    A+PKLLSP S+  +  DLQED+ITT+LN+SIH++NKKLV ETP 
Sbjct  204   KRLPSFRALFGEESLDAIPKLLSPLSQAKLESDLQEDLITTLLNISIHENNKKLVLETPN  263

Query  671   VISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKD  850
             V+ +L+++LRSG IET+SNAAAA+FTLSALDSNKA+IG+ GALKPLIDLL+EGH L MKD
Sbjct  264   VLPLLMEALRSGTIETKSNAAAALFTLSALDSNKAIIGRFGALKPLIDLLDEGHPLVMKD  323

Query  851   VASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGEL  1030
             VASAIF LC+LHENKAR + DG VRV+++KI+NR HVDELL+I+AMLSS+ RAIEEM EL
Sbjct  324   VASAIFNLCILHENKARVVSDGGVRVIMKKILNRTHVDELLSIVAMLSSSQRAIEEMVEL  383

Query  1031  GAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSR  1210
             GAVP LLS+IR++SCARNKENCI IL+AIC +DR+K KE+K+EES + TISQL +NG+SR
Sbjct  384   GAVPCLLSIIRESSCARNKENCIAILHAICFSDRSKWKEMKEEESKYCTISQLVENGSSR  443

Query  1211  AKRKASGVLDRLNRGVGFIHTA  1276
             AKRKASGVL+R+NR     HTA
Sbjct  444   AKRKASGVLERMNRANYLTHTA  465



>ref|XP_008460394.1| PREDICTED: U-box domain-containing protein 9 [Cucumis melo]
Length=461

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/440 (64%), Positives = 349/440 (79%), Gaps = 16/440 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGL----HPEQNNNSF-----PAEFRCPLS  154
             ELQ  + A++ +D  + + ID A+  L AL+ L        ++N F     P EFRCPLS
Sbjct  23    ELQTLILAIIDDDNYSTDTIDNAKDILSALKELKLRKRSRSSSNLFHNLISPQEFRCPLS  82

Query  155   GELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKV  334
              ELM+DPV++S+G+TYDRPFIQKWLNSGNR CP+TQQVLSHT LTPNHLIR MIS WC  
Sbjct  83    RELMRDPVILSTGETYDRPFIQKWLNSGNRTCPRTQQVLSHTDLTPNHLIREMISQWCAT  142

Query  335   NGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRA  514
              GI   D       +D V+T+ADR  FL+LLEKMS +   Q+ AA+ELR+LTKRMPSFRA
Sbjct  143   RGIELQDRVRVHYLDDDVITEADRDRFLMLLEKMSMTISEQKEAAKELRMLTKRMPSFRA  202

Query  515   LFGESMGAAMPKLLSPFS------RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             LFGES+ A +  LLSP S        ++H DLQED+ITT+LNLSIHD+NKKLVAETP  I
Sbjct  203   LFGESLDA-ISLLLSPLSGDKSQSNSNIHTDLQEDVITTLLNLSIHDNNKKLVAETPYAI  261

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +L+++LRSG +ETRSNAAAA+FTLSALD NKA+IGK+GALKPLI+LL+ GH L++KD A
Sbjct  262   PLLMEALRSGTMETRSNAAAALFTLSALDPNKAIIGKAGALKPLIELLDLGHPLSIKDAA  321

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF LC+LHENKARA+RDGAVRVL++KIM+++HVDELLAILAMLS + RAIEE+GELGA
Sbjct  322   SAIFNLCILHENKARAVRDGAVRVLLKKIMSQMHVDELLAILAMLSCHQRAIEEIGELGA  381

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             VP LL +IR++SC+RNKENCIVI++++C  DRTK KE+++EE  + TIS+LAQNGTSRAK
Sbjct  382   VPFLLRIIRESSCSRNKENCIVIIHSVCLYDRTKWKEMREEEKCYRTISELAQNGTSRAK  441

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKASGVL+R+NR V   HTA
Sbjct  442   RKASGVLERINRVVNMTHTA  461



>ref|XP_004290155.1| PREDICTED: U-box domain-containing protein 9-like [Fragaria vesca 
subsp. vesca]
Length=456

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/437 (65%), Positives = 353/437 (81%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             EL R V+++V ++G + E ID+A++ L AL+ L  ++ + SF        P EF+CP+S 
Sbjct  23    ELLRLVRSIVDDEGCSTETIDQAKETLGALKELELKKRSLSFKLKDILACPEEFKCPISK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+GQTYDRPFIQK L SGNRICPQTQQVLSHTILTPN+L+ GMI  WCK  
Sbjct  83    ELMRDPVIVSTGQTYDRPFIQKQLKSGNRICPQTQQVLSHTILTPNNLVHGMILQWCKDR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP +   NEDG+ T +DR + L LL+KMSS+   Q+ AA+ELRLLTKR+PSFRAL
Sbjct  143   GIQLSDPALLA-NEDGI-TASDRDHLLSLLQKMSSALPEQKEAAKELRLLTKRIPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             FGES+ A +P+LLSP S       +H +LQED+ITT+LNLSIHD+NKKLVAETP V+ +L
Sbjct  201   FGESLDA-IPQLLSPLSEGKFEGGIHSELQEDVITTLLNLSIHDNNKKLVAETPMVMPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I++L+SG I+TRSNAAAA+FTLSALDSNKALIG+SGALKPLIDLLEEGH LAMKDVASAI
Sbjct  260   IEALQSGTIQTRSNAAAALFTLSALDSNKALIGESGALKPLIDLLEEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LCV HENKARA+R GAV+ ++ K+ NR+HVDELL ILA+LSS+ +A+EEMG+LGAVP 
Sbjct  320   FNLCVTHENKARAVRVGAVKTILMKLTNRMHVDELLTILALLSSHPKAVEEMGDLGAVPC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LLS++RD  C R+KENCI +L+ IC  D TK KE+++EE ++ TIS+LA+NGTSRAKRKA
Sbjct  380   LLSIMRDAICDRSKENCIAVLHIICFNDPTKWKEMREEEKNYRTISELAKNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+LDRLNRGV   HTA
Sbjct  440   SGILDRLNRGVNLTHTA  456



>ref|XP_009340330.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Pyrus x bretschneideri]
Length=456

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 350/437 (80%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------PAEFRCPLSG  157
             ELQR VKA+V ++    + ID+A+  L AL+ L  ++ + S         P EFRCPLS 
Sbjct  23    ELQRLVKAIVDDEDFTTQTIDQARDTLSALKELKLKKRSLSLKLKDVLSCPEEFRCPLSK  82

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV+VS+G+TYDR FI+K L +GNRICP+TQQVL+HT+LTPNHL+R MIS WC+  
Sbjct  83    ELMRDPVIVSTGETYDRAFIEKGLKAGNRICPRTQQVLTHTVLTPNHLVREMISQWCRNR  142

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI   DP +  +NEDG+ T++DR  FL LL KMS +   Q+ AA+ELR+LTKRMPSFRAL
Sbjct  143   GIELSDPALH-VNEDGI-TESDRDRFLSLLRKMSLTFPEQKEAAKELRMLTKRMPSFRAL  200

Query  518   FGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             F ES+ A +P+LLSP S       + P+LQED+ITT+LNLSIHD+NKKLVAET  VI +L
Sbjct  201   FNESIHA-IPQLLSPLSEGKFEDGIDPELQEDVITTLLNLSIHDNNKKLVAETLMVIPLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             +++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAI
Sbjct  260   MEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HENKARA+RDGAVR +++KI N VHVDELLAILAM+SS+ +A+EEMGELG V  
Sbjct  320   FNLCITHENKARAVRDGAVRTILKKIANSVHVDELLAILAMISSHPKAVEEMGELGGVSC  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL +IR+T+C+RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LA NGTSRAKRKA
Sbjct  380   LLRVIRETNCSRNKENCIAVLHTICLNDRTKWKEIREEENTYGTISELANNGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+LDRLNR V   HTA
Sbjct  440   NGILDRLNRSVNLTHTA  456



>ref|XP_002270882.1| PREDICTED: U-box domain-containing protein 9 [Vitis vinifera]
 emb|CBI28670.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/435 (66%), Positives = 345/435 (79%), Gaps = 13/435 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLH--------PEQNNNSFPAEFRCPLSG  157
             ELQR V  +V ED   A+  D+A + L ALR            E  N + P EFRCP+S 
Sbjct  24    ELQRLVSRIVDEDESCADTTDKALKILFALRDFKFKGSLDFGVETENPALPQEFRCPISK  83

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             +LM+DPVVV++GQTYDRPFIQKWL  G+R CP+TQQVLSHTILTPN+L+R MIS WCK +
Sbjct  84    QLMRDPVVVATGQTYDRPFIQKWLKDGHRTCPRTQQVLSHTILTPNNLVREMISEWCKEH  143

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI  P P V+ ++E+ V+TDADR +   LLE+MSSS+  Q+ AARELRLLTKRMPSFRAL
Sbjct  144   GIELPKP-VEDVDEE-VITDADRGHLNSLLERMSSSASDQKEAARELRLLTKRMPSFRAL  201

Query  518   FGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLID  691
             FGE   A +P+LLSP S   VDV P+LQED+ITT+LNLSIHD+NKKLVAE P  I VLI+
Sbjct  202   FGECTDA-VPQLLSPLSPDAVDVDPELQEDLITTVLNLSIHDNNKKLVAEDPMAIPVLIE  260

Query  692   SLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFV  871
             SL+SG IETR+NAAAA+FTLSALDSNK +IGKSGALKPL+DLLEEGH LAMKDVASAIF 
Sbjct  261   SLKSGTIETRTNAAAALFTLSALDSNKLIIGKSGALKPLLDLLEEGHPLAMKDVASAIFN  320

Query  872   LCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLL  1051
             LC++ ENK RA+ DGAV V+++KIM+ + VDELLAILAMLSS+ RA+EEMGELGAVP LL
Sbjct  321   LCIVLENKGRAVHDGAVTVILKKIMDGILVDELLAILAMLSSHQRAVEEMGELGAVPCLL  380

Query  1052  SLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASG  1231
              +IR++ C RNKENCI IL+ +C  DR KL+ I++EE+ +GTIS+LAQ GTSRAKRKA+G
Sbjct  381   RIIRESKCERNKENCIAILHTVCFNDRAKLRAIREEENDYGTISRLAQTGTSRAKRKANG  440

Query  1232  VLDRLNRGVGFIHTA  1276
             +L+RLNR     HTA
Sbjct  441   ILERLNRVALITHTA  455



>ref|XP_010243171.1| PREDICTED: U-box domain-containing protein 9 [Nelumbo nucifera]
Length=453

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/434 (65%), Positives = 343/434 (79%), Gaps = 12/434 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ------NNNSFPAEFRCPLSGEL  163
             EL+R VK +V ED    E  D+A +AL  L+ L  ++      +  + P +FRCPLS +L
Sbjct  23    ELKRLVKIIVEEDESRTETFDQAIEALSGLKDLKYKKSLSLKLDATACPEQFRCPLSNKL  82

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M+DPV+VSSGQTYDRPFI+KWL  GNR CPQTQQVLS T+LTPN L+R MIS WCK  GI
Sbjct  83    MRDPVIVSSGQTYDRPFIEKWLKEGNRTCPQTQQVLSQTVLTPNLLVRDMISQWCKNQGI  142

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEK-MSSSSCVQRSAARELRLLTKRMPSFRALF  520
               PD   +   E+G+ T +DR  F  LLE  +S S   Q  AA++LR LTKRMPSFRALF
Sbjct  143   ELPDS-FRDAQEEGI-TQSDREYFESLLEGILSGSVSEQTKAAKQLRQLTKRMPSFRALF  200

Query  521   GESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDS  694
             GES+ A +P+LL P +  +  +HPDLQED+ITT+LNLSIHDSNKKLVAETP VI +L++S
Sbjct  201   GESLDA-IPQLLVPLTPGQASLHPDLQEDVITTVLNLSIHDSNKKLVAETPEVIPLLMES  259

Query  695   LRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVL  874
             L SG IETRSNAAAA+FTLSALDSNKALIGKSGALKPLI+LL+EGH LAMKDVASAIF L
Sbjct  260   LTSGTIETRSNAAAALFTLSALDSNKALIGKSGALKPLINLLDEGHPLAMKDVASAIFNL  319

Query  875   CVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLS  1054
             C++HENKARA+ DGAV+V+++KI N + VDELLAILAMLSS+ +A++EMG+LGAV  LLS
Sbjct  320   CIMHENKARAVNDGAVKVILKKIKNHILVDELLAILAMLSSHQKAVDEMGDLGAVQCLLS  379

Query  1055  LIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGV  1234
             +IR++SC RNKENC+ ILY+IC  DRTK KEI+ EES+HGTISQLA+NGTSRAKRKA+G+
Sbjct  380   IIRESSCGRNKENCVAILYSICINDRTKCKEIRAEESAHGTISQLAKNGTSRAKRKANGI  439

Query  1235  LDRLNRGVGFIHTA  1276
             L+RL +     HTA
Sbjct  440   LERLKKTAANTHTA  453



>gb|KDP45270.1| hypothetical protein JCGZ_15135 [Jatropha curcas]
Length=457

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/438 (63%), Positives = 350/438 (80%), Gaps = 16/438 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF---------PAEFRCPLS  154
             EL++ V+ +V ++    E ID+A++ L AL+ L  ++ + S          P EF+CPLS
Sbjct  23    ELRKLVRTIVDDEDYPIEIIDQAKETLSALKELKIKKRSLSPKLREILLRPPEEFKCPLS  82

Query  155   GELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKV  334
              ELMKDPV++++G+TYDRPFIQKWL  GNR CP TQQVLSHT LTPNHLIR MIS WC+ 
Sbjct  83    KELMKDPVILATGETYDRPFIQKWLKGGNRTCPLTQQVLSHTYLTPNHLIRQMISQWCRS  142

Query  335   NGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRA  514
              G+   DP V  +NE+G+ T+ADR +FL LLEKMS +   Q+ AA+ELRLLTKRMPSFRA
Sbjct  143   QGLELQDP-VHYVNEEGI-TEADRDHFLSLLEKMSLTIPEQKEAAKELRLLTKRMPSFRA  200

Query  515   LFGESMGAAMPKLLSPFSRV----DVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISV  682
             LFGES+ A +P+LL+P S      ++HPDLQED+ITT+LNLSIHD+NKKLVAETP VI +
Sbjct  201   LFGESLDA-IPQLLNPLSTSKSTSEIHPDLQEDLITTLLNLSIHDNNKKLVAETPVVIPL  259

Query  683   LIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASA  862
             L+++LRSG IETR+NAAAA+FTLSALDSNKALIGKSGALKPLIDLL+EG+ LAMKD ASA
Sbjct  260   LMEALRSGTIETRTNAAAALFTLSALDSNKALIGKSGALKPLIDLLDEGNPLAMKDAASA  319

Query  863   IFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVP  1042
             IF LC +HENKARA+RDGAV+V+V+KIM+ V VDELLAILA+LSS+ RA+E+MGEL  VP
Sbjct  320   IFTLCFIHENKARAVRDGAVKVIVKKIMSGVLVDELLAILAILSSHQRAVEDMGELETVP  379

Query  1043  SLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRK  1222
              LL +IR+++C R+KENCI IL+ IC  DRT  K +++EE +H TIS+LA++GTSRA RK
Sbjct  380   CLLRIIRESTCERSKENCIAILHTICLYDRTNWKAVREEECAHETISKLARDGTSRAMRK  439

Query  1223  ASGVLDRLNRGVGFIHTA  1276
             A+G+L+RLNR +   HTA
Sbjct  440   ATGILERLNRAINLTHTA  457



>ref|XP_004144394.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus]
 ref|XP_004162645.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus]
 gb|KGN58380.1| hypothetical protein Csa_3G634320 [Cucumis sativus]
Length=461

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 346/440 (79%), Gaps = 16/440 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGL----HPEQNNNSF-----PAEFRCPLS  154
             ELQ  + A++ +D  + + ID A   L AL+ L        ++N F     P EFRCPLS
Sbjct  23    ELQTLILAIIDDDNYSTDTIDNAIHILSALKDLKLRKRSRSSSNLFHNLISPQEFRCPLS  82

Query  155   GELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKV  334
              ELM+DPV++S+G+TYDRPFIQKWLNSGNR CP+TQQVLSHT LTPNHLIR MIS WC  
Sbjct  83    RELMRDPVILSTGETYDRPFIQKWLNSGNRTCPRTQQVLSHTNLTPNHLIREMISQWCAT  142

Query  335   NGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRA  514
              GI   D       +D V+T+ADR  FL+LLEKMS +   Q+ AA+ELR+LTKRMPSFRA
Sbjct  143   RGIELQDRVRVHYLDDDVITEADRDRFLMLLEKMSLTVSEQKEAAKELRMLTKRMPSFRA  202

Query  515   LFGESMGAAMPKLLSPF------SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             LFGES+ A +  LLSP       S   +H DLQED+ITT+LNLSIHD+NKKLVAETP  I
Sbjct  203   LFGESLDA-ISLLLSPLCGDKSQSSSSIHTDLQEDVITTLLNLSIHDNNKKLVAETPYAI  261

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +L+++LRSG +ETRSNAAAA+FTLSALD NK +IGK+GALKPLI+LL+ GH L++KD A
Sbjct  262   PLLMEALRSGTMETRSNAAAALFTLSALDPNKTIIGKAGALKPLIELLDLGHPLSIKDAA  321

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF LC+LHENKARA+RDGAVRVL++KIM+++HVDELLAILAMLS + RAIEE+GELGA
Sbjct  322   SAIFNLCILHENKARAVRDGAVRVLLKKIMSQMHVDELLAILAMLSCHQRAIEEIGELGA  381

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             VP LL +IR++SC+RNKENCIVI++++C  DRTK K++++EE  + TIS+LAQNGTSRAK
Sbjct  382   VPFLLRIIRESSCSRNKENCIVIIHSVCLYDRTKWKDMREEEKCYRTISELAQNGTSRAK  441

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKASG+L+R+NR V   HTA
Sbjct  442   RKASGILERINRVVNMTHTA  461



>gb|KHG06294.1| U-box domain-containing 9 -like protein [Gossypium arboreum]
Length=466

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/445 (62%), Positives = 352/445 (79%), Gaps = 23/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF--------------PAEF  139
             ELQR VK +V ++  + + I++A+ ALCALR L     +++               P +F
Sbjct  25    ELQRLVKTIVDDEDCSVQTINQAKHALCALRELKFNTRSSATTMTSSLKLHEPLPCPQKF  84

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
              CPLS +LM+DPVV+SSGQTY+RPFI+KWL +GNR CPQTQQVLSHT+LTPNHL+  MIS
Sbjct  85    ICPLSKKLMRDPVVLSSGQTYERPFIEKWLKAGNRTCPQTQQVLSHTVLTPNHLVSEMIS  144

Query  320   NWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAARELRLLTKR  496
              WCK  GI  PDP VQ   ++GV T+A+R +F  LL+K+S+++   Q+ A +ELRLLTK 
Sbjct  145   QWCKSQGIELPDP-VQNRIQEGV-TEAERRHFFSLLDKLSAAALPQQKEAVKELRLLTKN  202

Query  497   MPSFRALFGESMGAAMPKLLSPFSRVD-----VHPDLQEDIITTILNLSIHDSNKKLVAE  661
             MPSFR+LFGES+   +P+LL+P S        +H DLQED+ITT+LNLSIHDSNKKLVAE
Sbjct  203   MPSFRSLFGESVDT-IPQLLTPLSGTKSRSGVLHTDLQEDVITTLLNLSIHDSNKKLVAE  261

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
             TP+VI +L+++LR G IET+SNAAAAIFTLSALDSNK LIGKSGALKPLIDLL+EGH LA
Sbjct  262   TPKVIPLLMEALRFGTIETKSNAAAAIFTLSALDSNKTLIGKSGALKPLIDLLDEGHPLA  321

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
             MKDVASAIF LC++HENKARA+RDGAV V+++KIM+ V V+ELLAILAMLS++ RA+EEM
Sbjct  322   MKDVASAIFNLCIIHENKARAVRDGAVSVILKKIMDGVLVNELLAILAMLSTHQRAVEEM  381

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             GELGAVP L+ ++R+++C RNKENCI IL+ +C  DRTKLK +++EE+ HGTIS+L  +G
Sbjct  382   GELGAVPCLIRIVRESTCERNKENCIAILHTVCLNDRTKLKALREEENIHGTISKLVLDG  441

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRAKRKASG+LDRL +GV   HTA
Sbjct  442   TSRAKRKASGILDRLRKGVNIPHTA  466



>ref|XP_010036763.1| PREDICTED: U-box domain-containing protein 9 [Eucalyptus grandis]
 gb|KCW48403.1| hypothetical protein EUGRSUZ_K02107 [Eucalyptus grandis]
Length=455

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/436 (65%), Positives = 345/436 (79%), Gaps = 15/436 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF-------PAEFRCPLSGE  160
             ELQR V+ +  E+  + E ID A++AL         +  +SF       P E+RCP+S E
Sbjct  24    ELQRLVRVIADEEECSVEVIDHAREAL-LALRELRARRRSSFSLRTLACPEEYRCPISKE  82

Query  161   LMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNG  340
             LM+DPV+V++GQTYDRP IQKWL +GNR+CPQTQQVLSHTILTPNHLIR +I  WCK  G
Sbjct  83    LMRDPVIVATGQTYDRPSIQKWLKAGNRMCPQTQQVLSHTILTPNHLIRELILRWCKSRG  142

Query  341   IWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALF  520
                 +P V C++ED   T+++R  FL LLEKMSS    Q+ AA+ELR LTKRMPSFRALF
Sbjct  143   FELSEP-VHCIDEDNA-TESERDRFLYLLEKMSSDISEQKEAAKELRSLTKRMPSFRALF  200

Query  521   GESMGAAMPKLLSPFS----RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLI  688
             GES  A + +LLSP S    +   H DLQED+ITT+LNLSIHD+NKKLVAETP VI +L+
Sbjct  201   GESPDA-ITQLLSPLSESQSQSGTHLDLQEDVITTLLNLSIHDNNKKLVAETPSVIPLLM  259

Query  689   DSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIF  868
             D+LRSG IETRSNAAAA+FTLSALDSNK LIGKSGALK LIDLL+EGH LAM DVASAIF
Sbjct  260   DALRSGTIETRSNAAAALFTLSALDSNKTLIGKSGALKLLIDLLDEGHPLAMTDVASAIF  319

Query  869   VLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSL  1048
              LC++HEN+ RA+RDGAV V+++KI NR+HVDELLAILAMLSS+ RAIEEM EL AV  L
Sbjct  320   NLCIIHENRGRAVRDGAVGVILDKIANRIHVDELLAILAMLSSHQRAIEEMCELEAVSCL  379

Query  1049  LSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
             L ++R+TSCARNKENCI IL+ IC +DRTKL+E+++EE+SH TIS+LA+NGTSRA+RKA+
Sbjct  380   LGVMRETSCARNKENCIAILHTICFSDRTKLRELREEENSHRTISELAKNGTSRAQRKAN  439

Query  1229  GVLDRLNRGVGFIHTA  1276
             G+L+RLNRG+   HTA
Sbjct  440   GILERLNRGINLTHTA  455



>ref|XP_003532252.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max]
 gb|KHN10943.1| U-box domain-containing protein 9 [Glycine soja]
Length=461

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/441 (64%), Positives = 349/441 (79%), Gaps = 19/441 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR------------GLHPEQNNNSFPAEFRC  145
             ELQR VK++V ++  + E ID+A++ LC L+             LH +   +S P EF+C
Sbjct  24    ELQRLVKSIVHDEDCSTETIDQAKETLCVLKELKLRNRSSLSLKLHNKSVASSCPDEFKC  83

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             PLS ELM+DPV+V+SGQTYDRPFIQKWLN+GNR CP+T QVLSHT+LTPNHLIR MI  W
Sbjct  84    PLSKELMRDPVIVASGQTYDRPFIQKWLNAGNRTCPRTHQVLSHTVLTPNHLIREMIEQW  143

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
              K  GI   +  VQ ++E+G+  +ADR +FL LL+KMSS+   Q++AA+ELRLLTK+ P 
Sbjct  144   SKNQGIELSNT-VQYIDEEGL-NEADREHFLCLLKKMSSTLSDQKTAAKELRLLTKKYPC  201

Query  506   FRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRV  673
             FR LF +S   A+P+LL P    D    VHPDLQED+ITT+LN+SIHD+NKKLVAETP V
Sbjct  202   FRVLFCDS-ADAIPQLLKPICGSDSFGSVHPDLQEDVITTLLNISIHDNNKKLVAETPMV  260

Query  674   ISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDV  853
             I +L+ +LRSG IETRSNAAAA+FTLSALDSNK LIGKSG LKPLIDLLEEGH LAMKDV
Sbjct  261   IPLLMRALRSGTIETRSNAAAALFTLSALDSNKELIGKSGVLKPLIDLLEEGHPLAMKDV  320

Query  854   ASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             ASAIF +CV+HENKARA +DGAVRV++ KI  ++HV ELLAILA+LSS+ RA+ +MG+LG
Sbjct  321   ASAIFNICVMHENKARAEKDGAVRVILAKINKQIHVAELLAILALLSSHQRAVHDMGDLG  380

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
             AVPSLL +IR++SC RNKENC+ IL  IC  DR+KLKEI++EE+SH TIS+LA++GTSRA
Sbjct  381   AVPSLLRIIRESSCERNKENCVAILQTICLYDRSKLKEIREEENSHKTISELAKHGTSRA  440

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
             KRKASG+L+RLNR V   HTA
Sbjct  441   KRKASGILERLNRAVNITHTA  461



>gb|KHN37468.1| U-box domain-containing protein 9 [Glycine soja]
Length=461

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/441 (64%), Positives = 350/441 (79%), Gaps = 19/441 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNN------------SFPAEFRC  145
             ELQR VK++V ++  + E ID+A++ LC L+ L   + ++            SFP EF+C
Sbjct  24    ELQRLVKSIVDDEDCSTETIDQAKETLCVLKELKLRKRSSLSLKLQNKSVTSSFPDEFKC  83

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             PLS ELM+DPV+++SGQTYDRPFIQKWLN+GNR CP+T QVLSHT+LTPNHLIR MI  W
Sbjct  84    PLSKELMRDPVILASGQTYDRPFIQKWLNAGNRTCPRTHQVLSHTVLTPNHLIREMIEQW  143

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
              K  GI F +  VQ ++E+G+   AD  +FL LL+KMSS+   Q++AA+ELRLLTK+ P 
Sbjct  144   SKNQGIEFSNT-VQYIDEEGL-NKADCEHFLCLLKKMSSTLSDQKTAAKELRLLTKKHPC  201

Query  506   FRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRV  673
             FR LF +S   A+P+LL P    D    VHPDLQED+ITT+LN+SIHD+NKKLVAETP V
Sbjct  202   FRVLFCDS-ADAIPQLLKPICGSDSFGSVHPDLQEDVITTLLNISIHDNNKKLVAETPMV  260

Query  674   ISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDV  853
             I +L+ +LRSG IETRSNAAAA+FTLSALDSNK LIGKSGALKPLIDLLEEGH LAMKDV
Sbjct  261   IPLLMRALRSGTIETRSNAAAALFTLSALDSNKELIGKSGALKPLIDLLEEGHPLAMKDV  320

Query  854   ASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             ASAIF +CV+HENKARA++DGAVRV++ KI  ++HV ELLAILA+LSS+ RA+ +MG+LG
Sbjct  321   ASAIFNICVMHENKARAVKDGAVRVILAKINKQIHVAELLAILALLSSHQRAVHDMGDLG  380

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
             AVPSLL +I+++SC RNKENC+ IL  IC  DR+KLKEI++EE+ H TIS+LA+NGTSRA
Sbjct  381   AVPSLLRIIKESSCERNKENCVAILQTICLYDRSKLKEIREEENGHKTISELAKNGTSRA  440

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
             KRKASG+L+RLNR V   HTA
Sbjct  441   KRKASGILERLNRVVHITHTA  461



>ref|XP_007140699.1| hypothetical protein PHAVU_008G134400g [Phaseolus vulgaris]
 gb|ESW12693.1| hypothetical protein PHAVU_008G134400g [Phaseolus vulgaris]
Length=460

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 351/440 (80%), Gaps = 18/440 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLH-----------PEQNNNSFPAEFRCP  148
             ELQR VK++V ++  + E ID+A++ LC L+ L              +N +S P EF+CP
Sbjct  24    ELQRLVKSIVDDEDCSTETIDQAKETLCVLKELKLRKRSSLCLKLHNRNVSSCPDEFKCP  83

Query  149   LSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWC  328
             LS ELM+DPV+V+SGQTYDR FIQKWLN+GNR CP+T QVLSHT+LTPNHLIR M+  W 
Sbjct  84    LSKELMRDPVIVASGQTYDRSFIQKWLNAGNRTCPRTHQVLSHTVLTPNHLIREMVEQWL  143

Query  329   KVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSF  508
             K  G+   +  V+ ++E+G+   ADR +FL LL+KMSS+   Q++AA+ELR+LTK+ P F
Sbjct  144   KNQGVELSNT-VEYIDEEGL-NQADREHFLCLLKKMSSTLSDQKTAAKELRMLTKKHPCF  201

Query  509   RALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             R LF +S   A+P+LL P    D    +HPDLQED+ITT+LN+SIHD+NKKLVAETP VI
Sbjct  202   RVLFCDS-ADAIPQLLKPICGSDSFSSIHPDLQEDVITTLLNISIHDNNKKLVAETPMVI  260

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +L+ +LRSG IETRSNAAAA+FTLSA+DSNK +IGKSGALKPLIDLLEEGH LAMKDVA
Sbjct  261   PLLMRALRSGTIETRSNAAAALFTLSAIDSNKEIIGKSGALKPLIDLLEEGHPLAMKDVA  320

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF +CV+HENKARA++DGAVRV++ KI N+VHVDELLAILA+LSS+ RA+ +MG+LGA
Sbjct  321   SAIFNICVMHENKARAVKDGAVRVILTKIKNQVHVDELLAILALLSSHQRAVHDMGDLGA  380

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             VPSLL +IR++SC RNKENC+ IL  IC  DR+KLKEI++EE+SH TIS+LAQ+GTSRAK
Sbjct  381   VPSLLRIIRESSCERNKENCVAILQTICLYDRSKLKEIREEENSHKTISELAQSGTSRAK  440

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKASG+L+RLNR V   HTA
Sbjct  441   RKASGILERLNRVVNITHTA  460



>ref|XP_010690013.1| PREDICTED: U-box domain-containing protein 9 [Beta vulgaris subsp. 
vulgaris]
Length=478

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/427 (63%), Positives = 343/427 (80%), Gaps = 22/427 (5%)
 Frame = +2

Query  53    EAIDRAQQALCALRGLHPEQ------NNNSF--PAEFRCPLSGELMKDPVVVSSGQTYDR  208
             + ID+ ++ L  L+ +  ++      +++SF  P EFRCPLS +LM+DPV++S+GQTYDR
Sbjct  55    DTIDKTKELLSVLKEVKLKKTTSLRLDDDSFSCPPEFRCPLSKQLMRDPVIISTGQTYDR  114

Query  209   PFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGV  388
             PFIQKWL +G+R+CP TQQVLSH++LTPN+L+R MIS WC   GI  PDP V  +NE+G 
Sbjct  115   PFIQKWLKAGHRMCPVTQQVLSHSLLTPNYLVREMISQWCNSRGIETPDP-VGYINEEGP  173

Query  389   VTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFS  568
              T+ADR  F  L++KMS S   Q++AA+ELRLLTKRMPSFRALFGES   A+P+LL P +
Sbjct  174   -TEADRDYFSSLIDKMSKSIGEQKAAAKELRLLTKRMPSFRALFGEST-EAIPRLLKPLT  231

Query  569   RV-----------DVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIE  715
             +            ++HPDLQED+ITT+LN+SIHDSNKKLVAETP VI++L+D+L+ G  E
Sbjct  232   QQRRGSFSSSRSNEIHPDLQEDVITTLLNISIHDSNKKLVAETPMVITLLVDALQYGTPE  291

Query  716   TRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENK  895
             TRSNAAAA+FTLSALDSNK LIGKSGALKPLIDLL+EG  +A+KD ASAIF LC++ ENK
Sbjct  292   TRSNAAAALFTLSALDSNKVLIGKSGALKPLIDLLDEGRPMAVKDAASAIFNLCIVPENK  351

Query  896   ARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSC  1075
             ARA+R+GAVRV+ +KI + VHVDELLAI AMLS++ RA+EE+ EL AVP LLS++R++SC
Sbjct  352   ARAVREGAVRVIFKKIKSGVHVDELLAIQAMLSTHQRAVEELAELEAVPCLLSVMRESSC  411

Query  1076  ARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRG  1255
             ARNKENCI ILY IC  DRTKL+E++DEE ++GT+SQLA++GTSRAKRKASG+L+RLNR 
Sbjct  412   ARNKENCIAILYTICINDRTKLREMRDEERAYGTLSQLAKDGTSRAKRKASGILERLNRA  471

Query  1256  VGFIHTA  1276
             +   HTA
Sbjct  472   LNITHTA  478



>ref|XP_003552093.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max]
Length=461

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/441 (63%), Positives = 349/441 (79%), Gaps = 19/441 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNN------------SFPAEFRC  145
             ELQR VK++V ++  + E ID+A++ LC L+ L   + ++            SFP EF+C
Sbjct  24    ELQRLVKSIVDDEDCSTETIDQAKETLCVLKELKLRKRSSLSLKLQNKSVTSSFPDEFKC  83

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             PLS ELM+DPV+++SGQTYDRPFIQKWLN+GNR CP+T QVLSHT+LTPNHLIR MI  W
Sbjct  84    PLSKELMRDPVILASGQTYDRPFIQKWLNAGNRTCPRTHQVLSHTVLTPNHLIREMIEQW  143

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
              K  GI F +  VQ ++E+G+   AD  +FL LL+KMSS+   Q++AA+ELRLLTK+ P 
Sbjct  144   SKNQGIEFSNT-VQYIDEEGL-NKADCEHFLCLLKKMSSTLSDQKTAAKELRLLTKKHPC  201

Query  506   FRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRV  673
             FR LF +S   A+P+LL P    D    VHPDLQED+ITT+LN+SIHD+NKKLVAETP V
Sbjct  202   FRVLFCDS-ADAIPQLLKPICGSDSFGSVHPDLQEDVITTLLNISIHDNNKKLVAETPMV  260

Query  674   ISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDV  853
             I +L+ +LRSG IETRSNAAAA+FTLSALDSNK LIGKSGALKPLIDLLEEGH LAMKDV
Sbjct  261   IPLLMRALRSGTIETRSNAAAALFTLSALDSNKELIGKSGALKPLIDLLEEGHPLAMKDV  320

Query  854   ASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             ASAIF +CV+HENKARA++DGAVRV++ KI  ++HV ELLAILA+LSS+  A+ +MG+LG
Sbjct  321   ASAIFNICVMHENKARAVKDGAVRVILAKINKQIHVAELLAILALLSSHQSAVHDMGDLG  380

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
             AVPSLL +I+++SC RNKENC+ IL  IC  DR+KLKEI++EE+ H TIS+LA+NGTSRA
Sbjct  381   AVPSLLRIIKESSCERNKENCVAILQTICLYDRSKLKEIREEENGHKTISELAKNGTSRA  440

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
             KRKASG+L+RLNR V   HTA
Sbjct  441   KRKASGILERLNRVVHITHTA  461



>gb|AFK33972.1| unknown [Lotus japonicus]
Length=453

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/435 (61%), Positives = 343/435 (79%), Gaps = 13/435 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPE---------QNNNSFPAEFRCPLS  154
             ELQR V+++V ++  +AEAID+A++ L  LR L            Q    FP EF+CP+S
Sbjct  22    ELQRLVRSIVDDEDCSAEAIDQAKETLSVLRDLKLRKKSSLSLKLQKTVVFPDEFKCPIS  81

Query  155   GELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKV  334
              ELMKDPV+V+SGQTYDRPFIQKWLNSGN+ CPQT QVL+HT+L PNHL+R MI  W K 
Sbjct  82    KELMKDPVIVASGQTYDRPFIQKWLNSGNQTCPQTNQVLAHTLLIPNHLVREMIEQWSKK  141

Query  335   NGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRA  514
              G+  P+  V  +NE+ +  +AD  +FL LLEKMSS+   Q++AA+ELRLLTK+ P +RA
Sbjct  142   QGLESPNT-VPYINEEAI-KEADSDHFLCLLEKMSSTLSDQKAAAKELRLLTKKHPCYRA  199

Query  515   LFGESMGAAMPKLLSPFSRVD-VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLID  691
             LF ++    +P+LL P    + +  DL+ED+ITT+LN+SIHDSNKK VAETP VI +L+ 
Sbjct  200   LFADTEDG-IPQLLKPICESNSLDSDLREDVITTLLNISIHDSNKKPVAETPMVIPLLMK  258

Query  692   SLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFV  871
             +LR+G IETRSNAAAAIFTLSALDSNK LIGKS ALKPLI+LLEEGH L MKDV+SAIF 
Sbjct  259   ALRTGTIETRSNAAAAIFTLSALDSNKELIGKSDALKPLIELLEEGHPLTMKDVSSAIFS  318

Query  872   LCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLL  1051
             +C++HEN+ARA++DGAVRV++ K+ NR+HV E LAILA+LS++H A+++MGELGAVPSLL
Sbjct  319   ICLIHENRARAVKDGAVRVILTKVKNRIHVAESLAILALLSTHHTAVQDMGELGAVPSLL  378

Query  1052  SLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASG  1231
             S++R+ SC R+KENC+ IL AIC  DR+KLKE++DEE+SH TIS+LA+ GTSRAKRKA+G
Sbjct  379   SIMREGSCERSKENCVAILQAICLYDRSKLKEVRDEENSHRTISELARTGTSRAKRKATG  438

Query  1232  VLDRLNRGVGFIHTA  1276
             +LDRLN+ V   HTA
Sbjct  439   ILDRLNKIVNITHTA  453



>ref|XP_006371139.1| hypothetical protein POPTR_0019s04500g [Populus trichocarpa]
 gb|ERP48936.1| hypothetical protein POPTR_0019s04500g [Populus trichocarpa]
Length=450

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/432 (62%), Positives = 338/432 (78%), Gaps = 11/432 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-----NNNSFPAEFRCPLSGELM  166
             EL++ VKA++ E+    E  D A + L  L+ L  ++     ++   P EF+CP+S E+M
Sbjct  23    ELEKLVKAILDEEDYRVEVTDEAMRVLSVLKELKFKKSLKIVDDTVLPEEFKCPISREIM  82

Query  167   KDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIW  346
              DPVV+++GQTYD PFIQ WLN G+R CPQTQQVLSHTILTPNHL+R MIS WCK  GI 
Sbjct  83    GDPVVLATGQTYDLPFIQGWLNDGHRTCPQTQQVLSHTILTPNHLVREMISQWCKERGIE  142

Query  347   FPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGE  526
              P P     + D V TDADR +   LLEKMSSS   Q+ AA+ELRLLTKRMPSFRALF +
Sbjct  143   LPRP---VKDVDEVRTDADRGHLKSLLEKMSSSLSDQKEAAKELRLLTKRMPSFRALFSD  199

Query  527   SMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             S  A +PKLL+P S  R + HPDLQED+ITT+LNLSIHD+NK+L AE P VI +L++S++
Sbjct  200   STDA-IPKLLNPLSPGRANTHPDLQEDLITTVLNLSIHDNNKRLAAENPLVIPLLVESVK  258

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
             SG IETRSNAAAAIF+LSALDSNK +IGKSGALKPLIDLLEEGH LAMKD ASAIF LC+
Sbjct  259   SGTIETRSNAAAAIFSLSALDSNKLIIGKSGALKPLIDLLEEGHPLAMKDAASAIFNLCL  318

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             + ENK RA+R+GAVRV+++KIM+ + VDELLAILAML+S+ +A+EEMGELGAV  LL +I
Sbjct  319   VLENKGRAVREGAVRVILKKIMDCIFVDELLAILAMLASHQKAVEEMGELGAVHCLLGII  378

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             R++S  RNKENC+ IL+ IC  D +K ++I++EE+++GT+S+LA++GTSRAKRKA+ +L+
Sbjct  379   RESSSERNKENCVAILHTICLNDYSKWRDIREEENANGTLSRLAESGTSRAKRKANSILE  438

Query  1241  RLNRGVGFIHTA  1276
             RLNR     HTA
Sbjct  439   RLNRAASLTHTA  450



>ref|XP_010999455.1| PREDICTED: U-box domain-containing protein 9-like [Populus euphratica]
Length=451

 Score =   533 bits (1372),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 267/433 (62%), Positives = 340/433 (79%), Gaps = 12/433 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-----NNNSFPAEFRCPLSGELM  166
             EL++ VKA++ E+    E  D A + L  L+ L  ++     ++   P EF+CP+S E+M
Sbjct  23    ELEKLVKAILDEEDYRVEVTDEAMRVLSVLKELKFKKSLKMVDDKIVPEEFKCPISREIM  82

Query  167   KDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIW  346
              DPVV+++GQTYD PFIQ+WLN G+R CPQTQQVLSHTILTPN L+R MIS WCK  GI 
Sbjct  83    GDPVVLATGQTYDLPFIQRWLNEGHRTCPQTQQVLSHTILTPNRLVREMISQWCKERGIE  142

Query  347   FPDPPVQCLNEDG-VVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
              P P     + DG V TDADR +   LLEKMSSS   Q+ AA+ELRLLTKRMPSFRALF 
Sbjct  143   LPKP---VKDVDGEVCTDADRGHLKSLLEKMSSSLSDQKEAAKELRLLTKRMPSFRALFS  199

Query  524   ESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSL  697
             +S+ A +PKLL+P S  R + HPDLQED+ITT+LNLSIHD+NK+L AE P VI +L++S+
Sbjct  200   DSIDA-IPKLLNPLSPGRANTHPDLQEDLITTVLNLSIHDNNKRLAAENPLVIPLLVESV  258

Query  698   RSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLC  877
             +SG IETRSNAAAAIF+LSALDSNK +IGKSGALKPLIDLLEEGH LAMKD ASAIF LC
Sbjct  259   KSGTIETRSNAAAAIFSLSALDSNKLIIGKSGALKPLIDLLEEGHPLAMKDAASAIFNLC  318

Query  878   VLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSL  1057
             ++ ENK RA+R+GAVRV++EKIM+ + VDELLAILAML+S+ +A+EEMGELGAV  LL +
Sbjct  319   LVLENKGRAVREGAVRVILEKIMDCIFVDELLAILAMLASHQKAVEEMGELGAVHCLLGI  378

Query  1058  IRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVL  1237
             IR++S  RNKENC+ IL+ IC  D +K ++I++EE+++GT+++LA++GTSRAKRKA+ +L
Sbjct  379   IRESSSERNKENCVAILHTICLNDYSKWRDIREEENANGTLARLAESGTSRAKRKANSIL  438

Query  1238  DRLNRGVGFIHTA  1276
             +RLNR     HTA
Sbjct  439   ERLNRAASLTHTA  451



>ref|XP_009337943.1| PREDICTED: U-box domain-containing protein 9-like [Pyrus x bretschneideri]
Length=471

 Score =   530 bits (1364),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 272/443 (61%), Positives = 333/443 (75%), Gaps = 22/443 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF----------------PA  133
             +L+R VKA+V ED    E  D A + L +L+ L   Q + SF                P 
Sbjct  33    QLERLVKAIVDEDDYRVETADEAIRTLASLKDLK-SQKSFSFKLAEGGSHGGGVLAGVPK  91

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EFRCP+SGELM DPVV+++G+T+DRPFIQ+WLN G+R CPQT QV+SHT+LTPNHL+R M
Sbjct  92    EFRCPISGELMADPVVLATGETFDRPFIQRWLNEGHRTCPQTNQVISHTVLTPNHLVREM  151

Query  314   ISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTK  493
             IS WC+   I  P P VQ ++E  +VT+ADR     LLEKMSSS   Q++AA+ELRLLTK
Sbjct  152   ISQWCREREIELPKP-VQDIDEQ-LVTNADRGYLNSLLEKMSSSLSDQKAAAKELRLLTK  209

Query  494   RMPSFRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETP  667
             R  SFRALFGES    +P+LL+P S  +VD HPDLQED+ITT+LNLSIHD+NK+LVAE  
Sbjct  210   RSSSFRALFGEST-ETIPQLLNPLSPGQVDAHPDLQEDLITTLLNLSIHDNNKRLVAENA  268

Query  668   RVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMK  847
              VI +LI+SL SG ++TRSNAAA  FTLSA+DSNK  IG SGA+KPLIDLL+EGH LAMK
Sbjct  269   SVICLLIESLISGTVQTRSNAAATFFTLSAIDSNKITIGASGAIKPLIDLLDEGHPLAMK  328

Query  848   DVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGE  1027
             D ASA+F LC + ENK RAI  GAVRV+++KIM+RV V ELLAILAMLSS+ RA++EM E
Sbjct  329   DAASAVFSLCTVLENKGRAINAGAVRVILKKIMDRVLVAELLAILAMLSSHQRAVQEMCE  388

Query  1028  LGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTS  1207
             LG VP L+ + R++ C RNKENC+ ILYA+C ADRTKLKEIK+EE  +GT S+L Q GTS
Sbjct  389   LGTVPCLIGITRESDCERNKENCVAILYALCFADRTKLKEIKEEEMVNGTFSRLVQTGTS  448

Query  1208  RAKRKASGVLDRLNRGVGFIHTA  1276
             RAKRKASG+L+RLNR     HTA
Sbjct  449   RAKRKASGILERLNRTGSITHTA  471



>ref|XP_008244688.1| PREDICTED: U-box domain-containing protein 9 isoform X2 [Prunus 
mume]
Length=396

 Score =   523 bits (1348),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 263/370 (71%), Positives = 314/370 (85%), Gaps = 7/370 (2%)
 Frame = +2

Query  179   VVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDP  358
             VV   +TYDRPFIQK L +GNRICP+TQQVLSHTILTPNHL+R MIS WCK  GI   DP
Sbjct  30    VVRKRKTYDRPFIQKGLKAGNRICPRTQQVLSHTILTPNHLVREMISQWCKNRGIELSDP  89

Query  359   PVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGA  538
              V  +NEDG+ T+++R +FL LL+KMSS    Q+ AA+ELR LTKRMPSFRALFGES+  
Sbjct  90    -VLLVNEDGI-TESERDHFLSLLQKMSSGLPEQKEAAKELRSLTKRMPSFRALFGESI-H  146

Query  539   AMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSG  706
             A+P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVAE+P VI +LI++L+SG
Sbjct  147   AIPQLLSPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKLVAESPMVIPLLIEALQSG  206

Query  707   AIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLH  886
              I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAIF LC+ H
Sbjct  207   TIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAIFNLCITH  266

Query  887   ENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRD  1066
             ENKARA+RDGAVR +++KI NR+HVDELLAILAMLSS+ +A+EEMGELGAVP LL +IR+
Sbjct  267   ENKARAVRDGAVRTILKKIRNRMHVDELLAILAMLSSHPKAVEEMGELGAVPCLLCVIRE  326

Query  1067  TSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRL  1246
             T+C RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LAQNGTSR+KRKASG+LDRL
Sbjct  327   TNCGRNKENCIAVLHTICLNDRTKWKEIREEENTYGTISELAQNGTSRSKRKASGILDRL  386

Query  1247  NRGVGFIHTA  1276
             NR V   HTA
Sbjct  387   NRTVNLTHTA  396



>ref|XP_008244689.1| PREDICTED: U-box domain-containing protein 9 isoform X3 [Prunus 
mume]
Length=391

 Score =   522 bits (1344),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 261/364 (72%), Positives = 311/364 (85%), Gaps = 7/364 (2%)
 Frame = +2

Query  197   TYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLN  376
             TYDRPFIQK L +GNRICP+TQQVLSHTILTPNHL+R MIS WCK  GI   DP V  +N
Sbjct  31    TYDRPFIQKGLKAGNRICPRTQQVLSHTILTPNHLVREMISQWCKNRGIELSDP-VLLVN  89

Query  377   EDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAAMPKLL  556
             EDG+ T+++R +FL LL+KMSS    Q+ AA+ELR LTKRMPSFRALFGES+  A+P+LL
Sbjct  90    EDGI-TESERDHFLSLLQKMSSGLPEQKEAAKELRSLTKRMPSFRALFGESI-HAIPQLL  147

Query  557   SPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRS  724
             SP S       +HP+LQED+ITT+LNLSIHD+NKKLVAE+P VI +LI++L+SG I+TRS
Sbjct  148   SPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKLVAESPMVIPLLIEALQSGTIQTRS  207

Query  725   NAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARA  904
             NAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH LAMKDVASAIF LC+ HENKARA
Sbjct  208   NAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPLAMKDVASAIFNLCITHENKARA  267

Query  905   IRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARN  1084
             +RDGAVR +++KI NR+HVDELLAILAMLSS+ +A+EEMGELGAVP LL +IR+T+C RN
Sbjct  268   VRDGAVRTILKKIRNRMHVDELLAILAMLSSHPKAVEEMGELGAVPCLLCVIRETNCGRN  327

Query  1085  KENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGVGF  1264
             KENCI +L+ IC  DRTK KEI++EE+++GTIS+LAQNGTSR+KRKASG+LDRLNR V  
Sbjct  328   KENCIAVLHTICLNDRTKWKEIREEENTYGTISELAQNGTSRSKRKASGILDRLNRTVNL  387

Query  1265  IHTA  1276
              HTA
Sbjct  388   THTA  391



>ref|XP_004492261.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Cicer arietinum]
Length=464

 Score =   521 bits (1341),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 262/444 (59%), Positives = 341/444 (77%), Gaps = 22/444 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ--------NNN--SFPAEFRCPL  151
             ELQR V ++V ++ ++ EAID+A+++LC L+ L   +        N N   FP EF+CPL
Sbjct  24    ELQRLVNSIVDDEDISIEAIDKAKESLCVLKELKIRKKSSMCLKINKNVVHFPDEFKCPL  83

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             S ELM+DPV+V+SGQTYDR FIQKWLN+GNR CPQT QVLS+T LTPN+LIR MI  W K
Sbjct  84    SNELMRDPVIVASGQTYDRFFIQKWLNAGNRTCPQTHQVLSNTFLTPNNLIREMIEKWSK  143

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
               GI   +  +  ++++G   ++D+++FL LLEKMSS+   ++SAA+ELRLLTK+ P FR
Sbjct  144   NQGIELCNV-ISYISDEGA-KESDKNHFLCLLEKMSSTLSDKKSAAKELRLLTKKHPCFR  201

Query  512   ALFGESMGAAMPKLLSPFSRVDVHP---------DLQEDIITTILNLSIHDSNKKLVAET  664
              LF +    A+P+LL P    +            DLQED+ITT+LN+SIHD+NKK+VAET
Sbjct  202   VLFCD-FENAIPQLLKPICEGNSIGNSSSNSINHDLQEDVITTLLNISIHDNNKKIVAET  260

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
             P VI +L+ +LR G IETR+N+AA +FTLSALDSNK LIGK  ALKPLI LLEEGH L M
Sbjct  261   PMVIPLLMKALRCGTIETRANSAATLFTLSALDSNKELIGKLNALKPLISLLEEGHPLTM  320

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KDVASAIF LC++H+NKARA+++GA+RV++ K+ NRVHVDELLAILA+LS++ +A+ EM 
Sbjct  321   KDVASAIFTLCMMHDNKARAVKEGAIRVIMMKMKNRVHVDELLAILALLSTHQKAVLEMA  380

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             ELGAVP LLS++R++SC RNKENC+ IL  IC  DR+KLK+IK+EE+S+ TIS+LA+NGT
Sbjct  381   ELGAVPCLLSVMRESSCERNKENCVAILQTICLYDRSKLKDIKEEENSYRTISELAKNGT  440

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRAKRKASG+L+RLNR V   HTA
Sbjct  441   SRAKRKASGILERLNRVVNITHTA  464



>gb|KEH22539.1| plant U-box protein [Medicago truncatula]
Length=459

 Score =   520 bits (1340),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 259/432 (60%), Positives = 336/432 (78%), Gaps = 17/432 (4%)
 Frame = +2

Query  23    AVVSEDGVNAEAIDRAQQALCALRGLH---PEQNNNS----------FPAEFRCPLSGEL  163
             ++V ++ ++ EAID+A++ LC L+ L      Q++NS          FP EF+CPLS E 
Sbjct  31    SIVDDEDISIEAIDKAKETLCVLKDLKLRKKSQSSNSMSFKINKNVTFPDEFKCPLSKEF  90

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M+DPV+V+SGQTYDRPFIQ+W N+GNR CPQT QVLSHT+LTPNHLIR MI  W K  G+
Sbjct  91    MRDPVIVASGQTYDRPFIQRWFNAGNRTCPQTHQVLSHTLLTPNHLIREMIEKWSKNQGL  150

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
                +  +  ++++G   +AD+ +FL LLEKMSS+ C Q+ AA++LRLLTK+ P FR LF 
Sbjct  151   ELCNA-MSYISDEGA-KEADQSHFLCLLEKMSSTLCDQKEAAKQLRLLTKKHPCFRVLFC  208

Query  524   ESMGAAMPKLLSPFSRVD-VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             +    A+P+LL P    D ++ +LQED+ITT+LN+SIHD+NKK VAE P VI +L  +LR
Sbjct  209   D-FEHAIPQLLKPICEGDSINHELQEDVITTLLNISIHDNNKKQVAEIPMVIPILKKALR  267

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
              G IETR+NAAA +FTLSALDSNK LIGKS ALKPLIDLLEEG+ LAMKDVASAIF LC+
Sbjct  268   CGTIETRANAAATLFTLSALDSNKELIGKSNALKPLIDLLEEGNPLAMKDVASAIFTLCM  327

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             +H+NKA A++DGAVRV++ K+ NRVHVDE LAILA+LS++ +A+ EM ELGAVP LLS++
Sbjct  328   MHDNKAIAVKDGAVRVIMAKMKNRVHVDESLAILALLSTHQKAVLEMAELGAVPCLLSIM  387

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             R++SC RNKENC+ IL  IC  DR+KL+EIK+EE+SH TIS+LA++GTSRAKRKASG+L+
Sbjct  388   RESSCERNKENCVAILQTICLYDRSKLREIKEEENSHRTISELAKSGTSRAKRKASGILE  447

Query  1241  RLNRGVGFIHTA  1276
             RL+R V   HTA
Sbjct  448   RLHRVVNITHTA  459



>ref|XP_009379719.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Pyrus x bretschneideri]
Length=469

 Score =   518 bits (1335),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 265/439 (60%), Positives = 332/439 (76%), Gaps = 18/439 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF------------PAEFRC  145
             +L+R VKA+V ED    E  D A +AL +L+ L  E++  SF            P EFRC
Sbjct  35    QLERLVKAIVDEDDYRVETADEAIRALASLKDLKSEKSF-SFKLHGGGGGTVVVPKEFRC  93

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             P+SGELM DPVV+++G+T+DRPFIQ+WLN G+R CPQT+QV+SHT+LTPNHL+R M+S W
Sbjct  94    PISGELMADPVVLATGETFDRPFIQRWLNEGHRTCPQTKQVISHTVLTPNHLVREMVSQW  153

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
             C+ + I  P P VQ ++E  +VT+ADR     LLEKMSSS   Q++AA++LRLLTKR  S
Sbjct  154   CREHEIELPKP-VQDIDEQ-LVTNADRGCLNSLLEKMSSSLSDQKAAAKQLRLLTKRSSS  211

Query  506   FRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVIS  679
             FRALFGES    +P+LL+P S  +VD HPDLQED+ITT+LNLSIHD+NK+LVAE   VI 
Sbjct  212   FRALFGEST-ETIPQLLNPLSPGQVDAHPDLQEDLITTLLNLSIHDNNKRLVAENTSVIR  270

Query  680   VLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVAS  859
             +LI+SL  G ++T+SNAAA  FTLSA+DSNK+ IG SGA+KPLIDLL+ GH LAMKDVAS
Sbjct  271   LLIESLEYGTVQTKSNAAATFFTLSAIDSNKSTIGASGAIKPLIDLLDVGHPLAMKDVAS  330

Query  860   AIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAV  1039
             A+F LC + ENK RAI  GAV V++ KIM+ V V ELL ILAMLS++ RA++EM ELGAV
Sbjct  331   AVFSLCTVLENKERAINAGAVGVILIKIMDHVLVAELLVILAMLSNHQRAVQEMCELGAV  390

Query  1040  PSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKR  1219
             P L+ + R++ C RNKENC+ ILY IC ADRTKLKEIK+EE + GT S+L Q GTSRAKR
Sbjct  391   PCLIGITRESDCERNKENCVAILYTICFADRTKLKEIKEEEMARGTFSRLVQTGTSRAKR  450

Query  1220  KASGVLDRLNRGVGFIHTA  1276
             KA G+L+RLNR     HTA
Sbjct  451   KARGILERLNRTGAITHTA  469



>gb|EYU21095.1| hypothetical protein MIMGU_mgv1a005997mg [Erythranthe guttata]
Length=461

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 258/436 (59%), Positives = 330/436 (76%), Gaps = 19/436 (4%)
 Frame = +2

Query  17    VKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-------------NNNSFPAEFRCPLSG  157
             VKA+V E+ VN +A++RA Q L AL+ +  ++             +  + P EF+CPLS 
Sbjct  29    VKAIVDEEDVNLDAVERAYQMLVALKEMKLKKTVSLKLRTDRELASAGTVPEEFKCPLSM  88

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELM+DPV++ SGQTYDRPFIQKWL SGNR CP+TQQVL+HT L PNHLIR MI+ WC  +
Sbjct  89    ELMRDPVIIDSGQTYDRPFIQKWLKSGNRTCPKTQQVLTHTTLAPNHLIREMITKWCNKH  148

Query  338   GIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             GI  PDP +    E+G   ++DR +FL LL +MSS+   Q+ AA+ELR LT++  S RAL
Sbjct  149   GIKLPDP-INYTYEEGFA-ESDREHFLSLLNRMSSALSEQKEAAKELRRLTRKTASVRAL  206

Query  518   FGESMGAAMPKLLSPFSR--VDVHPDLQEDIITTILNLSIHD-SNKKLVAETPRVISVLI  688
             F E+  A +P+LL+P S   +  HPDL EDIIT++LN++IHD +NKKLVAETP  I +LI
Sbjct  207   FAETPNA-IPQLLAPLSNGTIGAHPDLHEDIITSVLNIAIHDDNNKKLVAETPAAIPLLI  265

Query  689   DSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIF  868
             D++++G+IETRSNAAA IFTLSALDSNKAL+GKSGALKPLI+LL EGH  AM D ASAIF
Sbjct  266   DAVKNGSIETRSNAAATIFTLSALDSNKALLGKSGALKPLIELLREGHPAAMNDAASAIF  325

Query  869   VLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSL  1048
              LC+LHENK RA+RDGAV V++EKI NR  VD LL  LA+LS+N + +EEMG+L AVP L
Sbjct  326   NLCILHENKVRAVRDGAVVVILEKIKNRARVDILLPPLALLSTNQKCVEEMGDLEAVPCL  385

Query  1049  LSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
               +IR+T+C RNKENCI +L+AIC +DR+K K +++EES H TISQ+A NGTSRA+RKA 
Sbjct  386   FEIIRETTCDRNKENCIAMLHAICFSDRSKWKAMREEESMHRTISQVAHNGTSRAQRKAR  445

Query  1229  GVLDRLNRGVGFIHTA  1276
             G+L+RLN+ V   HTA
Sbjct  446   GILERLNKSVNVTHTA  461



>gb|EPS72799.1| hypothetical protein M569_01957 [Genlisea aurea]
Length=469

 Score =   514 bits (1324),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 268/445 (60%), Positives = 339/445 (76%), Gaps = 22/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVN--AEAIDRAQQALCALRGLHPEQ------------------NNN  121
             +L++ +KAV+ +D  +  +EAIDRA   L  L+G+  ++                  +  
Sbjct  27    DLKKMLKAVLDDDDGDFDSEAIDRAMAILSDLKGIKSKKGVGITIHDHHHHHHLRRKSQA  86

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             S P EF+CPLS ELMKDPV+++SGQT+DRPFI KWL SGNR CPQT QVLSHT+LTPNHL
Sbjct  87    SVPEEFKCPLSKELMKDPVIIASGQTFDRPFINKWLKSGNRTCPQTLQVLSHTVLTPNHL  146

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELR  481
             IR MIS WC  +GI  PD   +  +E+  +T++DR +FL LL KMSS+   Q+ AA+ELR
Sbjct  147   IREMISRWCADHGIELPDG-AKYADEEDALTESDRDHFLSLLAKMSSTLPEQKQAAKELR  205

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAE  661
              LTK +PSFRALFGES  A +PKLL P SR     DLQED+IT++LN+SIHD+NKKLVAE
Sbjct  206   RLTKNVPSFRALFGESPDA-IPKLLFPLSRDGTTADLQEDVITSLLNISIHDNNKKLVAE  264

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
             TP VI +L+D+L+SG + TRSN+AAA+FTLSALDSNK LIG+SGALK L+DLL EG +LA
Sbjct  265   TPAVIPLLVDALKSGTMVTRSNSAAALFTLSALDSNKTLIGRSGALKALVDLLNEGDALA  324

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
              KD ASAIF LC++HENK RA+ +GAV  +++KI  RVHV+EL++IL MLS++ RA+EEM
Sbjct  325   AKDAASAIFNLCIVHENKTRAVAEGAVPAILKKISGRVHVEELVSILTMLSNDQRAVEEM  384

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             G LGA P LL ++R T C RNKENC+ ILYAIC  DR+K KE+++EES HGTISQLAQNG
Sbjct  385   GILGATPFLLEILRATPCPRNKENCVAILYAICCNDRSKWKEMREEESRHGTISQLAQNG  444

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRAKRKASG+LDRL+R +  +HTA
Sbjct  445   TSRAKRKASGILDRLSRRIDLVHTA  469



>ref|XP_008388749.1| PREDICTED: U-box domain-containing protein 9-like [Malus domestica]
Length=467

 Score =   513 bits (1322),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 261/438 (60%), Positives = 326/438 (74%), Gaps = 16/438 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQN-----------NNSFPAEFRCP  148
             +L+R VKA+V ED    E  D A +AL  L+ L  +++               P EFRCP
Sbjct  33    QLERLVKAIVDEDDYRVETADEAIRALSYLKDLKSKKSLSFKLHGGGGGTVVIPKEFRCP  92

Query  149   LSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWC  328
             +SGELM DPVV+++G+T+DRPFIQ+W N G+R CPQT+QV+SHT+LTPNHL+R M+S WC
Sbjct  93    ISGELMADPVVLATGETFDRPFIQRWFNEGHRTCPQTKQVISHTVLTPNHLVREMVSQWC  152

Query  329   KVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSF  508
             + + I  P  PVQ ++E  +VT+ADR     LLEKMSSS   Q++AA++LRLLTKR  SF
Sbjct  153   REHEIELP-KPVQDIDEQ-LVTNADRGCLNSLLEKMSSSLSDQKAAAKQLRLLTKRSSSF  210

Query  509   RALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISV  682
             RALFGES    +P+LL+P S  +VD HPDLQED+ITT+LNLSIHD+NK+LVAE   VI +
Sbjct  211   RALFGEST-ETIPQLLNPLSXGQVDAHPDLQEDLITTLLNLSIHDNNKRLVAENASVIRL  269

Query  683   LIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASA  862
             LI+SL  G ++T+SNAAA  FTLSA+DSNK  IG SGA+KPLIDLL+ GH LAMKDVASA
Sbjct  270   LIESLEYGTVQTKSNAAATFFTLSAIDSNKITIGASGAMKPLIDLLDVGHPLAMKDVASA  329

Query  863   IFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVP  1042
             +F LC   ENK RAI  GAV V++ KIM+ V V E L ILAMLS++ RA++EM ELGAVP
Sbjct  330   VFSLCTXLENKERAINAGAVGVILIKIMDHVLVAEXLVILAMLSNHQRAVQEMCELGAVP  389

Query  1043  SLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRK  1222
              L+ + R++ C RNKENC+ ILY IC ADRTKLKEIK+EE + GT S+L Q GTSRAKRK
Sbjct  390   CLIGITRESDCERNKENCVAILYTICFADRTKLKEIKEEEMTRGTFSRLVQTGTSRAKRK  449

Query  1223  ASGVLDRLNRGVGFIHTA  1276
             ASG+L+RLNR     HTA
Sbjct  450   ASGILERLNRTGSITHTA  467



>gb|KDP23775.1| hypothetical protein JCGZ_23608 [Jatropha curcas]
Length=459

 Score =   508 bits (1308),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 268/439 (61%), Positives = 333/439 (76%), Gaps = 17/439 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS------------FPAEFRC  145
             +LQ  V+A++ E+  +    D+    L AL+ L  ++  NS             P EF+C
Sbjct  24    QLQILVQAILDEEDYSLGITDQIINILTALKKLKLKKLQNSSDDSLKVVDDCVVPDEFKC  83

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             P+S ELM DPV++++G+TYDRPFI +WLN G+R CPQTQQVL HTILTPNHL+R MI  W
Sbjct  84    PISRELMTDPVILATGRTYDRPFILRWLNDGHRTCPQTQQVLPHTILTPNHLVREMILQW  143

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
              K  GI   D PVQ + +D VVTDAD+     LL+KMSSS   Q+ AA+ELRLLTKR PS
Sbjct  144   SKERGIKL-DMPVQDV-DDNVVTDADKGYLNSLLKKMSSSLSDQKLAAKELRLLTKRKPS  201

Query  506   FRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVIS  679
             FRALF ES  AA+P+LL+P S  + D HPDLQED+ITTILNLSIHD NKK+VA  P VI 
Sbjct  202   FRALFSEST-AAIPQLLNPLSPGKADAHPDLQEDLITTILNLSIHDDNKKIVAGNPLVIP  260

Query  680   VLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVAS  859
             +LI+SL+ G +ETRSNAAAA+FTLSALDSNK LIG+SGALK LIDLLEEG+ LAMKD AS
Sbjct  261   LLIESLKFGTMETRSNAAAALFTLSALDSNKVLIGQSGALKSLIDLLEEGNPLAMKDAAS  320

Query  860   AIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAV  1039
             AIF LC++ +NK RA+RDGAV+V+++KIM  V VDELLAILAML+S+  A+EEM ELGAV
Sbjct  321   AIFNLCIVIDNKGRAVRDGAVKVILKKIMCGVLVDELLAILAMLASHQTAVEEMAELGAV  380

Query  1040  PSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKR  1219
               LL +IR+++  RNKENCI ILY IC  DRTK KEI++EE ++GT+S+LA+NGTSRAKR
Sbjct  381   NCLLDIIRESTSERNKENCIAILYTICFNDRTKFKEIQEEEKTYGTLSKLAENGTSRAKR  440

Query  1220  KASGVLDRLNRGVGFIHTA  1276
             KA+G+L+RL+R     HTA
Sbjct  441   KANGILERLDRVALLTHTA  459



>ref|XP_007205152.1| hypothetical protein PRUPE_ppa005364mg [Prunus persica]
 gb|EMJ06351.1| hypothetical protein PRUPE_ppa005364mg [Prunus persica]
Length=464

 Score =   506 bits (1304),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 271/437 (62%), Positives = 338/437 (77%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRG--------LHPEQNNN--SFPAEFRCPL  151
             +L+R VKA+V ED    E  D A +AL +L+G          P+ + N    P +FRCP+
Sbjct  31    QLERLVKAIVDEDDYRVETADEAIRALSSLKGLKLKKSLSFKPDGHGNLLDVPEDFRCPI  90

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             SGELMKDPVV+++GQTYDRPFIQ+WLN GNR CPQT+QVLSHT+LTPNHL++ MIS WC+
Sbjct  91    SGELMKDPVVLATGQTYDRPFIQRWLNEGNRTCPQTKQVLSHTVLTPNHLVQEMISQWCR  150

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
              +G+  P P VQ ++E+ VV++ADR     LL+KMSSS   Q+ AA+ELRLLTKR   FR
Sbjct  151   EHGMELPKP-VQDIDEE-VVSNADRGYLNSLLQKMSSSLSDQKEAAKELRLLTKRSSPFR  208

Query  512   ALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             ALFGES+   +P+LLSP S  + D  PDLQED+ITT+LNLSIHD+NK+LVAE P VI +L
Sbjct  209   ALFGESI-ETIPQLLSPLSPGQADTDPDLQEDLITTLLNLSIHDNNKRLVAEHPLVIPLL  267

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I+SL SG I+T+SNAAA  FTL+A+DSNK +IG SGAL PLIDLL+EGH LAMKDVASAI
Sbjct  268   IESLISGTIQTKSNAAATFFTLAAIDSNKIIIGTSGALNPLIDLLDEGHPLAMKDVASAI  327

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC + ENK RAI  GAV+V+++KIM+RV V ELLAILAMLSS+ +A++EM ELG V  
Sbjct  328   FSLCSVLENKGRAINAGAVKVILQKIMDRVLVAELLAILAMLSSHQKAVQEMCELGTVSC  387

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             L  +IR++ C  NKENCI ILY IC ADRTKLKEIK+EE ++GT+S+LA+ GTSRAKRKA
Sbjct  388   LFGIIRESDCEHNKENCIAILYTICFADRTKLKEIKEEEMANGTVSRLARTGTSRAKRKA  447

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+L+RLN+     HTA
Sbjct  448   SGILERLNKTGSITHTA  464



>ref|XP_006479026.1| PREDICTED: U-box domain-containing protein 9-like [Citrus sinensis]
Length=458

 Score =   506 bits (1302),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 335/440 (76%), Gaps = 18/440 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNA-EAIDRAQQALCALRGLHPEQNNN------------SFPAEFR  142
             ELQR VKA++ ED     +  + A + L  L+ L  +++++              P EFR
Sbjct  22    ELQRLVKAILDEDDYGGLQVTNEALRVLSCLKDLKLKKSHSFKGGAAGDDHLLGLPYEFR  81

Query  143   CPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISN  322
             CP+SGE+M DPVV+++GQT+DRP IQ+WL+ GNR CPQT+QVLSHT+L PNHL+R MIS 
Sbjct  82    CPISGEIMTDPVVLANGQTFDRPCIQRWLDEGNRTCPQTRQVLSHTVLIPNHLVREMISQ  141

Query  323   WCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMP  502
             WCK +GI  P P ++  +ED VVTDA R +   LLEKMSSS   Q+ AA+ELRLLTKRMP
Sbjct  142   WCKEHGIELPKP-IKDTDED-VVTDASRSHLNSLLEKMSSSLSDQKEAAKELRLLTKRMP  199

Query  503   SFRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             SFRALFGES  A +P LLSP S  R D  P L ED+ITTILNLSIHD NK+LVAE P  I
Sbjct  200   SFRALFGESTDA-IPLLLSPLSPGRADTDPGLLEDLITTILNLSIHDENKRLVAENPLAI  258

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +LIDS+R+G IETR NAAAA+F+LSALDSNK +IGK GA+ PLIDLLEEGH LAMKDVA
Sbjct  259   PLLIDSVRTGTIETRRNAAAALFSLSALDSNKLIIGKLGAMTPLIDLLEEGHPLAMKDVA  318

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF LC+L ENK RA+  GAVRV++ KIM    VDELLAILAMLSS+  AIEE+GELGA
Sbjct  319   SAIFSLCILLENKRRAVHAGAVRVILRKIMENSLVDELLAILAMLSSHQDAIEEIGELGA  378

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             +P LL +IR+++C RNKENC  ILY IC  DRT+ +EI +EE+++GT+S+LA+NGTSRAK
Sbjct  379   IPCLLRIIRESTCERNKENCAAILYNICFTDRTRTREIMEEENANGTLSRLAENGTSRAK  438

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKA+G+L+RLN+    +HTA
Sbjct  439   RKANGILERLNKAALIVHTA  458



>ref|XP_008218380.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Prunus mume]
Length=462

 Score =   503 bits (1295),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 271/437 (62%), Positives = 332/437 (76%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR----------GLHPEQNNNSFPAEFRCPL  151
             +L+R VKA+V ED    E  D A  AL +L+           L    N    P +FRCP+
Sbjct  29    QLERLVKAIVDEDDYRVETADEAISALSSLKGLKLKKSLSFKLDGHGNLLDVPEDFRCPI  88

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             SGELMKDPVV+++GQTYDRPFIQ+WLN GNR CPQT+QVLSHT+LTPNHL+R MIS WC+
Sbjct  89    SGELMKDPVVLATGQTYDRPFIQRWLNEGNRTCPQTKQVLSHTVLTPNHLVREMISQWCR  148

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
              +G+  P P VQ ++E+ VVT+ADR     LL+KMSSS   Q+ AA+ELRLLTKR   FR
Sbjct  149   EHGMELPKP-VQDIDEE-VVTNADRGYLNSLLQKMSSSLSDQKEAAKELRLLTKRSSPFR  206

Query  512   ALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             ALFGES+   + +LLSP S  + D  PDL ED+ITT+LNLSIHD+NK+LVAE P VI +L
Sbjct  207   ALFGESI-ETIRQLLSPLSPGQADTDPDLHEDLITTLLNLSIHDNNKRLVAEHPLVIPLL  265

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I+SL SG I+T+SNAAA  FTL+A+DSNK +IG SGAL PLIDLL+EGH LAMKDVASAI
Sbjct  266   IESLISGTIQTKSNAAATFFTLAAIDSNKIIIGTSGALNPLIDLLDEGHPLAMKDVASAI  325

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC + ENK RAI  GAVRV+++KIM+RV V ELLAILAMLSS+ +A++EM ELG V  
Sbjct  326   FSLCSVLENKGRAINAGAVRVILQKIMDRVLVAELLAILAMLSSHQKAVQEMCELGTVSC  385

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             L  +IR++ C  NKENCI ILY IC ADRTKLKEIK+EE ++GT+S+LA+ GTSRAKRKA
Sbjct  386   LFGIIRESDCEHNKENCIAILYTICFADRTKLKEIKEEEMANGTVSRLARTGTSRAKRKA  445

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+L+RLN+     HTA
Sbjct  446   SGILERLNKTGSITHTA  462



>ref|XP_008218381.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Prunus mume]
Length=445

 Score =   502 bits (1293),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 271/437 (62%), Positives = 332/437 (76%), Gaps = 15/437 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR----------GLHPEQNNNSFPAEFRCPL  151
             +L+R VKA+V ED    E  D A  AL +L+           L    N    P +FRCP+
Sbjct  12    QLERLVKAIVDEDDYRVETADEAISALSSLKGLKLKKSLSFKLDGHGNLLDVPEDFRCPI  71

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             SGELMKDPVV+++GQTYDRPFIQ+WLN GNR CPQT+QVLSHT+LTPNHL+R MIS WC+
Sbjct  72    SGELMKDPVVLATGQTYDRPFIQRWLNEGNRTCPQTKQVLSHTVLTPNHLVREMISQWCR  131

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
              +G+  P P VQ ++E+ VVT+ADR     LL+KMSSS   Q+ AA+ELRLLTKR   FR
Sbjct  132   EHGMELPKP-VQDIDEE-VVTNADRGYLNSLLQKMSSSLSDQKEAAKELRLLTKRSSPFR  189

Query  512   ALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
             ALFGES+   + +LLSP S  + D  PDL ED+ITT+LNLSIHD+NK+LVAE P VI +L
Sbjct  190   ALFGESI-ETIRQLLSPLSPGQADTDPDLHEDLITTLLNLSIHDNNKRLVAEHPLVIPLL  248

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             I+SL SG I+T+SNAAA  FTL+A+DSNK +IG SGAL PLIDLL+EGH LAMKDVASAI
Sbjct  249   IESLISGTIQTKSNAAATFFTLAAIDSNKIIIGTSGALNPLIDLLDEGHPLAMKDVASAI  308

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC + ENK RAI  GAVRV+++KIM+RV V ELLAILAMLSS+ +A++EM ELG V  
Sbjct  309   FSLCSVLENKGRAINAGAVRVILQKIMDRVLVAELLAILAMLSSHQKAVQEMCELGTVSC  368

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             L  +IR++ C  NKENCI ILY IC ADRTKLKEIK+EE ++GT+S+LA+ GTSRAKRKA
Sbjct  369   LFGIIRESDCEHNKENCIAILYTICFADRTKLKEIKEEEMANGTVSRLARTGTSRAKRKA  428

Query  1226  SGVLDRLNRGVGFIHTA  1276
             SG+L+RLN+     HTA
Sbjct  429   SGILERLNKTGSITHTA  445



>gb|KDO42117.1| hypothetical protein CISIN_1g012677mg [Citrus sinensis]
Length=458

 Score =   501 bits (1291),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 270/440 (61%), Positives = 333/440 (76%), Gaps = 18/440 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNA-EAIDRAQQALCALRGLHPEQNNN------------SFPAEFR  142
             ELQR VKA++ ED     +  + A + L  L+ L  ++ ++              P EFR
Sbjct  22    ELQRLVKAILDEDDYGGLQVTNEALRVLSCLKDLKLKKPHSFKGGAAGDDHLLGLPYEFR  81

Query  143   CPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISN  322
             CP+SGE+M DPVV+++GQT+DRP IQ+WL+ GNR CPQT+QVLSHT+L PNHL+R MIS 
Sbjct  82    CPISGEIMTDPVVLANGQTFDRPCIQRWLDEGNRTCPQTRQVLSHTVLIPNHLVREMISQ  141

Query  323   WCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMP  502
             WCK +GI  P P ++  +ED VVTDA R +   LLEKMSSS   Q+ AA+ELRLLTKRMP
Sbjct  142   WCKEHGIELPKP-IKDTDED-VVTDASRSHLNSLLEKMSSSLSDQKEAAKELRLLTKRMP  199

Query  503   SFRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
              FRALFGES  A +P LLSP S  R D  P L ED+ITTILNLSIHD NK+LVAE P  I
Sbjct  200   LFRALFGESTDA-IPLLLSPLSPGRADTDPGLLEDLITTILNLSIHDENKRLVAENPLAI  258

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +LIDS+R+G IETR NAAAA+F+LSALDSNK +IGK GA+ PLIDLLEEGH LAMKDVA
Sbjct  259   PLLIDSVRTGTIETRRNAAAALFSLSALDSNKLIIGKLGAMTPLIDLLEEGHPLAMKDVA  318

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF LC+L ENK RA+  GAVRV++ KIM    VDELLAILAMLSS+  AIEE+GELGA
Sbjct  319   SAIFSLCILLENKRRAVHAGAVRVILRKIMENSLVDELLAILAMLSSHQDAIEEIGELGA  378

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             +P LL +IR+++C RNKENC  ILY IC  DRT+ +EI +EE+++GT+S+LA+NGTSRAK
Sbjct  379   IPCLLRIIRESTCERNKENCAAILYNICFTDRTRTREIMEEENANGTLSRLAENGTSRAK  438

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKA+G+L+RLN+    +HTA
Sbjct  439   RKANGILERLNKAALIVHTA  458



>ref|XP_009779917.1| PREDICTED: U-box domain-containing protein 9-like [Nicotiana 
sylvestris]
Length=462

 Score =   498 bits (1282),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 267/441 (61%), Positives = 335/441 (76%), Gaps = 19/441 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-NNNSF------------PAEFR  142
             ELQRAVKAVV +D  + E  DRA Q LCAL+ L  +  N+N              P EF 
Sbjct  25    ELQRAVKAVVEDDDYSLEVTDRAMQCLCALKELKLKPLNSNPLDIRSLSLSLPIPPHEFV  84

Query  143   CPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISN  322
             CPLSG+LMKDPVV++SGQTYDRPFIQKWL  G+R CP+T+QVLSH++LTPNHL+R MIS 
Sbjct  85    CPLSGQLMKDPVVLASGQTYDRPFIQKWLKDGHRTCPETKQVLSHSVLTPNHLVRKMISQ  144

Query  323   WCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRM  499
             WC+ +GI  P P     N+D ++T+ADR +   LLE +SSS    Q+ AA+E+R+LTK+M
Sbjct  145   WCQKHGIELPGPS-HDENQD-IITNADRDHLNSLLEMLSSSKVPEQKKAAKEVRVLTKQM  202

Query  500   PSFRALFGESMGAAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRV  673
             PS RA+FGE    A+ KLL+P     V+ HPDLQED++TT+LN+SIHDSNKKLVAE P  
Sbjct  203   PSLRAVFGEC-NDAITKLLNPLLSGNVNTHPDLQEDLVTTVLNISIHDSNKKLVAENPVA  261

Query  674   ISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDV  853
             +  LI+SL+ G +ETRSN+AAA+FTLSALDSNK +I K GALKPLIDLL EG  LAMKD 
Sbjct  262   LPFLIESLKFGTLETRSNSAAALFTLSALDSNKHIIAKVGALKPLIDLLNEGQPLAMKDA  321

Query  854   ASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             ASAIF L ++HENK RA+ +GA++V+++KI   V +DELLAILA+LSS+H+AIEEMGELG
Sbjct  322   ASAIFNLSIVHENKGRAVAEGAIKVIMKKIRGHVLIDELLAILALLSSHHKAIEEMGELG  381

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
             AV  LLS+I + +  RNKENCI ILY +C  DRTKL+EI  +ES +GTIS LAQ+GTSRA
Sbjct  382   AVSCLLSIINEDTSDRNKENCIAILYTMCYNDRTKLREIWLDESVNGTISSLAQSGTSRA  441

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
             KRKA+G+L+RL+R V  +HT 
Sbjct  442   KRKANGILERLDRYVSLVHTT  462



>ref|XP_007147242.1| hypothetical protein PHAVU_006G107800g [Phaseolus vulgaris]
 gb|ESW19236.1| hypothetical protein PHAVU_006G107800g [Phaseolus vulgaris]
Length=443

 Score =   496 bits (1276),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 263/430 (61%), Positives = 327/430 (76%), Gaps = 11/430 (3%)
 Frame = +2

Query  5     LQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFP--AEFRCPLSGELMKDPV  178
             L+  VKA+V  D    EA D A   L AL+      + + FP   EFRCP+S +LM DPV
Sbjct  19    LRELVKAIVDSDDYTVEAADEAIATLSALKHFKSPNSLDDFPLPPEFRCPISTQLMTDPV  78

Query  179   VVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDP  358
             ++S+GQTYDRPFIQ+WL  G+R CPQTQQVLSH+ILTPN+L+R MI  WC+  GI  P P
Sbjct  79    ILSTGQTYDRPFIQRWLKEGHRTCPQTQQVLSHSILTPNYLVRDMIVQWCRDRGIELPKP  138

Query  359   PVQCLNE-DGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMG  535
                 +N+ D VVT+ADR++   LL K+S S   Q+ AA+ELRLLTKRMPS R L GES  
Sbjct  139   ----VNDIDEVVTNADRNHLNSLLRKLSLSVSDQKQAAKELRLLTKRMPSIRILAGES-S  193

Query  536   AAMPKLLSPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSG  706
               +P+LLSP S        PDL ED+ITT+LNLSIHD NKK  AE P VIS+LID+L+SG
Sbjct  194   DVIPQLLSPLSSPGTASADPDLHEDLITTVLNLSIHDDNKKGFAEDPAVISLLIDALKSG  253

Query  707   AIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLH  886
              I+TRSNAAAAIFTLSALDSNK +IGKSGA+K L++LL+EG  LAMKD ASAIF LC++H
Sbjct  254   TIQTRSNAAAAIFTLSALDSNKHIIGKSGAIKHLLELLDEGQPLAMKDAASAIFNLCLVH  313

Query  887   ENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRD  1066
             ENK R +RDGAVRV+++K+M+ + VDELLAILA+LSS+ RAIEEMG+LGAVP LL +IR+
Sbjct  314   ENKGRTVRDGAVRVILKKMMDHILVDELLAILALLSSHPRAIEEMGDLGAVPLLLRIIRE  373

Query  1067  TSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRL  1246
             ++  R+KENC+ ILY IC +DRTKLKEI++EE ++GT+  LAQ GTSRAKRKA+G+L+RL
Sbjct  374   STSERSKENCVAILYTICFSDRTKLKEIREEEKANGTLLNLAQCGTSRAKRKANGILERL  433

Query  1247  NRGVGFIHTA  1276
             NR     HTA
Sbjct  434   NRSPYLTHTA  443



>ref|XP_009590562.1| PREDICTED: U-box domain-containing protein 9-like [Nicotiana 
tomentosiformis]
Length=462

 Score =   491 bits (1264),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 338/440 (77%), Gaps = 21/440 (5%)
 Frame = +2

Query  8     QRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-NNNSF------------PAEFRCP  148
             QRAVKAVV +D  + EA DRA Q LCAL+ L  +  N+N              P EF CP
Sbjct  27    QRAVKAVVEDDDYSLEATDRAMQCLCALKELKLKPLNSNPLDIRSLSLSLPIPPNEFVCP  86

Query  149   LSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWC  328
             +SG+LMKDPVV++SG TYDRPFIQKWL  G+R CP+T+QVLSH++LTPNHL+R MIS+WC
Sbjct  87    ISGQLMKDPVVLASGLTYDRPFIQKWLKDGHRTCPETKQVLSHSVLTPNHLVRKMISHWC  146

Query  329   KVNGIWFPDPPVQCLNED-GVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMP  502
             + +GI  P P     +ED  ++T+ADR    +LLE +SS + + Q+ AA+E+R+LTK+MP
Sbjct  147   QKHGIELPGP---SHDEDHDIITNADRDRLNLLLEILSSGNVLEQKKAAKEVRVLTKQMP  203

Query  503   SFRALFGESMGAAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             S RA+FGE    A+ KLL+P     V+ HPDLQED++TT+LN+SIHDSNKKL+AE P V+
Sbjct  204   SLRAVFGEC-NDAITKLLNPLLSGNVNNHPDLQEDLVTTVLNISIHDSNKKLIAENPVVV  262

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +LI+SL+ G +ETRSN+AAA+FTLSALDSNK +I K+GALKPLIDLL EG  LAMKD A
Sbjct  263   PLLIESLKFGTLETRSNSAAALFTLSALDSNKHIITKAGALKPLIDLLNEGQPLAMKDAA  322

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGA  1036
             SAIF L ++HENK +A+ +GA++V+++KI  RV +DELLAILA+LSS+H+AIEEMGELGA
Sbjct  323   SAIFNLSIVHENKGKAVAEGAIKVIMKKIRGRVLIDELLAILALLSSHHKAIEEMGELGA  382

Query  1037  VPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             V  LLS+I + +  RNKENCI ILY +C  DRTKL+EI  +ES +GTIS LAQ+GTSRAK
Sbjct  383   VSCLLSIINEDTSDRNKENCIAILYTMCYNDRTKLREIWLDESVNGTISCLAQSGTSRAK  442

Query  1217  RKASGVLDRLNRGVGFIHTA  1276
             RKA+G+L+RL+R V   HT 
Sbjct  443   RKANGILERLDRYVSLAHTT  462



>ref|NP_566304.1| ARM domain-containing protein [Arabidopsis thaliana]
 sp|Q9SRT0.1|PUB9_ARATH RecName: Full=U-box domain-containing protein 9; AltName: Full=Plant 
U-box protein 9 [Arabidopsis thaliana]
 gb|AAF02146.1|AC009853_6 hypothetical protein [Arabidopsis thaliana]
 gb|AAL91644.1| AT3g07360/F21O3_7 [Arabidopsis thaliana]
 gb|AEE74532.1| ARM domain-containing protein [Arabidopsis thaliana]
Length=460

 Score =   490 bits (1262),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 332/448 (74%), Gaps = 29/448 (6%)
 Frame = +2

Query  2     ELQRAVKAVV----SEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEF  139
             EL+R +K ++     ED +  + ID+ Q AL ALR     +             S P EF
Sbjct  19    ELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKMAKSSSLEMLETVSCPEEF  78

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
             RCPLS ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS
Sbjct  79    RCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIREMIS  138

Query  320   NWCKVNGI-----WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELR  481
              WCK NG+     + P+     +NED  VT +DR  F  LL K+SSS+   Q+SAA+ELR
Sbjct  139   KWCKKNGLETKSQYHPN----LVNEDETVTRSDREIFNSLLCKVSSSNLQDQKSAAKELR  194

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SNKKL  652
             LLT++   FRALFGES    + +L++P      +PD  LQED++TT+LN+SIHD SNKKL
Sbjct  195   LLTRKGTEFRALFGESPDE-ITRLVNPLLH-GSNPDEKLQEDVVTTLLNISIHDDSNKKL  252

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             V E P VI +LID+LR G + TRSNAAAAIFTLSALDSNK LIGKSG LKPLIDLLEEG+
Sbjct  253   VCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLEEGN  312

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
              LA+KDVA+AIF LC+ HEN++RA+RDGAVRVL +KI N ++VDELLAILAML ++ +A+
Sbjct  313   PLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAV  372

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
             EE+GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI++L+
Sbjct  373   EELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLS  432

Query  1193  QNGTSRAKRKASGVLDRLNRGVGFIHTA  1276
             + GTSRA+RKA+G+LDRL + +   HTA
Sbjct  433   REGTSRAQRKANGILDRLRKAMNLTHTA  460



>ref|XP_010547136.1| PREDICTED: U-box domain-containing protein 9-like [Tarenaya hassleriana]
Length=466

 Score =   490 bits (1262),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 258/448 (58%), Positives = 333/448 (74%), Gaps = 27/448 (6%)
 Frame = +2

Query  2     ELQRAVKAVVSEDG---VNAEAIDRAQQALCALRGLHPEQ----NNNSF--------PAE  136
             E+Q+ V++++ E+G   +  +A D+ Q+AL AL+ +   +    N++S         P E
Sbjct  23    EMQKLVRSILEEEGDDNLGVQAFDQLQEALLALKEMTVRKKKMGNSSSLEMFETMSCPDE  82

Query  137   FRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMI  316
             FRCPLS ELM+DPVV++SGQT+DRP IQKWL+SGN+ CP+TQQVLSHT LTPN LIR +I
Sbjct  83    FRCPLSNELMRDPVVLASGQTFDRPSIQKWLSSGNKTCPKTQQVLSHTALTPNVLIRELI  142

Query  317   SNWCKVNGIWFPDP-----PVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             S WCK  G+   +P     P     E+ V+  +D   F  LL K+SS +   Q+SAA+EL
Sbjct  143   SKWCKKVGL---EPSNLVHPHLVEEEEPVLPKSDLEIFQSLLAKISSPNLSDQKSAAKEL  199

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             RLLTKR P FRALFG+S  + + +L+ P   S  +V   LQED+ITT+LN+SIHDSNKKL
Sbjct  200   RLLTKRGPEFRALFGDS-PSEITRLVGPLKGSSSNVDEQLQEDVITTLLNISIHDSNKKL  258

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             V E P VI +L+DSLR G I TRSNAAAAIFTLSALDSNK +IGKSGALKPLIDLLEEGH
Sbjct  259   VCENPNVIPLLLDSLRRGTIATRSNAAAAIFTLSALDSNKTMIGKSGALKPLIDLLEEGH  318

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
              LA+KDVA+AIF LC+ H+N+ARA+RDGAVRV+  KI + ++VDELL ILAML S+ +A+
Sbjct  319   PLAIKDVAAAIFTLCIAHDNRARAVRDGAVRVMNNKISDGLYVDELLVILAMLVSHWKAV  378

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
             +E+GELGAV  LL +IR++ C RNKEN + IL+ IC +DRTK KEI++ E +HG +++LA
Sbjct  379   DELGELGAVSWLLKIIRESECERNKENAVAILHTICFSDRTKWKEIREAEKAHGAMAKLA  438

Query  1193  QNGTSRAKRKASGVLDRLNRGVGFIHTA  1276
             + GTSRA+RKASG+LDRL R V   HTA
Sbjct  439   REGTSRAQRKASGILDRLRRAVNLTHTA  466



>ref|XP_004302119.1| PREDICTED: U-box domain-containing protein 9-like [Fragaria vesca 
subsp. vesca]
Length=449

 Score =   488 bits (1256),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 260/432 (60%), Positives = 330/432 (76%), Gaps = 10/432 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNN----SFPAEFRCPLSGELMK  169
             +L++ VK +V E+    E  + A +AL +L+ L   + +       P EFRCP+SGELM 
Sbjct  21    QLRKLVKDIVEEEDYRVETAEEAMRALSSLKNLKSSKKSLSFKLDVPQEFRCPISGELMI  80

Query  170   DPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWF  349
             DPVV+++GQTYDRPFIQ+ LN G++ICPQT+QVL+HTILTPN+L+R MIS WCK +GI  
Sbjct  81    DPVVLATGQTYDRPFIQRLLNEGSQICPQTKQVLAHTILTPNNLVRQMISQWCKEHGIES  140

Query  350   PDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRALFGE  526
             P P VQ + E+ +VT ADR+    LL+K SSSS   Q+ AA+ELRLLTKR  SFRALFGE
Sbjct  141   PKP-VQDIGEE-IVTSADRNYLNALLQKTSSSSLSDQKEAAKELRLLTKRSSSFRALFGE  198

Query  527   SMGAAMPKLLSPFSR--VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             S    + +LLSP S+  V  HPDLQED+ITT+LNLSIHD+NK+LVAE P VI +LI+SL 
Sbjct  199   S-AEIIAQLLSPLSQGQVATHPDLQEDLITTLLNLSIHDNNKRLVAENPLVIPLLIESLV  257

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
              G I+T+SNAAA  FTLSA+DSNK +IG SGALKPLIDLL EGH LAMKDVA+AIF LC 
Sbjct  258   FGTIQTKSNAAATFFTLSAIDSNKIVIGASGALKPLIDLLHEGHPLAMKDVATAIFRLCT  317

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
               EN+ RA+  G V V+++KIM+ V V ELLAILA++S+N +AI++M E GAV  L+ +I
Sbjct  318   DLENRGRAVNAGVVWVILKKIMDGVLVAELLAILAIISTNQKAIQDMCEFGAVSCLVKII  377

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             R+++C R+KENCIVILY IC + R+KLKEIKDEE S+GT S+LAQ+GTSRAKRKA G+L+
Sbjct  378   RESNCERDKENCIVILYNICFSARSKLKEIKDEEMSNGTFSRLAQSGTSRAKRKAIGILE  437

Query  1241  RLNRGVGFIHTA  1276
             RLN+     HTA
Sbjct  438   RLNKTGTVTHTA  449



>ref|XP_010248085.1| PREDICTED: U-box domain-containing protein 9-like isoform X1 
[Nelumbo nucifera]
Length=441

 Score =   488 bits (1255),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/433 (57%), Positives = 322/433 (74%), Gaps = 10/433 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR------GLHPEQNNNSFPAEFRCPLSGEL  163
             EL R ++ ++ ED    E  D+A + L AL+       L  + +  + P  FRCPLS EL
Sbjct  11    ELSRLIQLILDEDDSRPETFDQAMEILSALKDFKCKKSLSHKVDTIACPDLFRCPLSKEL  70

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             MKDPVV++SG+TYDRPFIQKWL  GN ICP++++++S ++L PN L++ +IS WCK  GI
Sbjct  71    MKDPVVLASGETYDRPFIQKWLKDGNLICPKSKEIISQSVLIPNLLVQDIISEWCKNQGI  130

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
               P+P  Q  +E+G+   A +H   +L   +S++   Q+ AA+E R LTKR  SFR LFG
Sbjct  131   KLPBP-AQDSDEEGITQVAIQHFESLLDAILSNNLSGQKRAAKEFRRLTKRETSFRILFG  189

Query  524   ESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSL  697
               +  A+ +LL P +  R    PDLQED+ITT+LNLSIHDSNKKLVAETP+ I +L++SL
Sbjct  190   R-IPHAIDQLLMPITSGRASFVPDLQEDVITTVLNLSIHDSNKKLVAETPKAIPLLVESL  248

Query  698   RSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLC  877
              SG I+TR NAAAA+FTLSALDSNK LIGKSGALKPLI L++EGH LAMKD ASAIF LC
Sbjct  249   MSGTIDTRRNAAAALFTLSALDSNKVLIGKSGALKPLIKLVDEGHPLAMKDAASAIFTLC  308

Query  878   VLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSL  1057
                EN+AR + DGAV V+++KIM R+ VDELLAILAMLSSN +A++EM + GAVP LLS+
Sbjct  309   FTFENRARTVDDGAVEVILKKIMERILVDELLAILAMLSSNQKAVKEMADHGAVPCLLSI  368

Query  1058  IRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVL  1237
             I++TS   NKENC+VILY+IC +DRTK KEI+ +E++HGT+SQ+AQNGT RAKRKA+G+L
Sbjct  369   IKETSSGHNKENCVVILYSICFSDRTKCKEIRADENAHGTMSQIAQNGTPRAKRKANGIL  428

Query  1238  DRLNRGVGFIHTA  1276
             +RLNR     HTA
Sbjct  429   ERLNRVAINTHTA  441



>emb|CDX74050.1| BnaA03g29970D [Brassica napus]
Length=456

 Score =   488 bits (1255),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 259/444 (58%), Positives = 325/444 (73%), Gaps = 25/444 (6%)
 Frame = +2

Query  2     ELQRAVKAVVS----EDGVNAEAIDRAQQALCALR------------GLHPEQNNNSFPA  133
             EL+R +K ++S    EDG++ + ID+ Q+AL A R             L   +   S P 
Sbjct  19    ELKREMKKLLSNIEEEDGLSVQTIDQLQEALSAFRQATTMRKMAKSSSLEMLETAVSCPD  78

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EFRCPLS ELM+DPVV++SGQTYD+ FIQ+WL+SGNR CP+T+QVL HT LTPN LIR M
Sbjct  79    EFRCPLSNELMRDPVVLASGQTYDKLFIQRWLSSGNRTCPKTEQVLPHTALTPNVLIRDM  138

Query  314   ISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQ--RSAARELRLL  487
             IS WCK  G+               VT +DR  F  LL K+SSSS VQ  RSAA+ELRLL
Sbjct  139   ISKWCKTVGL----ETNNLYESKKAVTRSDREVFNSLLCKVSSSSNVQDQRSAAKELRLL  194

Query  488   TKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHD-SNKKLVAET  664
             TK+   FRALFGES    + +L+SP   V+    LQED++TT+LN+SIHD SNKKLV E 
Sbjct  195   TKKGTEFRALFGES-SEGITRLVSPL-LVNQDEQLQEDVVTTLLNISIHDDSNKKLVCEN  252

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
             P VI +LID+L  G + TRSNAAAAIFTLSALDSNKALIGKSG LKPLIDLLEEG+ LA+
Sbjct  253   PNVIPLLIDALTRGTVATRSNAAAAIFTLSALDSNKALIGKSGILKPLIDLLEEGNPLAI  312

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KD A+AIF LC+ HEN++RA++DGAVRVL +KI   ++VDELLA+LAML ++ +A+EE+G
Sbjct  313   KDAAAAIFTLCIAHENRSRAVKDGAVRVLGKKISEGLYVDELLALLAMLVTHWKAVEELG  372

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             ELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEI++EES HGTI++LA+ GT
Sbjct  373   ELGGVSWLLEITRESECKRNKENAIVILHTICFSDRTKWKEIREEESGHGTITRLAREGT  432

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRA+RKA+G+LDRL + +   HTA
Sbjct  433   SRAQRKANGILDRLRKAMNLTHTA  456



>ref|XP_002319132.2| hypothetical protein POPTR_0013s04930g [Populus trichocarpa]
 gb|EEE95055.2| hypothetical protein POPTR_0013s04930g [Populus trichocarpa]
Length=526

 Score =   489 bits (1260),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 319/431 (74%), Gaps = 12/431 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-----NNNSFPAEFRCPLSGELM  166
             EL++ VK ++ E+    E  D A + L  L+ L  ++     +N   P EF CP+S ++M
Sbjct  100   ELEKLVKTILVEEDYRVEVTDEAMRILSVLKELKFKKSSKVVDNTVIPEEFICPISKKIM  159

Query  167   KDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIW  346
              DPVV+++GQTYDRPFIQ+ LN G+R CPQTQQV+SHT LTPNHL++ MIS W K  GI 
Sbjct  160   NDPVVLATGQTYDRPFIQRLLNEGHRTCPQTQQVISHTFLTPNHLVQEMISKWRKERGIE  219

Query  347   FPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGE  526
              P P V    +D V TDADR     LLEKMSSS   Q+ AA+ELRL+TK+ PSFRALF +
Sbjct  220   LPKPLV----DDDVHTDADRVYLKSLLEKMSSSLSDQKEAAKELRLITKKKPSFRALFSD  275

Query  527   SMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             S  A +P+LL+P S  R + HPDLQED+ITTI NLSIH++NK+L AE P VI +L++S+R
Sbjct  276   STDA-IPQLLNPLSPGRANTHPDLQEDLITTIFNLSIHENNKQLFAENPHVIPLLVESVR  334

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
             SG IETRSNAAAA+F+LS+LDSNK +IGK+GAL PLI LLEEGH  AMKD A AIF LC+
Sbjct  335   SGTIETRSNAAAALFSLSSLDSNKLIIGKAGALNPLIGLLEEGHPPAMKDAALAIFNLCL  394

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             + ENK RA+++GAVRV+++KIM+ + VDELLA LA+L+S   A++EMG LGAVP L+ +I
Sbjct  395   VLENKVRAVQEGAVRVILKKIMDCILVDELLATLAILTSQQEAVQEMGLLGAVPCLIDII  454

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             R++S  RNKENC  IL+ IC  DRTK + + +EE ++ T+S LA++GTSRAKRKA+G+L 
Sbjct  455   RESSSERNKENCAAILHTICLNDRTKWRAVMEEEKANATLSILAEHGTSRAKRKANGILK  514

Query  1241  RLNRGVGFIHT  1273
              LNR     HT
Sbjct  515   ILNRAASITHT  525



>ref|XP_003554736.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max]
Length=440

 Score =   485 bits (1249),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 250/426 (59%), Positives = 324/426 (76%), Gaps = 5/426 (1%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLH-PEQNNNSFPAEFRCPLSGELMKDPV  178
             +L+  VK++V  D    EA D A   L +L+ L  P  ++   P +FRCP+S +LM DPV
Sbjct  19    KLRELVKSIVDSDDYTLEAADEAIATLSSLKHLKSPIPDDFPLPPQFRCPISTQLMSDPV  78

Query  179   VVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDP  358
             ++S+GQTYDRPFIQ+WLN G+R CPQTQQVLSHTILTPN+L+R MI  WC+  GI  P+P
Sbjct  79    ILSTGQTYDRPFIQRWLNEGHRTCPQTQQVLSHTILTPNYLVRDMILLWCRDRGIDLPNP  138

Query  359   PVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGA  538
                  + D VVT+ADR++   LL K+  S   Q+ AA+ELRLLTKRMPS R L GES   
Sbjct  139   ---AKDLDEVVTNADRNHLNSLLRKLQLSVPDQKEAAKELRLLTKRMPSIRTLVGES-SD  194

Query  539   AMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIET  718
              +P LLSP +     PDL ED+ITT+LNLSIHD NKK  AE P +IS+LID+L+ G I+T
Sbjct  195   TIPLLLSPLAAASTDPDLHEDLITTVLNLSIHDDNKKSFAEDPALISLLIDALKCGTIQT  254

Query  719   RSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKA  898
             RSNAAAAIFTLSA+DSNK +IG+SGA+K L++LL+EG  LAMKD ASAIF LC++HENK 
Sbjct  255   RSNAAAAIFTLSAIDSNKHIIGESGAIKHLLELLDEGQPLAMKDAASAIFNLCLVHENKG  314

Query  899   RAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCA  1078
             R +RDGAVRV++ K+M+ + VDELLAILA+LSS+ +A+EEMG+  AVP LL +IR+++  
Sbjct  315   RTVRDGAVRVILNKMMDHILVDELLAILALLSSHPKAVEEMGDFDAVPLLLGVIRESTSE  374

Query  1079  RNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGV  1258
             R+KENC+ ILY IC +DRTKLKEI++EE ++GT+++L + GTSRAKRKA+G+L+RLNR  
Sbjct  375   RSKENCVAILYTICFSDRTKLKEIREEEKANGTLTKLGKCGTSRAKRKANGILERLNRSP  434

Query  1259  GFIHTA  1276
                HTA
Sbjct  435   SLTHTA  440



>emb|CDY08002.1| BnaC03g35210D [Brassica napus]
Length=455

 Score =   486 bits (1250),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 322/439 (73%), Gaps = 20/439 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR------------GLHPEQNNNSFPAEFRC  145
             E+++ +  +  EDG++ + ID+ Q+ L A R             L   +   SFP EFRC
Sbjct  23    EMKKLLSNIEEEDGLSVQRIDQLQETLSAFRQATAMRKMEKSSSLEMLETAVSFPDEFRC  82

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             PLS ELM+DPVV++SGQTYD+ FIQ+WL+SGNR CP+T+QVL HT LTPN LIR MIS W
Sbjct  83    PLSNELMRDPVVLASGQTYDKLFIQRWLSSGNRTCPKTEQVLPHTALTPNVLIRDMISKW  142

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMP  502
             CK  G+               VT +DR  F  LL K+SSS+   QRSAA+ELRLLTK+  
Sbjct  143   CKTVGL----ETTNLYESKKAVTRSDREVFNSLLCKVSSSNIQDQRSAAKELRLLTKKGT  198

Query  503   SFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHD-SNKKLVAETPRVIS  679
              FRALFGES    + +L+SP   ++   DL+ED+ITT+LN+SIHD SNKKLV E P VI 
Sbjct  199   EFRALFGES-SEGITRLVSPL-LLNRDEDLEEDVITTLLNISIHDDSNKKLVCENPNVIP  256

Query  680   VLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVAS  859
             +LID+L  G + TRSNAAAAIFTLSALDSNKALIGKSG LKPLIDLLEEG+ LA+KD A+
Sbjct  257   LLIDALTRGTVATRSNAAAAIFTLSALDSNKALIGKSGILKPLIDLLEEGNPLAIKDAAA  316

Query  860   AIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAV  1039
             AIF LC+ HEN++RA++DGAVRVL +KI   ++VDELLA+LAML ++ +A+EE+GELG V
Sbjct  317   AIFTLCIAHENRSRAVKDGAVRVLGKKISEGLYVDELLALLAMLVTHWKAVEELGELGGV  376

Query  1040  PSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKR  1219
               LL + R++ C RNKEN IVIL+ IC +DRT  KEI++EESSHGTI++LA+ GTSRA+R
Sbjct  377   SWLLEITRESECKRNKENAIVILHTICFSDRTMWKEIREEESSHGTITRLAREGTSRAQR  436

Query  1220  KASGVLDRLNRGVGFIHTA  1276
             KA+G+LDRL + +   HTA
Sbjct  437   KANGILDRLRKAMNLTHTA  455



>ref|XP_006375873.1| hypothetical protein POPTR_0013s04900g [Populus trichocarpa]
 gb|ERP53670.1| hypothetical protein POPTR_0013s04900g [Populus trichocarpa]
Length=449

 Score =   484 bits (1245),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 245/431 (57%), Positives = 319/431 (74%), Gaps = 12/431 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-----NNNSFPAEFRCPLSGELM  166
             EL++ V+ ++ E+    E  D A + L  L+ L  ++     +N   P EF CP+S ++M
Sbjct  23    ELEKLVQTILVEEDYRVEVTDEAMRILSVLKELKFKKSSKVVDNTVIPEEFICPISKKIM  82

Query  167   KDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIW  346
              DPVV+++GQTYDRPFIQ+ LN G+R CPQTQQV+SHT LTPNHL++ MIS W +  GI 
Sbjct  83    NDPVVLATGQTYDRPFIQRLLNEGHRTCPQTQQVISHTFLTPNHLVQEMISKWRRERGIE  142

Query  347   FPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGE  526
              P P    L +D V TDADR     LLEKMSSS   Q+ AA+ELRL+TK+ PSFRALF +
Sbjct  143   LPKP----LVDDDVHTDADRVYLKSLLEKMSSSLSDQKEAAKELRLITKKKPSFRALFSD  198

Query  527   SMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             S  A +P+LL+P S  R + HPDLQED+ITTI NLSIH++NK+L AE P VI +L++S+R
Sbjct  199   STDA-IPQLLNPLSPGRANTHPDLQEDLITTIFNLSIHENNKQLFAENPHVIPLLVESVR  257

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
             SG IETRSNAAAA+F+LS+LDSNK +IGK+GAL PLI LLEEGH  AMKD A AIF LC+
Sbjct  258   SGTIETRSNAAAALFSLSSLDSNKLIIGKAGALNPLIGLLEEGHPPAMKDAALAIFNLCL  317

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             + ENK RA+++GAVRV+++KIM+ + VDELLA LA+L+S   A++EMG LGAVP L+ +I
Sbjct  318   VLENKVRAVQEGAVRVILKKIMDCILVDELLATLAILTSQQEAVQEMGLLGAVPCLIDII  377

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             RD+S  RNKENC  IL+ IC  DRTK + + +EE ++ T+S LA++GTSRAKRKA+G+L 
Sbjct  378   RDSSSERNKENCAAILHTICLNDRTKWRAVMEEEKANATLSILAEHGTSRAKRKANGILK  437

Query  1241  RLNRGVGFIHT  1273
              LN     IHT
Sbjct  438   ILNGAASIIHT  448



>ref|XP_010674205.1| PREDICTED: U-box domain-containing protein 9-like [Beta vulgaris 
subsp. vulgaris]
Length=470

 Score =   484 bits (1247),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/430 (57%), Positives = 321/430 (75%), Gaps = 18/430 (4%)
 Frame = +2

Query  32    SEDGVNAEAIDRAQQALCAL----------RGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             SE+GV    ID A QAL AL          R L    +    P E+RCP+S E+MKDPVV
Sbjct  44    SENGVILGRIDEAIQALTALKELKLNKKNKRSLSSTLDQLHVPDEYRCPISKEIMKDPVV  103

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             +S+GQTYDRPFIQ+WL  GNR+CPQTQQVL+H  LTPNHL+  +I  WCK +G   P PP
Sbjct  104   LSTGQTYDRPFIQRWLKDGNRLCPQTQQVLTHVELTPNHLVLELIKQWCKDHGTELP-PP  162

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAA  541
             +Q ++ DG VTD DR+    LLEKMS +    + AA+E+R LT+RMPSFR+ FGES  A 
Sbjct  163   LQDVH-DGFVTDGDRNQLNTLLEKMSLTLSELKEAAKEIRTLTRRMPSFRSFFGESPNA-  220

Query  542   MPKLLSPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAI  712
             +P+LL+P      ++ HPDL+ED++TTILNLSIHD+NKKL+A+ P VI  L +SL+ G +
Sbjct  221   LPQLLAPLKDSVILEDHPDLREDLVTTILNLSIHDNNKKLIADYPLVIPFLNESLKCGTM  280

Query  713   ETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHEN  892
             ET++NAAAA+FTLSALD NK LIG+SGALK LIDLLE+GH  AMKDVASAIF LC   EN
Sbjct  281   ETKTNAAAALFTLSALDENKLLIGESGALKSLIDLLEQGHQSAMKDVASAIFNLCRKREN  340

Query  893   KARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTS  1072
             +A+AIRDGAV+V+++KI  + HV ELLAILA+LS+NH+AI+E+ +L +   LLS+IR+++
Sbjct  341   RAKAIRDGAVKVILQKIKEKTHVSELLAILALLSTNHKAIDELEDLESAGCLLSIIRESN  400

Query  1073  CARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRL--  1246
             C  ++ENCIVIL+ IC      LK++++EE  HGTIS+LA+NGTSRAKRKA+ +LD+L  
Sbjct  401   CEPDRENCIVILHDICGYSHFTLKDVRNEEKDHGTISKLAENGTSRAKRKANSILDKLKS  460

Query  1247  NRGVGFIHTA  1276
             NR + + HTA
Sbjct  461   NRRMNYTHTA  470



>emb|CDY71737.1| BnaAnng38640D [Brassica napus]
Length=462

 Score =   484 bits (1245),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 255/445 (57%), Positives = 325/445 (73%), Gaps = 21/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVV----SEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEF  139
             EL+R +K ++     EDG++ + ID  Q+AL A +     +             S P EF
Sbjct  19    ELKREMKKLLMNMEEEDGLSVQTIDHLQEALSAFKQATMRKMARSSSLEMLETVSCPEEF  78

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
             RCPLS ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS
Sbjct  79    RCPLSKELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIRDMIS  138

Query  320   NWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKR  496
              WCK  G+         ++E+  VT +DR  F  LL K+SSS+   Q+SAA+ELR LTK+
Sbjct  139   KWCKTVGLETTTYQSSLVDEEKAVTRSDREIFNSLLCKLSSSNLQDQKSAAKELRRLTKK  198

Query  497   MPSFRALFGESMGAAMPKLLSPF----SRVDVHPDLQEDIITTILNLSIHD-SNKKLVAE  661
                FRALFGES    + +L++P     S ++    LQED+ITT+LN+SIHD SNKKLV E
Sbjct  199   GTEFRALFGES-SDNITRLVNPLLLHGSTLNQDEQLQEDVITTLLNVSIHDDSNKKLVCE  257

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
                VI +LID+LR G + TRSNAAA +FTLSALDSNKALIGKSG LKPLIDLLEEG+  A
Sbjct  258   NANVIPLLIDALRRGTVATRSNAAATVFTLSALDSNKALIGKSGILKPLIDLLEEGNPSA  317

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
             +KD A+AIF LC+ HEN++RA++DGAVRVL +KI + ++VDELLAILAML ++ +A+EE+
Sbjct  318   IKDAAAAIFTLCIAHENRSRAVKDGAVRVLGKKISDGLYVDELLAILAMLVTHWKAVEEL  377

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EESSHGTI++LA+ G
Sbjct  378   GELGGVTWLLRITRESECKRNKENAIVILHTICFSDRTKWKEIKEEESSHGTITKLAREG  437

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRA+RKA+G+LDRL + +   HTA
Sbjct  438   TSRAQRKANGILDRLRKAMNLTHTA  462



>ref|XP_002862652.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH38910.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=460

 Score =   483 bits (1243),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 330/448 (74%), Gaps = 29/448 (6%)
 Frame = +2

Query  2     ELQRAVKAVV----SEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEF  139
             EL+R +K ++     ED    + ID+ Q+AL ALR     +             S P EF
Sbjct  19    ELKREMKKLLIKIEDEDDFGVQTIDQLQEALSALREATMRKMAKSSSLEMLETVSCPEEF  78

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
             RCPLS ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS
Sbjct  79    RCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIREMIS  138

Query  320   NWCKVNGI-----WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAARELR  481
              WCK  G+     + P+     +NE+  VT +DR  F  LL K+SSS+   Q SAA+ELR
Sbjct  139   KWCKKIGLETKNQYHPN----LVNEEEAVTRSDREIFNSLLCKVSSSNLHDQNSAAKELR  194

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SNKKL  652
             LLTK+   FRALFGES    + +L++P      +PD  LQED++TT+LN+SIHD SNKKL
Sbjct  195   LLTKKGTEFRALFGESPDE-ITRLVNPLLH-GSNPDEKLQEDVVTTLLNISIHDDSNKKL  252

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             V E P VI +LID+LR G + TRSNAAAAIFTLSALDSNK LIGKSG LKPLIDLLEEG+
Sbjct  253   VCENPCVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLEEGN  312

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
              LA+KDVA+AIF LC+ HEN++RA+RDGAVRVL +KI N ++VDELLAILAML ++ +A+
Sbjct  313   PLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAV  372

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
             EE+GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI++L+
Sbjct  373   EELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLS  432

Query  1193  QNGTSRAKRKASGVLDRLNRGVGFIHTA  1276
             + GTSRA+RKA+G+LDRL + +   HTA
Sbjct  433   REGTSRAQRKANGILDRLRKAMNLTHTA  460



>emb|CDY28059.1| BnaC05g44610D [Brassica napus]
Length=462

 Score =   483 bits (1242),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 254/445 (57%), Positives = 325/445 (73%), Gaps = 21/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVVS----EDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEF  139
             EL+R +K +++    EDG++ + ID+ Q+AL A +     +             S P EF
Sbjct  19    ELKREMKKLLTNIEEEDGLSVQTIDQLQEALSAFKQATMRKMAKSSSLEMLETMSCPEEF  78

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
             RCPLS ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS
Sbjct  79    RCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIRDMIS  138

Query  320   NWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKR  496
              WCK  G+         ++E+  VT +DR  F  LL K+SSS+   Q+SAA+ELR LTK+
Sbjct  139   KWCKTVGLETTTYQSSLVDEEKAVTRSDREIFNSLLCKLSSSNLQDQKSAAKELRRLTKK  198

Query  497   MPSFRALFGESMGAAMPKLLSPF----SRVDVHPDLQEDIITTILNLSIHD-SNKKLVAE  661
                FRALFGES    + +L++P     S ++    LQED+ITT+LN+SIHD  NKKLV E
Sbjct  199   GTEFRALFGES-SDNITRLVNPLLLHGSTLNQDEQLQEDVITTLLNVSIHDDGNKKLVCE  257

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
                VI +LID+LR G + TRSNAAA +FTLSALDSNKALIGKSG LKPLIDLLEEG+  A
Sbjct  258   NANVIPLLIDALRRGTVATRSNAAATVFTLSALDSNKALIGKSGILKPLIDLLEEGNPSA  317

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
             +KD A+AIF LC+ HEN++RA++DGAVRVL +KI   ++VDELLAILAML ++ +A+EE+
Sbjct  318   IKDAAAAIFTLCIAHENRSRAVKDGAVRVLGKKISEGLNVDELLAILAMLVTHWKAVEEL  377

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EESSHGTI++LA+ G
Sbjct  378   GELGGVTWLLRITRESECKRNKENAIVILHTICFSDRTKWKEIKEEESSHGTITKLAREG  437

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRA+RKA+G+LDRL + +   HTA
Sbjct  438   TSRAQRKANGILDRLRKAMNLTHTA  462



>ref|XP_003520854.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max]
Length=430

 Score =   481 bits (1238),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 251/428 (59%), Positives = 325/428 (76%), Gaps = 8/428 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             +L+  VKA+V  D  + +A D A   L +L+ L    ++   P +FRCP+S +LM DPV+
Sbjct  8     KLRELVKAIVDSDDYSLQAADEAIATLSSLKHLK-SPDDFPLPPQFRCPISTQLMSDPVI  66

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             +S+GQTYDRPFIQ+WLN G+R CPQTQQVLSHTILTPN+L+R MI  WC+  GI  P P 
Sbjct  67    LSTGQTYDRPFIQRWLNEGHRTCPQTQQVLSHTILTPNYLVRDMILQWCRDRGIDLPGP-  125

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAA  541
             V+ ++E   VT+ADR++   LL K+  S   Q+ AA+ELRLLTKRMPS R L GES    
Sbjct  126   VKDIDE--AVTNADRNHLNSLLRKLQLSVPDQKEAAKELRLLTKRMPSIRTLVGES-SDV  182

Query  542   MPKLLSPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAI  712
             +P+LLSP S        PDL ED+ITTILNLSIHD NKK+ A  P VIS+LID+L+ G I
Sbjct  183   IPQLLSPLSSPGAASTDPDLHEDLITTILNLSIHDDNKKVFATDPAVISLLIDALKCGTI  242

Query  713   ETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHEN  892
             +TRSNAAA IFTLSA+DSNK +IG+SGA+K L++LL+EG   AMKD ASAIF LC++HEN
Sbjct  243   QTRSNAAATIFTLSAIDSNKHIIGESGAIKHLLELLDEGQPFAMKDAASAIFNLCLVHEN  302

Query  893   KARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTS  1072
             K R +RDGAVRV++ K+M+ + VDELLAILA+LSS+ +A+EEMG+  AVP LL +IR+++
Sbjct  303   KGRTVRDGAVRVILNKMMDHILVDELLAILALLSSHPKAVEEMGDFDAVPLLLGIIREST  362

Query  1073  CARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
               R+KENC+ ILY IC +DRTKLKEI++EE ++GT+S+LA+ GTSRAKRKA+G+L+RLNR
Sbjct  363   SERSKENCVAILYTICFSDRTKLKEIREEEKANGTLSKLAKCGTSRAKRKANGILERLNR  422

Query  1253  GVGFIHTA  1276
                  HTA
Sbjct  423   SPSLTHTA  430



>ref|XP_009147083.1| PREDICTED: U-box domain-containing protein 9 [Brassica rapa]
Length=462

 Score =   480 bits (1236),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 324/445 (73%), Gaps = 21/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVV----SEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEF  139
             EL+R +K ++     EDG++ + ID  Q+AL A +     +             S P EF
Sbjct  19    ELKREMKKLLMNMEEEDGLSVQTIDHLQEALSAFKQATMRKMARSSSLEMLETVSCPEEF  78

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
             RCPLS ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS
Sbjct  79    RCPLSKELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIRDMIS  138

Query  320   NWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKR  496
              WCK  G+         ++E+  VT +DR  F  LL K+SSS+   Q+SAA+ELR LTK+
Sbjct  139   KWCKTVGLETTTYQSSLVDEEKAVTRSDREIFNSLLCKLSSSNLQDQKSAAKELRRLTKK  198

Query  497   MPSFRALFGESMGAAMPKLLSPF----SRVDVHPDLQEDIITTILNLSIHD-SNKKLVAE  661
                FRALFGES    + +L++P     S ++    LQED+ITT+LN+SIHD SNKKLV E
Sbjct  199   GTEFRALFGES-SDNITRLVNPLLLHGSTLNQDEQLQEDVITTLLNVSIHDDSNKKLVCE  257

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
                VI +LID+LR G + TRSNAAA +FT SALDSNKALIGKSG LKPLIDLLEEG+  A
Sbjct  258   NANVIPLLIDALRRGTVATRSNAAATVFTFSALDSNKALIGKSGILKPLIDLLEEGNPSA  317

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
             +KD A+AIF LC+ HEN++RA++DGA++VL +KI + ++VDELLAILAML ++ +A+EE+
Sbjct  318   IKDAAAAIFTLCIAHENRSRAVKDGAIKVLGKKISDGLYVDELLAILAMLVTHWKAVEEL  377

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EESSHGTI++LA+ G
Sbjct  378   GELGGVTWLLRITRESECKRNKENAIVILHTICFSDRTKWKEIKEEESSHGTITKLAREG  437

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRA+RKA+G+LDRL + +   HTA
Sbjct  438   TSRAQRKANGILDRLRKAMNLTHTA  462



>ref|XP_004494763.1| PREDICTED: U-box domain-containing protein 9-like [Cicer arietinum]
Length=456

 Score =   480 bits (1235),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 252/437 (58%), Positives = 321/437 (73%), Gaps = 16/437 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQN----------NNSFPAEFRCPL  151
             +L + VK +V  D    +  D A   L +L+     +N          + + P EFRCP+
Sbjct  24    KLWKLVKTIVDTDDFTLQTADDAIATLSSLKDFKFRRNGPKSFSDKLDDFALPPEFRCPI  83

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             S +LM DPV++S+GQTYDRPFIQ+WLN G+R CPQTQQVLSHTILTPN+L+R MI+ WC+
Sbjct  84    STQLMTDPVILSTGQTYDRPFIQRWLNEGHRTCPQTQQVLSHTILTPNYLVRDMIAQWCR  143

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
                           + D VVTDADR     LL K+S S   Q++AA+ELRLLTKR PSFR
Sbjct  144   XXXX---XXXXXXXDTDEVVTDADRDRLNALLHKLSLSVSDQKAAAKELRLLTKRTPSFR  200

Query  512   ALFGESMGAAMPKLLSPFSRVD--VHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
              LF ES G  + +LLSP S      HPDLQED+ITT+LNLSIHD NKK+ AE P +IS+L
Sbjct  201   TLFRES-GDVITQLLSPLSPDTGCTHPDLQEDLITTVLNLSIHDDNKKVFAEDPALISLL  259

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             ID+L+ G I+TRSNAAAAIFTLSALDSNK +IGKSGA+K L+ LL+EGH  AMKD ASAI
Sbjct  260   IDALKCGTIQTRSNAAAAIFTLSALDSNKLIIGKSGAIKHLLGLLDEGHPFAMKDAASAI  319

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC++HENK R +R+GAV+V++ KIM+ + VDELLAILA+LSS+ +A+EEMG+ GAVP 
Sbjct  320   FNLCLVHENKGRTVREGAVKVILNKIMDHILVDELLAILALLSSHPKAVEEMGDRGAVPF  379

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LLS+IR+++  R+KENC+ ILY IC +DRT  KEIK+EE ++GT+S+LAQ GTSRAKRKA
Sbjct  380   LLSIIRESTSERSKENCVAILYTICYSDRTTWKEIKEEEKANGTLSKLAQCGTSRAKRKA  439

Query  1226  SGVLDRLNRGVGFIHTA  1276
             + +L+R+NR     HTA
Sbjct  440   TSILERVNRSPSLTHTA  456



>ref|XP_010486284.1| PREDICTED: U-box domain-containing protein 9 [Camelina sativa]
Length=465

 Score =   477 bits (1227),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 256/430 (60%), Positives = 321/430 (75%), Gaps = 28/430 (7%)
 Frame = +2

Query  53    EAIDRAQQALCALRGLHP-------------EQNNNSFPAEFRCPLSGELMKDPVVVSSG  193
             +AID+ Q AL ALR                 E   +S P EFRCPLS ELM+DPVV++SG
Sbjct  42    QAIDQLQDALSALREATMRRKMAKSSSLEMLETTVSSCPDEFRCPLSNELMRDPVVLASG  101

Query  194   QTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI-----WFPDP  358
             QTYD+ FIQKWL+SGNR CP+TQQVL +T LTPN LIR MIS WCK  G+     + P+ 
Sbjct  102   QTYDKLFIQKWLSSGNRTCPKTQQVLPNTALTPNLLIRDMISKWCKKIGLDTKNQYHPN-  160

Query  359   PVQCLNEDGVVTDADRHNFLVLLEKMSSS-SCVQRSAARELRLLTKRMPSFRALFGESMG  535
                 +NE+  VT +DR  F  LL K+SSS    Q+SAA+ELRLLT++   FRALFGES  
Sbjct  161   ---LVNEEEAVTRSDREIFNSLLCKVSSSIRQDQKSAAKELRLLTRKGTEFRALFGESPD  217

Query  536   AAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SNKKLVAETPRVISVLIDSLRSG  706
               + +LL+P      +PD  LQED++TT+LN++IHD SNKKLV E P VI +LID+LR G
Sbjct  218   E-ITRLLNPLLH-GSNPDENLQEDVVTTLLNIAIHDDSNKKLVCENPNVIPLLIDALRRG  275

Query  707   AIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLH  886
              + TRSNAAAA+FTLSALDSNK LIGKSG LKPLIDLLEEG+ LA+KDVA+AIF LC+ H
Sbjct  276   TVATRSNAAAAVFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAH  335

Query  887   ENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRD  1066
             EN++RA+RDGAVRVL +KI N +HVDELLAILAML ++ +A+EE+GELG V  LL + R+
Sbjct  336   ENRSRAVRDGAVRVLGKKISNGLHVDELLAILAMLVTHWKAVEELGELGGVSWLLKITRE  395

Query  1067  TSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRL  1246
             + C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI++L++ GTSRA+RKA+G+LDRL
Sbjct  396   SECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGTSRAQRKANGILDRL  455

Query  1247  NRGVGFIHTA  1276
              + +   HTA
Sbjct  456   RKAMNLTHTA  465



>ref|XP_010464356.1| PREDICTED: U-box domain-containing protein 9-like [Camelina sativa]
Length=468

 Score =   476 bits (1226),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 257/431 (60%), Positives = 320/431 (74%), Gaps = 28/431 (6%)
 Frame = +2

Query  53    EAIDRAQQALCALRGLHP--------------EQNNNSFPAEFRCPLSGELMKDPVVVSS  190
             +AID+ Q+AL ALR                  E   +S P EFRCPLS ELM+DPVV++S
Sbjct  43    QAIDQLQEALSALREATMRRKKMAKSSSLDMLETTVSSCPDEFRCPLSNELMRDPVVLAS  102

Query  191   GQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQ-  367
             GQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS WCK  G+   D   Q 
Sbjct  103   GQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIRDMISKWCKKIGL---DNKNQY  159

Query  368   ----CLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRALFGESM  532
                  +NE+  VT +DR  F  LL K+SSS    Q+SAA+ELRLLT++   FRALFGES 
Sbjct  160   HHSNLVNEEEAVTRSDREIFNSLLCKISSSVLQDQKSAAKELRLLTRKGTEFRALFGESP  219

Query  533   GAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SNKKLVAETPRVISVLIDSLRS  703
                + +LLSP      +PD  LQED++TT+LN++IHD SNKKLV E P VI +LID+LR 
Sbjct  220   DE-ITRLLSPLLH-GSNPDENLQEDVVTTLLNIAIHDDSNKKLVCENPNVIPLLIDALRR  277

Query  704   GAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVL  883
             G + TRSNAAAA+FTLSALDSNK LIGKSG LKPLIDLLEEG+ LA+KDVA+AIF LC+ 
Sbjct  278   GTVATRSNAAAAVFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIA  337

Query  884   HENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIR  1063
             HEN++RA+RDGAV VL +KI N ++VDELLAILAML ++ +A+EE+GELG V  LL + R
Sbjct  338   HENRSRAVRDGAVSVLGKKISNGLYVDELLAILAMLVTHWKAVEELGELGGVSWLLKITR  397

Query  1064  DTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDR  1243
             ++ C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI++L++ GTSRA+RKA+G+LDR
Sbjct  398   ESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGTSRAQRKANGILDR  457

Query  1244  LNRGVGFIHTA  1276
             L + +   HTA
Sbjct  458   LRKAMNLTHTA  468



>emb|CDP04252.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   476 bits (1224),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 254/434 (59%), Positives = 325/434 (75%), Gaps = 11/434 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF------PAEFRCPLSGEL  163
             ELQ  V+++V ED    EA DRA QAL  L+ L  + +N         P EFRCPLSG+L
Sbjct  24    ELQILVQSIVEEDDYALEAADRAMQALSCLKELKLKHSNPQSLLLTLPPPEFRCPLSGQL  83

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M DPVV++SGQT+DRPFIQ WLN GNR CPQT+QVLSH IL PN L++ MI  W + +GI
Sbjct  84    MIDPVVIASGQTFDRPFIQNWLNEGNRTCPQTEQVLSHMILVPNVLLKDMICRWSREHGI  143

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRALF  520
               P P VQ ++E+  + +AD+     LLEK+SS +   Q+ AA+E+R LTKR PSFR LF
Sbjct  144   QLPTP-VQDVDEEKAIANADQGRLSSLLEKLSSCAVSDQKIAAKEIRQLTKRSPSFRVLF  202

Query  521   GESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDS  694
             GE +  A+  L+ P +  + D+ PDL+ED+ITTILNLSI D+NKKL AE P VI +LI++
Sbjct  203   GE-ITNAISYLIEPLASGKPDIDPDLEEDLITTILNLSILDTNKKLFAENPAVIPLLIEA  261

Query  695   LRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVL  874
             L+   IETRSNAAAA+FTLSA+DSNK +IG+ GALKPLI+LLEEGH  AMKD ASAIF L
Sbjct  262   LKFERIETRSNAAAALFTLSAIDSNKYMIGELGALKPLIELLEEGHPPAMKDAASAIFSL  321

Query  875   CVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLS  1054
             CV+ ENK+RA+ DGAV V+++KI++ + +DELLAILAML+S+ +AIEEM ELGA+  LL+
Sbjct  322   CVVLENKSRAVSDGAVGVIMKKIVDHLLMDELLAILAMLASHQKAIEEMAELGALSFLLN  381

Query  1055  LIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGV  1234
             +IR+ +  RNKENCI ILY +C  DR KL+EI+ EE ++GTISQLA NGTSRAKRKA G+
Sbjct  382   VIREKTSERNKENCIAILYTMCFNDRAKLREIRKEEDANGTISQLALNGTSRAKRKALGL  441

Query  1235  LDRLNRGVGFIHTA  1276
             L+R+NR     +TA
Sbjct  442   LERINRYAAISNTA  455



>ref|XP_010552019.1| PREDICTED: U-box domain-containing protein 9 [Tarenaya hassleriana]
Length=464

 Score =   475 bits (1223),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 325/445 (73%), Gaps = 23/445 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDG---VNAEAIDRAQQALCALRGLHPEQNNN-----------SFPAEF  139
             E+Q+ V+ ++ ++G   +  + ID+ Q AL  L+ +   +              SFP EF
Sbjct  23    EMQKLVRIILEDEGDDDLGVQTIDQLQVALSDLKEMTVRKKMGKSSSLDMLETVSFPEEF  82

Query  140   RCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMIS  319
              CPLS ELM+DPVV+ SGQT+DRPFIQKWL+SGNR CP+TQQVLSHT LTPN LI  MIS
Sbjct  83    LCPLSSELMRDPVVLVSGQTFDRPFIQKWLSSGNRTCPKTQQVLSHTGLTPNVLIGEMIS  142

Query  320   NWCKVNGIWFPD---PPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLL  487
              WC+  GI   +   P    +N++  VT +DR  F  LL K+SS     ++SAA+ELRLL
Sbjct  143   KWCQNVGIDSSNLIHP--HLVNQEEAVTRSDRQIFQSLLAKISSPDLSDKKSAAKELRLL  200

Query  488   TKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHDSNKKLVAE  661
             TKR P FRALFG+S    + +LLSP    + +PD  LQED+ITT+LN+SIHD+NK LV E
Sbjct  201   TKRGPEFRALFGDS-PVEITRLLSPLKGPNPNPDEQLQEDVITTLLNISIHDNNKILVCE  259

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
              P  I +L+DSLR G I TRSNAAAAIFTLSALDSNK +IGKSGALKPL++LLEEGH +A
Sbjct  260   NPNAIPLLMDSLRRGTIATRSNAAAAIFTLSALDSNKIVIGKSGALKPLVNLLEEGHPMA  319

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
              KDVA+AIF LC+ HEN+ARA+R+GAVRV+  KI + ++VDELLAILAML S+ +A+EE+
Sbjct  320   TKDVAAAIFNLCIAHENRARAVREGAVRVIGRKISDGLYVDELLAILAMLVSHWKAVEEL  379

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
              EL AV  LL +IR++ C RNKEN + IL++IC +DRTK KEI++EE  HGT+++LA+ G
Sbjct  380   SELEAVSWLLKIIRESKCERNKENAVAILHSICFSDRTKWKEIREEEKDHGTMTKLAREG  439

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRA+RKA+G+L R+ R V   HTA
Sbjct  440   TSRAQRKANGILGRVRRAVNLTHTA  464



>ref|XP_006297377.1| hypothetical protein CARUB_v10013402mg [Capsella rubella]
 gb|EOA30275.1| hypothetical protein CARUB_v10013402mg [Capsella rubella]
Length=543

 Score =   477 bits (1228),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 255/444 (57%), Positives = 326/444 (73%), Gaps = 24/444 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR-----------GLHPEQNNNSFPAEFRCP  148
             E+++ +  +  +D +  + ID+ Q AL A R            L   +     P +FRCP
Sbjct  105   EMRKFLIKIEDDDDLGVQTIDQLQDALSAFREATMRKIAKSSSLEMLETTLPCPQDFRCP  164

Query  149   LSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWC  328
             LS ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS WC
Sbjct  165   LSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIRDMISKWC  224

Query  329   KVNGIWFPDPPVQ----CLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTK  493
             K  G+   D   Q     +NE+  VT +DR  F  LL K+SSS    Q+SAA+ELRLLT+
Sbjct  225   KKIGL---DTKNQFNSNLVNEEEAVTRSDREIFNSLLCKVSSSILQDQKSAAKELRLLTR  281

Query  494   RMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SNKKLVAET  664
             +   FRALFGES    + +LL+P      +PD  LQED++TT+LN+SIHD +NKKLV E 
Sbjct  282   KGTEFRALFGESPDE-ITRLLNPLLH-GSNPDENLQEDVVTTLLNISIHDDNNKKLVCEN  339

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
             P VI +LID+LR G + TRSNAAAA+FTLSALDSNK LIGKSG LKPLIDLLEEG+ LA+
Sbjct  340   PNVIPLLIDALRRGTVATRSNAAAAVFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAI  399

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KDVA+AIF LC+ HEN++RA+RDGAVRVL +KI N ++VDELLAILAML ++ +A+EE+G
Sbjct  400   KDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAVEELG  459

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             ELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI++L++ GT
Sbjct  460   ELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGT  519

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRA+RKA+G+LDRL + +   HTA
Sbjct  520   SRAQRKANGILDRLRKAMNLTHTA  543



>ref|XP_009124360.1| PREDICTED: U-box domain-containing protein 9-like [Brassica rapa]
Length=451

 Score =   473 bits (1217),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 244/437 (56%), Positives = 324/437 (74%), Gaps = 20/437 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEFRCPL  151
             E+++ ++ +  +D ++ + I++ Q+ L   +    ++             S P EFRCPL
Sbjct  23    EIKKLLRTIEEDDDLSVQTINQLQETLSDFKRATIKKMAKSSSLEMLETVSCPEEFRCPL  82

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             S ELM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVLSHT LTPN LI  MIS WCK
Sbjct  83    SNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLSHTGLTPNLLISDMISKWCK  142

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSF  508
               G       V+ +N+    T ++R     LL K+SSS+   Q+SAA+ELRLLT++   F
Sbjct  143   KVG-------VETMNQYQSNTISNREVLNSLLCKVSSSNLQDQKSAAKELRLLTRKGTVF  195

Query  509   RALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHD-SNKKLVAETPRVISVL  685
             RA FGES    + +L++P   ++    LQED+ITT+LN+SIHD +NKKLV E P VI +L
Sbjct  196   RAFFGES-SDQITRLVNPLLSLNQDEHLQEDVITTLLNISIHDDNNKKLVCENPNVIPLL  254

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             ID+L+ G + TRSNAAAAIFTLSALDSNK+LIGKSG LKPLIDLLEEG+ LA+KDVA+AI
Sbjct  255   IDALKRGTVATRSNAAAAIFTLSALDSNKSLIGKSGVLKPLIDLLEEGNPLAIKDVAAAI  314

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC+ HEN++RA++DGAVRVL EKI + ++VDELLAILAML ++ +A+EE+G+LG V  
Sbjct  315   FTLCIAHENRSRAVKDGAVRVLGEKISDGLYVDELLAILAMLVTHWKAVEELGDLGGVSW  374

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LL + R++ C RNKEN IVIL+ +C +DRTK KEIKDEESS+GTI++LA+ GTSRA+RKA
Sbjct  375   LLKITRESECKRNKENAIVILHTVCFSDRTKWKEIKDEESSYGTITKLAREGTSRAQRKA  434

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G+LDRL + +   HTA
Sbjct  435   NGILDRLRKAMNLTHTA  451



>ref|XP_009134963.1| PREDICTED: U-box domain-containing protein 9-like [Brassica rapa]
Length=456

 Score =   472 bits (1214),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 258/445 (58%), Positives = 328/445 (74%), Gaps = 27/445 (6%)
 Frame = +2

Query  2     ELQRAVKAVVS----EDGVNAEAIDRAQQALCALR------------GLHPEQNNNSFPA  133
             EL+R +K ++S    EDG++ + ID+ Q+ L A R             L   +   S P 
Sbjct  19    ELKREMKKLLSNIEEEDGLSVQTIDQLQETLSAFRQATTMRKMAKSSSLEMLETAVSCPD  78

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EFRCPLS ELM+DPVV++SGQTYD+ FIQ+WL+SGNR CP+T+QVL HT LTPN LIR M
Sbjct  79    EFRCPLSNELMRDPVVLASGQTYDKLFIQRWLSSGNRTCPKTEQVLPHTALTPNVLIRDM  138

Query  314   ISNWCKVNGIWFPDPPVQCLNEDG-VVTDADRHNFLVLLEKMSSSSCVQ--RSAARELRL  484
             IS WCK  G+       + L+E    VT +DR  F  LL K+SSSS +Q  RSAA+ELRL
Sbjct  139   ISKWCKTVGL-----ETKNLHESKKAVTRSDREIFNSLLCKLSSSSNIQDQRSAAKELRL  193

Query  485   LTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHD-SNKKLVAE  661
             LTK+   FRALFGES    + +L+SP   ++    LQED+ITT+LN+SIHD SNKKLV E
Sbjct  194   LTKKGTEFRALFGES-SEGITRLVSPL-LLNRDEQLQEDVITTLLNISIHDDSNKKLVCE  251

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
              P VI +LID+L  G + TRSNAAAAIFTLSALDSNKALIGKSG LKPLIDLLEEG+ LA
Sbjct  252   NPNVIPLLIDALTRGTVATRSNAAAAIFTLSALDSNKALIGKSGVLKPLIDLLEEGNPLA  311

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEM  1021
             +KD A+AIF LC+ HEN++RA+++GAVRVL +KI   ++VDELLA+LAML ++ +A+EE+
Sbjct  312   IKDAAAAIFTLCIAHENRSRAVKEGAVRVLGKKISEGLYVDELLALLAMLVTHWKAVEEL  371

Query  1022  GELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNG  1201
             GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEI++EES HGTI++LA+ G
Sbjct  372   GELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIREEESGHGTITRLAREG  431

Query  1202  TSRAKRKASGVLDRLNRGVGFIHTA  1276
             TSRA+RKA+G+LDRL + +   HTA
Sbjct  432   TSRAQRKANGILDRLRKAMNLTHTA  456



>gb|AES82721.2| plant U-box protein [Medicago truncatula]
Length=460

 Score =   469 bits (1207),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 254/447 (57%), Positives = 321/447 (72%), Gaps = 26/447 (6%)
 Frame = +2

Query  5     LQRAVKAVV-SEDGVNAEAIDRAQQALCALRGLH-PEQNNNSF-----------------  127
             L + VK +V S+D  + +  D A   L +L+      +N NS                  
Sbjct  17    LWKLVKTIVDSDDDYSLQTTDDAISTLSSLKDFKIKNKNKNSLSSKNGTTKSFSHKFDHF  76

Query  128   --PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
               P+ F CP+S +LM DPV++S+GQTYDRPFIQ+WLN G R CPQTQQVLSHTILTPN+L
Sbjct  77    APPSHFLCPISSQLMIDPVILSTGQTYDRPFIQRWLNEGKRTCPQTQQVLSHTILTPNYL  136

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELR  481
             +R MI+ WCK  G+  P P  +  + D VVT+ADR    VLL K+S S   Q++AA+ELR
Sbjct  137   VRDMIAQWCKERGLELPQPSAR--DTDEVVTNADRDRLNVLLHKLSCSVSDQKAAAKELR  194

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDV--HPDLQEDIITTILNLSIHDSNKKLV  655
             LLTKR PSFR LF ES G  + +LL P S      HPDLQED+ITTILNLSI D NKK+ 
Sbjct  195   LLTKRTPSFRTLFKES-GDVITQLLHPLSPGSACPHPDLQEDLITTILNLSILDDNKKVF  253

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
             AE P +I++LID+++ G I T+SNAAAAIFTLSA+DSNK +IGKSGA+K L+ LL+EG +
Sbjct  254   AEDPTLINLLIDAMKWGTIPTKSNAAAAIFTLSAIDSNKLIIGKSGAIKHLVGLLDEGDT  313

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
             LAMKD ASAIF LC++HENK R +R+GAVRV++ KIMN + VDELLAILA+LSS+  A+E
Sbjct  314   LAMKDAASAIFNLCLVHENKGRTVREGAVRVILNKIMNSILVDELLAILALLSSHPTAVE  373

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
             EM + GAVP LL +IR+++  R KENCI ILY IC  DRT  +EIK+EE ++GT+S+LAQ
Sbjct  374   EMRDCGAVPFLLKIIRESTSERCKENCIAILYTICYNDRTMWREIKEEEKTNGTLSKLAQ  433

Query  1196  NGTSRAKRKASGVLDRLNRGVGFIHTA  1276
              GTSRAKRKASG+L+R+NR     HTA
Sbjct  434   CGTSRAKRKASGILERVNRSPSLTHTA  460



>ref|XP_011034441.1| PREDICTED: U-box domain-containing protein 9-like [Populus euphratica]
Length=449

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 319/431 (74%), Gaps = 12/431 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-----NNNSFPAEFRCPLSGELM  166
             EL++ VK ++ E+    E  D A + L  L+ L  ++     +N   P EF CP+S E+M
Sbjct  23    ELEKLVKTILVEEDYRLEVTDEATRILSVLKELKFKKPSKVVDNIVIPEEFICPISKEIM  82

Query  167   KDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIW  346
              DPVV+++GQTYDRPFIQ+ LN G+R CPQTQQV+S T LTPNHL++ MIS W K  GI 
Sbjct  83    NDPVVLATGQTYDRPFIQRLLNEGHRTCPQTQQVISRTFLTPNHLVQEMISKWRKERGIE  142

Query  347   FPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGE  526
              P P    L +DGV TDADR     LLEKMSSS   ++ AA+ELRLLTKR PSFRALF +
Sbjct  143   QPKP----LVDDGVHTDADRVCLKSLLEKMSSSLSDKKEAAKELRLLTKRKPSFRALFSD  198

Query  527   SMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             S  A +P+LL+P S  R + HPDLQED+ITTI NLSIH++NK+L AE P VI +L++S+R
Sbjct  199   STDA-IPQLLNPLSPGRANTHPDLQEDLITTIFNLSIHENNKRLFAENPHVIPLLVESVR  257

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
             SG  ETRSNAAAA+F+LSALDSNK +IGKSGALKPLIDLLEEGH  AM+D A AIF LC+
Sbjct  258   SGTTETRSNAAAALFSLSALDSNKLIIGKSGALKPLIDLLEEGHPPAMRDAALAIFNLCL  317

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             + ENK RA+++GAVRV+++KIM+ + VDELLA LA+L+S   A+EEMG LGAVP L+ ++
Sbjct  318   VLENKVRAVQEGAVRVILKKIMDCILVDELLATLAVLTSQQEAVEEMGLLGAVPCLIDIM  377

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             R++S  RNKENC  IL+ IC  DRTK   + +EE ++ T+S LA++GTSRAKRKA+G+L 
Sbjct  378   RESSSERNKENCAAILHTICLNDRTKWPAVMEEEKANATLSILAEHGTSRAKRKANGILK  437

Query  1241  RLNRGVGFIHT  1273
              LNR     HT
Sbjct  438   ILNRAASITHT  448



>gb|KFK38195.1| hypothetical protein AALP_AA3G081600 [Arabis alpina]
Length=467

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 251/452 (56%), Positives = 325/452 (72%), Gaps = 30/452 (7%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVN--AEAIDRAQQALCALRG------------------LHPEQNNN  121
             EL+R +K ++ ED  +   + ID+ Q+AL AL+                   L     ++
Sbjct  19    ELKREMKKILEEDDGDLCVQTIDQLQEALSALKQATMMRKKKISSKSGSLDMLEKTTVSS  78

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             S P EFRCP+S ELM+DPVV++SGQTYD+ FIQKWL+S NR CP+T+QVLSHT+LTPN L
Sbjct  79    SCPDEFRCPISNELMRDPVVLASGQTYDKLFIQKWLSSDNRTCPKTKQVLSHTVLTPNVL  138

Query  302   IRGMISNWCKVNGIWFPDPP-VQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQ--RSAAR  472
             IR MI  WCK  GI   +      +N+   VT +DR  F  LL K+SSSS  Q  +SAA+
Sbjct  139   IREMIWKWCKKVGIETTNQNHSSFVNDAEAVTRSDREIFNSLLCKVSSSSNFQEQKSAAK  198

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPF---SRVDVHPDLQEDIITTILNLSIHD-S  640
             ELRL TK+   FRALFGES    + +LL+P    S  D H  +QED+ITT+LN+SIHD S
Sbjct  199   ELRLRTKKGTEFRALFGES-SDGITRLLNPLLHGSNPDEH--IQEDVITTLLNISIHDDS  255

Query  641   NKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLL  820
             NKKLV E P VI +L+D+LR G + TRSNAAA IFTLSALDSNK LIGKSG LKPLIDLL
Sbjct  256   NKKLVCENPNVIPLLMDALRRGTVATRSNAAATIFTLSALDSNKVLIGKSGILKPLIDLL  315

Query  821   EEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSN  1000
             +EG+ LA+KD A+AIF LC+ HEN++R+++DGAVRVL +KI N ++VDELLAILAML ++
Sbjct  316   DEGNPLAIKDAAAAIFSLCIAHENRSRSVKDGAVRVLGKKISNGLYVDELLAILAMLVTH  375

Query  1001  HRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTI  1180
              +A+EE+ +LG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EE+ HGTI
Sbjct  376   WKAVEELSDLGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENVHGTI  435

Query  1181  SQLAQNGTSRAKRKASGVLDRLNRGVGFIHTA  1276
             ++LA+ GT RA+RKA+G+L+RL + +   HTA
Sbjct  436   TKLAREGTPRAQRKANGILERLRKAMNLTHTA  467



>ref|XP_003626503.1| U-box domain-containing protein [Medicago truncatula]
Length=552

 Score =   466 bits (1200),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 253/446 (57%), Positives = 320/446 (72%), Gaps = 26/446 (6%)
 Frame = +2

Query  5     LQRAVKAVV-SEDGVNAEAIDRAQQALCALRGLH-PEQNNNSF-----------------  127
             L + VK +V S+D  + +  D A   L +L+      +N NS                  
Sbjct  17    LWKLVKTIVDSDDDYSLQTTDDAISTLSSLKDFKIKNKNKNSLSSKNGTTKSFSHKFDHF  76

Query  128   --PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
               P+ F CP+S +LM DPV++S+GQTYDRPFIQ+WLN G R CPQTQQVLSHTILTPN+L
Sbjct  77    APPSHFLCPISSQLMIDPVILSTGQTYDRPFIQRWLNEGKRTCPQTQQVLSHTILTPNYL  136

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELR  481
             +R MI+ WCK  G+  P P  +  + D VVT+ADR    VLL K+S S   Q++AA+ELR
Sbjct  137   VRDMIAQWCKERGLELPQPSAR--DTDEVVTNADRDRLNVLLHKLSCSVSDQKAAAKELR  194

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDV--HPDLQEDIITTILNLSIHDSNKKLV  655
             LLTKR PSFR LF ES G  + +LL P S      HPDLQED+ITTILNLSI D NKK+ 
Sbjct  195   LLTKRTPSFRTLFKES-GDVITQLLHPLSPGSACPHPDLQEDLITTILNLSILDDNKKVF  253

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
             AE P +I++LID+++ G I T+SNAAAAIFTLSA+DSNK +IGKSGA+K L+ LL+EG +
Sbjct  254   AEDPTLINLLIDAMKWGTIPTKSNAAAAIFTLSAIDSNKLIIGKSGAIKHLVGLLDEGDT  313

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
             LAMKD ASAIF LC++HENK R +R+GAVRV++ KIMN + VDELLAILA+LSS+  A+E
Sbjct  314   LAMKDAASAIFNLCLVHENKGRTVREGAVRVILNKIMNSILVDELLAILALLSSHPTAVE  373

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
             EM + GAVP LL +IR+++  R KENCI ILY IC  DRT  +EIK+EE ++GT+S+LAQ
Sbjct  374   EMRDCGAVPFLLKIIRESTSERCKENCIAILYTICYNDRTMWREIKEEEKTNGTLSKLAQ  433

Query  1196  NGTSRAKRKASGVLDRLNRGVGFIHT  1273
              GTSRAKRKASG+L+R+NR     HT
Sbjct  434   CGTSRAKRKASGILERVNRSPSLTHT  459



>ref|XP_006443314.1| hypothetical protein CICLE_v10024335mg [Citrus clementina]
 gb|ESR56554.1| hypothetical protein CICLE_v10024335mg [Citrus clementina]
Length=433

 Score =   456 bits (1173),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 252/438 (58%), Positives = 315/438 (72%), Gaps = 39/438 (9%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNA-EAIDRAQQALCALRGLHPEQNNN------------SFPAEFR  142
             ELQR VKA++ ED     +  + A + L  L+ L  +++++              P EFR
Sbjct  22    ELQRLVKAILDEDDYGGLQVTNEALRVLSCLKDLKLKKSHSFKGGAAGDDHLLGLPYEFR  81

Query  143   CPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISN  322
             CP+SGE+M DPVV+++GQT+DRP IQ+WL+ GNR CPQT+QVLSHT+L PNHL+R MIS 
Sbjct  82    CPISGEIMTDPVVLANGQTFDRPCIQRWLDEGNRTCPQTRQVLSHTVLIPNHLVREMISQ  141

Query  323   WCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMP  502
             WCK +GI  P P ++  +ED VVTDA R +   LLEKMSSS   Q+ AA+ELR       
Sbjct  142   WCKEHGIELPKP-IKDTDED-VVTDASRSHLNSLLEKMSSSLSDQKEAAKELR-------  192

Query  503   SFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISV  682
                           P  LSP  R D  P L ED+ITTILNLSIHD NK+LVAE P  I +
Sbjct  193   --------------P--LSP-GRADTDPGLLEDLITTILNLSIHDENKRLVAENPLAIPL  235

Query  683   LIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASA  862
             LIDS+R+G IETR NAAAA+F+LSALDSNK +IGK GA+ PLIDLLEEGH LAMKDVASA
Sbjct  236   LIDSVRTGTIETRRNAAAALFSLSALDSNKLIIGKLGAMTPLIDLLEEGHPLAMKDVASA  295

Query  863   IFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVP  1042
             IF LC+L ENK RA+  GAVRV++ KIM    VDELLAILAMLSS+  AIEE+GELGA+P
Sbjct  296   IFSLCILLENKRRAVHAGAVRVILRKIMENSLVDELLAILAMLSSHQDAIEEIGELGAIP  355

Query  1043  SLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRK  1222
              LL +IR+++C RNKENC  ILY IC  DRT+ +EI +EE+++GT+S+LA+NGTSRAKRK
Sbjct  356   CLLRIIRESTCERNKENCAAILYNICFTDRTRTREIMEEENANGTLSRLAENGTSRAKRK  415

Query  1223  ASGVLDRLNRGVGFIHTA  1276
             A+G+L+RLN+    +HTA
Sbjct  416   ANGILERLNKAALIVHTA  433



>ref|XP_008244691.1| PREDICTED: U-box domain-containing protein 9 isoform X4 [Prunus 
mume]
Length=323

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 276/326 (85%), Gaps = 7/326 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MIS WCK  GI   DP V  +NEDG+ T+++R +FL LL+KMSS    Q+ AA+ELR LT
Sbjct  1     MISQWCKNRGIELSDP-VLLVNEDGI-TESERDHFLSLLQKMSSGLPEQKEAAKELRSLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVA  658
             KRMPSFRALFGES+  A+P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVA
Sbjct  59    KRMPSFRALFGESI-HAIPQLLSPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKLVA  117

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             E+P VI +LI++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH L
Sbjct  118   ESPMVIPLLIEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPL  177

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
             AMKDVASAIF LC+ HENKARA+RDGAVR +++KI NR+HVDELLAILAMLSS+ +A+EE
Sbjct  178   AMKDVASAIFNLCITHENKARAVRDGAVRTILKKIRNRMHVDELLAILAMLSSHPKAVEE  237

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             MGELGAVP LL +IR+T+C RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LAQN
Sbjct  238   MGELGAVPCLLCVIRETNCGRNKENCIAVLHTICLNDRTKWKEIREEENTYGTISELAQN  297

Query  1199  GTSRAKRKASGVLDRLNRGVGFIHTA  1276
             GTSR+KRKASG+LDRLNR V   HTA
Sbjct  298   GTSRSKRKASGILDRLNRTVNLTHTA  323



>ref|XP_004492262.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Cicer arietinum]
Length=377

 Score =   452 bits (1164),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 227/371 (61%), Positives = 290/371 (78%), Gaps = 12/371 (3%)
 Frame = +2

Query  191   GQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQC  370
               TYDR FIQKWLN+GNR CPQT QVLS+T LTPN+LIR MI  W K  GI   +  +  
Sbjct  10    SHTYDRFFIQKWLNAGNRTCPQTHQVLSNTFLTPNNLIREMIEKWSKNQGIELCNV-ISY  68

Query  371   LNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAAMPK  550
             ++++G   ++D+++FL LLEKMSS+   ++SAA+ELRLLTK+ P FR LF +    A+P+
Sbjct  69    ISDEGA-KESDKNHFLCLLEKMSSTLSDKKSAAKELRLLTKKHPCFRVLFCD-FENAIPQ  126

Query  551   LLSPFSRVDVHP---------DLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRS  703
             LL P    +            DLQED+ITT+LN+SIHD+NKK+VAETP VI +L+ +LR 
Sbjct  127   LLKPICEGNSIGNSSSNSINHDLQEDVITTLLNISIHDNNKKIVAETPMVIPLLMKALRC  186

Query  704   GAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVL  883
             G IETR+N+AA +FTLSALDSNK LIGK  ALKPLI LLEEGH L MKDVASAIF LC++
Sbjct  187   GTIETRANSAATLFTLSALDSNKELIGKLNALKPLISLLEEGHPLTMKDVASAIFTLCMM  246

Query  884   HENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIR  1063
             H+NKARA+++GA+RV++ K+ NRVHVDELLAILA+LS++ +A+ EM ELGAVP LLS++R
Sbjct  247   HDNKARAVKEGAIRVIMMKMKNRVHVDELLAILALLSTHQKAVLEMAELGAVPCLLSVMR  306

Query  1064  DTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDR  1243
             ++SC RNKENC+ IL  IC  DR+KLK+IK+EE+S+ TIS+LA+NGTSRAKRKASG+L+R
Sbjct  307   ESSCERNKENCVAILQTICLYDRSKLKDIKEEENSYRTISELAKNGTSRAKRKASGILER  366

Query  1244  LNRGVGFIHTA  1276
             LNR V   HTA
Sbjct  367   LNRVVNITHTA  377



>gb|KHN35338.1| U-box domain-containing protein 9 [Glycine soja]
Length=370

 Score =   447 bits (1150),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 294/374 (79%), Gaps = 7/374 (2%)
 Frame = +2

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M DPV++S+GQTYDRPFIQ+WLN G+R CPQTQQVLSHTILTPN+L+R MI  WC+  GI
Sbjct  1     MSDPVILSTGQTYDRPFIQRWLNEGHRTCPQTQQVLSHTILTPNYLVRDMILQWCRDRGI  60

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
               P P V+ ++E   VT+ADR++   LL K+  S   Q+ AA+ELRLLTKRMPS R L G
Sbjct  61    DLPGP-VKDIDE--AVTNADRNHLNSLLRKLQLSVPDQKEAAKELRLLTKRMPSIRTLVG  117

Query  524   ESMGAAMPKLLSPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDS  694
             ES    +P+LLSP S        PDL ED+ITTILNLSIHD NKK+ A  P VIS+LID+
Sbjct  118   ES-SDVIPQLLSPLSSPGAASTDPDLHEDLITTILNLSIHDDNKKVFATDPAVISLLIDA  176

Query  695   LRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVL  874
             L+ G I+TRSNAAA IFTLSA+DSNK +IG+SGA+K L++LL+EG   AMKD ASAIF L
Sbjct  177   LKCGTIQTRSNAAATIFTLSAIDSNKHIIGESGAIKHLLELLDEGQPFAMKDAASAIFNL  236

Query  875   CVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLS  1054
             C++HENK R +RDGAVRV++ K+M+ + VDELLAILA+LSS+ +A+EEMG+  AVP LL 
Sbjct  237   CLVHENKGRTVRDGAVRVILNKMMDHILVDELLAILALLSSHPKAVEEMGDFDAVPLLLG  296

Query  1055  LIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGV  1234
             +IR+++  R+KENC+ ILY IC +DRTKLKEI++EE ++GT+S+LA+ GTSRAKRKA+G+
Sbjct  297   IIRESTSERSKENCVAILYTICFSDRTKLKEIREEEKANGTLSKLAKCGTSRAKRKANGI  356

Query  1235  LDRLNRGVGFIHTA  1276
             L+RLNR     HTA
Sbjct  357   LERLNRSPSLTHTA  370



>ref|XP_008348974.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Malus domestica]
Length=323

 Score =   443 bits (1140),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 272/326 (83%), Gaps = 7/326 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MIS WCK  GI   DP V  +NEDG+ T++DR +FL LL+KMSS+   Q+ AA+ELR+LT
Sbjct  1     MISQWCKDRGIELSDP-VLLVNEDGI-TESDRDHFLSLLKKMSSTFPEQKEAAKELRMLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVA  658
             KRMPSFRALF ES  A +P+LLSP S       +HP+LQED+ITT+LNLSIHD+NKKLVA
Sbjct  59    KRMPSFRALFSESTHA-IPQLLSPLSEGKFEDGIHPELQEDVITTLLNLSIHDNNKKLVA  117

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ETP VI +L+++LRSG I+TRSNAAAA+FTLSALDSNKALIGKSGAL PLI LL+EGH L
Sbjct  118   ETPMVIPLLMEALRSGTIQTRSNAAAALFTLSALDSNKALIGKSGALXPLIALLDEGHPL  177

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
              MKDVASAIF LC+ HENKARA+R+GAV+ +++KI NRVHVDELLAILAMLSS+ +A+EE
Sbjct  178   VMKDVASAIFNLCITHENKARAVREGAVKTILKKIANRVHVDELLAILAMLSSHPKAVEE  237

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             MGELG V  LL +IR+T+C RNKENCI IL+ IC  DRTK +EI++EE+++GTI++LAQN
Sbjct  238   MGELGGVSCLLRVIRETNCGRNKENCIAILHTICLNDRTKWREIREEENAYGTITELAQN  297

Query  1199  GTSRAKRKASGVLDRLNRGVGFIHTA  1276
             GTSRAKRKASG+LDRLNR V   HTA
Sbjct  298   GTSRAKRKASGILDRLNRAVNLTHTA  323



>gb|KDO60883.1| hypothetical protein CISIN_1g012404mg [Citrus sinensis]
Length=323

 Score =   441 bits (1133),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/326 (68%), Positives = 273/326 (84%), Gaps = 7/326 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MIS WC+  GI  P+  VQ +NE+G+ T+ADR +FL LL+KMS++   Q  AA+ELRLLT
Sbjct  1     MISQWCRSQGIELPNS-VQYINEEGI-TEADRDHFLSLLKKMSATLPDQTEAAKELRLLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVA  658
             KRMPSFRALFGES  A +P+LLSP S       ++P+LQED+ITT+LNLSIHD+NKKLVA
Sbjct  59    KRMPSFRALFGESHDA-IPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVA  117

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ETP VI +L+D+LRSG IETRSNAAAA+FTLSALDSNK +IGKSGALKPLIDLL+EGH  
Sbjct  118   ETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQS  177

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
             AMKDVASAIF LC+ HENKARA+RDG V V+++KIM+ VHVDELLAILAMLS+NHRA+EE
Sbjct  178   AMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEE  237

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             +G+LG V  +L +IR+++C RNKENCI IL+ IC +DRTK K +++EES+HGTIS+LAQ+
Sbjct  238   IGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQD  297

Query  1199  GTSRAKRKASGVLDRLNRGVGFIHTA  1276
             GT+RAKRKA+G+L+RL R V   HTA
Sbjct  298   GTARAKRKATGILERLKRTVNLTHTA  323



>ref|XP_009403611.1| PREDICTED: U-box domain-containing protein 9-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   446 bits (1146),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 313/445 (70%), Gaps = 25/445 (6%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS------------------F  127
             EL+R VKA++  D    E  + A +AL AL+ L    + NS                   
Sbjct  17    ELRRLVKAIIEGDDGRVETYEEAAKALEALKDLRFRGSGNSNGNLANQRKAERRQASVAI  76

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P  F CP+S ELM+DPVV++SGQTYDR FIQ+WL+SGN  CP+TQQVLS T LTPNHL+R
Sbjct  77    PEHFLCPISAELMRDPVVLASGQTYDRRFIQEWLSSGNLTCPRTQQVLSDTTLTPNHLVR  136

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELR  481
              MIS WC  +G+  P  P+    E+G++T  +R+    +L+K+S SS +  ++ A RELR
Sbjct  137   SMISQWCTEHGVTLP--PLDDEQEEGLITRKERNALCRILDKLSLSSSIPDRKQAVRELR  194

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHDSNKKLV  655
             LLTK   SFRAL GE+ G  +P LLS  S   ++ D  +Q DI+TT+LNLSIHDSNKK++
Sbjct  195   LLTKGSRSFRALVGENPGT-IPLLLSALSVPGLYSDTAVQGDIVTTVLNLSIHDSNKKII  253

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              + P+ I  LID L++G +ETRSN+AAA+F+LSALD+NK  IG+ GA+KPL++LLEEG  
Sbjct  254   GDNPQAIPSLIDVLKTGTMETRSNSAAALFSLSALDANKLKIGELGAMKPLVELLEEGSP  313

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
              A KD  SAIF LC++HEN+ARA+R+G V V++  I ++  VDE LAILA+LS +  A+E
Sbjct  314   SAKKDAGSAIFSLCMVHENRARAVREGVVGVVLTAITHQSLVDESLAILALLSGHQEAVE  373

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
             E+ +   VP LL +I+D+SCARNKEN +V+L+A+C  DRTKL+E+ +EE S+G+IS+LAQ
Sbjct  374   EIADTSGVPPLLGIIKDSSCARNKENAVVVLFAVCMHDRTKLREVGEEEKSNGSISRLAQ  433

Query  1196  NGTSRAKRKASGVLDRLNRGVGFIH  1270
             NGTSRA+RKA+G+LD+  R +   H
Sbjct  434   NGTSRARRKATGILDKWKRTLHSTH  458



>ref|XP_010248086.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Nelumbo nucifera]
Length=362

 Score =   439 bits (1130),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/363 (61%), Positives = 281/363 (77%), Gaps = 4/363 (1%)
 Frame = +2

Query  194   QTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCL  373
             QTYDRPFIQKWL  GN ICP++++++S ++L PN L++ +IS WCK  GI  P+P  Q  
Sbjct  2     QTYDRPFIQKWLKDGNLICPKSKEIISQSVLIPNLLVQDIISEWCKNQGIKLPBP-AQDS  60

Query  374   NEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAAMPKL  553
             +E+G+   A +H   +L   +S++   Q+ AA+E R LTKR  SFR LFG  +  A+ +L
Sbjct  61    DEEGITQVAIQHFESLLDAILSNNLSGQKRAAKEFRRLTKRETSFRILFGR-IPHAIDQL  119

Query  554   LSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSN  727
             L P +  R    PDLQED+ITT+LNLSIHDSNKKLVAETP+ I +L++SL SG I+TR N
Sbjct  120   LMPITSGRASFVPDLQEDVITTVLNLSIHDSNKKLVAETPKAIPLLVESLMSGTIDTRRN  179

Query  728   AAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAI  907
             AAAA+FTLSALDSNK LIGKSGALKPLI L++EGH LAMKD ASAIF LC   EN+AR +
Sbjct  180   AAAALFTLSALDSNKVLIGKSGALKPLIKLVDEGHPLAMKDAASAIFTLCFTFENRARTV  239

Query  908   RDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNK  1087
              DGAV V+++KIM R+ VDELLAILAMLSSN +A++EM + GAVP LLS+I++TS   NK
Sbjct  240   DDGAVEVILKKIMERILVDELLAILAMLSSNQKAVKEMADHGAVPCLLSIIKETSSGHNK  299

Query  1088  ENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGVGFI  1267
             ENC+VILY+IC +DRTK KEI+ +E++HGT+SQ+AQNGT RAKRKA+G+L+RLNR     
Sbjct  300   ENCVVILYSICFSDRTKCKEIRADENAHGTMSQIAQNGTPRAKRKANGILERLNRVAINT  359

Query  1268  HTA  1276
             HTA
Sbjct  360   HTA  362



>ref|XP_008346217.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Malus domestica]
Length=323

 Score =   437 bits (1125),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/326 (69%), Positives = 271/326 (83%), Gaps = 7/326 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MIS WCK  GI   DP +  +NEDG+ T++DR +FL LL KMSS+   Q+ AA+ELR+LT
Sbjct  1     MISQWCKNRGIELSDPVLH-VNEDGI-TESDRDHFLSLLRKMSSTFPEQKEAAKELRMLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVA  658
             KRMPSFRALF ES+  A+P+LLSP S       + P+LQEDIITT+LNLSIHD+NKKLVA
Sbjct  59    KRMPSFRALFSESI-HAIPQLLSPLSEGKFEDGIDPELQEDIITTLLNLSIHDNNKKLVA  117

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ET  VI +L+++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LLEEGH L
Sbjct  118   ETLMVIPLLMEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLEEGHPL  177

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
             AMKDVASAIF LC+ HENKARA+RDGAVR +++KI N +HVDELLAILAM+SS+ +A+EE
Sbjct  178   AMKDVASAIFNLCITHENKARAVRDGAVRTILKKIANGMHVDELLAILAMISSHPKAVEE  237

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             MGELG V  LL +IR+T+C+RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LA N
Sbjct  238   MGELGGVSCLLGVIRETNCSRNKENCIAVLHTICLNDRTKWKEIREEENAYGTISELANN  297

Query  1199  GTSRAKRKASGVLDRLNRGVGFIHTA  1276
             GTSRAKRKASG+LDRLNR V   HTA
Sbjct  298   GTSRAKRKASGILDRLNRAVNLTHTA  323



>ref|XP_010109324.1| U-box domain-containing protein 9 [Morus notabilis]
 gb|EXC21756.1| U-box domain-containing protein 9 [Morus notabilis]
Length=455

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 242/437 (55%), Positives = 314/437 (72%), Gaps = 17/437 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ-------NNNS---FPAEFRCPL  151
             ELQR V+A+V +D    E  D A + L +L+ L  ++       +NNS    P EF+CP+
Sbjct  24    ELQRLVRAIVDDDDYAVE--DEAVKVLSSLKELKLKKTQSFKFDDNNSNPEVPEEFKCPI  81

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             S ELMKDPVV+++G TYDRP I++WLN G + CPQTQQVL HT+LTPNHL+R MIS WC 
Sbjct  82    SKELMKDPVVLATGLTYDRPLIERWLNEGLQTCPQTQQVLPHTVLTPNHLVREMISQWCT  141

Query  332   VNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFR  511
              +G   P        ++ VV  AD      LLEKM  S   Q+ AA+ELR+ TKR PSFR
Sbjct  142   EHGHELPKGTRDM--DEKVVRKADGAYLNSLLEKMCLSLPDQKEAAKELRVATKRSPSFR  199

Query  512   ALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVL  685
              LFGES   A+ K+L+P S  + D HPDLQED+ITT+LNLSI + NK+LV E P  I++L
Sbjct  200   ELFGES-NEAISKVLNPLSPDQADTHPDLQEDLITTLLNLSICEKNKRLVGENPLAITLL  258

Query  686   IDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAI  865
             ++SL+SG  +TRSNAAAAIFTLS L+SNK +IG  GA++PLIDLL+EG+  AM+D ASAI
Sbjct  259   VESLKSGTPQTRSNAAAAIFTLSDLNSNKLVIGNGGAIRPLIDLLDEGNPQAMRDAASAI  318

Query  866   FVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             F LC++ ENK RA+++GAV V+V+KI + V V ELLAILA+LS + +A++EM EL  VP 
Sbjct  319   FNLCIVLENKRRAVQEGAVPVIVKKIKDHVMVAELLAILALLSVHQKAVDEMDELNVVPL  378

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             LLS IR++SC  +KENCI ILY  C  DR +L+EIK EE+ +G+IS+LA+ GTSRA+RKA
Sbjct  379   LLSFIRESSCENSKENCIAILYTTCYNDRVRLREIKAEEAKNGSISRLARTGTSRARRKA  438

Query  1226  SGVLDRLNRGVGFIHTA  1276
             +G L+RLNR     HTA
Sbjct  439   NGFLERLNRSALITHTA  455



>ref|XP_009415947.1| PREDICTED: U-box domain-containing protein 9-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   441 bits (1135),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 241/447 (54%), Positives = 315/447 (70%), Gaps = 29/447 (6%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS------------------F  127
             EL+R V+A+  ED    E  + A +AL AL+ L    + NS                   
Sbjct  22    ELRRLVRAIAEEDDSRIEKFEGAARALAALKDLRFRGSGNSNGALASQRKAETEIEAVVV  81

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P  F CP+S ELM+DPVVV+SGQTYDR FI++WL+SGNR CPQTQ+VLS T LTPNHL+R
Sbjct  82    PEHFLCPISAELMRDPVVVASGQTYDRAFIEEWLSSGNRTCPQTQRVLSDTTLTPNHLVR  141

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELR  481
              MIS WC  +G+  P  P+    E+G++T  +R+    + +KMSSSS V  Q+ A RELR
Sbjct  142   SMISQWCIEHGVTLP--PLDQGQEEGLITGKERNALRRIFDKMSSSSSVPEQKQAVRELR  199

Query  482   LLTKRMPSFRALFGESMGAAMPKLLS----PFSRVDVHPDLQEDIITTILNLSIHDSNKK  649
             LLTKR  SFRAL GE+    +P+LLS    P  R D  P++QED +TTILNLSIHDSNKK
Sbjct  200   LLTKRNRSFRALVGENPDT-IPQLLSVLSAPGLRCD--PEVQEDTVTTILNLSIHDSNKK  256

Query  650   LVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
             +V + P+ I +LID+L++G +ETRSNAAAA+F+LSALD NK  IG+SGA+KPL+DLLE+G
Sbjct  257   IVGDNPQAIPLLIDALQTGTMETRSNAAAALFSLSALDCNKLKIGESGAMKPLVDLLEQG  316

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRA  1009
                A KD  SAIF LC++HEN+ARA+R GAV V+++ I +   VDE LAILA+LSS+  A
Sbjct  317   SPSAKKDAGSAIFNLCMVHENRARAVRGGAVGVVLKAIGHHSLVDESLAILALLSSDQDA  376

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
             +EE+   G VP LL ++RD+ CARNKEN  V+L++IC  DRTKL+E+ +EE  HG+IS+L
Sbjct  377   VEEIARAGGVPRLLGIVRDSPCARNKENAAVVLFSICMHDRTKLREVGEEEEKHGSISRL  436

Query  1190  AQNGTSRAKRKASGVLDRLNRGVGFIH  1270
             AQNGTSRA+RKA+G++D+  R     H
Sbjct  437   AQNGTSRARRKAAGIIDKWKRASRSTH  463



>ref|XP_009340331.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Pyrus x bretschneideri]
Length=323

 Score =   432 bits (1111),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 220/326 (67%), Positives = 269/326 (83%), Gaps = 7/326 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MIS WC+  GI   DP +  +NEDG+ T++DR  FL LL KMS +   Q+ AA+ELR+LT
Sbjct  1     MISQWCRNRGIELSDPALH-VNEDGI-TESDRDRFLSLLRKMSLTFPEQKEAAKELRMLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVA  658
             KRMPSFRALF ES+ A +P+LLSP S       + P+LQED+ITT+LNLSIHD+NKKLVA
Sbjct  59    KRMPSFRALFNESIHA-IPQLLSPLSEGKFEDGIDPELQEDVITTLLNLSIHDNNKKLVA  117

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ET  VI +L+++L+SG I+TRSNAAAA+FTLSALDSNKALIGKSGALKPLI LL+EGH L
Sbjct  118   ETLMVIPLLMEALQSGTIQTRSNAAAALFTLSALDSNKALIGKSGALKPLIALLDEGHPL  177

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
             AMKDVASAIF LC+ HENKARA+RDGAVR +++KI N VHVDELLAILAM+SS+ +A+EE
Sbjct  178   AMKDVASAIFNLCITHENKARAVRDGAVRTILKKIANSVHVDELLAILAMISSHPKAVEE  237

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             MGELG V  LL +IR+T+C+RNKENCI +L+ IC  DRTK KEI++EE+++GTIS+LA N
Sbjct  238   MGELGGVSCLLRVIRETNCSRNKENCIAVLHTICLNDRTKWKEIREEENTYGTISELANN  297

Query  1199  GTSRAKRKASGVLDRLNRGVGFIHTA  1276
             GTSRAKRKA+G+LDRLNR V   HTA
Sbjct  298   GTSRAKRKANGILDRLNRSVNLTHTA  323



>gb|EAZ23084.1| hypothetical protein OsJ_06778 [Oryza sativa Japonica Group]
Length=467

 Score =   427 bits (1097),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 221/444 (50%), Positives = 310/444 (70%), Gaps = 26/444 (6%)
 Frame = +2

Query  5     LQRAVKAVVSEDGVNAEAIDRAQQALCALRG--LHPEQNNN----------------SFP  130
             L+R V AV +      +A D A  AL ALR   L P   +                 + P
Sbjct  25    LRRLVAAVTAGGFGGGKAFDEAASALAALRDAELGPPPKDRPGAGVERRRSGHAEAAAVP  84

Query  131   AEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRG  310
              +F CP+S E+M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TIL PNHL+R 
Sbjct  85    EQFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTILIPNHLVRS  144

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRL  484
             MI+ WC  NGI     P++   ED +VT+ +R +F  L +++SSSS +  +R A ++LRL
Sbjct  145   MIAQWCTENGIALS--PLENQEED-LVTNNERKSFSELFDRISSSSNISEKRQAIKDLRL  201

Query  485   LTKRMPSFRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             LTKR  SFRA+ GE+  + + +++S  S   ++ + ++ ED +TTILNLSIH+SNKK++ 
Sbjct  202   LTKRNSSFRAVIGENPDS-ISQMISAVSNPELESNSEVLEDTVTTILNLSIHESNKKIIG  260

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             +  + I+ LI +L+SG +E RSNAAAAIF+LSALDSNKA IG+SGA++PL+DLLE G   
Sbjct  261   DDTKAITFLISALQSGTMEARSNAAAAIFSLSALDSNKAKIGESGAMRPLVDLLEHGSMT  320

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
             A KD ASAIF LC LHENK+RA + G + V+++ I +    DE L ILA+LSS+H  +EE
Sbjct  321   AKKDAASAIFSLCKLHENKSRATKSGVIDVVLKAISDESLTDESLTILALLSSDHETVEE  380

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             +GE G VP +L +I+D  C RNKEN + +L++IC  DRTKL+E+ ++E+ +G+++ LAQN
Sbjct  381   IGETGGVPCMLHIIKDDQCKRNKENAVAVLFSICMYDRTKLREVVEDENLNGSLAWLAQN  440

Query  1199  GTSRAKRKASGVLDRLNRGVGFIH  1270
             GTSRA+RKA+G+LD+L R +   H
Sbjct  441   GTSRARRKAAGILDKLKRTIHKTH  464



>dbj|BAD22116.1| Avr9/Cf-9 rapidly elicited protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD21861.1| Avr9/Cf-9 rapidly elicited protein-like [Oryza sativa Japonica 
Group]
Length=467

 Score =   424 bits (1089),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 217/428 (51%), Positives = 304/428 (71%), Gaps = 26/428 (6%)
 Frame = +2

Query  53    EAIDRAQQALCALR------------GLHPEQNNN------SFPAEFRCPLSGELMKDPV  178
             EA D A  AL ALR            G   E+  +      + P +F CP+S E+M+DPV
Sbjct  41    EAFDEAASALAALRDAELGPPPKDRPGAGAERRRSGHAEAAAVPEQFLCPISSEIMRDPV  100

Query  179   VVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDP  358
             V++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TIL PNHL+R MI+ WC  NGI     
Sbjct  101   VLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTILIPNHLVRSMIAQWCTENGIALS--  158

Query  359   PVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESM  532
             P++   ED +VT+ +R +F  L +++SSSS +  +R A ++LRLLTKR  SFRA+ GE+ 
Sbjct  159   PLENQEED-LVTNNERKSFSELFDRISSSSNISEKRQAIKDLRLLTKRNSSFRAVIGENP  217

Query  533   GAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSG  706
              + + +++S  S   ++ + ++ ED +TTILNLSIH+SNKK++ +  + I+ LI +L+SG
Sbjct  218   DS-ISQMISAVSNPELESNSEVLEDTVTTILNLSIHESNKKIIGDDTKAITFLISALQSG  276

Query  707   AIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLH  886
              +E RSNAAAAIF+LSALDSNKA IG+SGA++PL+DLLE G   A KD ASAIF LC LH
Sbjct  277   TMEARSNAAAAIFSLSALDSNKAKIGESGAMRPLVDLLEHGSMTAKKDAASAIFSLCKLH  336

Query  887   ENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRD  1066
             ENK+RA + G + V+++ I +    DE L ILA+LSS+H  +EE+GE G VP +L +I+D
Sbjct  337   ENKSRATKSGVIDVVLKAISDESLTDESLTILALLSSDHETVEEIGETGGVPCMLHIIKD  396

Query  1067  TSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRL  1246
               C RNKEN + +L++IC  DRTKL+E+ ++E+ +G+++ LAQNGTSRA+RKA+G+LD+L
Sbjct  397   DQCKRNKENAVAVLFSICMYDRTKLREVVEDENLNGSLAWLAQNGTSRARRKAAGILDKL  456

Query  1247  NRGVGFIH  1270
              R +   H
Sbjct  457   KRTIHKTH  464



>ref|NP_001172966.1| Os02g0488701 [Oryza sativa Japonica Group]
 dbj|BAH91695.1| Os02g0488701, partial [Oryza sativa Japonica Group]
Length=423

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/387 (53%), Positives = 291/387 (75%), Gaps = 8/387 (2%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P +F CP+S E+M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TIL PNHL
Sbjct  38    AVPEQFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTILIPNHL  97

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARE  475
             +R MI+ WC  NGI     P++   ED +VT+ +R +F  L +++SSSS +  +R A ++
Sbjct  98    VRSMIAQWCTENGIALS--PLENQEED-LVTNNERKSFSELFDRISSSSNISEKRQAIKD  154

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKK  649
             LRLLTKR  SFRA+ GE+  + + +++S  S   ++ + ++ ED +TTILNLSIH+SNKK
Sbjct  155   LRLLTKRNSSFRAVIGENPDS-ISQMISAVSNPELESNSEVLEDTVTTILNLSIHESNKK  213

Query  650   LVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
             ++ +  + I+ LI +L+SG +E RSNAAAAIF+LSALDSNKA IG+SGA++PL+DLLE G
Sbjct  214   IIGDDTKAITFLISALQSGTMEARSNAAAAIFSLSALDSNKAKIGESGAMRPLVDLLEHG  273

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRA  1009
                A KD ASAIF LC LHENK+RA + G + V+++ I +    DE L ILA+LSS+H  
Sbjct  274   SMTAKKDAASAIFSLCKLHENKSRATKSGVIDVVLKAISDESLTDESLTILALLSSDHET  333

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
             +EE+GE G VP +L +I+D  C RNKEN + +L++IC  DRTKL+E+ ++E+ +G+++ L
Sbjct  334   VEEIGETGGVPCMLHIIKDDQCKRNKENAVAVLFSICMYDRTKLREVVEDENLNGSLAWL  393

Query  1190  AQNGTSRAKRKASGVLDRLNRGVGFIH  1270
             AQNGTSRA+RKA+G+LD+L R +   H
Sbjct  394   AQNGTSRARRKAAGILDKLKRTIHKTH  420



>ref|XP_008778975.1| PREDICTED: U-box domain-containing protein 9-like [Phoenix dactylifera]
Length=445

 Score =   421 bits (1083),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 300/420 (71%), Gaps = 9/420 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             EL+R V  +V ED    E  D A + +  L+ L     + + P  F CP+S ELMKDPV+
Sbjct  23    ELRRLVMLIVEEDDGRIETYDEASRVISELKDL--TFGSPAVPQHFLCPISSELMKDPVI  80

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             ++SGQTYDRPFIQ+WLNSG+RICPQT+QVL +TIL PNH++R MIS WC  + I  P   
Sbjct  81    LASGQTYDRPFIQEWLNSGSRICPQTRQVLPNTILIPNHMVRIMISEWCMEHDIPLPALE  140

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRALFGESMGA  538
              Q   ++ ++T  +R     LLEK+SSSS   Q+ A +E+RLLTK   SFRAL GE    
Sbjct  141   SQ---DETLITRKERSALYELLEKISSSSIPGQKQAMKEIRLLTKHNRSFRALIGEKPDT  197

Query  539   AMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAI  712
              +P LLS  S   ++  P++QED +TTILNLSIH+SNKK+V + P+ I  LID+L++G +
Sbjct  198   -IPHLLSVLSVPGLNCDPEVQEDTVTTILNLSIHESNKKIVGDDPQAIPFLIDALKNGTM  256

Query  713   ETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHEN  892
             ET+SNAAAA+FTLSALDSNK  IG+ GA+KPL++LLE+G   A KD ASAIF +C+ HEN
Sbjct  257   ETQSNAAAALFTLSALDSNKLKIGELGAIKPLLELLEQGSKTAKKDSASAIFNICMAHEN  316

Query  893   KARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTS  1072
             + +A+++GAV V+++ I ++  VD  LAILA+LS +  A+EE+G+ G VP LL +IR+++
Sbjct  317   RTKAVKEGAVGVVLKAIKDQSLVDGSLAILALLSGDQEALEEIGKSGGVPCLLGIIREST  376

Query  1073  CARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
             C RNKEN +V L+A+C  D TK +E++++E  +G+IS LAQ GT RA+RKA G+LD L R
Sbjct  377   CERNKENAVVALFAVCMYDPTKRREVREDEKLNGSISALAQTGTRRARRKADGILDMLKR  436



>ref|XP_009379990.1| PREDICTED: U-box domain-containing protein 9 [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   422 bits (1084),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 298/442 (67%), Gaps = 25/442 (6%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGL----------------------HPEQN  115
             ELQR V+ +  ED       + A + L AL+ +                          +
Sbjct  31    ELQRLVREIAEEDDGQIGTYEEAARVLAALKQVTFAGSGGSNGTPRSPLANQWRTDERMD  90

Query  116   NNSFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPN  295
             + S P  FRCP+S ELMKDPVV++SGQTYDRPFIQ+WLNSGNR CPQ+ Q+L +TILTPN
Sbjct  91    SASVPEHFRCPISSELMKDPVVLASGQTYDRPFIQEWLNSGNRTCPQSHQILPNTILTPN  150

Query  296   HLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAA  469
             HL+  MIS WC  + +  P    +   + G++T  +++    LL+K+ S S V  Q+ A 
Sbjct  151   HLVHRMISQWCIEHDVSLPPLDNEQDEDKGLITVTEKNVLDGLLQKICSPSSVMEQKRAL  210

Query  470   RELRLLTKRMPSFRALFGESMGAAMPKLLSP-FSRVDVHPDLQEDIITTILNLSIHDSNK  646
              ELRLLTK   SFRAL GE+  A    L  P    +   P +QED +TTILN+SI+++NK
Sbjct  211   SELRLLTKCKRSFRALIGENDDAISQLLAVPSIPELSADPKVQEDAVTTILNISINETNK  270

Query  647   KLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEE  826
             K+V + P+ I  LID+L++G IET SN+AAA+F+LSALDSNK  IG+ GA+KPLI+LLE+
Sbjct  271   KIVGDNPQAIPFLIDALKAGRIETCSNSAAALFSLSALDSNKLKIGELGAMKPLIELLEQ  330

Query  827   GHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHR  1006
             G S A KD  SA+F LC+ HEN+ARA+  G + V+++ I +R  V+E LAILA+LSSN  
Sbjct  331   GSSSARKDAGSAVFSLCLAHENRARAVSGGVLGVVLKAITDRSLVNESLAILALLSSNQE  390

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
             AIEE+ E G VP LLS+IR++SCARNKEN + +LY+IC  DR +L+E+ +EE S+G ISQ
Sbjct  391   AIEEIAETGGVPCLLSIIRESSCARNKENAVAVLYSICMYDRKRLREVGEEEDSNGIISQ  450

Query  1187  LAQNGTSRAKRKASGVLDRLNR  1252
             L QNGTSRA+RKA+G+LD+  R
Sbjct  451   LVQNGTSRARRKAAGILDKWKR  472



>ref|XP_006407844.1| hypothetical protein EUTSA_v10020790mg [Eutrema salsugineum]
 gb|ESQ49297.1| hypothetical protein EUTSA_v10020790mg [Eutrema salsugineum]
Length=427

 Score =   418 bits (1074),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 225/391 (58%), Positives = 285/391 (73%), Gaps = 19/391 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEFRCPL  151
             E+++ ++ +  +D    + ID+ Q+AL A +     +             S P EFRCPL
Sbjct  23    EMKKLLRNIEEDDDFGVQTIDQLQEALSAFKQATMRKMAKSSSLEMLETVSCPEEFRCPL  82

Query  152   SGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCK  331
             S +LM+DPVV++SGQTYD+ FIQKWL+SGNR CP+TQQVL HT LTPN LIR MIS WCK
Sbjct  83    SNDLMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIREMISKWCK  142

Query  332   VNGIWFPDPPVQCL-NEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPS  505
               G+   +     L NE+  VT +DR  F  LL K+SSS+   Q+SAA+ELRLLTK+ P 
Sbjct  143   KVGLETTNQHHSNLVNEEKAVTKSDREIFSSLLCKVSSSNLQDQKSAAKELRLLTKKGPD  202

Query  506   FRALFGESMGAAMPKLLSPF---SRVDVHPDLQEDIITTILNLSIHD-SNKKLVAETPRV  673
             FRALFGE     + +LL+P    S  D H  +QED++TT+LN+SIHD SNKKLV E P V
Sbjct  203   FRALFGEHPDE-ITRLLNPLLHGSNPDEH--IQEDVVTTLLNISIHDDSNKKLVCENPNV  259

Query  674   ISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDV  853
             I +LID+LR G + TRSNAAAAIFTLSALDSNK LIGKSG LKPLIDLL+EG+ LA+KDV
Sbjct  260   IPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLDEGNPLAIKDV  319

Query  854   ASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             A+AIF LC+ HEN++RA++DGAVRVL +KI N ++VDELLAILAML ++ +A+EE+GELG
Sbjct  320   AAAIFTLCIAHENRSRAVKDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAVEELGELG  379

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSA  1126
              V  LL + R++ C RNKEN IVIL+ ICSA
Sbjct  380   GVSWLLEITRESECKRNKENAIVILHTICSA  410



>ref|XP_003574980.1| PREDICTED: U-box domain-containing protein 9-like [Brachypodium 
distachyon]
Length=463

 Score =   412 bits (1059),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/388 (54%), Positives = 288/388 (74%), Gaps = 9/388 (2%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             S P +F CP+S E+M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TIL  NHL
Sbjct  77    SVPEQFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTILIANHL  136

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARE  475
             +R MIS WC  NGI  P  PV+   ED +VT+ +R     + ++++ SS +  QR A ++
Sbjct  137   VRSMISQWCTENGITLP--PVEDREED-LVTNNERKACGEIFDRITFSSNISEQRQAIKD  193

Query  476   LRLLTKRMPSFRALFGESMG--AAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKK  649
             LRLLTKR  SFRA+ GE     A M  +++  S ++   ++ ED +TTILNLSIH+SNKK
Sbjct  194   LRLLTKRNSSFRAVIGEKPDTIAQMISVVAD-SELEHSAEVLEDTVTTILNLSIHESNKK  252

Query  650   LVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
             ++ + P  I  LI +L+SG ++ RSNAAAAIF+LSALDSNKA IG+SGAL+PL+DLLE+G
Sbjct  253   IIGDDPTAIPFLIRALQSGTMDARSNAAAAIFSLSALDSNKAKIGESGALRPLVDLLEQG  312

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRA  1009
               +A KD ASAIF LC+LHENK+RA + G + V ++ I +   +DE +AILA+LSS+H  
Sbjct  313   SMIAKKDAASAIFNLCMLHENKSRATKSGVIDVTLKAICDESLIDESMAILALLSSDHET  372

Query  1010  IEEMGELGAVPSLLSLIRDT-SCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
             +EE+GE G VP +L +I++   C RNKEN + +L+AIC  DR+KL+EI ++ES +G+++ 
Sbjct  373   VEEIGETGGVPCMLRIIKEEDQCKRNKENAVAVLFAICMYDRSKLREIAEDESLNGSLAW  432

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVGFIH  1270
             LAQNGT+RA+RKA+G+LD+L R +   H
Sbjct  433   LAQNGTTRARRKAAGILDKLKRTMHATH  460



>ref|XP_004495551.1| PREDICTED: U-box domain-containing protein 9-like [Cicer arietinum]
Length=455

 Score =   410 bits (1053),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 310/442 (70%), Gaps = 21/442 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS-------------FPAEFR  142
             +L+  V ++V  D     A D A  AL  LR       + S              P +FR
Sbjct  18    KLKEVVNSIVEGDDFTLHAADEAITALSVLRDFKCSSASFSSKFDLLSFPVPVSVPPQFR  77

Query  143   CPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISN  322
             CP+SG +M DPV++++GQTYDRPFIQ+WLN  ++ICPQTQ VLSH+IL+PN+L+  MIS 
Sbjct  78    CPISGHIMTDPVILANGQTYDRPFIQRWLNEVHKICPQTQHVLSHSILSPNYLVYDMISR  137

Query  323   WCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMP  502
             WCK  GI  P P      E+G VT+A ++   +LL K+S S+  Q+ AARE+R+L  RMP
Sbjct  138   WCKDQGIELPMPVGDI--ENGQVTEAHKYRLRLLLHKLSLSTLDQKEAAREIRMLANRMP  195

Query  503   SFRALFGESMGAAMPKLLSPFSR-VD-VHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             SFR LFG+S    + KLL P S  VD V P+L ED+IT++LNLSI+D+NK++ AE  +++
Sbjct  196   SFRTLFGDS--EVIQKLLIPLSPGVDCVDPELHEDLITSVLNLSINDNNKRVFAEDEKLM  253

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
             S +IDSL+SG I+TRSNAAAAIF+LSA+D NK +IGK+GA+K L+DLLE+GH   MKD A
Sbjct  254   SFIIDSLKSGTIQTRSNAAAAIFSLSAVDINKHIIGKTGAIKYLVDLLEKGHPSTMKDAA  313

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEK-IMNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             SAIF LC+  ENKAR +R+GAV+V++ K IM+ V VDE LA+LA+LSS+ +AI+ +G  G
Sbjct  314   SAIFNLCIAQENKARTVREGAVQVILSKIIMDHVLVDEFLALLALLSSHSKAIQALGSHG  373

Query  1034  AVPSLLSLIRDTSCA-RNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSR  1210
             AVP  + ++RD+S + R+KENC+ ILY I   D+TK KEIK++E  +GT++ LAQ GTSR
Sbjct  374   AVPFFMDILRDSSVSDRSKENCVAILYIIFFNDKTKRKEIKNDEIVNGTLATLAQCGTSR  433

Query  1211  AKRKASGVLDRLNRGVGFIHTA  1276
             AKRKA G+LDRL       HT 
Sbjct  434   AKRKACGILDRLKLSQSSKHTT  455



>ref|XP_006648643.1| PREDICTED: U-box domain-containing protein 9-like, partial [Oryza 
brachyantha]
Length=405

 Score =   407 bits (1045),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 288/385 (75%), Gaps = 8/385 (2%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P  F CP+S E+M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+T+L PNHL+R
Sbjct  22    PEHFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTVLIPNHLVR  81

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELR  481
              MI+ WC  NGI     P++   ED +VT+ +R  F  L +++SSSS +  ++ A ++LR
Sbjct  82    SMIAQWCTENGIALS--PLENQEED-LVTNNERKAFSELFDRISSSSDISEKKQAIKDLR  138

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDV--HPDLQEDIITTILNLSIHDSNKKLV  655
             LLTKR  SFRA+ GE+  + + +++S  S  ++  + ++ ED +TTILNLSIH+SNKK++
Sbjct  139   LLTKRNSSFRAVIGENPDS-ISQMISAVSNAELESNSEVLEDTVTTILNLSIHESNKKII  197

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              +  + ++ LI +L+SG +E RSNAAAAIF+LSALDSNKA IG+SGA++PL+DLLE G  
Sbjct  198   GDDTKAVTFLISALQSGTMEARSNAAAAIFSLSALDSNKAKIGESGAMRPLVDLLEHGSM  257

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
              A KD ASAIF LC LHENK+RA R G + V+++ I +   +DE L ILA+LSS+H  +E
Sbjct  258   TAKKDAASAIFSLCKLHENKSRATRSGIIDVVLKSISDESLIDEALTILALLSSDHETVE  317

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
             E+GE G VP +L ++ D  C RNKEN + +L++IC  DRTKL+E+ ++E+ +G+++ LAQ
Sbjct  318   EIGETGGVPCMLRIVSDDQCKRNKENAVAVLFSICMYDRTKLREVVEDENLNGSLAWLAQ  377

Query  1196  NGTSRAKRKASGVLDRLNRGVGFIH  1270
             NGTSRA+RKA+G+LD+L R +   H
Sbjct  378   NGTSRARRKAAGILDKLKRTIHKTH  402



>gb|EEC73195.1| hypothetical protein OsI_07255 [Oryza sativa Indica Group]
Length=372

 Score =   405 bits (1041),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 200/373 (54%), Positives = 281/373 (75%), Gaps = 8/373 (2%)
 Frame = +2

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TIL PNHL+R MI+ WC  NGI
Sbjct  1     MRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTILIPNHLVRSMIAQWCTENGI  60

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRAL  517
                  P++   ED +VT+ +R +F  L +++SSSS +  +R A ++LRLLTKR  SFRA+
Sbjct  61    ALS--PLENQEED-LVTNNERKSFSELFDRISSSSNISEKRQAIKDLRLLTKRNSSFRAV  117

Query  518   FGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLID  691
              GE+  + + +++S  S   ++ + ++ ED +TTILNLSIH+SNKK++ +  + I+ LI 
Sbjct  118   IGENPDS-ISQMISAVSNPELESNSEVLEDTVTTILNLSIHESNKKIIGDDTKAITFLIS  176

Query  692   SLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFV  871
             +L+SG +E RSNAAAAIF+LSALDSNKA IG+SGA++PL+DLLE G   A KD ASAIF 
Sbjct  177   ALQSGTMEARSNAAAAIFSLSALDSNKAKIGESGAMRPLVDLLEHGSMTAKKDAASAIFS  236

Query  872   LCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLL  1051
             LC LHENK+RA + G + V+++ I +    DE L ILA+LSS+H  +EE+GE G VP +L
Sbjct  237   LCKLHENKSRATKSGVIDVVLKAISDESLTDESLTILALLSSDHETVEEIGETGGVPCML  296

Query  1052  SLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASG  1231
              +I+D  C RNKEN + +L++IC  DRTKL+E+ ++E+ +G+++ LAQNGTSRA+RKA+G
Sbjct  297   HIIKDDQCKRNKENAVAVLFSICMYDRTKLREVVEDENLNGSLAWLAQNGTSRARRKAAG  356

Query  1232  VLDRLNRGVGFIH  1270
             +LD+L R +   H
Sbjct  357   ILDKLKRTIHKTH  369



>ref|XP_002453828.1| hypothetical protein SORBIDRAFT_04g019280 [Sorghum bicolor]
 gb|EES06804.1| hypothetical protein SORBIDRAFT_04g019280 [Sorghum bicolor]
Length=464

 Score =   407 bits (1045),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 205/391 (52%), Positives = 279/391 (71%), Gaps = 16/391 (4%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P  F CP+S E+M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TI+ PNHL
Sbjct  79    AVPEHFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTIIIPNHL  138

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARE  475
             +R MIS WC  NGI  P  PV+  +ED +VT+ +R  F  + E+++SSS +  QR A ++
Sbjct  139   VRSMISQWCTDNGITLP--PVENQDED-LVTNNERKTFSKIFERIASSSNLSEQREAIKD  195

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQ------EDIITTILNLSIHD  637
             LRLLTK   S RA  GE      P  +S    V  +P+L+      ED++TTILNLSIH+
Sbjct  196   LRLLTKCNSSLRAAIGEK-----PDSISQIISVASNPELENNAEVLEDMVTTILNLSIHE  250

Query  638   SNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDL  817
             SNKK++ + P  I  LI +L+SG +E RSNAAAAIF+LSALDSNK  IG+ G ++PL+DL
Sbjct  251   SNKKIIGDDPLAIPFLIRTLQSGTMEARSNAAAAIFSLSALDSNKVKIGELGVMRPLVDL  310

Query  818   LEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSS  997
             LE G  +A KD ASAIF LC+LHENK+RA + G + V ++ I +   VDE LAILA+LS 
Sbjct  311   LEHGSMIAKKDAASAIFNLCMLHENKSRATKSGVIDVTLKAITDDSLVDESLAILALLSG  370

Query  998   NHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGT  1177
             +H  +EE+GE G V S+L +I++  C RNKEN + +L+A+C  DRTKL+E+ + E  +G+
Sbjct  371   DHETVEEIGETGGVASMLHVIKEDQCKRNKENAVAVLFAVCMYDRTKLREVAEHEKLNGS  430

Query  1178  ISQLAQNGTSRAKRKASGVLDRLNRGVGFIH  1270
             ++ L QNGTSRA+RKA G+LD++ R +   H
Sbjct  431   LAWLVQNGTSRARRKAVGILDKMKRTLHQPH  461



>ref|XP_008811326.1| PREDICTED: U-box domain-containing protein 9-like [Phoenix dactylifera]
Length=469

 Score =   403 bits (1035),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 221/443 (50%), Positives = 301/443 (68%), Gaps = 30/443 (7%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS-------------------  124
             EL+R V+A+  +D    +  D A +AL ALR +    N NS                   
Sbjct  22    ELRRLVRAIAEDDDTQIKTFDEAARALAALRDVKFGGNGNSKGKRSPSPLSKETKKDGKI  81

Query  125   ----FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTP  292
                  P  F CP+S ELM+DPV+++SGQTY+RPFIQ+WLNSGNR CPQTQQ+L +T L P
Sbjct  82    GSPAIPQHFLCPISSELMRDPVILASGQTYERPFIQEWLNSGNRTCPQTQQILPNTTLIP  141

Query  293   NHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSA  466
             NH +R MIS WC  +GI  P P V+   E+G++T  +R     LL+K+SSSS +  Q+ A
Sbjct  142   NHAVRSMISEWCAEHGI--PLPAVES-QEEGLITKDERDALNELLDKISSSSSIPEQKQA  198

Query  467   ARELRLLTKRMPSFRALFGESMGA-AMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSN  643
              +ELRLLTKR  SFRAL G    A ++   L     +D  P+LQED +TTILNLSIHDSN
Sbjct  199   VKELRLLTKRNRSFRALLGGKPDAISLLLSLLSVPGLDGDPELQEDTVTTILNLSIHDSN  258

Query  644   KKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLE  823
             KK+V   P+ I +LID+L++G +ETR NAAAA+FTLSALDSNK  IG+SGA+KPL++LLE
Sbjct  259   KKIVGADPQAIPLLIDALKNGTMETRGNAAAALFTLSALDSNKLKIGESGAIKPLLELLE  318

Query  824   EGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNH  1003
             +G   A  D ASAIF +C+  EN+ RA+++GAV V+++ I ++  VD  LAIL +LS + 
Sbjct  319   QGCETARTDAASAIFNICMAPENRMRAVKEGAVHVVLKAIEDQSLVDGPLAILTLLSGDP  378

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
              A+E++ E G +P LL ++R+++C RNKEN +  L+++C  DR  L+E+  EE  HGT+S
Sbjct  379   DAMEQIAESG-MPCLLGIMRESACDRNKENAVAALFSVCMHDRLMLREVGKEEKLHGTVS  437

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
              LAQNGTSRA+RKA+G+L+RL +
Sbjct  438   ALAQNGTSRARRKAAGILERLKK  460



>ref|XP_004952492.1| PREDICTED: U-box domain-containing protein 9-like [Setaria italica]
Length=457

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/389 (53%), Positives = 279/389 (72%), Gaps = 21/389 (5%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P +F CP+S E+M+DPVV++SGQTYDR FIQ+WL +GNR CPQTQQVLS+TIL PNHL+R
Sbjct  79    PEQFLCPISSEIMRDPVVLASGQTYDRRFIQEWLGAGNRTCPQTQQVLSNTILIPNHLVR  138

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELR  481
              MIS WC  NGI  P  PV+   ED +VT+ +R  F  + E+++SSS +  QR A ++LR
Sbjct  139   SMISQWCTDNGITLP--PVENQEED-LVTNNERKTFSKIFERIASSSNLSEQREAIKDLR  195

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQ------EDIITTILNLSIHDSN  643
             LLTK   S RA  GE      P  +S       +P+L+      ED++TTILNLSIH+SN
Sbjct  196   LLTKCNSSLRAAIGEK-----PDSISQMISTVSNPELENNAEVLEDMVTTILNLSIHESN  250

Query  644   KKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLE  823
             KK++ + P  I  LI +L+SG +E RSN+AAAIF+LSAL+SNKA IG+ GA++PL+DLLE
Sbjct  251   KKIIGDDPLAIPFLIRALQSGTMEARSNSAAAIFSLSALNSNKAKIGELGAMRPLVDLLE  310

Query  824   EGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNH  1003
              G  +A KD ASAIF LC+LHENK+R     A ++ ++ I + + VDE LAILA+LS +H
Sbjct  311   HGSMIAKKDAASAIFNLCMLHENKSR-----ASKMTLKAIADDLLVDESLAILALLSGDH  365

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
               +EE+GE G V S+L +I++  C RNKEN   +L+A+C  DRTKL+E+ ++E+ +G+++
Sbjct  366   ETVEEIGETGGVASMLRVIKEDQCKRNKENAAAVLFAVCMYDRTKLREVAEDENLNGSLA  425

Query  1184  QLAQNGTSRAKRKASGVLDRLNRGVGFIH  1270
              L QNGTSRA+RKASG+LD++ R V   H
Sbjct  426   WLTQNGTSRARRKASGILDKMKRAVHHTH  454



>gb|ACU18266.1| unknown [Glycine max]
Length=323

 Score =   395 bits (1015),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 213/326 (65%), Positives = 262/326 (80%), Gaps = 7/326 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             MI  W K  GI F +  VQ ++E+G+   AD  +FL LL+KMSS+   Q++AA+ELRLLT
Sbjct  1     MIEQWSKNQGIEFSNT-VQYIDEEGL-NKADCEHFLCLLKKMSSTLSDQKTAAKELRLLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFSRVD----VHPDLQEDIITTILNLSIHDSNKKLVA  658
             K+ P FR LF +S   A+P+LL P    D    VHPDLQED+I T+LN+SIHD+NKKLVA
Sbjct  59    KKHPCFRVLFCDS-ADAIPQLLKPICGSDSFGSVHPDLQEDVIATLLNISIHDNNKKLVA  117

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ETP VI +L+ +LRSG IETRSNAAAA+FTLSALDSNK LIGKSGALKPLIDLLEEGH L
Sbjct  118   ETPMVIPLLMRALRSGTIETRSNAAAALFTLSALDSNKELIGKSGALKPLIDLLEEGHPL  177

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEE  1018
             AMKDVASAIF +CV+HENKARA++DGAVRV++ KI  ++HV ELLAILA+LSS+  A+ +
Sbjct  178   AMKDVASAIFNICVMHENKARAVKDGAVRVILAKINKQIHVAELLAILALLSSHQSAVHD  237

Query  1019  MGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQN  1198
             MG+LGAVPSLL +I+++SC RNKENC+ IL  IC  DR+KLKEI++EE+ H TI +LA+N
Sbjct  238   MGDLGAVPSLLRIIKESSCERNKENCVAILQTICLYDRSKLKEIREEENGHKTIFELAKN  297

Query  1199  GTSRAKRKASGVLDRLNRGVGFIHTA  1276
             GTSRAKRKASG+L+RLNR V   HTA
Sbjct  298   GTSRAKRKASGILERLNRVVHITHTA  323



>ref|NP_001150782.1| LOC100284415 [Zea mays]
 gb|ACG40355.1| spotted leaf protein 11 [Zea mays]
 gb|AFW71461.1| spotted leaf protein 11 [Zea mays]
Length=465

 Score =   398 bits (1022),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 205/399 (51%), Positives = 275/399 (69%), Gaps = 24/399 (6%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P  F CP+S E+M+DPVV++SGQTYDR FIQ+WL++GNR CPQTQQVLS+TI+TPNHL
Sbjct  72    AVPEHFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTIITPNHL  131

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSC---VQRSAAR  472
             +R MIS WC  NGI  P  PV+  +ED +VT+ +R  F  L E++ SSS     QR A +
Sbjct  132   VRSMISQWCTDNGITLP--PVENQDED-LVTNNERETFRKLFERIVSSSSDLSEQREAIK  188

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQ------EDIITTILNLSIH  634
             ELRL TK   S RA  GE      P  +S    V   P+L+      ED +T ILNLSIH
Sbjct  189   ELRLRTKCNSSLRAAIGE-----RPDSISQMISVASSPELENSAEVVEDTVTAILNLSIH  243

Query  635   DSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLID  814
             +SNKK++ + P  +  LI +L+SG +E RSNAAAAIF+LSALD NKA IG+ GA++PL++
Sbjct  244   ESNKKIIGDDPLAVPFLIKALQSGTMEARSNAAAAIFSLSALDGNKARIGELGAMRPLVE  303

Query  815   LLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM-------NRVHVDELL  973
             LLE G + A KD ASAIF LC LHENK+RA + GAV V +  +        +   VDE L
Sbjct  304   LLEHGSTAARKDAASAIFNLCTLHENKSRATKSGAVDVTLRAVACAGDGSGSGSLVDESL  363

Query  974   AILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIK  1153
             A+LA+LS +H A+EE+GE G V S+L +++D  C RNKEN   +L+A+C  DRT+L+E+ 
Sbjct  364   AVLALLSGDHEAVEEVGETGGVASMLHVVKDDPCKRNKENAAAVLFAVCVYDRTRLREVA  423

Query  1154  DEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGVGFIH  1270
             + E  +G++  LA+NGTSRA+RKA+G+LD++ R +   H
Sbjct  424   EHEKLNGSLGWLARNGTSRARRKAAGILDKMKRSMHHPH  462



>gb|KHN04967.1| U-box domain-containing protein 9 [Glycine soja]
Length=443

 Score =   395 bits (1015),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 302/427 (71%), Gaps = 14/427 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ------NNNSFPAEFRCPLSGEL  163
             +L+ +VK +V  D    +A D A  AL AL+ L          ++ + P  FRCPLSG L
Sbjct  13    KLRESVKIIVESDDYTVDAADEAMDALSALKDLKCTTSLSRNLDDAAVPPHFRCPLSGNL  72

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M DPV+++SGQ +DR FIQ+WLN   RICP+TQQVLSH+ILTPN  ++ MIS WCK +G+
Sbjct  73    MTDPVILASGQNFDRAFIQRWLNEVRRICPKTQQVLSHSILTPNCFLQNMISLWCKEHGV  132

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
               P P      E   + +  R +   LL K+S S   Q+ AA+ELR LTKR+P+FR LFG
Sbjct  133   ELPKPVWDIHGEK--LAEDHRLHMRSLLYKLSLSVSEQKEAAKELRQLTKRIPTFRTLFG  190

Query  524   ES-MGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             +S +   M + LSP +   V P+L ED+ITT+LNLSIHD+NK+++AE  +VIS+LI+SL+
Sbjct  191   DSEVIQLMLRPLSPGT-ASVDPELHEDLITTLLNLSIHDNNKRVLAEDEKVISLLIESLK  249

Query  701   -SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLC  877
              SG +ETRSNAAAAIF++SA+D+N+ +IGKSG +K L+DLLEEGH  AM+D ASA+F LC
Sbjct  250   YSGTVETRSNAAAAIFSMSAIDANRHIIGKSGVIKYLVDLLEEGHPPAMRDAASALFKLC  309

Query  878   VLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSL  1057
               HENK R +R+GAV+V++ KI++ V VDELLA+LA+LSS+H A+E +   GAVP LL +
Sbjct  310   YTHENKGRTVREGAVQVILGKIVDHVLVDELLALLALLSSHHMAVEALVNHGAVPFLLDI  369

Query  1058  IRD---TSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
             +R+   TS  R KENC+VIL  IC  DR K +EI ++E  +GT+ +LAQ G SRA+RKA 
Sbjct  370   LREKENTSEERIKENCVVILCTICFNDREKRREIGEDEMVNGTLYELAQRGNSRAQRKAR  429

Query  1229  GVLDRLN  1249
              +L+ L+
Sbjct  430   AILESLH  436



>ref|XP_003590900.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES61151.1| plant U-box protein [Medicago truncatula]
Length=446

 Score =   394 bits (1012),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 226/431 (52%), Positives = 304/431 (71%), Gaps = 22/431 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSF-----------PAEFRCP  148
             +L+  V  +V  D     A D A  AL  LR +   + + SF           P +FRCP
Sbjct  14    KLKELVNTIVEGDDFTVHAADEAITALSVLRDM---KCSASFSRKFDHLSLPVPPQFRCP  70

Query  149   LSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWC  328
             +SG +M DPV+++ GQTYDRPFIQ+WLN  ++ CPQ Q+VLSH+IL+PN+L+  MIS WC
Sbjct  71    ISGLIMTDPVILAIGQTYDRPFIQRWLNEVHKACPQAQRVLSHSILSPNYLVYDMISRWC  130

Query  329   KVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSF  508
             K +GI  P P      ++G VT+A ++    LL K+S S+  Q+ A RELRLLTKRMPSF
Sbjct  131   KEHGIELPMPVGDI--DNGEVTEAHKYRLRSLLHKLSLSALDQKEATRELRLLTKRMPSF  188

Query  509   RALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISV  682
             R LFG+S    +  LLSP S     + P+L ED+IT +LNLS  +SNK+   E  ++I+ 
Sbjct  189   RRLFGDS--EVIQNLLSPLSPGLACIDPELHEDLITAVLNLSFDESNKRAFVEDEKLITF  246

Query  683   LIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASA  862
             +IDSL+SG I+TRSNAAAAI +LSALD NK +IGK+ A+K L+DLLE+GH  +MKD  SA
Sbjct  247   IIDSLKSGTIQTRSNAAAAILSLSALDINKHIIGKTDAIKNLVDLLEKGHPSSMKDALSA  306

Query  863   IFVLCVLHENKARAIRDGAVRVLVEK-IMNRVHVDELLAILAMLSSNHRAIEEMGELGAV  1039
             IF LC+ HENKAR +R+GAV+V++ K IM+RV VDE L++LA+LSS+ +A+  +G  GAV
Sbjct  307   IFNLCIAHENKARTVREGAVQVILSKIIMDRVLVDEFLSLLALLSSHSKAVAALGSHGAV  366

Query  1040  PSLLSLIRDTSCA-RNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAK  1216
             P  + ++RD S + R+KENC+ ILY I   D+TK KEIK++E ++GT+S+LAQ GTSRAK
Sbjct  367   PFFMGILRDNSISDRSKENCVAILYIIFFNDKTKRKEIKEDEIANGTLSKLAQCGTSRAK  426

Query  1217  RKASGVLDRLN  1249
             RKASG+LDRLN
Sbjct  427   RKASGILDRLN  437



>ref|XP_009379720.1| PREDICTED: U-box domain-containing protein 9-like isoform X2 
[Pyrus x bretschneideri]
Length=321

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 203/324 (63%), Positives = 250/324 (77%), Gaps = 5/324 (2%)
 Frame = +2

Query  311   MISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLT  490
             M+S WC+ + I  P  PVQ ++E  +VT+ADR     LLEKMSSS   Q++AA++LRLLT
Sbjct  1     MVSQWCREHEIELP-KPVQDIDEQ-LVTNADRGCLNSLLEKMSSSLSDQKAAAKQLRLLT  58

Query  491   KRMPSFRALFGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAET  664
             KR  SFRALFGES    +P+LL+P S  +VD HPDLQED+ITT+LNLSIHD+NK+LVAE 
Sbjct  59    KRSSSFRALFGEST-ETIPQLLNPLSPGQVDAHPDLQEDLITTLLNLSIHDNNKRLVAEN  117

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
               VI +LI+SL  G ++T+SNAAA  FTLSA+DSNK+ IG SGA+KPLIDLL+ GH LAM
Sbjct  118   TSVIRLLIESLEYGTVQTKSNAAATFFTLSAIDSNKSTIGASGAIKPLIDLLDVGHPLAM  177

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KDVASA+F LC + ENK RAI  GAV V++ KIM+ V V ELL ILAMLS++ RA++EM 
Sbjct  178   KDVASAVFSLCTVLENKERAINAGAVGVILIKIMDHVLVAELLVILAMLSNHQRAVQEMC  237

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             ELGAVP L+ + R++ C RNKENC+ ILY IC ADRTKLKEIK+EE + GT S+L Q GT
Sbjct  238   ELGAVPCLIGITRESDCERNKENCVAILYTICFADRTKLKEIKEEEMARGTFSRLVQTGT  297

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRAKRKA G+L+RLNR     HTA
Sbjct  298   SRAKRKARGILERLNRTGAITHTA  321



>ref|XP_003555559.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max]
Length=487

 Score =   395 bits (1014),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 302/427 (71%), Gaps = 14/427 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ------NNNSFPAEFRCPLSGEL  163
             +L+ +VK +V  D    +A D A  AL AL+ L          ++ + P  FRCPLSG L
Sbjct  57    KLRESVKIIVESDDYTVDAADEAMDALSALKDLKCTTSLSRNLDDAAVPPHFRCPLSGNL  116

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M DPV+++SGQ +DR FIQ+WLN   RICP+TQQVLSH+ILTPN  ++ MIS WCK +G+
Sbjct  117   MTDPVILASGQNFDRAFIQRWLNEVRRICPKTQQVLSHSILTPNCFLQNMISLWCKEHGV  176

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
               P P      E   + +  R +   LL K+S S   Q+ AA+ELR LTKR+P+FR LFG
Sbjct  177   ELPKPVWDIHGEK--LAEDHRLHMRSLLYKLSLSVSEQKEAAKELRQLTKRIPTFRTLFG  234

Query  524   ES-MGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
             +S +   M + LSP +   V P+L ED+ITT+LNLSIHD+NK+++AE  +VIS+LI+SL+
Sbjct  235   DSEVIQLMLRPLSPGT-ASVDPELHEDLITTLLNLSIHDNNKRVLAEDEKVISLLIESLK  293

Query  701   -SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLC  877
              SG +ETRSNAAAAIF++SA+D+N+ +IGKSG +K L+DLLEEGH  AM+D ASA+F LC
Sbjct  294   YSGTVETRSNAAAAIFSMSAIDANRHIIGKSGVIKYLVDLLEEGHPPAMRDAASALFKLC  353

Query  878   VLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSL  1057
               HENK R +R+GAV+V++ KI++ V VDELLA+LA+LSS+H A+E +   GAVP LL +
Sbjct  354   YTHENKGRTVREGAVQVILGKIVDHVLVDELLALLALLSSHHMAVEALVNHGAVPFLLDI  413

Query  1058  IRD---TSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
             +R+   TS  R KENC+VIL  IC  DR K +EI ++E  +GT+ +LAQ G SRA+RKA 
Sbjct  414   LREKENTSEERIKENCVVILCTICFNDREKRREIGEDEMVNGTLYELAQRGNSRAQRKAR  473

Query  1229  GVLDRLN  1249
              +L+ L+
Sbjct  474   AILESLH  480



>ref|XP_004237643.2| PREDICTED: U-box domain-containing protein 9-like [Solanum lycopersicum]
Length=443

 Score =   392 bits (1008),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 204/421 (48%), Positives = 295/421 (70%), Gaps = 14/421 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             ELQR  K +V +D       +     L AL+ L   +   + P ++ CP+S +LMKDPVV
Sbjct  25    ELQRKAKCIVEDDDYTIHDTEEVMDCLSALKDL---KLRPAPPPQYLCPISHQLMKDPVV  81

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             ++SGQTYDRPFI+KWLN GNR CP+T+++LS+  L PN L++ +IS WCK +G+  PD  
Sbjct  82    LASGQTYDRPFIEKWLNKGNRTCPETKELLSNLDLIPNLLMKELISLWCKKHGLELPD--  139

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRS--AARELRLLTKRMPSFRALFGESMG  535
                  + G++T+ADR  F  LL  +SS+  +     AA ++R+LTK+ PS RA F E   
Sbjct  140   ----KDQGIITEADRDRFNSLLHILSSNDDIPEKIKAAEQVRMLTKQFPSLRAFFEED-S  194

Query  536   AAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGA  709
              A+ KLL P     V+ HP LQE +ITT+ N+SIHD+NKKLVA  P VI +LI+SL  G 
Sbjct  195   IAVTKLLDPLMSENVNDHPKLQEHLITTVTNISIHDANKKLVATNPVVIPLLIESLTFGT  254

Query  710   IETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHE  889
             IETRSN+AAA+ TLS+L+SNK +I K+GAL+PL+ LL+EG  LAMKD A+AI+ L ++ E
Sbjct  255   IETRSNSAAALCTLSSLESNKCIIMKAGALEPLVKLLDEGPLLAMKDAAAAIYSLILVKE  314

Query  890   NKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDT  1069
             N+A A+ +G V+V+++KI +R+ +D++L +LA+LSS  +AIE+M +L AV  LLS+I++ 
Sbjct  315   NRAVAVFEGVVKVIMKKITDRILIDKMLVLLALLSSYDKAIEQMIKLEAVSCLLSIIKED  374

Query  1070  SCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
                 +KE+CI IL+ +C  DRT+LKE+  +ES +G I+ LA NGT+RAKRKA  +++R++
Sbjct  375   RSDESKEHCITILHTLCYNDRTRLKEMWRDESVNGAIANLALNGTTRAKRKAKEIVERID  434

Query  1250  R  1252
             +
Sbjct  435   K  435



>ref|XP_007030262.1| U-box domain-containing protein 9 [Theobroma cacao]
 gb|EOY10764.1| U-box domain-containing protein 9 [Theobroma cacao]
Length=518

 Score =   394 bits (1013),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 220/425 (52%), Positives = 297/425 (70%), Gaps = 10/425 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAID--RAQQALCALRGLHP---EQNNNSFPAEFRCPLSGELM  166
             ELQR VK ++ ED +  + I+  R    L  L+   P     ++  FP +F+CPLSGE+M
Sbjct  88    ELQRVVKTILEEDDIGLKTIEATRILSNLAELKLKKPVGIRLDDTIFPEKFKCPLSGEIM  147

Query  167   KDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIW  346
              DPVV+SSGQTYDRP IQKWLN GN  CP ++QVLSHTIL PN L+R +I +W K  GI 
Sbjct  148   GDPVVLSSGQTYDRPNIQKWLNEGNLTCPLSKQVLSHTILIPNCLVRELILHWSKERGIA  207

Query  347   FPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGE  526
              P    Q ++ D +  + DR     LLEKMSSS   Q+ AA+ELR LTK  PS+RA+F E
Sbjct  208   LPKS-YQDVDGD-MNAEVDRIYLNSLLEKMSSSLSDQKEAAKELRRLTKTAPSYRAVFCE  265

Query  527   SMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLR  700
                 A+ +LLSP S  +V+  P LQED+ITT+LNLSIH +NKKL+AE P VI +LI+S++
Sbjct  266   -FTDAISRLLSPLSQSKVESDPGLQEDLITTVLNLSIHGNNKKLIAENPVVIPLLIESMK  324

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
              G IETR NAAAA+F+LSALDSNK +IG SGAL PL++LL EGH LA+ D ASAIF LC 
Sbjct  325   FGTIETRRNAAAALFSLSALDSNKFIIGNSGALVPLLELLREGHPLALMDAASAIFNLCF  384

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             + ENKA+ I  G V+V+++KI + + VDELL ILA+LS++H A++E+G+   +  L  +I
Sbjct  385   VSENKAKFIEIGIVKVMLQKIKDGIFVDELLGILALLSTHHDAVDELGDFDTLRWLFQII  444

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             RD+   R +ENC+ ILY +CS D   L  I+ EE    T+++LA  GT+RA+RKASG+++
Sbjct  445   RDSHSERTRENCVSILYNVCSKDLNMLMVIRAEEIKKCTLAELADTGTTRARRKASGIIE  504

Query  1241  RLNRG  1255
             ++++ 
Sbjct  505   KIHKA  509



>ref|XP_010907242.1| PREDICTED: U-box domain-containing protein 9-like [Elaeis guineensis]
Length=468

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 297/445 (67%), Gaps = 34/445 (8%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS-------------------  124
             EL+R V+A+  +D    +  D A +AL ALR +    N NS                   
Sbjct  21    ELRRLVRAIAEDDDTQIKTFDEAARALAALRDVKLGGNGNSKGKRLPSPLSKETKKDDKI  80

Query  125   ----FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTP  292
                  P  F CP+S ELM+DPV+++SGQTYDRPFIQ+WLNSGNR CPQTQQ+L +  L P
Sbjct  81    GSPTIPQHFLCPISSELMRDPVILASGQTYDRPFIQEWLNSGNRTCPQTQQILPNITLIP  140

Query  293   NHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSA  466
             NH +R MIS WC  +GI  P    Q   ++G++T  +R+    LL+K+SSSS +  ++ A
Sbjct  141   NHAVRRMISEWCGEHGIPLPALESQ---DEGLITKDERNALNELLDKISSSSSIPERKQA  197

Query  467   ARELRLLTKRMPSFRALFGESMGAAMPKLL---SPFSRVDVHPDLQEDIITTILNLSIHD  637
              +ELRLLTKR  SFRAL GE   A    LL    P    D+  +LQED +TTILNLSIHD
Sbjct  198   VKELRLLTKRNRSFRALLGEKPDALSLLLLLLSEPGLNDDL--ELQEDTVTTILNLSIHD  255

Query  638   SNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDL  817
             SNKKLV   P  I +LID+L++G +ETR NAAAA+FTLSALDSNK  IG+ GA+KPL++L
Sbjct  256   SNKKLVGADPGAIPLLIDALKNGTMETRGNAAAALFTLSALDSNKLKIGELGAIKPLLEL  315

Query  818   LEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSS  997
             LE+G   A  D ASAIF +C   EN+ +A++DGAV V++E I ++  VD  LAIL +LS 
Sbjct  316   LEQGGEAAKLDAASAIFSICTAPENRMKAVKDGAVGVVLEVIKDQSLVDGPLAILTLLSG  375

Query  998   NHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGT  1177
             +  A+E++ E G +P LL ++R+++C RNKEN +  ++A+C  DR  L+E+  EE+ HGT
Sbjct  376   DPDAMEQIAENG-MPCLLGIMRESTCDRNKENAVAAVFAVCLHDRWMLREVGKEENLHGT  434

Query  1178  ISQLAQNGTSRAKRKASGVLDRLNR  1252
             IS LAQNGT+RA+RKA+G+L+RL +
Sbjct  435   ISALAQNGTTRARRKATGILERLKK  459



>ref|XP_007143945.1| hypothetical protein PHAVU_007G115800g [Phaseolus vulgaris]
 gb|ESW15939.1| hypothetical protein PHAVU_007G115800g [Phaseolus vulgaris]
Length=457

 Score =   390 bits (1001),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 213/420 (51%), Positives = 294/420 (70%), Gaps = 12/420 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS------FPAEFRCPLSGEL  163
             +L+  V+++V  D     A D+A  AL AL+ L     +++       P  FRCPLS  L
Sbjct  15    KLRELVESIVDRDDYTVHAADKAIHALSALKDLKSTTFHSTNMEHTPVPLHFRCPLSDHL  74

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M DPV++++GQT+DRPFIQKWLN  N +CPQ Q+VLS  ILTPN L++GMIS WCK NG+
Sbjct  75    MTDPVILTTGQTFDRPFIQKWLNEVNGVCPQAQEVLSLCILTPNFLLQGMISEWCKENGV  134

Query  344   WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFG  523
               P P     +E   +T+A +H    LL K+S S   Q+ AARELR L KRM + R LFG
Sbjct  135   DLPKPIFDIHDEQ--LTEAHKHRLRSLLFKLSLSLSEQKEAARELRQLAKRMSAIRTLFG  192

Query  524   ESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSL  697
              S    +  L+ P S     + PDL +D+I T+LN+SI+D+NK+L+AE  +VIS LIDSL
Sbjct  193   NSQMVNL--LMRPVSIGTASMDPDLHDDLIATLLNISINDTNKRLLAENEKVISFLIDSL  250

Query  698   RSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLC  877
             +SG ++TRSNAAAA+F++S+LDSNK +IGKSGA+K L+DLLEEG  LAMKD ASA+F LC
Sbjct  251   KSGTVQTRSNAAAAVFSMSSLDSNKHIIGKSGAIKYLVDLLEEGDPLAMKDAASALFKLC  310

Query  878   VLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSL  1057
                EN A+ +R+GAV++++ KI++ V VDELL++LA+L+++ +A+E +   G V  LL +
Sbjct  311   FARENIAKTVREGAVQIILGKIVDHVLVDELLSLLALLATHSKAVEALVNHGGVRFLLDI  370

Query  1058  IRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVL  1237
             +R+ +  R KEN  VIL+ IC  DR K  EI++EE ++GT+S+L QNG+SRAKRKAS +L
Sbjct  371   LRENTVERIKENSAVILHLICYHDREKRAEIREEEMANGTLSRLVQNGSSRAKRKASSIL  430



>ref|XP_004237642.1| PREDICTED: U-box domain-containing protein 9-like [Solanum lycopersicum]
Length=431

 Score =   383 bits (984),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 296/429 (69%), Gaps = 19/429 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             ELQR V  +V       E ID A   L AL  L   +   + P E+ CP+S +LMKDPVV
Sbjct  18    ELQRRVNCIVENADYTIEDIDEAIHCLSALEDL---KLRAAPPPEYLCPISHQLMKDPVV  74

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             ++SGQTYDRP+I+ WLN GNR CP+T+++L ++ L PN ++R +IS WCK +GI      
Sbjct  75    LASGQTYDRPYIENWLNKGNRTCPETKELLPNSHLIPNLVMRKLISLWCKDHGI------  128

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRS--AARELRLLTKRMPSFRALFGESMG  535
                  E GV+ ++DRH+F  LL+ +SS+  +     AA+ +R+LTK  P  RA F     
Sbjct  129   -----EHGVIPESDRHHFNSLLQILSSNHDLPEKIKAAKLVRILTKSFPPLRAFFQWD-T  182

Query  536   AAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGA  709
              A+ KLL P     V+ HP LQE++ITTI+N+S+HD NKK++A  P VI +L+ SL+ G 
Sbjct  183   VALTKLLHPLMSGNVNDHPKLQEELITTIMNISLHDPNKKIIATNPLVIPLLVQSLKFGT  242

Query  710   IETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHE  889
             +ETRSN+AAA+ TLS+LDSNK++I K+GAL+PL+ LL+EG  LAMKD A+AI  L V+ E
Sbjct  243   LETRSNSAAALCTLSSLDSNKSIITKAGALEPLVKLLDEGPLLAMKDAAAAIVNLAVVKE  302

Query  890   NKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDT  1069
             N++ A+ +GAV+V+++KI +R+ VDELL +L+MLS+  + IE+M +L AV  LLS+I++ 
Sbjct  303   NRSIAVFEGAVKVIMKKITDRILVDELLVLLSMLSTYDKPIEQMVKLDAVSCLLSIIKED  362

Query  1070  SCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
             +  ++KE+CI IL+ +C  DRT+L+EI  +ES +G I+ LA NGT+RAKRKA  +++R++
Sbjct  363   TSDKSKEHCIAILHTLCYNDRTRLQEIWRDESVNGIIANLALNGTTRAKRKAKEIVERID  422

Query  1250  RGVGFIHTA  1276
             +      T+
Sbjct  423   KYFSAAQTS  431



>ref|NP_850531.1| ARM domain-containing protein [Arabidopsis thaliana]
 ref|NP_001030656.1| ARM domain-containing protein [Arabidopsis thaliana]
 gb|AEE74533.1| ARM domain-containing protein [Arabidopsis thaliana]
 gb|AEE74534.1| ARM domain-containing protein [Arabidopsis thaliana]
Length=325

 Score =   375 bits (962),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 256/331 (77%), Gaps = 15/331 (5%)
 Frame = +2

Query  311   MISNWCKVNGI-----WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAR  472
             MIS WCK NG+     + P+     +NED  VT +DR  F  LL K+SSS+   Q+SAA+
Sbjct  1     MISKWCKKNGLETKSQYHPN----LVNEDETVTRSDREIFNSLLCKVSSSNLQDQKSAAK  56

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SN  643
             ELRLLT++   FRALFGES    + +L++P      +PD  LQED++TT+LN+SIHD SN
Sbjct  57    ELRLLTRKGTEFRALFGESPDE-ITRLVNPLLH-GSNPDEKLQEDVVTTLLNISIHDDSN  114

Query  644   KKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLE  823
             KKLV E P VI +LID+LR G + TRSNAAAAIFTLSALDSNK LIGKSG LKPLIDLLE
Sbjct  115   KKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLE  174

Query  824   EGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNH  1003
             EG+ LA+KDVA+AIF LC+ HEN++RA+RDGAVRVL +KI N ++VDELLAILAML ++ 
Sbjct  175   EGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHW  234

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
             +A+EE+GELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI+
Sbjct  235   KAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTIT  294

Query  1184  QLAQNGTSRAKRKASGVLDRLNRGVGFIHTA  1276
             +L++ GTSRA+RKA+G+LDRL + +   HTA
Sbjct  295   KLSREGTSRAQRKANGILDRLRKAMNLTHTA  325



>ref|XP_010908320.1| PREDICTED: U-box domain-containing protein 9-like, partial [Elaeis 
guineensis]
Length=380

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 263/356 (74%), Gaps = 7/356 (2%)
 Frame = +2

Query  194   QTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCL  373
             QTYDR FIQ+WLNSGNRICPQT+QVL +TILTPNHL+R MIS WC  + I  P    Q  
Sbjct  20    QTYDRAFIQEWLNSGNRICPQTRQVLPNTILTPNHLVRSMISEWCIEHDIPLPALESQ--  77

Query  374   NEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAARELRLLTKRMPSFRALFGESMGAAMPK  550
              ++G++T  +R     LLEK+SSSS   Q+ A +ELRLLTK   SFRAL GE     +P 
Sbjct  78    -DEGLITRKERSALHELLEKISSSSIHGQKQAMKELRLLTKNNRSFRALIGEQPDI-IPL  135

Query  551   LLSPFSRVDVHPD--LQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRS  724
             LLS  S   ++ D  +QED +TTILNLSIH+SNK++V + P  I  LID+L++G +ETRS
Sbjct  136   LLSVLSVSGLNDDPVVQEDTVTTILNLSIHESNKRIVGDDPEAIPFLIDALKNGTMETRS  195

Query  725   NAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARA  904
             NAAAA+FTLSALDSNK  IG+ GA++PL++LLE+G + A KD ASAIF +C+ HEN+A+A
Sbjct  196   NAAAALFTLSALDSNKLKIGELGAIRPLLELLEQGSTTAKKDAASAIFNICMPHENRAKA  255

Query  905   IRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARN  1084
             +++GAV V+++ I +    D  LAILA+LS +  A+EE+G+ G VP LL +IR+++C RN
Sbjct  256   VKEGAVGVVLKAIRDPSLADGSLAILALLSGDQDALEEIGKSGGVPCLLGIIRESTCERN  315

Query  1085  KENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
             KEN +V+L+A+C  DRT  +E++++E  +G+IS LAQ GT RA+RKA G+LD L R
Sbjct  316   KENAVVVLFAVCMYDRTNRREVREDEKLNGSISALAQTGTRRARRKADGILDMLKR  371



>gb|EEC77056.1| hypothetical protein OsI_15442 [Oryza sativa Indica Group]
Length=459

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 266/380 (70%), Gaps = 10/380 (3%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             PA F CP+S  +M+DPVV+ SGQTYDR  IQ+W ++GN+ICPQTQQVLSHTIL PNHL+R
Sbjct  76    PALFLCPISSGIMRDPVVIESGQTYDRRSIQEWFSAGNQICPQTQQVLSHTILIPNHLVR  135

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKM--SSSSCVQRSAARELR  481
              MIS WC  NG+  P+   Q   E+  VT+++   F  +  K+  SSSS  ++ A ++LR
Sbjct  136   TMISQWCTENGLTLPEIENQ---EEDHVTNSEEKTFDEIFVKITSSSSSGGRKQAIKDLR  192

Query  482   LLTKRMPSFRALFGE---SMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             L+TKR   FRA+ G+   S+   +    +P  + D  P + ED++T ILN SIHDSNKK+
Sbjct  193   LVTKRNSEFRAVLGQRPDSIAQMIMARSTPGLQND--PQVLEDMVTIILNFSIHDSNKKI  250

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             + +    I  LI +L+SG + +RSN+AAAIFTLSALDSNK  IGK GA+ PLIDLLE G 
Sbjct  251   IGDDSEAIQFLIWALKSGDMGSRSNSAAAIFTLSALDSNKEKIGKLGAMDPLIDLLEHGS  310

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
              +A KD ASAIF LC+LHEN++ A R G V V +  I ++  V+E LAILA+LS N   +
Sbjct  311   IIAKKDAASAIFSLCLLHENRSIAARSGIVDVAMRAIDDQSLVEESLAILALLSRNQEMV  370

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
             E + E     S+L  IR++ C R+KEN +V+L+AIC+ +RTKLKE++ +ES +G+++ LA
Sbjct  371   EIITEFNGTASMLRSIRESECKRSKENAMVVLFAICTYNRTKLKEVEADESINGSLTFLA  430

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             Q GT RA+RKASG+L+++ R
Sbjct  431   QTGTQRARRKASGILEKMKR  450



>ref|XP_010418119.1| PREDICTED: U-box domain-containing protein 9-like [Camelina sativa]
Length=395

 Score =   370 bits (950),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 209/362 (58%), Positives = 258/362 (71%), Gaps = 31/362 (9%)
 Frame = +2

Query  2     ELQRAVKAVV-----SEDGVNAEAIDRAQQALCALRGLHP-----------EQNNNSFPA  133
             EL+R ++ ++      +D    +AID+ Q+AL ALR               E   +S P 
Sbjct  19    ELKREMRKLLIKIEEEDDDSGVQAIDQLQEALSALREATMRRKKSSSLEMLETTVSSCPD  78

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EFRCPLS ELMKDPVV++SGQTYDR FIQKWL+SGNR CP+TQQVL HT LTPN LIR M
Sbjct  79    EFRCPLSNELMKDPVVLASGQTYDRLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIRDM  138

Query  314   ISNWCKVNGI-----WFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARE  475
             IS WCK  G+     + P+     +NE+  VT +DR  F  LL K+SSS    Q+SA +E
Sbjct  139   ISKWCKKIGLDTKNQYHPN----LVNEEEAVTRSDREIFNSLLCKVSSSILQDQKSAVKE  194

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHD-SNK  646
             LRLLT++   FRALFGES    + +LL+P      +PD  LQED++TT+LN++IHD SNK
Sbjct  195   LRLLTRKGTEFRALFGESPDE-ITRLLNPLLH-GSNPDENLQEDVVTTLLNIAIHDDSNK  252

Query  647   KLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEE  826
             KLV E P VI +LID+LR G + TRSNAAAA+FTLSALDSNK LIGKSG LKPLIDLLEE
Sbjct  253   KLVCENPNVIPLLIDALRRGTVATRSNAAAAVFTLSALDSNKVLIGKSGILKPLIDLLEE  312

Query  827   GHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHR  1006
             G+ LA+KDVA+AIF LC+ HEN++RA+RDGAVRVL +KI N ++VDELLAILAML +N  
Sbjct  313   GNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLXTNTN  372

Query  1007  AI  1012
              I
Sbjct  373   EI  374



>dbj|BAK01875.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   372 bits (954),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 199/428 (46%), Positives = 278/428 (65%), Gaps = 21/428 (5%)
 Frame = +2

Query  23    AVVSEDGVNAEAIDRAQQALCALRGLH--------------PEQNNNSFPAEFRCPLSGE  160
             A ++  G  AEA D A  AL  LR  H                +   S PA+F CP+S +
Sbjct  23    ATITAGGAGAEAFDEAATALSELREAHVGGSRKGARGEETRSAKEAESVPAQFLCPISSK  82

Query  161   LMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNG  340
             +M+DPVVV SGQTYDR FI  W ++GN++CPQTQQVL +T L PN LIR +I+ WC  NG
Sbjct  83    IMRDPVVVESGQTYDRRFIADWFSAGNQMCPQTQQVLLNTTLIPNLLIRSLIAEWCTENG  142

Query  341   IWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSS--CVQRSAARELRLLTKRMPSFRA  514
               F   P++   ED +  ++++  F  +  K++SSS    ++ A + LRLLTKR   FRA
Sbjct  143   --FALSPIENQEEDPIC-NSEQRTFDEIFNKITSSSNSTERKQAIKGLRLLTKRSSEFRA  199

Query  515   LFGESMGAAMPKLLSPFSRVDVHPDLQ--EDIITTILNLSIHDSNKKLVAETPRVISVLI  688
             +  E   +      + FS   +  D Q  ED++T ILN S+HDSNKK++ + P  I  LI
Sbjct  200   VLEERPDSISQMTFARFSNPGLQNDPQVVEDMVTIILNFSLHDSNKKIIGDDPEAIPFLI  259

Query  689   DSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIF  868
              +L+SG + +RSN+AAAIFTLSALDSNK  IG+ GA++PLIDLLE G  +A KD ASAIF
Sbjct  260   WALKSGDMGSRSNSAAAIFTLSALDSNKEKIGELGAIEPLIDLLEHGSIIAKKDAASAIF  319

Query  869   VLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSL  1048
              LC+LHEN++ A R G V V +  I ++  V+E LAILA+LSSN+  +E M E G    +
Sbjct  320   NLCMLHENRSIATRSGIVDVAIRAIGDQSLVEEFLAILALLSSNYDMVELMIEFGGASCM  379

Query  1049  LSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKAS  1228
             L  +R++ C R+KEN  VIL++IC  +RTKLKEI+ +E+++G+++ LAQNGT RA+RKA+
Sbjct  380   LQAMRESECKRSKENAAVILFSICMYNRTKLKEIEADENANGSLASLAQNGTPRARRKAT  439

Query  1229  GVLDRLNR  1252
              +L+ + +
Sbjct  440   AILEMMKK  447



>ref|XP_006340482.1| PREDICTED: U-box domain-containing protein 9-like [Solanum tuberosum]
Length=396

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/387 (50%), Positives = 280/387 (72%), Gaps = 11/387 (3%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P E+ CPLS +LMKDPVV++SG+TYDRPFI++W   GNR CP+T++VLS+  L PN L+R
Sbjct  17    PPEYLCPLSHQLMKDPVVLASGRTYDRPFIERWFKIGNRTCPETKEVLSNLDLIPNLLMR  76

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRS--AARELR  481
               IS WCK +GI  PD       + G++T+ADR +F  LL+ +SS+  V     AA+++R
Sbjct  77    EHISLWCKEHGIELPD------KDQGIITEADRDHFNSLLQILSSNDDVPEKIKAAKQVR  130

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +LTK+ P  RA F E    A+ KLL P     V+ HP LQED+ITT++N+S+HD+NKKLV
Sbjct  131   MLTKQFPFLRAFFEED-SIAVTKLLDPLMSGNVNDHPKLQEDLITTVMNISLHDANKKLV  189

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
             A  P VI +L++SL SG +ETRSN+AAA+  LS L+SNK +I K+GAL+PL+ LL+EG  
Sbjct  190   ATNPVVIPLLVESLTSGTLETRSNSAAALCALSLLESNKCIIMKAGALEPLVKLLDEGPL  249

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
             LAMKD A+AI+ L ++ EN+A A+ +GA++V+++KI  R+ +D++  +LAMLSS  +AIE
Sbjct  250   LAMKDAAAAIYSLSLVKENRAIAVFEGAIKVIMKKITGRILIDKMFVLLAMLSSYDKAIE  309

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
             +M +L AV  LLS+I++ +   +KE+CI IL+ +C  DRT+L+E+  +ES  GTI+ LA 
Sbjct  310   QMIKLDAVSCLLSIIKEDTSDNSKEHCIAILHTLCYNDRTRLQEMWRDESVKGTIANLAL  369

Query  1196  NGTSRAKRKASGVLDRLNRGVGFIHTA  1276
             NGT+RAKRKA  +++R+++      T+
Sbjct  370   NGTTRAKRKAKEIVERIDKYFSGAQTS  396



>ref|NP_001052522.2| Os04g0348400 [Oryza sativa Japonica Group]
 dbj|BAH01428.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF14436.2| Os04g0348400 [Oryza sativa Japonica Group]
Length=459

 Score =   370 bits (951),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/380 (51%), Positives = 265/380 (70%), Gaps = 10/380 (3%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             PA F CP+S  +M+DPVV+ SGQTYDR  IQ+W ++GN+ICPQTQQVLSHTI+ PNHL+R
Sbjct  76    PALFLCPISSGIMRDPVVIESGQTYDRRSIQEWFSAGNQICPQTQQVLSHTIVIPNHLVR  135

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSS--SCVQRSAARELR  481
              MIS WC  NG+  P+   Q   E   VT+++   F  +  K++SS  S  ++ A ++LR
Sbjct  136   TMISQWCTENGLTLPEIENQ---EQDHVTNSEEKTFDEIFVKITSSANSGGRKQAIKDLR  192

Query  482   LLTKRMPSFRALFGESMGAAMPKLL---SPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             LLTKR   FRA+ G+   +    +L   +P  + D  P + ED++T ILN SIHDSNKK+
Sbjct  193   LLTKRNSEFRAVLGQRPDSIAQMILARSTPGLQND--PQVLEDMVTIILNFSIHDSNKKI  250

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             + +    I  LI +L+SG + +RSN+AAAIFTLSALDSNK  IGK GA+ PLIDLLE G 
Sbjct  251   IGDDSEAIQFLIWALKSGDMGSRSNSAAAIFTLSALDSNKEKIGKLGAMDPLIDLLEHGS  310

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
              +A KD ASAIF LC+LHEN++ A R G V V +  I ++  V+E LAILA+LS N   +
Sbjct  311   IIAKKDAASAIFNLCLLHENRSIAARSGIVDVAMRAIDDQSLVEESLAILALLSRNQEMV  370

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
             E + E     S+L  IR++ C R+KEN +V+L+AIC+ +RTKLKE++ +ES +G+++ LA
Sbjct  371   EIITEFNGTASMLRSIRESECKRSKENAMVVLFAICTYNRTKLKEVEADESINGSLTFLA  430

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             Q GT RA+RKASG+L+++ R
Sbjct  431   QTGTQRARRKASGILEKMKR  450



>ref|XP_010558729.1| PREDICTED: putative U-box domain-containing protein 46 [Tarenaya 
hassleriana]
 ref|XP_010558731.1| PREDICTED: putative U-box domain-containing protein 46 [Tarenaya 
hassleriana]
Length=467

 Score =   368 bits (944),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 263/385 (68%), Gaps = 10/385 (3%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P EF CPLS ++M DPV+V+SGQTY+R +IQKWL   +R CP+T++VLSHT+LTPNH IR
Sbjct  84    PKEFMCPLSMKIMGDPVIVASGQTYERLYIQKWLAECDRTCPKTKEVLSHTVLTPNHSIR  143

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRL  484
              +I  WC+ N +  P+P     + DG V + DR +   LL+K+SSSS   Q+ AA+ELR 
Sbjct  144   DLILKWCQHNDVELPNP---VSDTDGAVHELDRDHLDTLLQKISSSSVSDQKEAAKELRR  200

Query  485   LTKRMPSFRALF----GESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             LTKR PSFR        +S+   +  L S  S V+  P+LQED+ITT+ NLSI + NK L
Sbjct  201   LTKRAPSFRLFLLRERPDSIAQLLSPLSSSVSAVNSKPELQEDLITTLFNLSIPEKNKTL  260

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             V E P  I +L  SL  G +ETR NAAA  F+LS  DSNK +IG S ALKPL+DL+EEG 
Sbjct  261   VTENPFAIPLLAKSLAHGTMETRRNAAATFFSLSVTDSNKLIIGNSDALKPLMDLIEEGD  320

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
             SLAMKD  +A+F LC + ENK +A++  AV VLVEK+ + V VD  L+ILA+LS++ +A+
Sbjct  321   SLAMKDAGAAVFNLCTVLENKEKAVQARAVPVLVEKVKDGVFVDASLSILALLSTHEQAV  380

Query  1013  EEMGELGAVPSLLSLIRDTSCA--RNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
             EEM  LG +  L S+IR  SC+  R  EN +VI++ IC  DR++LK +++EE  + T++ 
Sbjct  381   EEMVGLGFMSDLFSIIRKPSCSCPRTSENAVVIVFNICDQDRSRLKTVREEERQNRTMTY  440

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVG  1261
             LA  GT RAKRKA+ +L +L R  G
Sbjct  441   LAMQGTDRAKRKANSLLQKLKRISG  465



>ref|XP_007030252.1| U-box domain-containing protein 9 [Theobroma cacao]
 gb|EOY10754.1| U-box domain-containing protein 9 [Theobroma cacao]
Length=456

 Score =   367 bits (941),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 211/426 (50%), Positives = 298/426 (70%), Gaps = 14/426 (3%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQ------NNNSFPAEFRCPLSGEL  163
             EL R V  ++ E+ +  + I+ A + LC L  L  ++      ++   P +F+CPLSGE 
Sbjct  26    ELGRVVTTILEEEDIGLKTIE-ATRILCNLAELKLKKPVGLGVDDAVMPEKFKCPLSGER  84

Query  164   MKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGI  343
             M DPV+++SGQT+DRP IQKWLN GN  CP ++QVLSHTILTPN+L+R +IS+WC  +GI
Sbjct  85    MGDPVILASGQTFDRPHIQKWLNEGNLTCPLSKQVLSHTILTPNYLVRELISDWCIRHGI  144

Query  344   WFPDPPVQCLNEDGVV-TDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALF  520
               P       + DG + T+ D+     LLE+MSS    Q+ AA+ELR LTK   S+RA+F
Sbjct  145   ALPK---SYQDVDGNMNTEVDQIYLNSLLERMSSCISDQKEAAKELRRLTKTTRSYRAVF  201

Query  521   GESMGAAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDS  694
              E    A+ +LLSP   S+V++ P +QED+ITT+LNLSIH +NKKL+AE P VI VLI+S
Sbjct  202   CE-FTDAISRLLSPLLQSKVELDPSVQEDLITTVLNLSIHGNNKKLIAENPIVIPVLIES  260

Query  695   LRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVL  874
             ++ G IETR NAAAA+F+LSALDSNK +IG SGAL PL++LL E H LAM D ASAIF L
Sbjct  261   MKFGTIETRRNAAAALFSLSALDSNKFIIGNSGALVPLLELLHERHPLAMIDAASAIFSL  320

Query  875   CVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLS  1054
             C++ EN+A+ I  G V+V+++KI + + VDELL++LA+LS++   +EE+G+L  +  LL 
Sbjct  321   CIVSENRAKFIEIGIVKVMLQKIKDGIFVDELLSLLALLSTDQNVVEELGDLDTLRWLLQ  380

Query  1055  LIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGV  1234
             +IRD+S    KENC+ ILY +C  D T L  I+ EE    T++++   GT+RA+RKASG+
Sbjct  381   IIRDSSSKLAKENCVAILYNVCLKDLTMLMVIRAEEIKKHTLAEIVDTGTARARRKASGI  440

Query  1235  LDRLNR  1252
             + ++++
Sbjct  441   IKKIHK  446



>ref|XP_006653286.1| PREDICTED: U-box domain-containing protein 9-like, partial [Oryza 
brachyantha]
Length=400

 Score =   363 bits (933),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/391 (49%), Positives = 266/391 (68%), Gaps = 20/391 (5%)
 Frame = +2

Query  137   FRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMI  316
             F CP+S E+M+DPVV+ SGQTYDR FI++W ++GN+ICPQTQQVLSHTIL PN L+R MI
Sbjct  2     FLCPISSEIMRDPVVIESGQTYDRQFIEEWFSAGNQICPQTQQVLSHTILIPNQLVRTMI  61

Query  317   SNWCKVNGIWFPDPPVQ------CLNEDGVV---------TDADRHNFLVLLEKMSS--S  445
             S WC  NGI  P    Q      C NED V+          ++++  F  +  K++S  S
Sbjct  62    SQWCMENGITLPQIESQNGDRVICQNEDRVICQNGDRDICQNSEQKKFDEIFVKITSATS  121

Query  446   SCVQRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQ--EDIITTIL  619
             S  ++ A ++LRLLTKR   FR +  E    ++ +++   S   +  D Q  ED++T IL
Sbjct  122   SGERKQAIKDLRLLTKRNSEFRVVL-EQRPDSIAQMILARSTPGLQNDAQVLEDMVTIIL  180

Query  620   NLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGAL  799
             N SIHDSNKK++ +    I  LI +L+SG + +RSN+AAAIFTLSA+DSNK  IG+ GA+
Sbjct  181   NFSIHDSNKKIIGDDSEAIQFLIWALKSGDMGSRSNSAAAIFTLSAIDSNKEKIGELGAM  240

Query  800   KPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAI  979
             +PLIDLLE G+ +A KD ASAIF LC+L EN++ A R G + V +  I +   V+E LAI
Sbjct  241   EPLIDLLEHGNIIAKKDAASAIFNLCLLQENRSIATRSGIIDVAMRAIEDHSLVNESLAI  300

Query  980   LAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDE  1159
             LA+LS NH  +E + E     S+L  IR++ C R+KEN +V+L+AIC+ +RTKLKE++ +
Sbjct  301   LALLSRNHEMVEIITEFNGTASMLRSIRESDCKRSKENAMVVLFAICTYNRTKLKEVEAD  360

Query  1160  ESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
             ES +G+++ LAQ GT RA+RKASG+L+++ R
Sbjct  361   ESINGSLALLAQTGTQRARRKASGILEKMKR  391



>ref|XP_011084722.1| PREDICTED: uncharacterized protein LOC105166900 [Sesamum indicum]
Length=861

 Score =   371 bits (952),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 214/440 (49%), Positives = 294/440 (67%), Gaps = 32/440 (7%)
 Frame = +2

Query  2     ELQRAVKAVVSEDG---VNAEAIDRAQQALCALRGLHPEQNNNSF-------------PA  133
             ELQR V+A+V ED    + A A D A Q L AL+ L  +Q+ +               P 
Sbjct  16    ELQRVVEALVEEDDDCDLTA-AADNAIQTLGALKELKLKQSTDQEFVEIKNLVGFQEPPP  74

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EFRCP+SG LMKDPVV++SGQTY+  +I +WL  G++ CP+T Q L HT+L PNH I+ M
Sbjct  75    EFRCPISGLLMKDPVVLASGQTYEEQYITEWLKDGHQKCPKTDQPLPHTLLIPNHSIKKM  134

Query  314   ISNWCKVNGIWFP---DPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRL  484
             + NWCK++    P    PP    +E+   T   +H  + LL ++SSSS     AA+ELRL
Sbjct  135   VMNWCKLHNFDMPRTSHPPA---DEEYAATANSKH-LVQLLNRLSSSS--ASDAAKELRL  188

Query  485   LTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD--LQEDIITTILNLSIHDSNKK--L  652
             LT R PSFRALFGE  GA +PKL SP      + D  L +D++ T+LN+S H+SNK   L
Sbjct  189   LTSRSPSFRALFGEITGA-VPKLFSPLLLEKAYSDARLHDDLVATVLNVSAHESNKAKIL  247

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
              +  P V+S LIDSLRS  IETRS+AAA I  LSA D+NK LIG+SGA+KPL+DL+ EG 
Sbjct  248   ASRNPLVVSFLIDSLRSKNIETRSHAAAVISALSAFDTNKYLIGESGAIKPLVDLITEGQ  307

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAI  1012
              LA+ +   AI  LC + EN+ RAI +GAV  +++KI+ RV +DE+LAILA LSS+HRAI
Sbjct  308   PLALNEATCAILNLCTVTENRERAISEGAVIAVMDKIVGRVLIDEMLAILATLSSHHRAI  367

Query  1013  EEMGELGAVPSLLSLIRDTSCA-RNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
             EEM E G +  L  ++R+ + + +++E+C+ I+Y +C +DRTKL++I + E +  T+ ++
Sbjct  368   EEMDEHGMIFCLFEMLRENNISEQSEEHCVAIIYVMCFSDRTKLRKIHEVEDACETLHRV  427

Query  1190  AQNGTSRAKRKASGVLDRLN  1249
             A+ GTSRAKRKAS +L+RLN
Sbjct  428   ARTGTSRAKRKASSILERLN  447



>ref|XP_003579564.2| PREDICTED: U-box domain-containing protein 9-like [Brachypodium 
distachyon]
Length=503

 Score =   359 bits (921),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 261/379 (69%), Gaps = 7/379 (2%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P +F CP+S ++M DPVVV SGQTYDR FI++W ++GN+ CPQ+QQVL +  L PN LIR
Sbjct  117   PEQFLCPISSKIMGDPVVVESGQTYDRHFIEEWFSAGNQTCPQSQQVLLNKTLIPNLLIR  176

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSS--CVQRSAARELR  481
              MI+ WC  NG  F  PPV+  NED   +++++  F  +  K++SSS    Q+ A + LR
Sbjct  177   SMIAQWCTQNG--FSLPPVENQNEDHA-SNSEQRTFDDIFNKITSSSNSTEQKQAIKNLR  233

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQ--EDIITTILNLSIHDSNKKLV  655
             LLTKR   FRA+  E   +      S FS  ++  D Q  ED++T ILN S+HDSNKK++
Sbjct  234   LLTKRSSEFRAILEERPDSISEMTFSRFSTPELQNDPQVVEDMVTIILNFSLHDSNKKII  293

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              + P  I  LI +L+SG + +RSN+AAAIFTLSA+DSNK  IG+ GA+ PLIDLLE G  
Sbjct  294   GDDPEAIPFLIWALKSGDMGSRSNSAAAIFTLSAVDSNKVKIGELGAMGPLIDLLEHGSI  353

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
             +A KD ASAIF LC+LHEN++RA R G V V +  I ++   +E LAILA+LSSN+  +E
Sbjct  354   IAKKDAASAIFSLCLLHENRSRATRSGIVDVSMRAIRDQSLTEESLAILALLSSNYDMVE  413

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
              M E      +L  +R++ C R+KEN +V+L++IC  +R KLK++++ E+++G+++ LAQ
Sbjct  414   LMIEFDGATCMLQAVRESECKRSKENAVVVLFSICMYNRAKLKQVEEHENTNGSLAFLAQ  473

Query  1196  NGTSRAKRKASGVLDRLNR  1252
             NGT RA+RKA+ +L+ + +
Sbjct  474   NGTPRARRKAAAILEMMTK  492



>ref|XP_010550249.1| PREDICTED: putative U-box domain-containing protein 46 [Tarenaya 
hassleriana]
Length=470

 Score =   357 bits (916),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 190/389 (49%), Positives = 259/389 (67%), Gaps = 9/389 (2%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P EF CPLS ++M DPVVV++GQTY+R +IQKWLN  +R CP+T++VLSHTILTPNHL+R
Sbjct  85    PKEFICPLSMKIMSDPVVVATGQTYERLYIQKWLNECDRTCPKTKEVLSHTILTPNHLVR  144

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRL  484
              +IS WC   G   P P     + D    + DR     LL+K+SSSS   Q+ AA+ELR 
Sbjct  145   DLISKWCLDYGFDLPKP---ASDTDEAPRELDRDLLESLLQKISSSSVSDQKEAAKELRR  201

Query  485   LTKRMPSFRALFGESMGAAMPKLLSPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LTKR+PS R  F      ++ +LLS       ++ +P+LQED+ITT+ NLSI + NK L+
Sbjct  202   LTKRIPSSRLFFLRERPDSLSQLLSQLHSNDPINSNPELQEDLITTVFNLSIPEENKSLI  261

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              E P  I +L  SL  G +ETR NAAA   +LS  DSNK +IG S AL PLI L+EEG S
Sbjct  262   VENPIAIPMLARSLTHGTMETRRNAAATFSSLSTTDSNKLIIGSSEALIPLIILIEEGDS  321

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
             LAM D  +A+F LC + ENK +A++ GAV VL +KI + V VD  ++ILA+LSS+ +A+E
Sbjct  322   LAMNDAGAAVFNLCTVLENKKKAVQAGAVPVLTKKIKDGVFVDAWISILALLSSHRQAVE  381

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
             EM  LG +  L  ++R  SC   KEN + I+++IC  DR++LK +++EE+ + T++ +A 
Sbjct  382   EMVRLGFMSDLFGIMRKPSCPLMKENAVAIIFSICEKDRSQLKAVREEENRNDTLTNIAV  441

Query  1196  NGTSRAKRKASGVLDRLNRGVGFI--HTA  1276
              GT RAKRKA+ +L +L R  G    HTA
Sbjct  442   QGTDRAKRKANTLLQKLKRTAGSYDPHTA  470



>gb|EYU39768.1| hypothetical protein MIMGU_mgv1a023902mg [Erythranthe guttata]
Length=426

 Score =   352 bits (904),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 193/424 (46%), Positives = 283/424 (67%), Gaps = 22/424 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             ELQR V+A++ ED  + +A + A +   AL+  +P       P EF CP+SG LM+ PVV
Sbjct  10    ELQRVVEALMEEDDDDLDATENAIEICLALQK-NP-------PPEFNCPISGVLMRHPVV  61

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFP--D  355
             ++SGQTY+   I++WL  G++ CP T Q+L HT L PN  I+ MI NWC ++    P  D
Sbjct  62    LASGQTYEEQIIEEWLKDGHQTCPLTNQLLPHTALIPNLSIKKMIDNWCTLHRFEIPIDD  121

Query  356   PPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMG  535
                Q  +      +A+  + + LLEK+SS+S  +  AA+ELR LTK+  SFRALFGE+  
Sbjct  122   DETQDFS-----ANANAEHLIELLEKLSSTS-DRADAAKELRFLTKKFSSFRALFGETKD  175

Query  536   AAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVA---ETPRVISVLIDSLR  700
             A +P+L SP      +   DL+ D++  +LN+S H+SNKK +     +P  +S L++SLR
Sbjct  176   A-IPRLFSPILIRNTNSDSDLRNDLVAIVLNISTHESNKKRIVAGENSPLAVSFLVESLR  234

Query  701   SGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCV  880
                ++TRSNAAAAI +LS LDSNK LI KSGA++ LI+L+EEGH  A++D   AI  LC 
Sbjct  235   DENVKTRSNAAAAISSLSTLDSNKHLISKSGAIRALIELIEEGHPFALRDACFAILNLCT  294

Query  881   LHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
             + EN+   +R+GAV  +VEKI++ V VDE+L ILAMLSS+ RAIEE+ E G +  L  ++
Sbjct  295   VFENREIVVREGAVMPIVEKIIDCVLVDEMLEILAMLSSHERAIEEIEECGVIFCLFGVL  354

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
              +    ++ ENC+ I+Y +C +DR KL+EI + E+++  +S++A++GTSRAKRKA+G+L+
Sbjct  355   GENVSEKSTENCVSIIYNVCFSDRRKLREISEVENAYEILSRVAKSGTSRAKRKANGILE  414

Query  1241  RLNR  1252
             R+NR
Sbjct  415   RMNR  418



>ref|XP_006340514.1| PREDICTED: U-box domain-containing protein 9-like [Solanum tuberosum]
Length=411

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/421 (45%), Positives = 279/421 (66%), Gaps = 41/421 (10%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             ELQR V +++ +   + E  D A   L AL+ L   +   + P E+ CPLS +LMKDPVV
Sbjct  23    ELQRRVNSIIEDADYSIEDTDEAMHCLSALKEL---KVRPTPPLEYLCPLSHQLMKDPVV  79

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             ++SGQTYDR FI+KWLN G+R CP+T++VL H+ L PN L+R +IS WC  +GI  PD  
Sbjct  80    LASGQTYDRLFIEKWLNKGSRTCPETKEVLPHSDLIPNLLMRKLISLWCNDHGIELPDK-  138

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMG  535
                  E G++ ++DR++F  LL+ +SS+  V  +  AA+ + +LTKR P  RA F E   
Sbjct  139   ----EEQGIIPESDRYHFNSLLDTLSSNDDVLEKMKAAKLVCILTKRFPPLRAFFEED-S  193

Query  536   AAMPKLLSPF--SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGA  709
              A+ KLL P     V+ HP LQED+ITT++N+S+HD NKKL+A  P VI +L++SL+ G 
Sbjct  194   VAVTKLLEPLMSGNVNDHPKLQEDLITTVMNISLHDPNKKLIATNPIVIPLLVESLKFGT  253

Query  710   IETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHE  889
             +ETRSN+ AA+ TLS+L+SNK +I K+GAL+PL+ LL+EG  LAMKD A+AI  L V+ E
Sbjct  254   LETRSNSTAALCTLSSLESNKCIIMKAGALEPLVKLLDEGPLLAMKDAAAAIVSLGVVKE  313

Query  890   NKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDT  1069
             N++ A+ +GAV+V+++KI +R+ VDE +                            I++ 
Sbjct  314   NRSIAVFEGAVKVIMKKITDRIPVDEFI----------------------------IKED  345

Query  1070  SCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
             +  ++KE+CI IL+ +C  DRT+L+E+  +ES +GTI+ LA NGT+RAKRKA  ++++++
Sbjct  346   TSDKSKEHCIAILHTLCYNDRTRLQEMWRDESVNGTIANLALNGTTRAKRKAKEIVEQID  405

Query  1250  R  1252
             +
Sbjct  406   K  406



>ref|XP_004975335.1| PREDICTED: U-box domain-containing protein 9-like [Setaria italica]
Length=465

 Score =   348 bits (894),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 265/393 (67%), Gaps = 10/393 (3%)
 Frame = +2

Query  107   EQNNNSFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTIL  286
             E++    P +F CP+S  +M DPV+V+SGQTYDR  I++W ++GN++CPQT Q L  T L
Sbjct  75    EKDAVQVPTQFLCPISSRIMSDPVIVASGQTYDRRCIEEWFSAGNQLCPQTHQALLDTTL  134

Query  287   TPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSS--SCVQR  460
              PNHL+R MI  WC  N   F  PP +   E+   T++D+  F  + +K++SS  S   R
Sbjct  135   IPNHLVRSMILQWCTENR--FNLPPAEN-QEESNATNSDQKTFDEIFKKITSSPKSSEMR  191

Query  461   SAARELRLLTKRMPSFRALFGE---SMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSI  631
              A + LRL TK+   FRA+ GE   S+   +    +P  + D  P + ED++T ILN S+
Sbjct  192   QAIKYLRLATKQNSDFRAVLGERPDSISRMIFARSTPGLQND--PQVLEDMVTIILNFSL  249

Query  632   HDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLI  811
             HDSNKK++ + P  I  LI +L+SG + +R N+AAAIFTLSALDSNK  IG+ GA+ PL+
Sbjct  250   HDSNKKVIGDDPEAIPFLIWALKSGDMGSRGNSAAAIFTLSALDSNKEKIGELGAIGPLV  309

Query  812   DLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAML  991
             DLL+ G+ +A KD ASAIF LC+LHENK+RA ++G V V +  I +++ VD  LAILA+L
Sbjct  310   DLLDNGNIIAKKDAASAIFNLCLLHENKSRATKNGIVDVAMRAIDDQLLVDGSLAILALL  369

Query  992   SSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSH  1171
             SSNH  +E + E      +L  IR++ C+R+KEN +V+L+AIC  +R KLKE++ +E  +
Sbjct  370   SSNHEVVEMITEFDGTACMLRAIRESECSRSKENAVVVLFAICMFNRMKLKEVEVDEKIN  429

Query  1172  GTISQLAQNGTSRAKRKASGVLDRLNRGVGFIH  1270
             G+++ LAQ+GTSRA+RKA G+L+++ R +   H
Sbjct  430   GSLALLAQSGTSRARRKAVGILEKMKRNMHNRH  462



>gb|EEE60783.1| hypothetical protein OsJ_14363 [Oryza sativa Japonica Group]
Length=371

 Score =   340 bits (873),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 249/361 (69%), Gaps = 10/361 (3%)
 Frame = +2

Query  185   SSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPV  364
             S+  TYDR  IQ+W ++GN+ICPQTQQVLSHTI+ PNHL+R MIS WC  NG+  P+   
Sbjct  7     STNMTYDRRSIQEWFSAGNQICPQTQQVLSHTIVIPNHLVRTMISQWCTENGLTLPEIEN  66

Query  365   QCLNEDGVVTDADRHNFLVLLEKMSSS--SCVQRSAARELRLLTKRMPSFRALFGESMGA  538
             Q   E   VT+++   F  +  K++SS  S  ++ A ++LRLLTKR   FRA+ G+   +
Sbjct  67    Q---EQDHVTNSEEKTFDEIFVKITSSANSGGRKQAIKDLRLLTKRNSEFRAVLGQRPDS  123

Query  539   AMPKLL---SPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGA  709
                 +L   +P  + D  P + ED++T ILN SIHDSNKK++ +    I  LI +L+SG 
Sbjct  124   IAQMILARSTPGLQND--PQVLEDMVTIILNFSIHDSNKKIIGDDSEAIQFLIWALKSGD  181

Query  710   IETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHE  889
             + +RSN+AAAIFTLSALDSNK  IGK GA+ PLIDLLE G  +A KD ASAIF LC+LHE
Sbjct  182   MGSRSNSAAAIFTLSALDSNKEKIGKLGAMDPLIDLLEHGSIIAKKDAASAIFNLCLLHE  241

Query  890   NKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDT  1069
             N++ A R G V V +  I ++  V+E LAILA+LS N   +E + E     S+L  IR++
Sbjct  242   NRSIAARSGIVDVAMRAIDDQSLVEESLAILALLSRNQEMVEIITEFNGTASMLRSIRES  301

Query  1070  SCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
              C R+KEN +V+L+AIC+ +RTKLKE++ +ES +G+++ LAQ GT RA+RKASG+L+++ 
Sbjct  302   ECKRSKENAMVVLFAICTYNRTKLKEVEADESINGSLTFLAQTGTQRARRKASGILEKMK  361

Query  1250  R  1252
             R
Sbjct  362   R  362



>ref|XP_008441805.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis melo]
Length=444

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 185/441 (42%), Positives = 279/441 (63%), Gaps = 21/441 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR-GLHPEQNNNS-----------FPAEFRC  145
             +L++ +  ++ E+  ++ A D A Q L +L+  L P  ++              P +FRC
Sbjct  9     DLKQVLYRIIQEEDFDSSAADDAIQILTSLKFSLMPAPSSQESPGCSGSKTLIIPDKFRC  68

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             P+SG+LMKDPV++ +GQTYDR FI+KW + G+  CPQT++VL+   LTPN L+R MIS W
Sbjct  69    PISGDLMKDPVLLITGQTYDRFFIEKWFHEGHNTCPQTKEVLTDMTLTPNRLLRSMISQW  128

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
             C  N    P    +   E+ V    + H   +L   MSSS  V++ AA+ELR  T+    
Sbjct  129   CLDNRFELP----RLSYEEEVDNVTESHLDALLNRLMSSSLIVKKEAAKELRETTRCSHE  184

Query  506   FRALFGESMGAAMPKLLSPF---SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             FRALF +  G+ + +LL P     +VD+HPDLQED+ITTILN+S+ D NK+ V E P V+
Sbjct  185   FRALFAKLPGS-VERLLHPLISIGKVDLHPDLQEDLITTILNISVFDDNKEHVVENPLVL  243

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +LI+SL+ G+IE  +NA AAI++LS  ++NK  +GK G  K LI LL+  H    +D  
Sbjct  244   PLLIESLQHGSIELTANAVAAIYSLSFSEANKITMGKVGIFKHLISLLDYAHPGVTRDAG  303

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKIMNR-VHVDELLAILAMLSSNHRAIEEMGELG  1033
             SAI+ LC   EN+ +A+  G V  +   I    + VD+L++ILA+L ++ +AI+EM +  
Sbjct  304   SAIYNLCTTVENREKAVGSGVVAAIFRNIARSLLLVDKLISILALLCTDVKAIDEMCKFD  363

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
              VP +L  IR+T   R KENC  IL+AIC+ D+++L++I+++E+ + TI +L++NG SRA
Sbjct  364   VVPCMLRFIRETESQRIKENCASILFAICTTDQSQLRKIQEDENKNETILELSKNGNSRA  423

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
              RKA+G+L+R+ R     HT+
Sbjct  424   SRKATGILERMQRAASRTHTS  444



>gb|EMT06620.1| U-box domain-containing protein 9 [Aegilops tauschii]
Length=494

 Score =   339 bits (870),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 262/415 (63%), Gaps = 41/415 (10%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQ----------------------------------T  199
             S PA+F CP+S ++M+DPVVV SGQ                                  T
Sbjct  70    SVPAQFLCPISSKIMRDPVVVESGQQMSVLRISYRYGLKLSVIEHKCDHLITVLESSFLT  129

Query  200   YDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNE  379
             YDR +I +W ++GN++CPQTQQVL +T L PN LIR +I+ WC  NG  F   P++   E
Sbjct  130   YDRRYIAEWFSAGNQMCPQTQQVLLNTTLVPNLLIRSLIAEWCTENG--FALSPLENQEE  187

Query  380   DGVVTDADRHNFLVLLEKMSSSS--CVQRSAARELRLLTKRMPSFRALFGESMGAAMPKL  553
             D    ++++  F  +  K++SSS    ++ A + LRLLTKR   FRA+  E   +     
Sbjct  188   DHTC-NSEQRTFDEIFNKITSSSNSTERKQAIKGLRLLTKRSSEFRAVLEERPDSISQMT  246

Query  554   LSPFSRVDVHPDLQ--EDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSN  727
              + FS   +  D Q  ED++T ILN S+HDSNKK++ + P  I  LI +L+SG + +RSN
Sbjct  247   FARFSNPGLQNDPQVVEDMVTIILNFSLHDSNKKIIGDDPEAIPFLIWALKSGDMGSRSN  306

Query  728   AAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAI  907
             +AAAIFTLSALDSNK  IG+ GA++PLIDLLE G  +A KD ASAIF LC+LHEN++ A 
Sbjct  307   SAAAIFTLSALDSNKEKIGELGAIEPLIDLLEHGSIIAKKDAASAIFNLCMLHENRSIAT  366

Query  908   RDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNK  1087
             R G V V +  I ++  V+E LAILA+LSSN+  +E M E G    +L  +R++ C R+K
Sbjct  367   RGGIVDVAIRAIGDQSLVEEFLAILALLSSNYDMVELMIEFGGATCMLQAMRESECKRSK  426

Query  1088  ENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
             EN  V+L++IC  +R KLKEI+ +E+++G+++ LAQNGT RA+RKA+ +L+ + +
Sbjct  427   ENAAVVLFSICMYNRAKLKEIETDENTNGSLASLAQNGTPRARRKAAAILEMMKK  481



>ref|XP_010667713.1| PREDICTED: U-box domain-containing protein 9-like [Beta vulgaris 
subsp. vulgaris]
Length=450

 Score =   337 bits (865),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 201/389 (52%), Positives = 274/389 (70%), Gaps = 13/389 (3%)
 Frame = +2

Query  29    VSEDGVNAEAID----RAQQALCALRGLHPEQ---NNNSFPAEFRCPLSGELMKDPVVVS  187
             V+  G N EAI     +A QAL AL  L  +Q   ++  FP EF CP+S EL+KDPVV+S
Sbjct  46    VNSGGDNNEAILGKILKAFQALSALGVLLKKQKHVDDFVFPDEFCCPISMELIKDPVVLS  105

Query  188   SGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQ  367
             +G TYDRP+I+KWL  GNRICPQTQQVLS+  L PNHLIR +I  WC   G   P  PVQ
Sbjct  106   TGVTYDRPYIEKWLKDGNRICPQTQQVLSNFELFPNHLIRELIKQWCMSRGYEVP-SPVQ  164

Query  368   CLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAAMP  547
              +   G +TDADR +   LL+K+SSS   Q+ AA+E+R LTK++PS  + FGES+GA M 
Sbjct  165   DIKV-GSLTDADRKHISSLLQKLSSSLSDQKEAAKEIRKLTKQLPSSCSFFGESIGA-ML  222

Query  548   KLLSPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIET  718
             +LLSP +     + HPDL ED+IT +LN+SI D NK+ + +   VI +LI+SL+ G +ET
Sbjct  223   QLLSPLTSPKTCEEHPDLHEDLITAVLNISIPDDNKQAIVKCASVIPLLIESLKLGTMET  282

Query  719   RSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKA  898
             R+NAAAA+F+LSALD NK  IG+ GALKPL+DLLE+G   AMKD ASAI+ LC   EN+ 
Sbjct  283   RTNAAAALFSLSALDDNKVAIGQLGALKPLLDLLEQGDRSAMKDAASAIYNLCRQRENRG  342

Query  899   RAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCA  1078
              A++DGA++V++ KI  RV+V E+LAILA+LS++  AI+E+ +L ++  LLS+IR++   
Sbjct  343   PAVKDGALKVIIGKIKERVYVSEMLAILALLSASRTAIDELEKLNSLDCLLSIIRESDSE  402

Query  1079  RNKENCIVILYAICSADRTKLKEIKDEES  1165
              +KENC V+L+  C+  R   K+I++ +S
Sbjct  403   TDKENCTVVLHDFCNYSRYARKDIREYKS  431



>emb|CAE02102.2| OSJNBa0020I02.15 [Oryza sativa Japonica Group]
 emb|CAH66373.1| OSIGBa0130K07.9 [Oryza sativa Indica Group]
Length=516

 Score =   339 bits (870),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 249/361 (69%), Gaps = 10/361 (3%)
 Frame = +2

Query  185   SSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPV  364
             S+  TYDR  IQ+W ++GN+ICPQTQQVLSHTI+ PNHL+R MIS WC  NG+  P+   
Sbjct  152   STNMTYDRRSIQEWFSAGNQICPQTQQVLSHTIVIPNHLVRTMISQWCTENGLTLPEIEN  211

Query  365   QCLNEDGVVTDADRHNFLVLLEKMSSS--SCVQRSAARELRLLTKRMPSFRALFGESMGA  538
             Q   E   VT+++   F  +  K++SS  S  ++ A ++LRLLTKR   FRA+ G+   +
Sbjct  212   Q---EQDHVTNSEEKTFDEIFVKITSSANSGGRKQAIKDLRLLTKRNSEFRAVLGQRPDS  268

Query  539   AMPKLL---SPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGA  709
                 +L   +P  + D  P + ED++T ILN SIHDSNKK++ +    I  LI +L+SG 
Sbjct  269   IAQMILARSTPGLQND--PQVLEDMVTIILNFSIHDSNKKIIGDDSEAIQFLIWALKSGD  326

Query  710   IETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHE  889
             + +RSN+AAAIFTLSALDSNK  IGK GA+ PLIDLLE G  +A KD ASAIF LC+LHE
Sbjct  327   MGSRSNSAAAIFTLSALDSNKEKIGKLGAMDPLIDLLEHGSIIAKKDAASAIFNLCLLHE  386

Query  890   NKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDT  1069
             N++ A R G V V +  I ++  V+E LAILA+LS N   +E + E     S+L  IR++
Sbjct  387   NRSIAARSGIVDVAMRAIDDQSLVEESLAILALLSRNQEMVEIITEFNGTASMLRSIRES  446

Query  1070  SCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
              C R+KEN +V+L+AIC+ +RTKLKE++ +ES +G+++ LAQ GT RA+RKASG+L+++ 
Sbjct  447   ECKRSKENAMVVLFAICTYNRTKLKEVEADESINGSLTFLAQTGTQRARRKASGILEKMK  506

Query  1250  R  1252
             R
Sbjct  507   R  507



>gb|EMS54565.1| U-box domain-containing protein 9 [Triticum urartu]
Length=585

 Score =   339 bits (870),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 263/415 (63%), Gaps = 41/415 (10%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQ----------------------------------T  199
             S PA+F CP+S ++M+DPVVV SGQ                                  T
Sbjct  161   SVPAQFLCPISSKIMRDPVVVESGQQMSVLRISYRYGLKLSVIGHKCDHLFTVPESSFRT  220

Query  200   YDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNE  379
             YDR +I +W ++GN++CPQTQQVL +T L PN LIR +I+ WC  NG  F   P++   E
Sbjct  221   YDRRYIAEWFSAGNQMCPQTQQVLLNTTLIPNLLIRSLIAEWCTENG--FALSPLEKQEE  278

Query  380   DGVVTDADRHNFLVLLEKMSSSS--CVQRSAARELRLLTKRMPSFRALFGESMGAAMPKL  553
             D +  ++++  F  +  K++SSS    ++ A + LRLLTKR   FRA+  E   +     
Sbjct  279   DHIC-NSEQRTFDEIFNKITSSSNSTERKQAIKGLRLLTKRSSEFRAVLEERPDSISQMT  337

Query  554   LSPFSRVDVHPDLQ--EDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSN  727
              + FS   +  D Q  ED++T ILN S+HDSNKK++ + P  I  LI +L+SG + +RSN
Sbjct  338   FARFSNPGLQNDPQVVEDMVTIILNFSLHDSNKKIIGDDPEAIPFLIWALKSGDMGSRSN  397

Query  728   AAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAI  907
             +AAAIFTLSALDSNK  IG+ GA++PLIDLLE G  +A KD ASAIF LC+LHEN++ A 
Sbjct  398   SAAAIFTLSALDSNKEKIGELGAIEPLIDLLEHGSIIAKKDAASAIFNLCMLHENRSIAT  457

Query  908   RDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNK  1087
             R G V V +  I ++  V+E LAILA+LSSN+  +E M E G    +L  +R++ C R+K
Sbjct  458   RSGIVDVAIRAIGDQSLVEEFLAILALLSSNYDMVELMIEFGGATCMLQAMRESECKRSK  517

Query  1088  ENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
             EN  V+L++IC  +R KLKEI+ +E+++G+++ LAQNGT RA+RKA+ +L+ + +
Sbjct  518   ENAAVVLFSICMYNRAKLKEIEADENTNGSLASLAQNGTPRARRKAAAILEMMKK  572



>ref|XP_004152860.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus]
 gb|KGN61318.1| hypothetical protein Csa_2G080180 [Cucumis sativus]
Length=444

 Score =   333 bits (855),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 187/441 (42%), Positives = 280/441 (63%), Gaps = 21/441 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR----GLHPEQ--------NNNSFPAEFRC  145
             +L++ +  ++ E   ++ A D A Q L AL+         Q        N   FP +FRC
Sbjct  9     DLKQVLYRIIQEQDFDSSAADEAIQILTALKFSLMAASSSQESTRCSGSNTLIFPDKFRC  68

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             P+SG+LMKDPV++ +GQTYDR FI+KW + G+  CPQT +VL+   LTPN L+R MIS W
Sbjct  69    PISGDLMKDPVLLITGQTYDRFFIEKWFHEGHNTCPQTNEVLTDMTLTPNRLLRSMISQW  128

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
             C  N +  P    +   E+ V    + H   +L + +SSS  V++ AA+ELR  T+    
Sbjct  129   CLDNRLELP----RLSYEEEVDNVTESHLDALLEKLLSSSLIVKKEAAKELRETTRWSHE  184

Query  506   FRALFGESMGAAMPKLLSPF---SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             FRALF +  G+ + +LL P     +VD+HPDL ED+ITTILN+S+ D NKK VAE P V+
Sbjct  185   FRALFAKLPGS-VERLLHPLVSIGKVDLHPDLLEDLITTILNISVFDDNKKHVAENPLVL  243

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
              +LI+SL+ G+IE  +NA AAI++LS  ++NK  +GK G  K LI LL+  H   ++D  
Sbjct  244   PLLIESLQHGSIELTANAVAAIYSLSFNEANKITMGKVGVFKHLISLLDYAHPGVIRDAG  303

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKI-MNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             SAI+ LC   EN+ +A+  G V  +   I  + + VD+L+ ILA+L ++ +AI EM +  
Sbjct  304   SAIYNLCTTVENREKAVGSGVVAAIFRNIGRSLLLVDKLILILALLCTDTKAINEMCKFD  363

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
             AVP +L +IR+T   R KENC  IL+AIC+ D+++L++I+++E+ + TI +L++ G SRA
Sbjct  364   AVPCMLRIIRETESQRIKENCASILFAICTTDQSQLRKIQEDENKYETILELSKIGNSRA  423

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
             +RKA+G+LDR++      HT+
Sbjct  424   RRKATGILDRMHSAAPRTHTS  444



>ref|XP_004155144.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus]
Length=444

 Score =   332 bits (851),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 187/441 (42%), Positives = 279/441 (63%), Gaps = 21/441 (5%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALR----GLHPEQ--------NNNSFPAEFRC  145
             +L++ +  ++ E   ++ A D A Q L AL+         Q        N   FP +FRC
Sbjct  9     DLKQVLYRIIQEQDFDSSAADEAIQILTALKFSLMAASSSQESTRCSGSNTLIFPDKFRC  68

Query  146   PLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNW  325
             P+SG+LMKDPV++ +GQTYDR FI+KW + G+  CPQT +VL+   LTPN L+R MIS W
Sbjct  69    PISGDLMKDPVLLITGQTYDRFFIEKWFHEGHNTCPQTNEVLTDMTLTPNRLLRSMISQW  128

Query  326   CKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPS  505
             C  N +  P    +   E+ V    + H   +L + +SSS  V++ AA+ELR  T+    
Sbjct  129   CLDNRLELP----RLSYEEEVDNVTESHLDALLEKLLSSSLIVKKEAAKELRETTRWSHE  184

Query  506   FRALFGESMGAAMPKLLSPF---SRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVI  676
             FRALF +  G+ + +LL P     +VD+HPDL ED+ITTILN+S+ D NKK VAE P V+
Sbjct  185   FRALFAKLPGS-VERLLHPLVSIGKVDLHPDLLEDLITTILNISVFDDNKKHVAENPLVL  243

Query  677   SVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVA  856
               LI+SL+ G+IE  +NA AAI++LS  ++NK  +GK G  K LI LL+  H   ++D  
Sbjct  244   PSLIESLQHGSIELTANAVAAIYSLSFNEANKITMGKVGVFKHLISLLDYAHPGVIRDAG  303

Query  857   SAIFVLCVLHENKARAIRDGAVRVLVEKI-MNRVHVDELLAILAMLSSNHRAIEEMGELG  1033
             SAI+ LC   EN+ +A+  G V  +   I  + + VD+L+ ILA+L ++ +AI EM +  
Sbjct  304   SAIYNLCTTVENREKAVGSGVVAAIFRNIGRSLLLVDKLILILALLCTDTKAINEMCKFD  363

Query  1034  AVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRA  1213
             AVP +L +IR+T   R KENC  IL+AIC+ D+++L++I+++E+ + TI +L++ G SRA
Sbjct  364   AVPCMLRIIRETESQRIKENCASILFAICTTDQSQLRKIQEDENKYETILELSKIGNSRA  423

Query  1214  KRKASGVLDRLNRGVGFIHTA  1276
             +RKA+G+LDR++      HT+
Sbjct  424   RRKATGILDRMHSAAPRTHTS  444



>ref|XP_002873884.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50143.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=458

 Score =   323 bits (829),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 265/415 (64%), Gaps = 20/415 (5%)
 Frame = +2

Query  53    EAIDRAQQALCALRGLH---PEQNNN--SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFI  217
             +AID A + L  LR +    PE + +    P EF C LS  +M +PV+++SGQTY++ +I
Sbjct  43    KAIDEAIRILTCLRKVESKKPEFDISPVEVPKEFICTLSNTIMIEPVIIASGQTYEKRYI  102

Query  218   QKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTD  397
              +WL    R CP+T+Q+LSH +  PNHLI  +I+ WC+VN +    P       D + T+
Sbjct  103   TEWLKH-ERTCPKTKQILSHCLWIPNHLINELITQWCRVNKVDRQKPS------DELATE  155

Query  398   ADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSR  571
                 +   LL+++SSSS V  Q  AA+ELR  TKR P+ R  F   +  ++ +LLSP S 
Sbjct  156   LFTGDIEALLQRISSSSSVADQIEAAKELRRQTKRFPNVRVFFVAGIHDSITRLLSPLSA  215

Query  572   ----VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAA  739
                 VD +P+LQE+IIT + NLSI ++NK ++AE   VI +L  SL+ G  ETR NAAA 
Sbjct  216   LGEAVDSNPELQENIITALFNLSILENNKTVIAENRLVIPLLTKSLKQGTAETRRNAAAT  275

Query  740   IFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGA  919
             + +LSA+DSNK +IG S A+K LIDL+EEG  LA K+  S +F LC++ ENK +A+  G 
Sbjct  276   LSSLSAIDSNKIIIGNSEAVKALIDLIEEGDLLATKEATSTVFNLCIVLENKEKAVSAGL  335

Query  920   VRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCI  1099
             +    +KI    +VDELL++LA++S+++RAIEEM  LG +  L  ++R  SC    EN +
Sbjct  336   IPAATKKIKAGSNVDELLSLLALISTHNRAIEEMDNLGFIYDLFKILRKPSCLLTGENAV  395

Query  1100  VILYAIC--SADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGV  1258
             VI++ +C  + DR++LK + +EE+ HGT ++LA+ G+ RA RKA G+L  + R V
Sbjct  396   VIVFNMCDRNRDRSRLKVVGEEENQHGTFTKLAKQGSVRAVRKAQGILQWIKRFV  450



>ref|XP_010907243.1| PREDICTED: U-box domain-containing protein 9-like [Elaeis guineensis]
Length=450

 Score =   318 bits (814),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 266/414 (64%), Gaps = 9/414 (2%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             EL R V+ +V +D    +  D A +AL  L+ L     +   P  F CP+SG LM+DPV+
Sbjct  25    ELWRLVRLIVDDDDGRVDTYDEAAKALAELKYL--TFGSPKVPQHFLCPISGMLMRDPVI  82

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             + SG+TYDR FIQ+ LNSGNR C ++Q+VLS+ ILTPNHL+R MIS WCK + I  P P 
Sbjct  83    LVSGETYDRAFIQELLNSGNRTCLRSQEVLSNAILTPNHLLRTMISEWCKEHDIPLPQPW  142

Query  362   VQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAA  541
              Q   + G++T         LL+ MSS S +Q+ A +ELRLLTK   + RAL GE     
Sbjct  143   SQ---DGGLITTIGHKPLHELLDNMSSLS-LQKEAMKELRLLTKHNKASRALLGEKPDT-  197

Query  542   MPKLLSPFSR--VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIE  715
             +P+LLS  S   +   P+  +D +TTILN+SIH+ NKK++ + PRVI  LI+SL+ G + 
Sbjct  198   IPQLLSVLSAPGLTSDPEFHDDTVTTILNISIHERNKKILGDDPRVIPFLINSLKYGDMA  257

Query  716   TRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENK  895
             TRSNAAAA+F+LSALDSNK  I + GA+KPL+ LL++G   A +D ASAIF +C+  ENK
Sbjct  258   TRSNAAAALFSLSALDSNKVKIVELGAIKPLVQLLKQGGETARRDAASAIFNICLDPENK  317

Query  896   ARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSC  1075
              +A+++G V V  +++M++  VDE LAILA+L     A+ E+G  G VP+L  +IR+++ 
Sbjct  318   EKAVKEGVVGVAWKRVMDKSLVDESLAILALLQRKQEAVLEIGGSGGVPALFGIIRESTS  377

Query  1076  ARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVL  1237
               +KEN + +L+AIC  D  K ++  +EE+   TI  L   G   A  KA  +L
Sbjct  378   RESKENAVALLHAICKWDPVKRRKALEEENLSNTIRTLCDVGHRGASEKAGKLL  431



>ref|XP_009120984.1| PREDICTED: putative U-box domain-containing protein 46 [Brassica 
rapa]
Length=456

 Score =   316 bits (809),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/425 (42%), Positives = 262/425 (62%), Gaps = 27/425 (6%)
 Frame = +2

Query  35    EDGVNAEAIDRAQQALCALRGLHPEQN-------NNSFPAEFRCPLSGELMKDPVVVSSG  193
             E GV  +AID A + + +LR + PE +           P EF+C LS ++M +PV+++SG
Sbjct  37    ETGVLMKAIDEANRIINSLREVEPETDILSPSPVKMDVPKEFKCTLSKKIMIEPVIIASG  96

Query  194   QTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCL  373
             QTY++ FIQ+WL    R CP + QVLSH   TPN L+  +I  WC VN    P    + +
Sbjct  97    QTYEKRFIQEWLKR-ERTCPISNQVLSHLSFTPNLLVDELIKQWCLVNKFKRPKSSEEIV  155

Query  374   NE---DGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGA  538
             NE   DG+ +         LL+++SS S V  Q  AA ELR  TKR  + RA     +  
Sbjct  156   NELFTDGIDS---------LLQRISSPSSVADQAQAAEELRRQTKRFANVRAFLVSELPG  206

Query  539   AMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIET  718
             ++ +LL+P S VD + DLQE+++TT+ NLSI + NK ++AETP VI +L  SL+ G  ET
Sbjct  207   SITRLLTPLSAVDSNLDLQENLVTTLFNLSIVEKNKTVIAETPLVIPLLTHSLKQGTAET  266

Query  719   RSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKA  898
             R N+AA + +LSA+DSN+ +IG S  LK LI L+EEG  L + + ASA+F +C + EN+ 
Sbjct  267   RRNSAATLLSLSAIDSNRLIIGNSETLKALIGLIEEG-GLFITEAASAVFNICTVSENRE  325

Query  899   RAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCA  1078
             +AI  G + VL  KI     V ELL++LA++S+++R ++EM +LG +  LLS++R  SC 
Sbjct  326   KAISSGLIPVLTNKIKEGSSVAELLSLLALVSTHNRGVKEMNDLGLINDLLSILRKPSCP  385

Query  1079  RNKENCIVILYAICSADRT---KLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
                EN +VI++ +C  +R    +L  + +EE+ HGT ++LA+ G+ RA RKA  +L  L 
Sbjct  386   VTHENAVVIVFNMCDRNRDRSGRLSVLSEEENQHGTFTKLAKQGSDRAVRKAEAILKWLK  445

Query  1250  R-GVG  1261
             R G G
Sbjct  446   RHGTG  450



>ref|XP_010668261.1| PREDICTED: U-box domain-containing protein 9-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=357

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 183/353 (52%), Positives = 247/353 (70%), Gaps = 11/353 (3%)
 Frame = +2

Query  197   TYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLN  376
             TYDRP+I+KWL  GNRICPQTQQVLS+  L PNHLIR +I  WC   G   P P VQ + 
Sbjct  1     TYDRPYIEKWLKDGNRICPQTQQVLSNIELFPNHLIRELIRQWCLNRGHEVPSP-VQDIK  59

Query  377   EDGVVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRALFGESMGAAMPKLL  556
               G +TDADR +   LL+K+SSS   Q+ AA+E+R LTK+MPS  + FGES  A M +LL
Sbjct  60    V-GSLTDADRKHISSLLQKLSSSLSDQKEAAKEIRKLTKQMPSSHSFFGESTDA-MLQLL  117

Query  557   SPFSR---VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSN  727
             +P +     + HPDL ED+IT +LN+SI D NK+ + + P VI +LI+SL+ G +ETR+N
Sbjct  118   TPLASPKTCEEHPDLHEDLITAVLNISIPDDNKQAIVKCPSVIPLLIESLKLGTMETRTN  177

Query  728   AAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAI  907
             AAAA+F+LSALD NK  IG+ GALKPL+DLLE+G   AMKD ASAI+ LC   EN+  A+
Sbjct  178   AAAALFSLSALDDNKVAIGQLGALKPLLDLLEQGDRSAMKDAASAIYNLCRQRENRGPAV  237

Query  908   RDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNK  1087
             +DGAV+V++ KI  RV+V E+LAILA+LS++H AI+E  +L +V  LLS+IRD+    +K
Sbjct  238   KDGAVKVIIGKIKERVYVSEMLAILALLSASHTAIDEFEKLNSVDCLLSIIRDSDSETDK  297

Query  1088  ENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRL  1246
             ENC V+L+  C+  R   K I+++ES        +++G     RKA+ +LDR+
Sbjct  298   ENCTVVLHDFCNYSRYARKGIREDESKWNN----SEDGRD-WNRKANAILDRV  345



>emb|CDY38506.1| BnaA10g16520D [Brassica napus]
Length=456

 Score =   314 bits (804),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 178/422 (42%), Positives = 260/422 (62%), Gaps = 21/422 (5%)
 Frame = +2

Query  35    EDGVNAEAIDRAQQALCALRGLHPEQNNNS-------FPAEFRCPLSGELMKDPVVVSSG  193
             E GV  +AID A + +  LR + PE +  S        P EF+C LS ++M +PV+++SG
Sbjct  37    ETGVLMKAIDEANRIINCLREVEPETDILSPTPEKVDVPKEFKCTLSKKIMIEPVIIASG  96

Query  194   QTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCL  373
             QTY++ +I  WL    R CP + QVLSH   TPN LI  +I+ WC VN    P       
Sbjct  97    QTYEKRYITAWLKR-ERTCPISNQVLSHLSFTPNLLIDDLITQWCIVNKFERPK------  149

Query  374   NEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGAAMP  547
             + + +VT+        LL+++SS S V  Q  AA ELR  TKR  + R  F   +  ++ 
Sbjct  150   SSEDIVTELFTDGIDSLLQRISSPSSVADQAQAAEELRRQTKRFANVRTFFVSQLPDSIT  209

Query  548   KLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSN  727
             +LL+P S VD  P+LQE+IITT+ NLSI + NK ++AETP VI +L  SL+ G  ETR N
Sbjct  210   RLLTPLSAVDSSPELQENIITTMFNLSIVEKNKTVIAETPLVIPLLTKSLKQGTAETRRN  269

Query  728   AAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAI  907
             +AA + +LSA+DSN+ +IG S  LK LI L+ EG  L + + ASA+F +C + EN+ +A+
Sbjct  270   SAATLLSLSAIDSNRLIIGNSETLKALIGLIGEG-GLFITEAASAVFNICSVSENREKAV  328

Query  908   RDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNK  1087
               G V VL  KI    +V ELL++LA++S+++R ++EM +LG +  LLS++R  SC    
Sbjct  329   SSGLVPVLTTKIKEGSNVAELLSLLALVSTHNRGVKEMNDLGFINDLLSILRKPSCPVTH  388

Query  1088  ENCIVILYAICSADRTK---LKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR-G  1255
             EN +VI++ +C  +R +   LK + +EE+ HGT ++LA+ G+ RA RKA  +L  L R G
Sbjct  389   ENAVVIVFNMCDRNRDRSGVLKVLSEEENQHGTFTKLAKQGSDRAVRKAEAILKWLKRHG  448

Query  1256  VG  1261
              G
Sbjct  449   TG  450



>ref|NP_197333.2| putative U-box domain-containing protein 46 [Arabidopsis thaliana]
 sp|Q3E9F7.1|PUB46_ARATH RecName: Full=Putative U-box domain-containing protein 46; AltName: 
Full=Plant U-box protein 46 [Arabidopsis thaliana]
 gb|AED92539.1| putative U-box domain-containing protein 46 [Arabidopsis thaliana]
Length=458

 Score =   314 bits (804),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 181/443 (41%), Positives = 271/443 (61%), Gaps = 31/443 (7%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVN-----------AEAIDRAQQALCALRGLH---PEQNNN--SFPA  133
             ELQ+ +  ++++ G N            +AID A + L  LR +    PE + +    P 
Sbjct  15    ELQKVLTEILNDGGGNDRDETEAFSGVVKAIDEAVRILTCLRKVESKIPESDISPVEVPK  74

Query  134   EFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGM  313
             EF C LS  +M +PV+++SGQTY++ +I +WL    R CP+T+QVLSH +  PNHLI  +
Sbjct  75    EFICTLSNTIMIEPVIIASGQTYEKRYITEWLKH-ERTCPKTKQVLSHRLWIPNHLISDL  133

Query  314   ISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLL  487
             I+ WC VN      P       D +V +    +   LL+++SSSS V  Q  AA+ELR  
Sbjct  134   ITQWCLVNKYDHQKPS------DELVAELFTSDIEALLQRVSSSSSVADQIEAAKELRHQ  187

Query  488   TKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPD----LQEDIITTILNLSIHDSNKKLV  655
             TK+ P+ R  F   +  ++ +LLSP S +D   D    LQE+I+T + NLSI +SNK ++
Sbjct  188   TKKFPNVRVFFVAGIHDSITRLLSPLSTLDEAVDSSLELQENIVTALFNLSILESNKTVI  247

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
             AE   VI +L  SL+ G  ETR NAAA + +LSA+DSNK +IG S A+K LIDL+EEG  
Sbjct  248   AENCLVIPLLTKSLKQGTDETRRNAAATLSSLSAIDSNKIIIGNSEAVKALIDLIEEGDL  307

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIE  1015
             LA K+  S +F LC++ ENK + +  G +    +KI    +VDELL++LA++S+++RA+E
Sbjct  308   LATKEATSTVFNLCIVLENKGKVVSAGLIHAATKKIKAGSNVDELLSLLALISTHNRAVE  367

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAIC--SADRTKLKEIKDEESSHGTISQL  1189
             EM +LG +  L S++R  S     EN +VI++ +   + DR++LK + +EE+ HGT ++L
Sbjct  368   EMDKLGFIYDLFSILRKPSSLLTGENAVVIVFNMYDRNRDRSRLKVVGEEENQHGTFTKL  427

Query  1190  AQNGTSRAKRKASGVLDRLNRGV  1258
             A+ G+ RA RKA G+L  + R V
Sbjct  428   AKQGSVRAARKAQGILQWIKRFV  450



>ref|XP_006289884.1| hypothetical protein CARUB_v10003498mg [Capsella rubella]
 gb|EOA22782.1| hypothetical protein CARUB_v10003498mg [Capsella rubella]
Length=465

 Score =   313 bits (803),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/416 (41%), Positives = 263/416 (63%), Gaps = 20/416 (5%)
 Frame = +2

Query  53    EAIDRAQQALCALRGLHPEQNNNS------FPAEFRCPLSGELMKDPVVVSSGQTYDRPF  214
             +AID A + L  LR +   +   S       P EF C LS  +M +PV+++SGQTY++ +
Sbjct  48    KAIDEAIRILNCLRRVEESRKPESDISPVKVPKEFICTLSNTIMIEPVIIASGQTYEKRY  107

Query  215   IQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVT  394
             I +WL    RICP++++VL+H     NHL+  +I+ WC+ N      PP      + +VT
Sbjct  108   ITEWLKH-ERICPKSKEVLAHGFWISNHLVNELITQWCRANKFDRRKPP-----PEEIVT  161

Query  395   DADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFS  568
             +    +   LL ++SS+S V  Q  A++ELR  TK+  + R  F E +  ++ +LLSP S
Sbjct  162   ELFTSDIEALLHRISSASSVADQTEASKELRRQTKKFTNVRVFFVEELPGSITRLLSPLS  221

Query  569   R----VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAA  736
                  VD++P+LQE+++TT+ NLSI + NK ++AE   VI +L  SL+ G  ETR NAAA
Sbjct  222   TLGEAVDLNPELQENLVTTLFNLSILEKNKTVIAENRLVIPLLTKSLKQGTAETRRNAAA  281

Query  737   AIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDG  916
              + +LSA+DSNK +IG S A+K LIDL+EEG  LA K+  S +F LC++ ENK + +  G
Sbjct  282   TLSSLSAIDSNKMIIGNSEAVKALIDLIEEGDVLATKEATSTVFNLCIVLENKEKVVSAG  341

Query  917   AVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENC  1096
              +R   +K+    +VDELL++LA++S++ RAIEEM +LG +  L S++R  S   N EN 
Sbjct  342   LIRAATKKVKAGSNVDELLSLLALISTHIRAIEEMDKLGFIYDLFSILRKPSSLLNGENA  401

Query  1097  IVILYAIC--SADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGV  1258
             +VI++ +C  + D+++LK + +EE+ HGT ++LA+ G+ RA RKA G+L  + + V
Sbjct  402   VVIVFNMCDRNRDQSRLKVVGEEENKHGTFTKLAKQGSVRAVRKAQGILQWIKKFV  457



>ref|XP_010420580.1| PREDICTED: putative U-box domain-containing protein 46 isoform 
X1 [Camelina sativa]
 ref|XP_010420582.1| PREDICTED: putative U-box domain-containing protein 46 isoform 
X2 [Camelina sativa]
Length=474

 Score =   308 bits (788),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 174/418 (42%), Positives = 257/418 (61%), Gaps = 22/418 (5%)
 Frame = +2

Query  53    EAIDRAQQALCALRGL----HPEQNNN----SFPAEFRCPLSGELMKDPVVVSSGQTYDR  208
             +AID A + L  LR       PE ++       P EF C LS  +M +PV+++SGQTY++
Sbjct  55    KAIDEAIRILNCLRNRVESSKPESDDTIAPVKVPKEFICTLSNTIMIEPVIIASGQTYEK  114

Query  209   PFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGV  388
              +I +WL    R CP++++VLSH    PNHLI  +I+ WC VN +     P      D +
Sbjct  115   RYITEWLKH-ERTCPKSKEVLSHCYWIPNHLINDLITQWCLVNKVDRLKRP-----SDEI  168

Query  389   VTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSP  562
             VT+    +   LL+++ S S V  Q  AA+ELR  TK+  + R  F   +  ++ +LLSP
Sbjct  169   VTELFTSDIETLLQRVYSPSSVTDQIEAAKELRRQTKKFANVRVFFVAGISDSITRLLSP  228

Query  563   FSR----VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNA  730
              S     VD++P+LQEDI+T + NLSI + NK ++AE   VI +L   L+ G  ETR NA
Sbjct  229   LSALGEGVDLNPELQEDIVTALFNLSILEKNKTVIAENLLVIPLLTKCLKQGTAETRRNA  288

Query  731   AAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIR  910
             AA + +LSA+DSNK +IG S A+K LIDL+EEG  LA ++  S +F LC++ ENK + + 
Sbjct  289   AATLSSLSAIDSNKIVIGNSEAVKALIDLIEEGDMLATREATSTVFNLCIVLENKEKVVS  348

Query  911   DGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKE  1090
              G +R   +KI    +VDELL++LA++S++  AIEEM  LG +  L S++R  S   N E
Sbjct  349   AGLIRAATKKIKAGSNVDELLSLLALISTHTGAIEEMDNLGFIYDLFSILRKPSSLLNGE  408

Query  1091  NCIVILYAIC--SADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGV  1258
             N +VI++ +C  + DR +LK + +EE+ HGT ++LA+ G+ RA RKA G+L  + R V
Sbjct  409   NAVVIVFNMCDRNRDRFRLKVVGEEENQHGTFTKLAKQGSVRAVRKAQGILQWIKRFV  466



>ref|XP_010454064.1| PREDICTED: putative U-box domain-containing protein 46 [Camelina 
sativa]
Length=467

 Score =   307 bits (787),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 167/397 (42%), Positives = 250/397 (63%), Gaps = 18/397 (5%)
 Frame = +2

Query  104   PEQNNNS----FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVL  271
             PE ++++     P EF C LS  +M +PV+++SGQTY++ +I +WL    R CP++++VL
Sbjct  69    PESDDHTSPVKVPKEFICTLSNTIMIEPVIIASGQTYEKRYITEWLKH-ERTCPKSKEVL  127

Query  272   SHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSC  451
             SH    PNHLI  +I+ WC VN +     P      D +VT+    +   LL+++ SSS 
Sbjct  128   SHCFWIPNHLINDLITQWCLVNKVDRLKRP-----SDEIVTELFTSDIEALLQRVYSSSS  182

Query  452   V--QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSR----VDVHPDLQEDIITT  613
             V  Q  AA+ELR  TK+  + R  F   +  ++ +LLSP S     VD++P+LQEDI+T 
Sbjct  183   VTDQIEAAKELRRQTKKFANVRVFFVAGINDSITRLLSPLSTLGEGVDLNPELQEDIVTA  242

Query  614   ILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSG  793
             + NLSI + NK ++AE   VI +L   L+ G  E R NAAA + +LSA+DSNK +IG S 
Sbjct  243   LFNLSILEKNKTVIAENSLVIPLLTKCLKQGTAEARRNAAATLSSLSAIDSNKIIIGNSE  302

Query  794   ALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELL  973
             A+K LIDL+EEG  LA ++  S +F LC++ ENK + +  G +R   +KI    +VDELL
Sbjct  303   AVKALIDLIEEGDMLATREATSTVFNLCIVLENKEKVVSAGLIRAATKKIKAGSNVDELL  362

Query  974   AILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAIC--SADRTKLKE  1147
             ++LA++S++  AIEEM  LG +  L S++R  S   N EN +VI++ +C  + DR +LK 
Sbjct  363   SLLALISTHTGAIEEMDHLGFIYDLFSILRKPSSLLNGENAVVIVFNMCDRNRDRFRLKV  422

Query  1148  IKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGV  1258
             + +EE+ HGT ++LA+ G+ RA RKA G+L  + R V
Sbjct  423   VGEEENQHGTFTKLAKQGSVRAVRKAQGILQWIKRFV  459



>ref|XP_010420583.1| PREDICTED: putative U-box domain-containing protein 46 isoform 
X3 [Camelina sativa]
Length=482

 Score =   303 bits (775),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/426 (40%), Positives = 256/426 (60%), Gaps = 30/426 (7%)
 Frame = +2

Query  53    EAIDRAQQALCALRGL----HPEQNNN----SFPAEFRCPLSGELMKDPVVVSSGQTYDR  208
             +AID A + L  LR       PE ++       P EF C LS  +M +PV+++SGQTY++
Sbjct  55    KAIDEAIRILNCLRNRVESSKPESDDTIAPVKVPKEFICTLSNTIMIEPVIIASGQTYEK  114

Query  209   PFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGV  388
              +I +WL    R CP++++VLSH    PNHLI  +I+ WC VN +     P      D +
Sbjct  115   RYITEWLKH-ERTCPKSKEVLSHCYWIPNHLINDLITQWCLVNKVDRLKRP-----SDEI  168

Query  389   VTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSP  562
             VT+    +   LL+++ S S V  Q  AA+ELR  TK+  + R  F   +  ++ +LLSP
Sbjct  169   VTELFTSDIETLLQRVYSPSSVTDQIEAAKELRRQTKKFANVRVFFVAGISDSITRLLSP  228

Query  563   FSR----VDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNA  730
              S     VD++P+LQEDI+T + NLSI + NK ++AE   VI +L   L+ G  ETR NA
Sbjct  229   LSALGEGVDLNPELQEDIVTALFNLSILEKNKTVIAENLLVIPLLTKCLKQGTAETRRNA  288

Query  731   AAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIR  910
             AA + +LSA+DSNK +IG S A+K LIDL+EEG  LA ++  S +F LC++ ENK + + 
Sbjct  289   AATLSSLSAIDSNKIVIGNSEAVKALIDLIEEGDMLATREATSTVFNLCIVLENKEKVVS  348

Query  911   DGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKE  1090
              G +R   +KI    +VDELL++LA++S++  AIEEM  LG +  L S++R  S   N E
Sbjct  349   AGLIRAATKKIKAGSNVDELLSLLALISTHTGAIEEMDNLGFIYDLFSILRKPSSLLNGE  408

Query  1091  NCIVILYAICSADRTK----------LKEIKDEESSHGTISQLAQNGTSRAKRKASGVLD  1240
             N +VI++ +C  +R +          +K + +EE+ HGT ++LA+ G+ RA RKA G+L 
Sbjct  409   NAVVIVFNMCDRNRDRFRLKVVGEEEMKVVGEEENQHGTFTKLAKQGSVRAVRKAQGILQ  468

Query  1241  RLNRGV  1258
              + R V
Sbjct  469   WIKRFV  474



>ref|XP_006400381.1| hypothetical protein EUTSA_v10015380mg, partial [Eutrema salsugineum]
 gb|ESQ41834.1| hypothetical protein EUTSA_v10015380mg, partial [Eutrema salsugineum]
Length=426

 Score =   297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/384 (42%), Positives = 248/384 (65%), Gaps = 16/384 (4%)
 Frame = +2

Query  128   PAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIR  307
             P  F+C LS ++M +PV+++SGQTY++ +I +WL    R CP++  VLSH +LTPNHL+ 
Sbjct  30    PKVFKCTLSNKIMVEPVIIASGQTYEKRYITEWLRH-ERTCPKSNLVLSHLLLTPNHLVD  88

Query  308   GMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV---QRSAAREL  478
              +I+ WC+ N      P       D + T+   +    LL+++SS S     +  AA+EL
Sbjct  89    ELITQWCRENNYDRLKP------SDEIATEMFTYGIDSLLQRISSPSSSVSDKTEAAKEL  142

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSR----VDVHPDLQEDIITTILNLSIHDSNK  646
             R  TK+  + R  F   +  ++ +LLSP S     VD +P+LQE+I+TT+ N+SI + NK
Sbjct  143   RNQTKKFSNVRRFFVTELPDSITRLLSPLSASGEAVDSNPELQENIVTTLFNISIVEKNK  202

Query  647   KLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEE  826
              ++AE P VI +LI  L+ G  ETR N+AA + +LSA+DSNK ++G S  LK LIDL+EE
Sbjct  203   TVIAENPLVIPLLIKFLKQGTPETRINSAATLLSLSAIDSNKIIMGNSEVLKALIDLIEE  262

Query  827   GHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHR  1006
             G S A  + AS +F LC+L +N+ +A+  G + V+ +KI    +V ELLAIL+++S+N+R
Sbjct  263   GDSAASLEAASVVFNLCILLQNREKAVLAGLIPVVTKKIKEGSNVAELLAILSLISTNNR  322

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADR--TKLKEIKDEESSHGTI  1180
             AIEEM +LG +  L S++R  SC+   EN +VI++ +C  +R  + LK +++EE+ +GT 
Sbjct  323   AIEEMSDLGFMNDLFSILRKPSCSVISENAVVIVFNMCERNRDMSGLKSLREEENQYGTF  382

Query  1181  SQLAQNGTSRAKRKASGVLDRLNR  1252
             ++LA+ G+ RA RKA  +L  L R
Sbjct  383   TKLAKQGSDRAVRKAEAILKWLKR  406



>ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris]
 gb|ESW15745.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris]
Length=631

 Score =   296 bits (759),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 239/385 (62%), Gaps = 13/385 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLVHTALTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED---GVVTDADRHNFLVLLEKMSSSSC-VQRSAAR  472
             + +I+ WC+ NGI  P     C  +       +D DR     LL+K++S++   QR+AA 
Sbjct  307   KSLIALWCESNGIELPKKQGSCRTKKCCGSSNSDCDRTAISALLDKLASNNIEQQRAAAG  366

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             ELRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  
Sbjct  367   ELRLLAKRNADNRVCIAEA--GAIPPLVDLLSSSD--PRTQEHAVTALLNLSINESNKGT  422

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +      I  ++D L+SG++E R NAAA +F+LS LD N+  IG +GA+  LI LL EG 
Sbjct  423   IVNAG-AIPDIVDVLKSGSMEARENAAATLFSLSVLDENRVQIGAAGAIPALIKLLCEGT  481

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHR  1006
                 KD A+AIF L +   NKARA++ G V  L++  K      VDE LAILA+L+S+H 
Sbjct  482   PRGKKDAATAIFNLSIYQGNKARAVKAGIVGPLIQFLKDAGGGMVDEALAILAILASHHE  541

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G+ G +P L+ +IR T   RN+EN   +L+++CS D   LK  K E  +   + +
Sbjct  542   GRVAIGQAGPIPILVEVIR-TGSPRNRENAATVLWSLCSGDPLLLKLAK-EHGAEAALQE  599

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVG  1261
             L++NGT RAKRKA  +L+ L R  G
Sbjct  600   LSENGTDRAKRKAGSILELLQRMKG  624



>emb|CDY68352.1| BnaCnng58610D [Brassica napus]
Length=456

 Score =   289 bits (740),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 173/425 (41%), Positives = 263/425 (62%), Gaps = 27/425 (6%)
 Frame = +2

Query  35    EDGVNAEAIDRAQQALCALRGLHPEQNNNS-------FPAEFRCPLSGELMKDPVVVSSG  193
             E GV  +AID A + + +LR + PE +  S        P EF+C LS ++M +PV+++SG
Sbjct  37    ETGVLMKAIDEANRIIKSLREVEPETDILSPLPEKVDVPKEFKCTLSKKIMIEPVIIASG  96

Query  194   QTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCL  373
             QTY++ +I +WL    R CP + QVLSH  LTPN L+  +I+ WC VN    P    + +
Sbjct  97    QTYEKRYITEWLKL-ERTCPISNQVLSHLSLTPNLLVDELITQWCLVNKFERPKSAEETV  155

Query  374   NE---DGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGA  538
              E   DG+ +         LL+++SS S V  Q  AA ELR  TKR  + R      +  
Sbjct  156   TELFTDGIDS---------LLQRISSPSSVADQAQAAAELRRQTKRFANVRTFLVSELPG  206

Query  539   AMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIET  718
             ++ +LL+P S V+++ +LQE++ITT+ NLSI + NK+++AE P VI +L  SL+ G  ET
Sbjct  207   SITRLLTPLSAVNLNLELQENLITTLFNLSIVEKNKRIIAENPLVIPLLTKSLKQGTSET  266

Query  719   RSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKA  898
             R N+AA + +LSA++SN+ +IG S  LK LI L+ EG  L   + ASA+F +C + EN+ 
Sbjct  267   RRNSAATLLSLSAIESNRLIIGNSETLKALIGLIGEG-GLFTTEAASAVFNICSVSENRE  325

Query  899   RAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCA  1078
             +A+  G + VL  KI    +V ELLA+LA+LS+++R ++EM +LG +  LLS++R  SC 
Sbjct  326   KAVSSGLIPVLTNKIKEGSNVAELLALLALLSTHNRGVKEMNDLGFISDLLSILRKPSCP  385

Query  1079  RNKENCIVILYAICSADRT---KLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLN  1249
                EN +VI++ +C  +R    +LK + +EE+ +GT ++LA+ G+ RA RKA  +L  L 
Sbjct  386   VTHENAVVIVFNMCDRNRDRSGRLKVLSEEENQYGTFTKLAKQGSDRAVRKAEAILKWLK  445

Query  1250  R-GVG  1261
             R G G
Sbjct  446   RHGTG  450



>ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max]
Length=631

 Score =   293 bits (749),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/385 (43%), Positives = 238/385 (62%), Gaps = 13/385 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLVHTALTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED---GVVTDADRHNFLVLLEK-MSSSSCVQRSAAR  472
             + +I+ WC+ NGI  P     C  +      ++D DR     LL+K MS+    QR+AA 
Sbjct  307   KSLIALWCESNGIELPKKQGSCRTKKCGGSSLSDCDRTAISALLDKLMSNDIEQQRAAAG  366

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             ELRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  
Sbjct  367   ELRLLAKRNADNRVCIAEA--GAIPPLVDLLSSSD--PRTQEHAVTALLNLSINESNKGT  422

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +      I  ++D L++G++E R NAAA +F+LS LD NK  IG +GA+  LI LL EG 
Sbjct  423   IVNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVLDENKVQIGAAGAIPALIKLLCEGT  481

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHR  1006
                 KD A+AIF L +   NKARA++ G V  L++  K      VDE LAI+A+L+S+H 
Sbjct  482   PRGKKDAATAIFNLSIYQGNKARAVKAGIVVPLIQFLKDAGGGMVDEALAIMAILASHHE  541

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G+   +P L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   + +
Sbjct  542   GRVAIGQAEPIPILVEVIR-TGSPRNRENAAAVLWSLCTGDPLQLK-LAKEHGAEAALQE  599

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVG  1261
             L++NGT RAKRKA  +L+ L R  G
Sbjct  600   LSENGTDRAKRKAGSILELLQRMEG  624



>gb|KHN00867.1| U-box domain-containing protein 14 [Glycine soja]
Length=631

 Score =   293 bits (749),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/385 (43%), Positives = 238/385 (62%), Gaps = 13/385 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLVHTALTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED---GVVTDADRHNFLVLLEK-MSSSSCVQRSAAR  472
             + +I+ WC+ NGI  P     C  +      ++D DR     LL+K MS+    QR+AA 
Sbjct  307   KSLIALWCESNGIELPKKQGSCRTKKCGGSSLSDCDRTAISALLDKLMSNDIEQQRAAAG  366

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             ELRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  
Sbjct  367   ELRLLAKRNADNRVCIAEA--GAIPPLVDLLSSSD--PRTQEHAVTALLNLSINESNKGT  422

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +      I  ++D L++G++E R NAAA +F+LS LD NK  IG +GA+  LI LL EG 
Sbjct  423   IVNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVLDENKVQIGAAGAIPALIKLLCEGT  481

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHR  1006
                 KD A+AIF L +   NKARA++ G V  L++  K      VDE LAI+A+L+S+H 
Sbjct  482   PRGKKDAATAIFNLSIYQGNKARAVKAGIVVPLIQFLKDAGGGMVDEALAIMAILASHHE  541

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G+   +P L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   + +
Sbjct  542   GRVAIGQAEPIPILVEVIR-TGSPRNRENAAAVLWSLCTGDPLQLK-LAKEHGAEAALQE  599

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVG  1261
             L++NGT RAKRKA  +L+ L R  G
Sbjct  600   LSENGTDRAKRKAGSILELLQRMEG  624



>gb|KFK26070.1| hypothetical protein AALP_AA8G199200 [Arabis alpina]
Length=437

 Score =   285 bits (730),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 164/419 (39%), Positives = 244/419 (58%), Gaps = 56/419 (13%)
 Frame = +2

Query  53    EAIDRAQQALCALRGLHPEQNNNS-----------FPAEFRCPLSGELMKDPVVVSSGQT  199
             +AID A + L  L+ +  ++N  S            P EF+C LS  +M +PV+++SG+T
Sbjct  47    KAIDEAIRVLTCLKKVESKKNPESDHTSSSPAPVEMPKEFKCTLSNNIMIEPVIIASGET  106

Query  200   YDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNE  379
             Y++ +I +WL   +  CP+T+QVLSH++ TPN+LI  +I  W                  
Sbjct  107   YEKRYITEWLKHTS-TCPKTKQVLSHSLWTPNNLIDELIRKW------------------  147

Query  380   DGVVTDADRHNFLVLLEKMSSSSCV--QRSAARELRLLTKRMPSFRALFGESMGAAMPKL  553
                               +SS S V  Q  AA ELRL TK+  + R  F   +  ++ +L
Sbjct  148   ------------------ISSPSSVADQSEAAEELRLRTKKFTNVRVFFVAQLRDSITRL  189

Query  554   LSPFS----RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETR  721
             LSP S     VD +P+LQE+IITT+ N+SI D NK ++A  P VI +L   L+ G  +TR
Sbjct  190   LSPISGLGEAVDGNPELQENIITTLFNISIVDQNKTVIAANPLVIPLLTKFLKQGTADTR  249

Query  722   SNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKAR  901
              N+A  + +LS +DSNK LIG S ALK LI L+EEG  LA ++ ASA+F +C+  EN+ +
Sbjct  250   RNSAGTLLSLSVIDSNKILIGNSEALKALIVLIEEGDFLATREAASAVFNICIASENREK  309

Query  902   AIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCAR  1081
             A+  G V VL  KI    +VDE LA+LA++SS+++AIEEM +LG +  L S++R  SC++
Sbjct  310   AVLAGLVPVLTNKIKAGSNVDEFLAVLALVSSHNQAIEEMEKLGLIYDLFSILRKQSCSK  369

Query  1082  NKENCIVILYAIC--SADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
               EN +VI+  +C  S D+++LK + +EE   GT ++LA+ G+ RA RK   +L    R
Sbjct  370   TCENAVVIVLNMCERSRDKSQLKVVGEEEKQFGTFTKLARQGSDRAVRKTKAILQLTKR  428



>ref|XP_010027134.1| PREDICTED: U-box domain-containing protein 9-like [Eucalyptus 
grandis]
 gb|KCW61431.1| hypothetical protein EUGRSUZ_H04159 [Eucalyptus grandis]
Length=451

 Score =   286 bits (731),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 174/427 (41%), Positives = 257/427 (60%), Gaps = 18/427 (4%)
 Frame = +2

Query  2     ELQRAVKAVVSEDGVNAEAIDRAQQAL-------CALRGLHPEQNNNSFPAEFRCPLSGE  160
             E+ R  + +  ED    E +D A +AL           G  P +     P EF CP+S  
Sbjct  23    EVSRLFEMIAKEDECKLETVDEAIRALQLYADSKWKTLGKRP-RVQQGIPEEFLCPISKS  81

Query  161   LMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNG  340
             +M DPVV+ +GQT+DR  IQ WLN G+R CP T Q L  T LTPN L+R +I   CK  G
Sbjct  82    VMVDPVVLENGQTFDRLPIQDWLNKGHRRCPLTLQFLRDTRLTPNLLVRRLIVKCCKEQG  141

Query  341   IWFPDPPVQCLNEDG-VVTDADRHNFLVLLEKMSSSSCVQRSAARELRLLTKRMPSFRAL  517
             I  P+     + ++G +  D DR  F  LL+++S S   Q+ AA+ELR LT R  S RA 
Sbjct  142   IKLPN----LMEDEGKIAGDCDRDYFESLLDRLSPSLNDQKVAAKELRDLTNRQASVRAF  197

Query  518   FGESMGAAMPKLLSPFS--RVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLID  691
             FGES GA   KLL+P S  +V  +PDL+ED+   +LNLSI + NK+L+ + P VIS L+ 
Sbjct  198   FGESAGA-FQKLLNPLSPNKVVDNPDLEEDLTAIVLNLSIIERNKELMEDNPFVISFLVG  256

Query  692   SLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFV  871
             SL S    TRS AAAA+  LS L SN  LIG++G + PLI+++ EG+ +A+ + +SA++ 
Sbjct  257   SLNSRTPRTRSIAAAALSELSILKSNWRLIGEAGTIGPLINVIGEGNIVAIVNASSALYK  316

Query  872   LCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLL  1051
             L  L EN   A +  A  V++++I+ R+ VDE++ +LA+LS +  A++E+    AVP LL
Sbjct  317   LLHLAENMKNATQARAPSVILQRIVKRICVDEMMGLLALLSRDLDAVDELINFDAVPLLL  376

Query  1052  SLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL--AQNGTSRAKRKA  1225
              ++ +    + KENC+ IL  ICS D   +K I+++E + G +  L  +   T+RA+RKA
Sbjct  377   KVLGEDRPGQCKENCVAILDKICSYDPNTVKRIRNDEDACGLLLALSASSTATARAQRKA  436

Query  1226  SGVLDRL  1246
             + ++ ++
Sbjct  437   ASIVKKI  443



>ref|XP_002882523.1| hypothetical protein ARALYDRAFT_896898 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58782.1| hypothetical protein ARALYDRAFT_896898 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  665   PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAM  844
             P VI +LID+LR G + TRSNAAAAIFTLSALDSNK LIGKSG LKPLIDLLEEG+ LA+
Sbjct  106   PCVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAI  165

Query  845   KDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMG  1024
             KDVA+AIF LC+ HEN++RA+RDGAVRVL +KI N ++VDELLAILAML ++ +A+EE+G
Sbjct  166   KDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAVEELG  225

Query  1025  ELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGT  1204
             ELG V  LL + R++ C RNKEN IVIL+ IC +DRTK KEIK+EE++HGTI++L++ GT
Sbjct  226   ELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGT  285

Query  1205  SRAKRKASGVLDRLNRGVGFIHTA  1276
             SRA+RKA+G+LDRL + +   HTA
Sbjct  286   SRAQRKANGILDRLRKAMNLTHTA  309


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 14/82 (17%)
 Frame = +2

Query  2    ELQRAVKAVV----SEDGVNAEAIDRAQQALCALRGLHPEQ----------NNNSFPAEF  139
            EL+R +K ++     ED    + ID+ Q+AL ALR     +             S P EF
Sbjct  19   ELKREMKKLLIKIEDEDDFGVQTIDQLQEALSALREATMRKMAKSSSLEMLETVSCPEEF  78

Query  140  RCPLSGELMKDPVVVSSGQTYD  205
            RCPLS ELM+DPVV++SGQ  +
Sbjct  79   RCPLSNELMRDPVVLASGQQQE  100



>ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max]
Length=632

 Score =   290 bits (743),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 165/385 (43%), Positives = 239/385 (62%), Gaps = 13/385 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  248   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLVHTALTPNYVL  307

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED---GVVTDADRHNFLVLLEKMSSSSC-VQRSAAR  472
             + +I+ WC+ NGI  P     C  +      ++D DR     LL+K++S+    QR+AA 
Sbjct  308   KSLIALWCESNGIELPKKQGNCRTKKCGGSSLSDCDRTAISALLDKLTSNDIEQQRAAAG  367

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             ELRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  
Sbjct  368   ELRLLAKRNADNRVCIAEA--GAIPPLVDLLSSSD--PRTQEHAVTALLNLSINESNKGT  423

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +      I  ++D L++G++E R NAAA +F+LS LD NK  IG +GA+  LI LL EG 
Sbjct  424   IVNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVLDENKVQIGAAGAIPALIKLLCEGT  482

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNR--VHVDELLAILAMLSSNHR  1006
                 KD A+AIF L +   NKARA++ G V  L++ + +     VDE LAI+A+L+S+H 
Sbjct  483   PRGKKDAATAIFNLSIYQGNKARAVKAGIVAPLIQFLTDAGGGMVDEALAIMAILASHHE  542

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G+   +  L+ +IR T   RN+EN   +L+++C+ D  +LK  K E  +   + +
Sbjct  543   GRVAIGQAEPIHILVEVIR-TGSPRNRENAAAVLWSLCTGDPLQLKLAK-EHGAEAALQE  600

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVG  1261
             L++NGT RAKRKA  +L+ L R  G
Sbjct  601   LSENGTDRAKRKAGSILELLQRMEG  625



>ref|XP_007204993.1| hypothetical protein PRUPE_ppa003509mg [Prunus persica]
 gb|EMJ06192.1| hypothetical protein PRUPE_ppa003509mg [Prunus persica]
Length=569

 Score =   288 bits (738),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 167/385 (43%), Positives = 236/385 (61%), Gaps = 17/385 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ LS+T LTPN+ +
Sbjct  161   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHGTCPKTQQNLSNTTLTPNYAL  220

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG-VVTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             R +I+ WC+ NGI  P  P   LN+     + A+R    +LL K++S++   QRSAA E+
Sbjct  221   RSLIAQWCEANGIEPPKRPNARLNKTASACSPAERTKIEILLRKLTSANPEDQRSAAGEI  280

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV-  655
             RLL KR    R    E+   A+P+L+   S  D     QE  +T +LNLSI + NK  + 
Sbjct  281   RLLAKRNADNRVAIAEA--GAIPRLVGLLSTPDSR--TQEHAVTALLNLSICEDNKGSII  336

Query  656   --AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
                  P ++ V    L++G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG
Sbjct  337   SCGAVPGIVHV----LKNGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEG  392

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNH  1003
                  KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+L+S+ 
Sbjct  393   TQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMQLLTEPGGGMVDEALAILAILASHP  452

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  +G   AVP L+ +I  T   RN+EN   +L  +CS D+  + E + E    G++ 
Sbjct  453   EGKSAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDQQHIVEAQ-ELGVMGSLM  510

Query  1184  QLAQNGTSRAKRKASGVLDRLNRGV  1258
             +LAQNGT R KRKA+ +L+R+NR V
Sbjct  511   ELAQNGTDRGKRKAAQLLERINRFV  535



>ref|XP_008448400.1| PREDICTED: U-box domain-containing protein 13 [Cucumis melo]
Length=658

 Score =   290 bits (742),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/380 (44%), Positives = 241/380 (63%), Gaps = 14/380 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S +LMKDPV+VS+GQTY+R FI+KWL  G+  CP+TQQVL+  ILTPN+++
Sbjct  258   IPEDFRCPISLDLMKDPVIVSTGQTYERGFIEKWLADGHMTCPKTQQVLTSKILTPNYVL  317

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             R +I+ WC+VNGI   +PP +  +   + +T A+R  +  LL K++S +   +RSAA E+
Sbjct  318   RSLIAQWCEVNGI---EPPQRSSSSQPIELTPAERSKYEALLHKLTSGNIEDKRSAAGEI  374

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L+   S  D  P  QE  +T +LNLSI D+NK+ + 
Sbjct  375   RLLAKRNANNRVAIAEA--GAIPLLVDLLSTTD--PLTQEHAVTALLNLSICDNNKRSIM  430

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
                R    ++  L+ G++E R NAAA +F+LS +D  K +IG SGA+ PLI LL EG   
Sbjct  431   AC-RAAPAIVHVLKWGSMEARENAAATLFSLSVVDEYKIMIGASGAILPLIALLNEGTQR  489

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM-NRV-HVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC    NK +A+R G V +L++ +  +R+  VDE LAILA+L+SN    
Sbjct  490   GKKDAATALFNLCFFQGNKIKAVRGGVVSILMQLLTESRIGMVDEALAILAILASNSEGR  549

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   +VP L++LI  T   RN+EN   +L  +C  D+  L E K E    G +  +A
Sbjct  550   AAIGAAESVPILVNLI-GTGSPRNRENAAAVLVHLCMGDKRHLVEAK-ELGVIGLLMDMA  607

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             +NGT R KRKA+ +LD++NR
Sbjct  608   ENGTDRGKRKATQLLDQINR  627



>ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 14 [Vitis vinifera]
Length=628

 Score =   288 bits (736),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/381 (43%), Positives = 236/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM+DPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  248   IPDDFRCPISLELMRDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  307

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEK-MSSSSCVQRSAARE  475
             + +I+ WC+ NGI  P     C N+     V+D DR     LL+K +  +  +QR+AA E
Sbjct  308   KSLIALWCESNGIELPKNQDNCRNKKTGKFVSDCDRPAIHALLQKLLDGNPEIQRAAAGE  367

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P+L+   S  D  P  QE  +T +LNLSI+++NK  +
Sbjct  368   LRLLAKRNADNRVCIAEA--GAIPRLVELLSSTD--PRTQEHAVTALLNLSINEANKGSI  423

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK +IG +GA+  LIDLL +G  
Sbjct  424   V-ISGAIPDIVDVLKTGSMEARENAAATLFSLSVIDENKVIIGAAGAIPALIDLLCQGTP  482

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NK RA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  483   RGKKDAATAIFNLAIYQGNKVRAVRAGIVVPLMRFLKDAGGGMVDEALAILAILASHQEG  542

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+    P L+ +I+ T   RN+EN   +L+++C+ D   LK I  E  +   + +L
Sbjct  543   KLAIGQAEPFPVLVEVIK-TGSPRNRENAAAVLWSLCTGDAQHLK-IARELGAEEALKEL  600

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++NGT RAKRKA  +L+ L R
Sbjct  601   SENGTDRAKRKAGNILELLQR  621



>gb|ACN40705.1| unknown [Picea sitchensis]
Length=497

 Score =   284 bits (726),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 239/379 (63%), Gaps = 10/379 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
             FP +FRCP+S ELM+DPV+V++GQTYDR  IQ+WL+ G++ CP+TQQVL H  LTPN+++
Sbjct  121   FPEDFRCPISLELMQDPVIVATGQTYDRLCIQRWLDLGHKTCPKTQQVLPHMTLTPNYVL  180

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAARELR  481
             R +I+ WC+ +G+  P       ++   V+  +R +  +L++++ S    VQR+AA E+R
Sbjct  181   RSLIAQWCESHGVEIPSKAGSSRSDSSDVSFGNRTSIDILVQQLYSRQIDVQRAAAEEIR  240

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAE  661
             LL KR    R L  E+   A+P+L+   S  D+    QE  +T +LNLSIH SNK  + +
Sbjct  241   LLAKRNADNRLLIAEA--GAIPQLVKLLSSTDMKT--QEHAVTALLNLSIHSSNKGFIVQ  296

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
                 I+ +ID L+ G+ E R NAAA +F+LS +D NK +IG SGA+ PL+DLL +G    
Sbjct  297   AG-AINRIIDVLKHGSTEARENAAATLFSLSVVDENKVIIGASGAIPPLVDLLRDGTVRG  355

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAIE  1015
              KD A+AIF L +   NK RA+R G V  L+  ++++    VDE LAILA+L+++     
Sbjct  356   KKDAATAIFNLSIYQGNKFRAVRAGVVPPLIALLVDQSIGMVDEALAILAILATHQEGRI  415

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
              +G+  A+  L+ LI   S ARNKEN   +L A+   D + L     +      + +LAQ
Sbjct  416   AIGQQSAIDILVELIHSGS-ARNKENAAAVLLALGMNDSSHLLAAM-QLGVFEYLIELAQ  473

Query  1196  NGTSRAKRKASGVLDRLNR  1252
             NGT+RA+RKA G+LD +++
Sbjct  474   NGTARARRKARGLLDLISK  492



>gb|KHN37791.1| U-box domain-containing protein 14 [Glycine soja]
Length=632

 Score =   287 bits (734),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 165/385 (43%), Positives = 237/385 (62%), Gaps = 13/385 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  248   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLVHTALTPNYVL  307

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED---GVVTDADRHNFLVLLEKMSSSSC-VQRSAAR  472
             + +I+ WC+ NGI  P     C  +      ++D DR     LL+K++S+    QR+AA 
Sbjct  308   KSLIALWCESNGIELPKKQGNCRTKKCGGSSLSDCDRTAISALLDKLTSNDIEQQRAAAG  367

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             ELRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  
Sbjct  368   ELRLLGKRNADNRVCIAEA--GAIPPLVDLLSSSD--PRTQEHAVTALLNLSINESNKGT  423

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +      I  ++D L++G++E R NAAA +F+LS LD NK  IG +GA+  LI LL EG 
Sbjct  424   IVNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVLDENKVQIGAAGAIPALIKLLCEGT  482

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHR  1006
                 KD A+AIF L +   NKARA++ G V  L++  K      VDE LAI+A+L+S+H 
Sbjct  483   PRGKKDAATAIFNLSIYQGNKARAVKAGIVAPLIQFLKDAGGGMVDEALAIMAILASHHE  542

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G+   +  L+ +IR T    N+EN   +L+++C+ D  +LK  K E  +   + +
Sbjct  543   GRVAIGQAEPIHILVEVIR-TGSPCNQENATAVLWSLCTGDPLQLKLAK-EHGAEAALQE  600

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVG  1261
             L++NGT RAKRKA  +L+ L R  G
Sbjct  601   LSENGTDRAKRKAGSILELLQRMEG  625



>ref|XP_006350763.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Solanum tuberosum]
Length=572

 Score =   285 bits (730),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 166/419 (40%), Positives = 248/419 (59%), Gaps = 12/419 (3%)
 Frame = +2

Query  11    RAVKAVVSEDGVNAEAIDRAQQALCALRG-LHPEQNNNSFPAEFRCPLSGELMKDPVVVS  187
             R +K  V  +    ++  R + + C+ +  +         P +FRCP+S ELMKDPV+VS
Sbjct  128   RKIKGFVLTETPEIDSSSREKSSTCSGQASIEATHKAPVIPDDFRCPISLELMKDPVIVS  187

Query  188   SGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQ  367
             SGQTY+R  I+KWL +G+  CP+TQQVL+  ++TPN+++R +I+ WC++NG+  P  P  
Sbjct  188   SGQTYERSSIEKWLEAGHSTCPKTQQVLTSNVVTPNYVLRSLIAQWCEMNGVESPKRPGS  247

Query  368   CLNED-GVVTDADRHNFLVLLEKMSSSSCVQR-SAARELRLLTKRMPSFRALFGESMGAA  541
               N+     T A+      LL K++S S   R SA  E+RLL KR    R    E+   A
Sbjct  248   SPNKSTSACTPAEHSTIENLLRKLTSGSPEDRLSATGEIRLLAKRNADNRVAIAEA--GA  305

Query  542   MPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETR  721
             +P L+   S  D    +QE  +T +LNLSI + NK+ +  T   +  ++  L+ G++E R
Sbjct  306   IPLLVDLLSTPDSR--IQEHAVTALLNLSICEDNKRSIV-TSGAVPGIVHVLKKGSMEAR  362

Query  722   SNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKAR  901
              NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G     KD A+A+F LC+   NK +
Sbjct  363   ENAAAALFSLSVIDENKVIIGTFGAIPPLVTLLSDGTQRGKKDAATALFNLCIYQGNKGK  422

Query  902   AIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSC  1075
             A+R G V  L+  +M      +DE LAILA+LSS+      +G  GAVP L+++I + S 
Sbjct  423   AVRAGVVVTLMGLLMEPQGGMIDEALAILAILSSHPEGKTTIGAAGAVPVLVNVITNGS-  481

Query  1076  ARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
              RNKEN   +L  +CS D+  L +++ E    G +  L QNGT R +RKA+ +L+R+NR
Sbjct  482   PRNKENAAAVLVHLCSGDQHHLVDVQ-ELGIMGPLVDLVQNGTERGRRKATQLLERINR  539



>ref|XP_006424806.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|ESR38046.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|KDO72885.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
 gb|KDO72886.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
 gb|KDO72887.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
Length=564

 Score =   284 bits (727),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 231/381 (61%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+R CP+TQQ L+ T +TPN+++
Sbjct  161   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVL  220

Query  305   RGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARE  475
             R +I+ WC+ NGI  P  P   +        + A+R    +LL K++S S   QRSAA E
Sbjct  221   RSLIAQWCEANGIEPPKRPSSSRPSKTSSACSPAERTKIEILLCKLTSGSPEDQRSAAGE  280

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  +
Sbjct  281   IRLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEDNKGSI  336

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
               +  V S+ +  LR G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG  
Sbjct  337   VSSGAVPSI-VHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQ  395

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G V  L+  +       VDE LAILA+LSS+   
Sbjct  396   RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEG  455

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G   AVP L+ +I + S  RN+EN   +L  +C+ D+  L E K E    G +  L
Sbjct  456   KAAIGAAEAVPVLVEVIGNGS-PRNRENAAAVLVHLCAGDQQYLAEAK-ELGVMGPLVDL  513

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             AQNGT R KRKA+ +L+R++R
Sbjct  514   AQNGTDRGKRKAAQLLERMSR  534



>ref|XP_004143106.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
 gb|KGN47162.1| hypothetical protein Csa_6G191020 [Cucumis sativus]
Length=657

 Score =   286 bits (731),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 239/380 (63%), Gaps = 14/380 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S +LMKDPV+VS+GQTY+R FI+KWL  G+  CP+TQQVL+  ILTPN+++
Sbjct  257   IPEDFRCPISLDLMKDPVIVSTGQTYERGFIEKWLADGHMTCPKTQQVLTSKILTPNYVL  316

Query  305   RGMISNWCKVNGIWFPDPPVQC-LNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             R +I+ WC+ NGI    PP +   ++   +T A+R  +  LL K++S +   +RSAA E+
Sbjct  317   RSLIAQWCEANGI---KPPQRASSSQPSELTPAERSKYEALLHKLTSGNIEDKRSAAGEI  373

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L+   S  D  P  QE  +T +LNLSI D+NK+ + 
Sbjct  374   RLLAKRNANNRVAIAEA--GAIPLLVDLLSTTD--PLTQEHAVTALLNLSICDNNKRSIM  429

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
                R    ++  L+ G++E R NAAA +F+LS +D  K +IG SGA+ PLI LL EG   
Sbjct  430   SC-RAAPGIVHVLKWGSMEARENAAATLFSLSVVDEYKVMIGASGAILPLIALLNEGTQR  488

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM-NRVH-VDELLAILAMLSSNHRAI  1012
               KD A+A+F LC    NK +A+R G V +L++ +  +R+  VDE LAILA+L++N    
Sbjct  489   GKKDAATALFNLCFFQGNKIKAVRGGVVSILMQLLTESRIGMVDEALAILAILANNSEGR  548

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   +VP L++LI  T   RN+EN   +L  +C  D+  L E K E    G +  +A
Sbjct  549   AAIGAAESVPILVNLI-GTGSPRNRENAAAVLVHLCMGDKRHLVEAK-ELGVIGLLVDMA  606

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             +NGT R KRKA+ +LD++NR
Sbjct  607   ENGTDRGKRKATQLLDQINR  626



>ref|XP_004163228.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
Length=657

 Score =   286 bits (731),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 239/380 (63%), Gaps = 14/380 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S +LMKDPV+VS+GQTY+R FI+KWL  G+  CP+TQQVL+  ILTPN+++
Sbjct  257   IPEDFRCPISLDLMKDPVIVSTGQTYERGFIEKWLADGHMTCPKTQQVLTSKILTPNYVL  316

Query  305   RGMISNWCKVNGIWFPDPPVQC-LNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             R +I+ WC+ NGI    PP +   ++   +T A+R  +  LL K++S +   +RSAA E+
Sbjct  317   RSLIAQWCEANGI---KPPQRASSSQPSELTPAERSKYEALLHKLTSGNIEDKRSAAGEI  373

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L+   S  D  P  QE  +T +LNLSI D+NK+ + 
Sbjct  374   RLLAKRNANNRVAIAEA--GAIPLLVDLLSTTD--PLTQEHAVTALLNLSICDNNKRSIM  429

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
                R    ++  L+ G++E R NAAA +F+LS +D  K +IG SGA+ PLI LL EG   
Sbjct  430   SC-RAAPGIVHVLKWGSMEARENAAATLFSLSVVDEYKVMIGASGAILPLIALLNEGTQR  488

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM-NRVH-VDELLAILAMLSSNHRAI  1012
               KD A+A+F LC    NK +A+R G V +L++ +  +R+  VDE LAILA+L++N    
Sbjct  489   GKKDAATALFNLCFFQGNKIKAVRGGVVSILMQLLTESRIGMVDEALAILAILANNSEGR  548

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   +VP L++LI  T   RN+EN   +L  +C  D+  L E K E    G +  +A
Sbjct  549   AAIGAAESVPILVNLI-GTGSPRNRENAAAVLVHLCMGDKRHLVEAK-ELGVIGLLVDMA  606

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             +NGT R KRKA+ +LD++NR
Sbjct  607   ENGTDRGKRKATQLLDQINR  626



>ref|XP_008223401.1| PREDICTED: U-box domain-containing protein 13 [Prunus mume]
Length=666

 Score =   286 bits (731),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 168/385 (44%), Positives = 234/385 (61%), Gaps = 17/385 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ LS+T LTPN+ +
Sbjct  259   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHGTCPKTQQNLSNTTLTPNYAL  318

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG-VVTDADRHNFLVLLEK-MSSSSCVQRSAAREL  478
             R +I+ WC+ NGI  P  P   LN+     + A+R    +LL K MS++   QRSAA E+
Sbjct  319   RSLIAQWCEANGIEPPKRPNARLNKTASACSPAERTKIEILLRKLMSANPEDQRSAAGEI  378

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV-  655
             RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  + 
Sbjct  379   RLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEDNKGSII  434

Query  656   --AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
                  P ++ V    L++G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG
Sbjct  435   SCGAVPGIVHV----LKNGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEG  490

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNH  1003
                  KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+L+S+ 
Sbjct  491   TQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMQLLTEPGGGMVDEALAILAILASHP  550

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  +G   AVP L+ +I  T   RN+EN   +L  +CS D+  + E + E    G++ 
Sbjct  551   EGKSAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDQQHIVEAQ-ELGVMGSLM  608

Query  1184  QLAQNGTSRAKRKASGVLDRLNRGV  1258
             +LAQNGT R KRKA+ +L+R+NR V
Sbjct  609   ELAQNGTDRGKRKAAQLLERINRFV  633



>ref|XP_006436479.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 ref|XP_006436480.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 ref|XP_006436482.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49719.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49720.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49722.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|KDO48790.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
 gb|KDO48791.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
 gb|KDO48792.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
Length=389

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 236/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  8     IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  67

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P     C ++     V+D DR     LL K+++ +   QR+AA E
Sbjct  68    KSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGE  127

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  128   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTD--PRTQEHAVTALLNLSINDSNKGTI  183

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  184   VNA-GAIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTP  242

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  243   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEG  302

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+   +P L+ +IR T   RN+EN   +L+AIC+ D  +LK I  E  +   + +L
Sbjct  303   KTAIGQAEPIPVLMEVIR-TGSPRNRENAAAVLWAICTGDAEQLK-IARELDAEEALKEL  360

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             +++GT RAKRKA  +L+ L R
Sbjct  361   SESGTDRAKRKAGSILELLQR  381



>ref|XP_006350762.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Solanum tuberosum]
Length=661

 Score =   285 bits (728),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 166/419 (40%), Positives = 248/419 (59%), Gaps = 12/419 (3%)
 Frame = +2

Query  11    RAVKAVVSEDGVNAEAIDRAQQALCALRG-LHPEQNNNSFPAEFRCPLSGELMKDPVVVS  187
             R +K  V  +    ++  R + + C+ +  +         P +FRCP+S ELMKDPV+VS
Sbjct  217   RKIKGFVLTETPEIDSSSREKSSTCSGQASIEATHKAPVIPDDFRCPISLELMKDPVIVS  276

Query  188   SGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQ  367
             SGQTY+R  I+KWL +G+  CP+TQQVL+  ++TPN+++R +I+ WC++NG+  P  P  
Sbjct  277   SGQTYERSSIEKWLEAGHSTCPKTQQVLTSNVVTPNYVLRSLIAQWCEMNGVESPKRPGS  336

Query  368   CLNED-GVVTDADRHNFLVLLEKMSSSSCVQR-SAARELRLLTKRMPSFRALFGESMGAA  541
               N+     T A+      LL K++S S   R SA  E+RLL KR    R    E+   A
Sbjct  337   SPNKSTSACTPAEHSTIENLLRKLTSGSPEDRLSATGEIRLLAKRNADNRVAIAEA--GA  394

Query  542   MPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETR  721
             +P L+   S  D    +QE  +T +LNLSI + NK+ +  T   +  ++  L+ G++E R
Sbjct  395   IPLLVDLLSTPDSR--IQEHAVTALLNLSICEDNKRSIV-TSGAVPGIVHVLKKGSMEAR  451

Query  722   SNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKAR  901
              NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G     KD A+A+F LC+   NK +
Sbjct  452   ENAAAALFSLSVIDENKVIIGTFGAIPPLVTLLSDGTQRGKKDAATALFNLCIYQGNKGK  511

Query  902   AIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSC  1075
             A+R G V  L+  +M      +DE LAILA+LSS+      +G  GAVP L+++I + S 
Sbjct  512   AVRAGVVVTLMGLLMEPQGGMIDEALAILAILSSHPEGKTTIGAAGAVPVLVNVITNGS-  570

Query  1076  ARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
              RNKEN   +L  +CS D+  L +++ E    G +  L QNGT R +RKA+ +L+R+NR
Sbjct  571   PRNKENAAAVLVHLCSGDQHHLVDVQ-ELGIMGPLVDLVQNGTERGRRKATQLLERINR  628



>ref|XP_011089810.1| PREDICTED: U-box domain-containing protein 13 [Sesamum indicum]
Length=663

 Score =   285 bits (728),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 235/393 (60%), Gaps = 15/393 (4%)
 Frame = +2

Query  110   QNNNSFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILT  289
             Q N   P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+ T LT
Sbjct  253   QKNLVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHSTCPKTQQALTSTALT  312

Query  290   PNHLIRGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QR  460
             PN+++R +I+ WC+ NGI  P  P   +        + A+R     LL K++S +   QR
Sbjct  313   PNYVLRSLIAQWCEANGIEPPKRPGSSRATKTGSACSPAERTKIEALLYKLTSGNPEDQR  372

Query  461   SAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDS  640
             SAA E+RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + 
Sbjct  373   SAAGEIRLLAKRNADNRVAIAEA--GAIPLLVQLLSTPDSR--TQEHAVTALLNLSICED  428

Query  641   NKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLL  820
             NK  +  +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL
Sbjct  429   NKGSIISSGAVPGI-VHVLKKGSMEARENAAATLFSLSVVDENKVTIGGSGAIPPLVTLL  487

Query  821   EEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLS  994
              EG     KD A+A+F LC+   NK +A+R G + +L+  +       VDE LAILA+L+
Sbjct  488   NEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPILMRLLTEPQGSMVDEALAILAILA  547

Query  995   SNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHG  1174
             S+      +G   AVP L+ +IR+ S  RNKEN   +L  +CS D+  L E + E    G
Sbjct  548   SHPEGKAAIGAAEAVPILVDVIRNGS-PRNKENAAAVLVHLCSGDQQHLVEAQ-ELGVMG  605

Query  1175  TISQLAQNGTSRAKRKASGVLDRLNRGVGFIHT  1273
              +  LAQ+GT R KRKA+ +L+R+NR   F+ T
Sbjct  606   PLLDLAQHGTERGKRKAAQLLERMNR---FVET  635



>ref|XP_011084290.1| PREDICTED: U-box domain-containing protein 14 [Sesamum indicum]
Length=632

 Score =   283 bits (725),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 164/383 (43%), Positives = 236/383 (62%), Gaps = 16/383 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  253   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  312

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVV--TDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC  NG+  P     C N+   +  +D DR     LL+K+++ +   QR+AA E
Sbjct  313   KSLIALWCDSNGVELPKKQGNCRNKRSGISGSDCDRAAIDALLQKLANGNPEQQRAAAGE  372

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDL--QEDIITTILNLSIHDSNKK  649
             LRLL KR    R    E+   A+P L+   S     PDL  QE  +T +LNLSI+++NK 
Sbjct  373   LRLLAKRNADNRVCIAEA--GAIPLLVELLS----SPDLRTQEHAVTALLNLSINEANKG  426

Query  650   LVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
              +      I  ++D L++G+ E R NAAA +F+LS +D NK  IG +GA+ PLIDLL +G
Sbjct  427   TIVNA-GAIPDIVDVLKNGSTEARENAAATLFSLSVVDENKVAIGAAGAIPPLIDLLCQG  485

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNH  1003
                  KD A+AIF L +   NK RA+R G V  L+   K      VDE LAILA+L+S+ 
Sbjct  486   TPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLMRLLKDPGGGMVDEALAILAILASHQ  545

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  +G+   +P+L+ +IR T   RN+EN   IL+++C+     +K  +D   +   + 
Sbjct  546   EGKVAIGQAEPIPTLVEVIR-TGSPRNRENAAAILWSLCTGSAQYIKIARD-LGAEEALK  603

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +L++NGT RAKRKA  VL+ L R
Sbjct  604   ELSENGTDRAKRKAGSVLELLQR  626



>ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 ref|XP_006488304.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis]
 gb|ESR38047.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|KDO72884.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
Length=661

 Score =   284 bits (727),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 231/381 (61%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+R CP+TQQ L+ T +TPN+++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVL  317

Query  305   RGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARE  475
             R +I+ WC+ NGI  P  P   +        + A+R    +LL K++S S   QRSAA E
Sbjct  318   RSLIAQWCEANGIEPPKRPSSSRPSKTSSACSPAERTKIEILLCKLTSGSPEDQRSAAGE  377

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  +
Sbjct  378   IRLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEDNKGSI  433

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
               +  V S+ +  LR G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG  
Sbjct  434   VSSGAVPSI-VHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQ  492

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G V  L+  +       VDE LAILA+LSS+   
Sbjct  493   RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEG  552

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G   AVP L+ +I + S  RN+EN   +L  +C+ D+  L E K E    G +  L
Sbjct  553   KAAIGAAEAVPVLVEVIGNGS-PRNRENAAAVLVHLCAGDQQYLAEAK-ELGVMGPLVDL  610

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             AQNGT R KRKA+ +L+R++R
Sbjct  611   AQNGTDRGKRKAAQLLERMSR  631



>ref|XP_010322360.1| PREDICTED: U-box domain-containing protein 13 isoform X2 [Solanum 
lycopersicum]
Length=572

 Score =   281 bits (720),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 232/380 (61%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VSSGQTY+R  I+KWL +G+  CP+TQQVL+  ++TPN+++
Sbjct  167   IPDDFRCPISLELMKDPVIVSSGQTYERSSIEKWLEAGHSTCPKTQQVLTSNVITPNYVL  226

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG-VVTDADRHNFLVLLEKMSSSSCVQR-SAAREL  478
             R +I+ WC++NG+  P  P    N+     T A+      LL K++S S   R SA  E+
Sbjct  227   RSLIAQWCEMNGVESPKRPGSSPNKSASACTPAEHSTIENLLRKLTSGSPEDRLSATGEI  286

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D    +QE  +T +LNLSI + NK+ + 
Sbjct  287   RLLAKRNADNRVAIAEA--GAIPLLVDLLSTPDSR--IQEHAVTALLNLSICEDNKRSIV  342

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              T   +  ++  L+ G++E R NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G   
Sbjct  343   -TSGAVPGIVHVLKKGSMEARENAAAALFSLSVIDENKVIIGTFGAIPPLVTLLSDGTQR  401

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L+  +       +DE LAILA+LSS+    
Sbjct  402   GKKDAATALFNLCIYQGNKGKAVRAGVVVTLMGLLTEPQGSMIDEALAILAILSSHPEGK  461

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G  GAVP L+++I   S  RNKEN   +L  +CS D+  L +++ E    G +  L 
Sbjct  462   TTIGAAGAVPVLVNVITSGS-PRNKENAAAVLVHLCSGDQHYLVDVQ-ELGIMGPLLDLV  519

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R +RKA+ +L+R+NR
Sbjct  520   QNGTERGRRKATQLLERINR  539



>gb|KHG05758.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=669

 Score =   284 bits (727),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 166/382 (43%), Positives = 231/382 (60%), Gaps = 11/382 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL  G+  CP+TQQ LS   LTPN+++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEQGHGTCPKTQQALSSPALTPNYVL  317

Query  305   RGMISNWCKVNGIWFPD-PPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             R +I+ WC+ NGI  P  P  +        + A+R    +LL K++SSS   QR AA E+
Sbjct  318   RSLIAQWCEANGIEPPKRPSTRPSKTTSACSPAERTKIEILLRKLTSSSPEDQRMAAGEI  377

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+S  S  D    +QE  +T +LNLSI + NK  + 
Sbjct  378   RLLAKRNADNRVAIAEA--GAIPLLVSLLSTPDSR--IQEHAVTALLNLSICEDNKASII  433

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG   
Sbjct  434   SSGAVPGI-VQVLKKGSMEARENAAATLFSLSVVDENKVTIGASGAIPPLVVLLSEGTQR  492

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V +L+  +       VDE LAILA+L+S+    
Sbjct  493   GKKDAATALFNLCIYQGNKGKAVRAGVVPILMRLLTEPGGGMVDEALAILAILASHPEGK  552

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   AVP L+ +I + S  RN+EN   +L  +CS D+  L E + E    G +  LA
Sbjct  553   SAIGAAEAVPVLVGVIGNGS-PRNRENGAAVLVHLCSGDQQHLAEAQ-ELGVKGPLVDLA  610

Query  1193  QNGTSRAKRKASGVLDRLNRGV  1258
             QNGT R KRKA+ +L+R+NR V
Sbjct  611   QNGTDRGKRKAAQLLERMNRFV  632



>ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 14-like [Fragaria 
vesca subsp. vesca]
Length=627

 Score =   282 bits (722),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 235/380 (62%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT +TPN+++
Sbjct  248   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTAITPNYVL  307

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKMS-SSSCVQRSAAREL  478
             + +I+ WC+ NG+  P        + G  V+D DR +   LLEK++  SS  QR+AA EL
Sbjct  308   KSLIALWCESNGVELPKKQGNKSKKPGCSVSDCDRASIDSLLEKLARGSSDEQRAAAGEL  367

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    ++   A+P L+   S  D  P  QE  +T +LNLSI++SNK  + 
Sbjct  368   RLLAKRNADNRVCIADA--GAIPLLVELLSSPD--PRTQEHAVTALLNLSINESNKGAIV  423

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
                  I  +++ L+ G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG   
Sbjct  424   -IAGAIHDIVEVLKHGSMEARENAAATLFSLSVVDENKVQIGAAGAIPALIKLLCEGTPR  482

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRAI  1012
               KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+    
Sbjct  483   GKKDAATAIFNLSIYQGNKARAVRAGIVTPLMSLLKDAGSGMVDEALAILAILASHQEGK  542

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               + +  A+P L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   + +L 
Sbjct  543   VAIAQADAIPILVEVIR-TGFPRNRENAAAVLWSLCTGDLQQLK-LARELGAEEALQELT  600

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             +NGT RAKRKA  VL+ L R
Sbjct  601   ENGTDRAKRKAGNVLELLQR  620



>ref|XP_007009958.1| U-box domain-containing protein 14 [Theobroma cacao]
 gb|EOY18768.1| U-box domain-containing protein 14 [Theobroma cacao]
Length=637

 Score =   283 bits (723),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 168/381 (44%), Positives = 237/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  251   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  310

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSS-SSCVQRSAARE  475
             + +I+ WC+ NG+  P     C +      V+D DR   + LLEK+++ +S  QR+AA E
Sbjct  311   KSLIALWCESNGVELPKKQGTCSSRKPGSSVSDCDRAAIIALLEKLANGNSEQQRAAAGE  370

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+DSNK  +
Sbjct  371   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTDSR--TQEHAVTALLNLSINDSNKGTI  426

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG  
Sbjct  427   VNA-GAIPDIVDVLKNGSMEARENAAATLFSLSVVDENKVAIGAAGAIPALIKLLCEGSP  485

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  486   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRLLKDAGGGMVDEALAILAILASHQEG  545

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+ G +P L+ +IR T   RN+EN   IL+++C+ D  +LK  KD   +   +  L
Sbjct  546   KVAIGQAGPIPVLMEVIR-TGSPRNRENSAAILWSLCTGDSEQLKIAKD-SGAEEALKDL  603

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             +++GT RAKRKA  +L+ L R
Sbjct  604   SESGTDRAKRKAGTILELLQR  624



>ref|XP_009368915.1| PREDICTED: U-box domain-containing protein 14 [Pyrus x bretschneideri]
Length=626

 Score =   282 bits (721),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 234/377 (62%), Gaps = 12/377 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT +TPN+++
Sbjct  243   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTAITPNYVL  302

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG--VVTDADRHNFLVLLEKMS-SSSCVQRSAARE  475
             + +I+ WC+ NG+  P       N      ++D DR +   LLE+++  +S  QR+AA E
Sbjct  303   KSLIALWCESNGVELPKKQGNGKNRKAGSCISDCDRTSIASLLERLAKGNSEEQRAAAGE  362

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  363   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSAD--PRTQEHAVTALLNLSINDSNKVGI  418

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GAL  LI LL EG  
Sbjct  419   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVVDENKVAIGAAGALPALIKLLCEGTP  477

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  478   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMSLLKDAGSGMVDEALAILAILASHQEG  537

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                + +   +P L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   + +L
Sbjct  538   KAAIAQAEPIPVLVEVIR-TGFPRNRENASAVLWSLCTGDLQQLK-LARELGAEEVMKEL  595

Query  1190  AQNGTSRAKRKASGVLD  1240
             +++GT RAKRKA GVL+
Sbjct  596   SESGTDRAKRKALGVLE  612



>ref|XP_004241233.1| PREDICTED: U-box domain-containing protein 13 isoform X1 [Solanum 
lycopersicum]
Length=661

 Score =   282 bits (721),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/419 (39%), Positives = 246/419 (59%), Gaps = 12/419 (3%)
 Frame = +2

Query  11    RAVKAVVSEDGVNAEAIDRAQQALCALR-GLHPEQNNNSFPAEFRCPLSGELMKDPVVVS  187
             R +K  V  +    ++  R + + C+ +  +         P +FRCP+S ELMKDPV+VS
Sbjct  217   RKIKGFVLTETPEIDSSSREKSSTCSGQVSIETTHKAPVIPDDFRCPISLELMKDPVIVS  276

Query  188   SGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQ  367
             SGQTY+R  I+KWL +G+  CP+TQQVL+  ++TPN+++R +I+ WC++NG+  P  P  
Sbjct  277   SGQTYERSSIEKWLEAGHSTCPKTQQVLTSNVITPNYVLRSLIAQWCEMNGVESPKRPGS  336

Query  368   CLNEDG-VVTDADRHNFLVLLEKMSSSSCVQR-SAARELRLLTKRMPSFRALFGESMGAA  541
               N+     T A+      LL K++S S   R SA  E+RLL KR    R    E+   A
Sbjct  337   SPNKSASACTPAEHSTIENLLRKLTSGSPEDRLSATGEIRLLAKRNADNRVAIAEA--GA  394

Query  542   MPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETR  721
             +P L+   S  D    +QE  +T +LNLSI + NK+ +  T   +  ++  L+ G++E R
Sbjct  395   IPLLVDLLSTPDSR--IQEHAVTALLNLSICEDNKRSIV-TSGAVPGIVHVLKKGSMEAR  451

Query  722   SNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKAR  901
              NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G     KD A+A+F LC+   NK +
Sbjct  452   ENAAAALFSLSVIDENKVIIGTFGAIPPLVTLLSDGTQRGKKDAATALFNLCIYQGNKGK  511

Query  902   AIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSC  1075
             A+R G V  L+  +       +DE LAILA+LSS+      +G  GAVP L+++I   S 
Sbjct  512   AVRAGVVVTLMGLLTEPQGSMIDEALAILAILSSHPEGKTTIGAAGAVPVLVNVITSGS-  570

Query  1076  ARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
              RNKEN   +L  +CS D+  L +++ E    G +  L QNGT R +RKA+ +L+R+NR
Sbjct  571   PRNKENAAAVLVHLCSGDQHYLVDVQ-ELGIMGPLLDLVQNGTERGRRKATQLLERINR  628



>ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 14-like [Cicer arietinum]
Length=630

 Score =   281 bits (718),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 166/384 (43%), Positives = 235/384 (61%), Gaps = 12/384 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G+R CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHRTCPKTQQTLLHTALTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVV--TDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I  WC+ NG+  P     C  +      +D DR     LL+K++S+    QR+AA E
Sbjct  307   KSLIGLWCESNGVELPKKQGNCRTKKSGSSHSDCDRTAIKALLDKLTSNDIEQQRAAAGE  366

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  +
Sbjct  367   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSAD--PRTQEHAVTALLNLSINESNKGSI  422

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS LD NK  IG +GA+  LI LL EG  
Sbjct  423   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVLDENKVAIGAAGAIPALIKLLCEGTP  481

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF LC+   NKARA++ G V  L+   K      VDE LAI+A+L+S+H  
Sbjct  482   RGKKDAATAIFNLCIYQGNKARAVKAGIVVSLIRFMKDAGGGMVDEALAIMAILASHHEG  541

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                + +   +P L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   +  L
Sbjct  542   RISISQAEPIPVLVEVIR-TGSPRNRENAAAVLWSVCTGDLMQLK-LAKEHGAEEALQGL  599

Query  1190  AQNGTSRAKRKASGVLDRLNRGVG  1261
             ++NGT RAKRKA  +L+ L R  G
Sbjct  600   SENGTDRAKRKAGSILELLQRMEG  623



>ref|XP_009774572.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Nicotiana sylvestris]
Length=568

 Score =   279 bits (713),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 162/380 (43%), Positives = 234/380 (62%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VSSGQTY+R  I+KWL +G+R CP+TQQVL+   LTPN+++
Sbjct  159   IPDDFRCPISLELMKDPVIVSSGQTYERSSIEKWLEAGHRTCPKTQQVLTSNTLTPNYVL  218

Query  305   RGMISNWCKVNGIWFPDPPVQCLNE-DGVVTDADRHNFLVLLEKMSSSSCVQR-SAAREL  478
             R +I+ WC+ NG+  P  P    N+     T A+      LL K++S     R SA  E+
Sbjct  219   RSLIAQWCEANGVEPPKRPGSLPNKATSACTPAEHSKIEDLLRKLTSGKPEDRLSATGEI  278

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D    +QE  +T +LNLSI + NK+ + 
Sbjct  279   RLLAKRNADNRVAIAEA--GAIPLLVDLLSTPDSR--IQEHAVTALLNLSICEDNKRSIV  334

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              T   +  ++  L+ G++E R NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G   
Sbjct  335   -TSGAVPGIVHVLKKGSMEARENAAAALFSLSVIDENKVIIGTYGAISPLVTLLSDGTQR  393

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+L+S+    
Sbjct  394   GKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGGMVDEALAILAILASHPEGK  453

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G  GAVP L+++I + S  RNKEN + +L  +CS D+  + E+++ E   G +  L 
Sbjct  454   AAIGAAGAVPVLVNVIANGS-PRNKENAVAVLVHLCSGDQHHIVEVQELE-VMGPLLDLV  511

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R KRKA+ +L+R+NR
Sbjct  512   QNGTDRGKRKATQLLERINR  531



>gb|KDP44223.1| hypothetical protein JCGZ_05690 [Jatropha curcas]
Length=663

 Score =   281 bits (720),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 164/383 (43%), Positives = 230/383 (60%), Gaps = 12/383 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+ T LTPN+++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHGTCPKTQQTLTSTALTPNYVL  317

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSCV-QRSAARE  475
             R +I+ WC+ NGI  P  P    +       + A+R    +LL K++S S   QR+AA E
Sbjct  318   RSLIAQWCEANGIEPPKRPSSSRSNKTTSAYSPAERTKIEILLHKLTSGSPEDQRAAAGE  377

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+S  S  D     QE  +T +LNLSI + NK  +
Sbjct  378   IRLLAKRNADNRVAIAEA--GAIPLLVSLLSTPDSR--TQEHAVTALLNLSICEDNKGSI  433

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG  
Sbjct  434   ISAGAVPGI-VHVLKKGSMEARENAAATLFSLSVVDENKVTIGSSGAIPPLVTLLSEGTQ  492

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G V  L+  +       VDE LAILA+L+S+   
Sbjct  493   RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAILAILASHPEG  552

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G   AVP L+ +I + S  RN+EN   +L  +CS D+  L E + E    G++  L
Sbjct  553   KAAIGAAEAVPVLVEVIGNGS-PRNRENAAAVLVHLCSGDQKHLAEAQ-ELGVMGSLIDL  610

Query  1190  AQNGTSRAKRKASGVLDRLNRGV  1258
             AQNGT R KRKA  +L+R++R V
Sbjct  611   AQNGTDRGKRKAQQLLERMSRYV  633



>gb|KHG15771.1| U-box domain-containing 14 -like protein [Gossypium arboreum]
Length=637

 Score =   281 bits (718),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 167/381 (44%), Positives = 238/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  251   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  310

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG--VVTDADRHNFLVLLEKMSS-SSCVQRSAARE  475
             + +I+ WC+ NG+  P     C +       +D DR   + LLEK+++ +S  QR+AA E
Sbjct  311   KSLIALWCESNGVELPKKQGTCRSRKAGSSASDCDRTAIITLLEKLANGNSEQQRAAAGE  370

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  371   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTD--PRTQEHAVTALLNLSINDSNKGTI  426

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG  
Sbjct  427   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIKLLCEGSP  485

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+H  
Sbjct  486   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRLLKDAGGGMVDEALAILAILASHHEG  545

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+   +P LL +IR T+  RN+EN   IL+++C+++  +LK  KD   +   +  L
Sbjct  546   RAAIGQADPIPVLLEVIR-TASPRNRENAAAILWSLCTSNLEQLKIAKD-FGAEEALKDL  603

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++ GT RAKRKA  +L+ L +
Sbjct  604   SETGTDRAKRKAGSILELLQQ  624



>ref|XP_008233282.1| PREDICTED: U-box domain-containing protein 14 [Prunus mume]
Length=628

 Score =   280 bits (717),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 235/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT +TPN+++
Sbjct  248   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTAITPNYVL  307

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG--VVTDADRHNFLVLLEKMS-SSSCVQRSAARE  475
             + +I+ WC+ NG+  P       N+     V+D DR +   LLEK++  +S  QR+AA E
Sbjct  308   KSLIALWCESNGVELPKKQGNGKNKKAGCSVSDCDRASIASLLEKLAKGNSEEQRAAAGE  367

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++SNK  +
Sbjct  368   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSSD--PRTQEHAVTALLNLSINESNKGAI  423

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L+ G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG  
Sbjct  424   VNAG-AIPDIVDVLKKGSMEARENAAATLFSLSVVDENKVAIGAAGAIPSLIKLLCEGTP  482

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARAIR G V  L+   K      VDE LAILA+L+S+   
Sbjct  483   RGKKDAATAIFNLSIYQGNKARAIRAGIVAPLMRLLKDAGSGMVDEALAILAILASHQEG  542

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                + +   +  L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   + +L
Sbjct  543   KMAIAQAEPISVLVEVIR-TGFPRNRENAAAVLWSLCTGDIQQLK-LARELGAEEALKEL  600

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++NGT RAKRKA  VL++L R
Sbjct  601   SENGTDRAKRKAGNVLEQLQR  621



>ref|XP_009343828.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
 ref|XP_009343833.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=672

 Score =   281 bits (720),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 166/383 (43%), Positives = 231/383 (60%), Gaps = 17/383 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I++WL +G+  CP+TQQ LS+T LTPN+ +
Sbjct  267   IPDDFRCPISLELMKDPVIVSTGQTYERSCIERWLEAGHGTCPKTQQSLSNTTLTPNYAL  326

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG-VVTDADRHNFLVLLEK-MSSSSCVQRSAAREL  478
             R +I+ WC+ NGI  P  P    N+     + A+R    +LL K MS +   QRSAA E+
Sbjct  327   RSLIAQWCEANGIEPPKRPNSRPNKTASACSPAERTKIGILLHKLMSVNPEDQRSAAGEI  386

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  + 
Sbjct  387   RLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEDNKGSII  442

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              +   I  ++  L++G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG   
Sbjct  443   SS-GAIPGIVHVLKNGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVKLLSEGTQR  501

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+LSS+H   
Sbjct  502   GKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAILAILSSHHEGK  561

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS---  1183
               +G   AVP L+ +I  T   RN+EN   +L  +CS D+  + E +      G +S   
Sbjct  562   AAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDQQHIIEAQ----KLGVVSLLL  616

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +LAQNGT R KRKA+ +L+R+NR
Sbjct  617   ELAQNGTDRGKRKAAQLLERMNR  639



>gb|KDP30475.1| hypothetical protein JCGZ_16154 [Jatropha curcas]
Length=630

 Score =   280 bits (717),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 258/438 (59%), Gaps = 28/438 (6%)
 Frame = +2

Query  26    VVSEDGVNAEAIDRAQQALCALRGL----HPEQNNN-----SF-------PAEFRCPLSG  157
             V+S +G   E + +    L  L+      +PE +N+     SF       P +FRCP+S 
Sbjct  198   VISSNGDPGEWLQKMSSILVKLKDYVEMGNPETDNSEAEKSSFRHRSPVIPDDFRCPISL  257

Query  158   ELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVN  337
             ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN++++ +I+ WC+ N
Sbjct  258   ELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVLKSLIALWCESN  317

Query  338   GIWFPDPP-VQCLNEDGVVTDA-DRHNFLVLLEKMSSSSC-VQRSAARELRLLTKRMPSF  508
             G+  P         + G    A DR   + LLEK+++ +   QR+AA ELRLL KR    
Sbjct  318   GVELPKQQGAYGTKKFGTSFSACDRIAIVALLEKLANGNPEQQRAAAGELRLLAKRNADN  377

Query  509   RALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLI  688
             R    E+   A+P L+   S  D     QE  +T +LNLSI+D NK  +      I  ++
Sbjct  378   RVCIAEA--GAIPLLVELLSSTDART--QEHAVTALLNLSINDINKGTIVNAG-AIPDIV  432

Query  689   DSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIF  868
             D L++G++E R NAAA +F+LS +D NK  IG +GA+  LIDLL EG     KD A+AIF
Sbjct  433   DVLKNGSMEARENAAATLFSLSVVDENKVAIGGAGAIPALIDLLREGTPRGKKDAATAIF  492

Query  869   VLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVP  1042
              L +   NKARA+R G V  L++  K      VDE LAILA+L+S+      +G+   +P
Sbjct  493   NLSIYQGNKARAVRAGIVLPLMQLLKDAGGGMVDEALAILAILASHQEGKVAIGQAEPIP  552

Query  1043  SLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRK  1222
              L+ +IR T   RN+EN   +L+++C+ D  ++K +  E  +   + +L+++GT RAKRK
Sbjct  553   VLMEVIR-TGSPRNRENAAAVLWSLCTGDSQQVK-LAKEFGAEEALKELSESGTDRAKRK  610

Query  1223  ASGVLDRLNRGVGFIHTA  1276
             A  +L+ + +  G ++ +
Sbjct  611   AGSLLELIQQVDGVVNQS  628



>ref|XP_009353692.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Pyrus x bretschneideri]
Length=564

 Score =   278 bits (711),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 164/380 (43%), Positives = 228/380 (60%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM DPV+VS+GQTY+R  I+KWL +G+  CP+TQQ LS+T LTPN+ +
Sbjct  161   IPDDFRCPISLELMNDPVIVSTGQTYERSCIEKWLEAGHVTCPKTQQSLSNTTLTPNYAL  220

Query  305   RGMISNWCKVNGIWFPD-PPVQCLNEDGVVTDADRHNFLVLLEK-MSSSSCVQRSAAREL  478
             R +I+ WC+ NGI  P  P  + +      + A+R    +LL K MS S   QRSAA E+
Sbjct  221   RSLIAQWCEANGIEPPKRPNSRPIKTTSACSPAERTKIEILLRKLMSVSPEDQRSAAGEI  280

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  + 
Sbjct  281   RLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEENKGSII  336

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              +   I  ++  L++G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG   
Sbjct  337   SS-GAIPGIVHVLKNGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEGTQR  395

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+LSS+    
Sbjct  396   GKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAILAILSSHGEGK  455

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   AVP L+ +I  T   RN+EN   +L  +CS D+  + E + E      + +LA
Sbjct  456   AAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDQQHIVEAQ-ELGVMTLLLELA  513

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R KRKA+ +L+R+NR
Sbjct  514   QNGTDRGKRKAAQLLERMNR  533



>ref|XP_002986139.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
 gb|EFJ12670.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
Length=639

 Score =   280 bits (716),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 239/387 (62%), Gaps = 17/387 (4%)
 Frame = +2

Query  113   NNNSFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTP  292
             +N + P +FRCP+S ELMKDPV+V++GQTY+R +IQKWL++G++ CP TQQ L H +LTP
Sbjct  253   SNPAIPEDFRCPISLELMKDPVIVATGQTYERSYIQKWLDAGHKTCPITQQTLPHLVLTP  312

Query  293   NHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTD----ADRHNFLVLLEKMSSSSC-VQ  457
             N+++R +I  WC+ NGI  P       +  G  +D     DR     LL+K+SS    VQ
Sbjct  313   NYVLRSLICQWCETNGIELPKK--VGTSRGGHSSDLEACGDRVAVEALLQKLSSPQVDVQ  370

Query  458   RSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHD  637
             R A  +LRLL KR    R    E+ G  +P L+   S  D    +QE  +T +LNLSIHD
Sbjct  371   RIAVADLRLLAKRSIDNRICIAEAGG--VPLLIGLLSSTDTR--IQEHAVTALLNLSIHD  426

Query  638   SNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDL  817
              NK  + +    I+ +++ L+SG++E R NAAA +F+LS +D NK  IG++ A+  L++L
Sbjct  427   PNKAQIVQAG-AINPIVEVLKSGSMEARENAAATLFSLSVVDDNKVTIGQTAAIPALVNL  485

Query  818   LEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKI-MNRVHVDELLAILAMLS  994
             L EG     KD A+A+F L +   NKA+A+R G V  L+E +  N   VDE LAILA+L+
Sbjct  486   LREGTPRGKKDAATALFNLSIYQGNKAKAVRAGVVPPLMELLDPNAGMVDEALAILAILA  545

Query  995   SNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHG  1174
             ++      +G+   +P L+ LIR  S ARNKEN   +L A+   D   L  +  ++   G
Sbjct  546   THQEGRVAIGQESTIPLLVELIRSGS-ARNKENAAAVLLALGQNDAAHL--VTAQQYDAG  602

Query  1175  T-ISQLAQNGTSRAKRKASGVLDRLNR  1252
               +++L QNGTSRA+RKAS +L+ +++
Sbjct  603   VPLAELVQNGTSRARRKASLILELMHK  629



>ref|XP_010504312.1| PREDICTED: U-box domain-containing protein 14 [Camelina sativa]
Length=631

 Score =   280 bits (716),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 234/387 (60%), Gaps = 13/387 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P  FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP++Q+ L H  LTPN+++
Sbjct  247   IPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED---GVVTDADRHNFLVLLEKMSSSSC-VQRSAAR  472
             + +I+ WC+ NGI  P     C          +D DR   L LL+K+ + +   QR+AA 
Sbjct  307   KSLIALWCESNGIELPQNQGSCRTTKLGGSSSSDCDRAFVLSLLDKLDNGTTEQQRAAAG  366

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             ELRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++ NK  
Sbjct  367   ELRLLAKRNVDNRVCIAEA--GAIPYLVDLLSSPD--PRTQEHSVTALLNLSINEGNKGA  422

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             + +    I+ +++ LR+G++E R NAAA +F+LS +D NK  IG +GA++ LI LLEEG 
Sbjct  423   IVDAG-AITDIVEVLRNGSMEARENAAATLFSLSVIDENKVTIGAAGAIQALISLLEEGT  481

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHR  1006
                 KD A+AIF LC+   NK+RA++ G V  L    K      VDE LAILA+LS+N  
Sbjct  482   RRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAILAILSTNQE  541

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 + E  ++P L+ +IR T   RN+EN   IL+ +C  +  +L  +  E  +   + +
Sbjct  542   GKTAIAEADSIPVLVDIIR-TGSPRNRENAAAILWYLCIGNMERLN-VAREVGADIALKE  599

Query  1187  LAQNGTSRAKRKASGVLDRLNRGVGFI  1267
             L +NGT RAKRKA+ +L+ + +  G +
Sbjct  600   LTENGTDRAKRKAASLLELIQQIEGVV  626



>ref|XP_002984952.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
 gb|EFJ13827.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
Length=639

 Score =   280 bits (716),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 239/387 (62%), Gaps = 17/387 (4%)
 Frame = +2

Query  113   NNNSFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTP  292
             +N + P +FRCP+S ELMKDPV+V++GQTY+R +IQKWL++G++ CP TQQ L H +LTP
Sbjct  253   SNPAIPEDFRCPISLELMKDPVIVATGQTYERSYIQKWLDAGHKTCPITQQTLPHLVLTP  312

Query  293   NHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVTD----ADRHNFLVLLEKMSSSSC-VQ  457
             N+++R +I  WC+ NGI  P       +  G  +D     DR     LL+K+SS    VQ
Sbjct  313   NYVLRSLICQWCETNGIELPKK--VGTSRGGHSSDLEACGDRVAVEALLQKLSSPQVDVQ  370

Query  458   RSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHD  637
             R A  +LRLL KR    R    E+ G  +P L+   S  D    +QE  +T +LNLSIHD
Sbjct  371   RIAVADLRLLAKRSIDNRICIAEAGG--VPLLIGLLSSTDTR--IQEHAVTALLNLSIHD  426

Query  638   SNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDL  817
              NK  + +    I+ +++ L+SG++E R NAAA +F+LS +D NK  IG++ A+  L++L
Sbjct  427   PNKAQIVQAG-AINPIVEVLKSGSMEARENAAATLFSLSVVDDNKVTIGQTAAIPALVNL  485

Query  818   LEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKI-MNRVHVDELLAILAMLS  994
             L EG     KD A+A+F L +   NKA+A+R G V  L+E +  N   VDE LAILA+L+
Sbjct  486   LREGTPRGKKDAATALFNLSIYQGNKAKAVRAGVVPPLMELLDPNAGMVDEALAILAILA  545

Query  995   SNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHG  1174
             ++      +G+   +P L+ LIR  S ARNKEN   +L A+   D   L  +  ++   G
Sbjct  546   THQEGRVAIGQESTIPLLVELIRSGS-ARNKENAAAVLLALGQNDAAHL--VTAQQYDAG  602

Query  1175  T-ISQLAQNGTSRAKRKASGVLDRLNR  1252
               +++L QNGTSRA+RKAS +L+ +++
Sbjct  603   VPLAELVQNGTSRARRKASLILELMHK  629



>ref|XP_008364702.1| PREDICTED: U-box domain-containing protein 14 [Malus domestica]
Length=622

 Score =   279 bits (714),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/379 (43%), Positives = 233/379 (61%), Gaps = 12/379 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT +TPN+++
Sbjct  243   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTAITPNYVL  302

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMS-SSSCVQRSAARELR  481
             + +I+ WC+ NG+  P    +       ++D DR +   LLE+++  +S  QR+AA ELR
Sbjct  303   KSLIALWCESNGVELPKNKNR--KAGSSISDCDRTSIASLLERLAKGNSEEQRAAAGELR  360

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAE  661
             LL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+DSNK  +  
Sbjct  361   LLAKRNADNRVCIAEA--GAIPLLVELLSSADSRT--QEHAVTALLNLSINDSNKVGIVN  416

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
                 I  ++D L++G++E R NAAA +F+LS +D NK  IG +GAL  LI LL EG    
Sbjct  417   AG-AIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGALPALIKLLCEGTPRG  475

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRAIE  1015
              KD A+AIF L +   NKARA+R G V  L+   K       DE LAILA+L+S+     
Sbjct  476   KKDAATAIFNLSIYQGNKARAVRAGIVPPLMRLLKDAGSGMADEALAILAILASHQEGKA  535

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQ  1195
              + +   +P L+ +IR T   RN+EN   +L+++C+ D  +LK +  E  +   + +L++
Sbjct  536   AIAQAEPIPVLVEVIR-TGFPRNRENAAAVLWSLCTGDLQQLK-LARELGAEEAMKELSE  593

Query  1196  NGTSRAKRKASGVLDRLNR  1252
             NGT RAKRKA  VL+ L R
Sbjct  594   NGTERAKRKAVSVLEFLQR  612



>ref|XP_008789545.1| PREDICTED: U-box domain-containing protein 12 isoform X2 [Phoenix 
dactylifera]
Length=595

 Score =   278 bits (711),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 232/379 (61%), Gaps = 17/379 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G+R CP+TQQ LSHT LTPN ++
Sbjct  219   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHRTCPKTQQNLSHTALTPNFVL  278

Query  305   RGMISNWCKVNGIWFPDPPVQC-LNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAAREL  478
             R +I+ WC  NGI  P     C   + G   D DR     LL+K+ S +   QR+AA EL
Sbjct  279   RSLIAQWCDANGIELPKKQGNCQAKKPGCHPDCDRAGINSLLQKLKSGNQDEQRAAAGEL  338

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L+   S  D  P +QE  +T +LNLSI++SNK  + 
Sbjct  339   RLLAKRNANNRVCIAEA--GAIPFLVELLSSPD--PRIQEHAVTALLNLSINESNKGNIV  394

Query  659   ET---PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
                  PR++ V    L++G++E R NAAA +F+LS +D NK  IG +GA+  L+DLL +G
Sbjct  395   NACAIPRIVGV----LQNGSMEARENAAATLFSLSVVDENKVTIGAAGAIPALVDLLCQG  450

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMN--RVHVDELLAILAMLSSNH  1003
                  KD A+AIF LC+   NK +A+R G V  L+  +++     VDE LAI A+L+ + 
Sbjct  451   SPRGKKDAATAIFNLCIYQGNKVKAVRAGLVEHLMRLLVDPGGGMVDEALAISAVLAGHP  510

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  +     +P L+ +++ T   RN+EN   +L+++C+ D  +L+  + E  +   + 
Sbjct  511   DGKLAIARSNPIPVLVEVMK-TGTPRNRENAAAVLWSLCTGDAQQLRAAR-ESGAEEALK  568

Query  1184  QLAQNGTSRAKRKASGVLD  1240
             +LA  GTSRAKRKA  +L+
Sbjct  569   ELAGTGTSRAKRKAGSLLE  587



>ref|XP_010940632.1| PREDICTED: U-box domain-containing protein 12 [Elaeis guineensis]
Length=634

 Score =   279 bits (714),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 236/379 (62%), Gaps = 17/379 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G+R CP+TQQ LS+T LTPN ++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHRTCPKTQQNLSNTALTPNFVL  317

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED-GVVTDADRHNFLVLLEKMSSSSC-VQRSAAREL  478
             R +I+ WC  NGI  P+    C ++  G  +D DR     LL+K+ S +   QR+AA EL
Sbjct  318   RSLIAQWCDANGIDLPNKQGNCRDKKPGRHSDCDRAGINSLLQKLKSGNQDEQRAAAGEL  377

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  + 
Sbjct  378   RLLAKRNANNRVCIAEA--GAIPFLVELLSSSD--PRTQEHAVTALLNLSINDSNKDNIV  433

Query  659   ET---PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
                  PR++ V    L++G++E + NAAA +F+LS +D NK +IG +GA+  L+DLL  G
Sbjct  434   NAHAIPRIVGV----LQNGSMEAKENAAATLFSLSVVDENKVIIGAAGAIPALVDLLRRG  489

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMN--RVHVDELLAILAMLSSNH  1003
                  KD A+AIF LC+   NK +A++ G V  L+  +++     VDE LAI+A+L+ + 
Sbjct  490   SPRGKKDAATAIFNLCIYQGNKVKAVKAGIVEHLMRLLVDPGGGMVDEALAIVAILAGHP  549

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  + +   +P L+ +++  S +RN+EN   +L+++C+ D  +L+  + E  +   + 
Sbjct  550   DGKLAIAQSNPIPVLVEMVKSGS-SRNRENAAAVLWSLCTGDAQQLRAAR-ESGAEEALK  607

Query  1184  QLAQNGTSRAKRKASGVLD  1240
             +L   GTSRAKRKA  +L+
Sbjct  608   ELTGTGTSRAKRKAGSLLE  626



>gb|EMT21789.1| U-box domain-containing protein 11 [Aegilops tauschii]
Length=575

 Score =   277 bits (709),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/383 (42%), Positives = 237/383 (62%), Gaps = 16/383 (4%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P +FRCP+S ELM+DPV+VS+GQTY+R FIQ+W++ GNR CP+TQQ L +  LTPN++
Sbjct  199   AMPEDFRCPISLELMRDPVIVSTGQTYERAFIQRWIDGGNRTCPKTQQKLQNLTLTPNYV  258

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVV-TDADRHNFLVLLEKMSSSSCVQR-SAARE  475
             +R +I  WC+  GI   +PP +   E   V    DR     L+  +S SS  +R SAA E
Sbjct  259   LRSLILQWCEEKGI---EPPTRSKYEGSSVEVGEDRLAIEALVRNLSCSSLDERKSAAAE  315

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +R L K+    R L  ES   A+P L+   S  D  P  QE  +T++LNLSI+D NK+L+
Sbjct  316   IRSLAKKSTDNRMLLAES--GAIPALVKLLSSKD--PKTQEHAVTSLLNLSIYDQNKELI  371

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKS-GALKPLIDLLEEGH  832
                  ++ + I  LR+G++E R NAAAAIF+LS +D NK +IG + GA++ L++LL+ G 
Sbjct  372   VVGGAIVPI-IQVLRTGSMEARENAAAAIFSLSLIDDNKIMIGSTPGAIEALVELLKSGS  430

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH---VDELLAILAMLSSNH  1003
             S   KD A+A+F LC+   NK RA+R G +  LV+ + +       DE L IL++L S+H
Sbjct  431   SRGRKDAATALFNLCIYQANKVRAVRAGILSPLVQMLQDSSSAGATDEALTILSVLVSHH  490

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  + +   +P L+ L+R +S ARNKEN   IL A+C  D   L  I     +   ++
Sbjct  491   ECKTAIAKAHTIPFLIDLLR-SSQARNKENAAAILLALCKKDAQNLACI-GRLGAQIPLT  548

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +L++ G+ RAKRKA+ +L+ L++
Sbjct  549   ELSKTGSDRAKRKATSLLEHLSK  571



>ref|XP_008789544.1| PREDICTED: U-box domain-containing protein 12 isoform X1 [Phoenix 
dactylifera]
Length=634

 Score =   278 bits (712),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 232/379 (61%), Gaps = 17/379 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G+R CP+TQQ LSHT LTPN ++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHRTCPKTQQNLSHTALTPNFVL  317

Query  305   RGMISNWCKVNGIWFPDPPVQC-LNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAAREL  478
             R +I+ WC  NGI  P     C   + G   D DR     LL+K+ S +   QR+AA EL
Sbjct  318   RSLIAQWCDANGIELPKKQGNCQAKKPGCHPDCDRAGINSLLQKLKSGNQDEQRAAAGEL  377

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L+   S  D  P +QE  +T +LNLSI++SNK  + 
Sbjct  378   RLLAKRNANNRVCIAEA--GAIPFLVELLSSPD--PRIQEHAVTALLNLSINESNKGNIV  433

Query  659   ET---PRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEG  829
                  PR++ V    L++G++E R NAAA +F+LS +D NK  IG +GA+  L+DLL +G
Sbjct  434   NACAIPRIVGV----LQNGSMEARENAAATLFSLSVVDENKVTIGAAGAIPALVDLLCQG  489

Query  830   HSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMN--RVHVDELLAILAMLSSNH  1003
                  KD A+AIF LC+   NK +A+R G V  L+  +++     VDE LAI A+L+ + 
Sbjct  490   SPRGKKDAATAIFNLCIYQGNKVKAVRAGLVEHLMRLLVDPGGGMVDEALAISAVLAGHP  549

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  +     +P L+ +++ T   RN+EN   +L+++C+ D  +L+  + E  +   + 
Sbjct  550   DGKLAIARSNPIPVLVEVMK-TGTPRNRENAAAVLWSLCTGDAQQLRAAR-ESGAEEALK  607

Query  1184  QLAQNGTSRAKRKASGVLD  1240
             +LA  GTSRAKRKA  +L+
Sbjct  608   ELAGTGTSRAKRKAGSLLE  626



>ref|XP_008385130.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=693

 Score =   280 bits (715),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 229/380 (60%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L +T LTPN+ +
Sbjct  288   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHATCPKTQQSLFNTTLTPNYAL  347

Query  305   RGMISNWCKVNGIWFPD-PPVQCLNEDGVVTDADRHNFLVLLEK-MSSSSCVQRSAAREL  478
             R +I+ WC+ NGI  P  P  + +      + A+R    +LL K MS S   QRSAA E+
Sbjct  348   RSLIAQWCEANGIEPPKRPNSRPIKTTSSCSPAERTKIEILLRKLMSVSPEDQRSAAGEI  407

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  + 
Sbjct  408   RLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEENKGSII  463

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              T   I  ++  L++G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG   
Sbjct  464   -TSGAIPGIVHVLKNGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEGTQR  522

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+LSS+    
Sbjct  523   GKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAILAILSSHAEGK  582

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   AVP L+ +I  T   RN+EN   +L  +CS D+  + E + E     ++ +LA
Sbjct  583   AAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDQQHIVEAQ-ELGVMTSLLELA  640

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R KRKA+ +L+R+NR
Sbjct  641   QNGTDRGKRKAAQLLERMNR  660



>ref|XP_004984736.1| PREDICTED: protein spotted leaf 11-like isoform X2 [Setaria italica]
Length=578

 Score =   277 bits (708),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 157/383 (41%), Positives = 236/383 (62%), Gaps = 14/383 (4%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P +FRCP+S +LMKDPV+V++GQTY+R  I++WL +G+  CP+TQQ L +  LTPN++
Sbjct  150   AIPDDFRCPISLDLMKDPVIVATGQTYERGCIERWLEAGHDTCPKTQQKLPNKSLTPNYV  209

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAREL  478
             +R +I+ WC+ NGI  P    Q  N     T A+ +N + LL+K+SS +   QR AA  L
Sbjct  210   LRSLITQWCEANGIEPPKRSAQLSNAPKPCTAAEHNNVVELLQKLSSQNLEDQRGAAGML  269

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             R L KR    RA  G++   A+P L+S  S  DV    QE ++T +LNLSI++ NK  + 
Sbjct  270   RQLAKRSAENRACIGDA--GAIPILVSLLSTTDV--STQEHVVTALLNLSIYEENKARII  325

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              T   +  ++  L+ G++E R N+AA +F+LS +D NK  IG SGA+  L+ LL  G   
Sbjct  326   -TSGAVPGIVHVLKRGSMEARENSAATLFSLSIVDENKVTIGASGAIPALVQLLSNGSQR  384

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V +L+E +       VDE LAILA+LS +    
Sbjct  385   GKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETESGMVDEALAILAILSGHPEGK  444

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS---  1183
               +G   A+P L+ +IR+ S ARNKEN   ++  +C+ ++ +    + +E   G +S   
Sbjct  445   AAIGAASAIPVLVGVIRNGS-ARNKENAAAVMVHLCNGEQQQQHLAEAQE--QGIVSLLE  501

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +LA++GT R KRKA  +L+R+NR
Sbjct  502   ELAESGTDRGKRKAIQLLERMNR  524



>ref|XP_009774522.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Nicotiana sylvestris]
Length=665

 Score =   278 bits (712),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 162/380 (43%), Positives = 234/380 (62%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VSSGQTY+R  I+KWL +G+R CP+TQQVL+   LTPN+++
Sbjct  256   IPDDFRCPISLELMKDPVIVSSGQTYERSSIEKWLEAGHRTCPKTQQVLTSNTLTPNYVL  315

Query  305   RGMISNWCKVNGIWFPDPPVQCLNE-DGVVTDADRHNFLVLLEKMSSSSCVQR-SAAREL  478
             R +I+ WC+ NG+  P  P    N+     T A+      LL K++S     R SA  E+
Sbjct  316   RSLIAQWCEANGVEPPKRPGSLPNKATSACTPAEHSKIEDLLRKLTSGKPEDRLSATGEI  375

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D    +QE  +T +LNLSI + NK+ + 
Sbjct  376   RLLAKRNADNRVAIAEA--GAIPLLVDLLSTPDSR--IQEHAVTALLNLSICEDNKRSIV  431

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              T   +  ++  L+ G++E R NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G   
Sbjct  432   -TSGAVPGIVHVLKKGSMEARENAAAALFSLSVIDENKVIIGTYGAISPLVTLLSDGTQR  490

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+L+S+    
Sbjct  491   GKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGGMVDEALAILAILASHPEGK  550

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G  GAVP L+++I + S  RNKEN + +L  +CS D+  + E+++ E   G +  L 
Sbjct  551   AAIGAAGAVPVLVNVIANGS-PRNKENAVAVLVHLCSGDQHHIVEVQELE-VMGPLLDLV  608

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R KRKA+ +L+R+NR
Sbjct  609   QNGTDRGKRKATQLLERINR  628



>ref|XP_009391057.1| PREDICTED: U-box domain-containing protein 12 [Musa acuminata 
subsp. malaccensis]
Length=641

 Score =   278 bits (710),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 156/375 (42%), Positives = 233/375 (62%), Gaps = 11/375 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R +IQKWL+SG++ CP+TQQ LSH  LTPN ++
Sbjct  257   IPDDFRCPISLELMKDPVIVSTGQTYERSYIQKWLDSGHKTCPKTQQTLSHATLTPNFVL  316

Query  305   RGMISNWCKVNGIWFPDPPVQCL-NEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAAREL  478
             + +I+ WC  NGI  P     C  ++ G  +D +R    VLL+++++ +   QR+AA EL
Sbjct  317   KSLIAQWCDANGIELPKKQGSCQESKPGNSSDCNRAGINVLLQRLANGNQEEQRAAAGEL  376

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++ NK L+ 
Sbjct  377   RLLAKRNADNRICIAEA--GAIPILVQLLSSPD--PRTQEHAVTALLNLSINEDNKGLIV  432

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             +  + I  ++++L S ++E R NAAAA+F+LS +D NK LIG++GA+  LI+LL  G   
Sbjct  433   KA-KAIPKIVEALESESMEARENAAAALFSLSVVDQNKVLIGEAGAIPALINLLCHGSPR  491

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK  A++ G V  L+  +++     VDE LAILA+L+S+    
Sbjct  492   GKKDAATAIFNLCIFKGNKVIAVKAGIVVYLIRMLVDPSGGMVDEALAILAILASSQEGK  551

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +     +P ++ L++ T  AR +EN   +L+++C  D  +L+    E  +   +  L 
Sbjct  552   TAITHSNPIPLMVKLMK-TGSARVRENAAALLFSLCGGDEQQLRAAV-ESGAEEALKDLM  609

Query  1193  QNGTSRAKRKASGVL  1237
             + GT RAKRKAS +L
Sbjct  610   ETGTERAKRKASSLL  624



>ref|XP_006655674.1| PREDICTED: U-box domain-containing protein 12-like [Oryza brachyantha]
Length=529

 Score =   275 bits (702),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 238/381 (62%), Gaps = 11/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+R  IQKWL+SG++ CP+TQQ LSHT LTPN ++
Sbjct  153   IPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQPLSHTSLTPNFVL  212

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +IS WC+VNGI  P       ++     +D D    + L+ ++ S +   QR+AA E+
Sbjct  213   KSLISQWCEVNGIELPKNKQNSRDKKATKSSDYDHAGLVSLMNRLRSGNQDEQRAAAGEI  272

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S +D  P  QE  +T +LNLSIH++NK  + 
Sbjct  273   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSLD--PRTQEHAVTALLNLSIHENNKASIV  328

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ++   I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  329   DS-HAIPKIVEVLKTGSMEARENAAATLFSLSVVDENKVTIGAAGAITPLINLLCDGSPR  387

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G V  L+  +++     +DE L++L++L+ N    
Sbjct  388   GKKDAATAIFNLCIYQGNKVRAVKAGIVIHLMNFLVDPTGGMIDEALSLLSILAGNPEGK  447

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               + +   +P L+ +I+ T   RN+EN   IL+ +CSAD  +    K    +   + +L+
Sbjct  448   VVIAQSEPIPPLIEVIK-TGSPRNRENAAAILWLLCSADAEQTLAAK-AAGAEDALKELS  505

Query  1193  QNGTSRAKRKASGVLDRLNRG  1255
             + GT RAKRKAS +L+ + + 
Sbjct  506   ETGTDRAKRKASSILELMRQA  526



>gb|KDO48789.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
Length=551

 Score =   275 bits (704),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 236/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  170   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  229

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P     C ++     V+D DR     LL K+++ +   QR+AA E
Sbjct  230   KSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGE  289

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  290   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTD--PRTQEHAVTALLNLSINDSNKGTI  345

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  346   VNA-GAIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTP  404

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  405   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEG  464

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+   +P L+ +IR T   RN+EN   +L+AIC+ D  +LK I  E  +   + +L
Sbjct  465   KTAIGQAEPIPVLMEVIR-TGSPRNRENAAAVLWAICTGDAEQLK-IARELDAEEALKEL  522

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             +++GT RAKRKA  +L+ L R
Sbjct  523   SESGTDRAKRKAGSILELLQR  543



>ref|XP_010521829.1| PREDICTED: U-box domain-containing protein 12 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score =   273 bits (698),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 174/426 (41%), Positives = 247/426 (58%), Gaps = 23/426 (5%)
 Frame = +2

Query  11    RAVKAVVSEDGVNAEAIDRAQQALCALRG---LHPEQNNNSFPAEFRCPLSGELMKDPVV  181
             + +K  V  +  N EA  R ++   + RG      +Q N   P +FRCP+S ELMKDPV+
Sbjct  36    KRIKDFVQTENPNLEAPARQRRPPPSCRGPRLQEGDQKNPFIPEDFRCPISLELMKDPVI  95

Query  182   VSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP  361
             VSSGQTY+R  I+KWL  G+  CP+TQQ L+ T +TPN+++R +I+ WC+ NGI  P  P
Sbjct  96    VSSGQTYERACIEKWLEEGHLTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEPPKRP  155

Query  362   VQ--CLNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAARELRLLTKRMPSFRALFGESM  532
              +          + ADR+    +L K+ S +   QRSAA E+RLL KR    R     + 
Sbjct  156   SRSQPSKASSSASPADRNKIEEILHKLGSQNPEEQRSAAGEIRLLAKRSTDNRIAIAAAG  215

Query  533   GAA-MPKLLS-PFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSG  706
                 + KLLS P SR       QE  +T +LNLSI ++NK  +  T   +  ++  LR G
Sbjct  216   AIPLLVKLLSTPDSRT------QEHAVTALLNLSICEANKGRIV-TSGAVPGIVQVLRRG  268

Query  707   AIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLH  886
             ++E R NAAA +F+LS +D NK  IG  GA+ PL+ LL EG     KD A+A+F LC+  
Sbjct  269   SMEARENAAATLFSLSVMDENKVTIGSLGAIPPLVTLLSEGTQRGKKDAATALFNLCIFQ  328

Query  887   ENKARAIRDGAV----RVLVEKIMNRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLS  1054
              NK +A+R G V    R+L E   +   VDE LAILA+LSS+      +G   AVP L+ 
Sbjct  329   GNKGKAVRAGLVPELMRLLTEP--DGGMVDEALAILAILSSHPEGKVAIGSANAVPVLVE  386

Query  1055  LIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGV  1234
              IR+   ARNKEN   +L  +CS D++ L E++ +    G + ++A++ T R KRKA  +
Sbjct  387   FIRN-GLARNKENAAAVLVHLCSWDQSHLVEVQ-KLGIMGPLIEMAESSTDRGKRKAGQL  444

Query  1235  LDRLNR  1252
             LDR++R
Sbjct  445   LDRISR  450



>ref|XP_006436478.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49718.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
Length=551

 Score =   275 bits (703),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 236/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  170   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  229

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P     C ++     V+D DR     LL K+++ +   QR+AA E
Sbjct  230   KSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGE  289

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  290   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTD--PRTQEHAVTALLNLSINDSNKGTI  345

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  346   VNA-GAIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTP  404

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  405   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEG  464

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+   +P L+ +IR T   RN+EN   +L+AIC+ D  +LK I  E  +   + +L
Sbjct  465   KTAIGQAEPIPVLMEVIR-TGSPRNRENAAAVLWAICTGDAEQLK-IARELDAEEALKEL  522

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             +++GT RAKRKA  +L+ L R
Sbjct  523   SESGTDRAKRKAGSILELLQR  543



>ref|XP_008466866.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis melo]
Length=511

 Score =   274 bits (700),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 171/427 (40%), Positives = 245/427 (57%), Gaps = 21/427 (5%)
 Frame = +2

Query  5     LQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS---FPAEFRCPLSGELMKDP  175
             L + +K  V  + +  EA  R +    +  G      NN     P +FRCP+S ELM+DP
Sbjct  55    LLKKIKDFVQTENLETEAPSRDKSPPASCSGHVSNDKNNKTPIIPDDFRCPISLELMRDP  114

Query  176   VVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPD  355
             V+VS+GQTY+R  I+KWL +G+  CP+TQQ LS T LTPN+++R +I+ WC+ NGI  P 
Sbjct  115   VIVSTGQTYERSCIEKWLEAGHVTCPKTQQNLSSTTLTPNYVLRSLIAQWCEANGIEPPK  174

Query  356   PP--VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRALFGE  526
              P   +        + A+R    +LL K++S +   QRSAA E+RLL KR    R    E
Sbjct  175   RPSSARTCRSSSSCSAAERTKIDILLCKLASGNPEDQRSAAGEIRLLAKRNADNRVAIAE  234

Query  527   SMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSG  706
             +   A+P L+   S  D    +QE  +T +LNLSI + NK  +  +  V  +++  L+ G
Sbjct  235   A--GAIPLLVGLLSTPDSR--VQEHAVTALLNLSICEDNKGSIISSGAVPGIVL-VLKKG  289

Query  707   AIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLH  886
             ++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG     KD A+A+F LC+  
Sbjct  290   SMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQ  349

Query  887   ENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLI  1060
              NK +A+R G V  L++ +       VDE LAILA+L+S+      +    AVP L+ +I
Sbjct  350   GNKGKAVRAGVVPTLMQLLTEPGTGMVDEALAILAILASHPEGKAAIRSAKAVPVLVDVI  409

Query  1061  RDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ---LAQNGTSRAKRKASG  1231
               T   RN+EN   +L  +CS D   L E ++     G IS    LA+NGT R KRKA+ 
Sbjct  410   -GTGSPRNRENAAAVLVHLCSGDEQHLVEARE----LGVISSLIDLARNGTDRGKRKAAQ  464

Query  1232  VLDRLNR  1252
             +L+R+NR
Sbjct  465   LLERINR  471



>ref|XP_004964257.1| PREDICTED: U-box domain-containing protein 12-like [Setaria italica]
Length=600

 Score =   276 bits (706),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 239/383 (62%), Gaps = 15/383 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+RP IQKWL+SG++ CP+TQQ LSHT LTPN ++
Sbjct  224   IPDEFRCPISLELMQDPVIVSSGQTYERPCIQKWLDSGHKTCPKTQQPLSHTSLTPNFVL  283

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +I+ WC+ NGI  P       ++     +D D    + L+ ++   +   QR+AA E+
Sbjct  284   KSLIAQWCEANGIELPKNKANSQDKKAAKSSDYDHAGLVSLMTRLRGGNQDEQRAAAGEI  343

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S  D  P  QE  +T +LNLSIH++NK  + 
Sbjct  344   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSSD--PRTQEHAVTALLNLSIHENNKASIV  399

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              +   I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  400   GS-HAIPKIVEVLKTGSMEARENAAATLFSLSVVDENKVTIGGAGAIPPLINLLCDGSPR  458

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G V  L+  +++      DE L +LA+L+ N  A 
Sbjct  459   GKKDAATAIFNLCIYQGNKIRAVKAGIVIHLMNFLVDPTGGMTDEALTLLAILAGNPEAR  518

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSAD--RTKLKEIKDEESSHGTISQ  1186
               + +   +P L+ +I+ T   RN+EN   IL+++C AD  +TK  ++   E +   + +
Sbjct  519   AVIAQSDPIPPLVEVIK-TESPRNRENAAAILWSLCCADVEQTKAAKVAGAEDA---LKE  574

Query  1187  LAQNGTSRAKRKASGVLDRLNRG  1255
             L+++GT RAKRK+S +L+ + + 
Sbjct  575   LSESGTDRAKRKSSSILELMRQA  597



>ref|XP_009353694.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Pyrus x bretschneideri]
Length=661

 Score =   278 bits (710),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 164/380 (43%), Positives = 228/380 (60%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM DPV+VS+GQTY+R  I+KWL +G+  CP+TQQ LS+T LTPN+ +
Sbjct  258   IPDDFRCPISLELMNDPVIVSTGQTYERSCIEKWLEAGHVTCPKTQQSLSNTTLTPNYAL  317

Query  305   RGMISNWCKVNGIWFPD-PPVQCLNEDGVVTDADRHNFLVLLEK-MSSSSCVQRSAAREL  478
             R +I+ WC+ NGI  P  P  + +      + A+R    +LL K MS S   QRSAA E+
Sbjct  318   RSLIAQWCEANGIEPPKRPNSRPIKTTSACSPAERTKIEILLRKLMSVSPEDQRSAAGEI  377

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  + 
Sbjct  378   RLLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEENKGSII  433

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              +   I  ++  L++G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG   
Sbjct  434   SS-GAIPGIVHVLKNGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEGTQR  492

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+LSS+    
Sbjct  493   GKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAILAILSSHGEGK  552

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G   AVP L+ +I  T   RN+EN   +L  +CS D+  + E + E      + +LA
Sbjct  553   AAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDQQHIVEAQ-ELGVMTLLLELA  610

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R KRKA+ +L+R+NR
Sbjct  611   QNGTDRGKRKAAQLLERMNR  630



>ref|XP_004142402.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus]
 gb|KGN52247.1| hypothetical protein Csa_5G622620 [Cucumis sativus]
Length=627

 Score =   276 bits (707),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 234/381 (61%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM+DPV+VS+GQTY+R  IQKWL++G++ CP++QQ L HT LTPN+++
Sbjct  246   IPDDFRCPISLELMRDPVIVSTGQTYERSCIQKWLDAGHKTCPKSQQALLHTALTPNYVL  305

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV--VTDADRHNFLVLLEKMSSSSCVQ-RSAARE  475
             + +I+ WC+ NG+  P     C N+     V+D DR     LL K+ + S  Q RSAA E
Sbjct  306   KSLIALWCENNGVELPKKQGSCRNKKAGNNVSDCDRSAIDALLVKLVNGSPEQKRSAAGE  365

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+D NK+ +
Sbjct  366   LRLLAKRNSDNRICIAEA--GAIPFLVELLSSNDTRT--QEHAVTALLNLSINDGNKRTI  421

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              +  R I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG  
Sbjct  422   VDL-RAIPAVVEVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALITLLREGTP  480

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARAIR G V  L+   K      VDE LAILA+L+++H  
Sbjct  481   RGKKDAATAIFNLSIYQGNKARAIRAGIVNPLMGFLKDAGGGMVDEALAILAILATHHEG  540

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +GE   +  LL  IR T   RN+EN   +L+++CS D  +LK +  E  +   + ++
Sbjct  541   KTAIGEAEPMAILLEFIR-TGSPRNRENAAAVLWSLCSTDFEQLK-LAREHGAEEALKEV  598

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++NGT RAKRKA  +L+   R
Sbjct  599   SENGTERAKRKAGSILELFQR  619



>emb|CDP09042.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   277 bits (709),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 173/416 (42%), Positives = 244/416 (59%), Gaps = 17/416 (4%)
 Frame = +2

Query  35    EDGVNAEAIDRAQQALCALRGLHPEQNNNS--FPAEFRCPLSGELMKDPVVVSSGQTYDR  208
             +D V  E  D    + C+ + L  E N+ S   P +FRCP+S ELM+DPV+VS+GQTY+R
Sbjct  220   KDFVQTENPDSDLPSSCSAQ-LSSEGNHKSPFIPEDFRCPISLELMRDPVIVSTGQTYER  278

Query  209   PFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPP--VQCLNED  382
               I+KWL +G+  CP+T+Q L+ T +TPN+++R +I+ WC+ NGI  P  P   Q     
Sbjct  279   SCIEKWLEAGHGTCPKTRQALTSTAVTPNYVLRSLIAQWCEANGIEPPKRPGSSQPNKTT  338

Query  383   GVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLS  559
                  ADR    VLL K++S +   QRSAA E+RLL KR    R    E    A+P L+ 
Sbjct  339   SACFPADRTKIDVLLHKLTSGNPEDQRSAAGEIRLLAKRNADNRVAIAEV--GAIPLLVG  396

Query  560   PFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAA  739
               S  D     QE  +T +LNLSI + NK  +  +  V  + +  L+ G++E R NAAA 
Sbjct  397   LLSTPDSR--TQEHAVTALLNLSICEDNKGRIINSGAVPGI-VHVLKKGSMEARENAAAT  453

Query  740   IFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGA  919
             +F+LS +D NK  IG SGA+ PL+ LL EG     KD A+A+F LC+   NK +A+R G 
Sbjct  454   LFSLSVVDENKVTIGTSGAIPPLVMLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGV  513

Query  920   VRVLVEKIMNRVH---VDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKE  1090
             V  L+ +++       VDE LAILA+L+S+      +G   AVP L+ +I + S  RNKE
Sbjct  514   VPTLM-RLLTEPQGGMVDEALAILAILASHPEGKAAIGAAEAVPVLVDVIGNGS-PRNKE  571

Query  1091  NCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASGVLDRLNRGV  1258
             N   +L  +CS D+  L E + E    G +  LAQNGT R +RKA+ +L+R+NR V
Sbjct  572   NAAAVLVHLCSGDQQHLVEAQ-ELGVMGYLLDLAQNGTERGRRKATQLLERMNRYV  626



>ref|XP_004157535.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus]
Length=627

 Score =   276 bits (707),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 234/381 (61%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM+DPV+VS+GQTY+R  IQKWL++G++ CP++QQ L HT LTPN+++
Sbjct  246   IPDDFRCPISLELMRDPVIVSTGQTYERSCIQKWLDAGHKTCPKSQQALLHTALTPNYVL  305

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV--VTDADRHNFLVLLEKMSSSSCVQ-RSAARE  475
             + +I+ WC+ NG+  P     C N+     V+D DR     LL K+ + S  Q RSAA E
Sbjct  306   KSLIALWCENNGVELPKKQGSCRNKKAGNNVSDCDRSAIDALLVKLVNGSPEQKRSAAGE  365

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+D NK+ +
Sbjct  366   LRLLAKRNSDNRICIAEA--GAIPFLVELLSSNDTRT--QEHAVTALLNLSINDGNKRTI  421

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              +  R I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG  
Sbjct  422   VDL-RAIPAVVEVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALITLLREGTP  480

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARAIR G V  L+   K      VDE LAILA+L+++H  
Sbjct  481   RGKKDAATAIFNLSIYQGNKARAIRAGIVNPLMGFLKDAGGGMVDEALAILAILATHHEG  540

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +GE   +  LL  IR T   RN+EN   +L+++CS D  +LK +  E  +   + ++
Sbjct  541   KTAIGEAEPMAILLEFIR-TGSPRNRENAAAVLWSLCSTDFEQLK-LAREHGAEEALKEV  598

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++NGT RAKRKA  +L+   R
Sbjct  599   SENGTERAKRKAGSILELFQR  619



>ref|XP_003557288.1| PREDICTED: U-box domain-containing protein 12 [Brachypodium distachyon]
Length=607

 Score =   276 bits (705),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/376 (41%), Positives = 233/376 (62%), Gaps = 11/376 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+R  IQKWL+SG++ CP+ Q  LSHT LTPN ++
Sbjct  231   IPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKMQVPLSHTSLTPNFVL  290

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +I+ WC+ NGI  P     C ++  V  +D D    + L+ ++ S +   QR+AA E+
Sbjct  291   KSLIAQWCEANGIELPKNKANCRDKKAVKSSDYDNAGLVSLMNRLRSGNQDEQRAAAGEI  350

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S  D  P  QE  +T +LNLSIH++NK  + 
Sbjct  351   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSSD--PRTQEHAVTALLNLSIHENNKASIV  406

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ++   I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  407   DS-NAIPKIVEVLKTGSMEARENAAATLFSLSVVDENKVTIGAAGAIPPLINLLCDGSPR  465

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G +  L+  +++     +DE L +LA+L+ N    
Sbjct  466   GKKDAATAIFNLCIYQGNKVRAVKAGIIIHLMNFLVDPTGGMLDEALTLLAILAGNPEGK  525

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               + +   +P L+ +IR T   RN+EN   IL+++CSAD  +    +        + +L+
Sbjct  526   AVITQSEPIPPLVEVIR-TGSPRNRENAAAILWSLCSADSEQTMAAR-AAGGEDALKELS  583

Query  1193  QNGTSRAKRKASGVLD  1240
             + GT RAKRKAS +L+
Sbjct  584   ETGTDRAKRKASSILE  599



>ref|XP_003537996.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max]
 gb|KHN21961.1| U-box domain-containing protein 13 [Glycine soja]
Length=661

 Score =   277 bits (708),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 230/381 (60%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+ T+LTPN+++
Sbjct  256   IPDDFRCPISLELMKDPVIVSTGQTYERTCIEKWLQAGHGTCPKTQQTLTSTVLTPNYVL  315

Query  305   RGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARE  475
             R +I+ WC+ NGI  P  P   Q        + A++     LL+K++S S   QRSAA E
Sbjct  316   RSLIAQWCEANGIEPPKRPSDSQPSKSASAYSPAEQSKIESLLQKLTSVSPEDQRSAAGE  375

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+++NK  +
Sbjct  376   IRLLAKRNADNRVAIAEA--GAIPLLVGLLSVPDSR--TQEHAVTALLNLSIYENNKGSI  431

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
               +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG  GA+ PL+ LL EG+ 
Sbjct  432   VSSGAVPGI-VHVLKKGSMEARENAAATLFSLSVIDENKVTIGSLGAIPPLVTLLSEGNQ  490

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G +  L+  +       VDE LAILA+L+S+   
Sbjct  491   RGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAILAILASHPEG  550

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +    AVP L+  I + S  RNKEN   +L  +CS D+  L + + E    G + +L
Sbjct  551   KATIRASEAVPVLVEFIGNGS-PRNKENAAAVLVHLCSGDQQYLAQAQ-ELGVMGPLLEL  608

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             AQNGT R KRKA  +L+R++R
Sbjct  609   AQNGTDRGKRKAGQLLERMSR  629



>gb|EYU39871.1| hypothetical protein MIMGU_mgv1a002720mg [Erythranthe guttata]
Length=644

 Score =   276 bits (707),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 165/389 (42%), Positives = 238/389 (61%), Gaps = 20/389 (5%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ LSHT LTPN+++
Sbjct  256   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLSHTALTPNYVL  315

Query  305   RGMISNWCKVNGIWFPDPPVQCLNE----------DGVVTDADRHNFLVLLEKMSSSSC-  451
             + +I+ WC+ NG+  P     C N               +D DR     LL+K+++ +  
Sbjct  316   KSLIALWCESNGVELPKKQGNCRNRRSSTTSTASGGTSSSDCDRAAISALLKKLANGNPD  375

Query  452   VQRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSI  631
              QR+AA ELRLL KR    R    E+   A+P L+   S  D+    QE  +T +LNLSI
Sbjct  376   QQRAAAGELRLLAKRNADNRVCIAEA--GAIPLLVELLSSQDLRT--QEHAVTALLNLSI  431

Query  632   HDSNKKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLI  811
             H+SNK ++      IS ++D L++G+ E R NAAA +F+LS +D NK  IG +GA+ PLI
Sbjct  432   HESNKGIIVNAG-AISDIVDVLKNGSTEARENAAATLFSLSVVDENKVAIGAAGAIAPLI  490

Query  812   DLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNR--VHVDELLAILA  985
             DLL  G     KD A+AIF L +   NK RA+R G V  L+  + ++    VDE LAILA
Sbjct  491   DLLCHGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLIGLLKDQGGGMVDESLAILA  550

Query  986   MLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEES  1165
             +L+S+      +G+   +P L+ +IR T   RN+EN   IL+++C+ +   LK +  E  
Sbjct  551   ILASHQEGKVALGQAEPIPILVEVIR-TGSPRNRENAAAILWSLCTGNSQCLK-LARELG  608

Query  1166  SHGTISQLAQNGTSRAKRKASGVLDRLNR  1252
             +   + +L++NGT RAKRKA  VL+ + R
Sbjct  609   AEEALKELSENGTDRAKRKAGSVLELIQR  637



>ref|XP_011000261.1| PREDICTED: U-box domain-containing protein 13-like [Populus euphratica]
Length=665

 Score =   277 bits (708),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 164/384 (43%), Positives = 229/384 (60%), Gaps = 14/384 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+ T  TPN+++
Sbjct  262   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLGAGHDTCPKTQQKLTSTAPTPNYVL  321

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVVT--DADRHNFLVLLEKMSSSSCV--QRSAAR  472
             R +I+ WC+ NGI  P  P        V T   A+R    +LL K+ +S C+  QRSAA 
Sbjct  322   RSLIAQWCEANGIEPPKRPSSSGTSKTVSTCSPAERTKIEILLHKL-TSGCLEDQRSAAG  380

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             E+RLL K     R    ++   A+P L+   S  D  P +QE  IT +LNLSI + NK  
Sbjct  381   EIRLLAKHNADNRVAIAQA--GAIPLLVGLLSTPD--PHIQEHAITALLNLSICEDNKGS  436

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +     V  + +  L+ G++E R NAAA +F+LS +D NK  IG  GA+ PL+ LL EG 
Sbjct  437   IVSAGAVPGI-VHVLKKGSMEARENAAATLFSLSVVDENKVTIGFLGAIPPLVTLLSEGT  495

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNR--VHVDELLAILAMLSSNHR  1006
                 KD A+A+F LC+   NK +A+R G V  L+  +       VDE LAILA+L+S+  
Sbjct  496   QRGKKDAATALFNLCIFQGNKGKAVRAGVVPTLMCLLTETGGGMVDEALAILAILASHPE  555

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G   AVP L+ +IR+ S  RN+EN   +L  +CS D+  + E + E    G +  
Sbjct  556   GKATIGAAEAVPVLVEVIRNGS-PRNRENAAAVLVHLCSGDQKHMVEAQ-EHGVMGPLVD  613

Query  1187  LAQNGTSRAKRKASGVLDRLNRGV  1258
             LAQNGT R KRKA  +L+R++R V
Sbjct  614   LAQNGTDRGKRKAQQLLERISRFV  637



>gb|KHG14011.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=671

 Score =   277 bits (708),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 166/383 (43%), Positives = 229/383 (60%), Gaps = 12/383 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL  G+  CP+TQQ LS   LTPN+++
Sbjct  257   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEQGHGTCPKTQQTLSSPALTPNYVL  316

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSCV-QRSAARE  475
             R +I+ WC+ NGI  P  P            + A+R    +LL K++SSS   QR AA E
Sbjct  317   RSLIAQWCEANGIEPPKRPGSSRPNKVTSACSPAERTKIEILLCKLASSSPEDQRMAAGE  376

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L++  S  D     QE  +T +LNLSI + NK  +
Sbjct  377   IRLLAKRNADNRVAIAEA--GAIPLLVTLLSTPDSR--TQEHAVTALLNLSICEENKGSI  432

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                  V S+ +  L+ G++E R NAAAA+F+LS +D NK  IG SGA+ PL+ LL EG  
Sbjct  433   ISFGAVPSI-VQVLKKGSMEARENAAAALFSLSVVDENKVTIGASGAIPPLVTLLSEGTQ  491

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G V  L+  +       VDE LAILA+LSS+   
Sbjct  492   RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAILAILSSHPEG  551

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G   AVP L+ +I + S  RN+EN   +L  +C+ D+  L E + E    G +  L
Sbjct  552   KSAIGAAEAVPVLVDVIGNGS-PRNRENAAAVLVHLCAGDQQHLAEAQ-ELGVMGPLLDL  609

Query  1190  AQNGTSRAKRKASGVLDRLNRGV  1258
             AQNGT R KRKA+ +L+R++R V
Sbjct  610   AQNGTDRGKRKAAQLLERMSRFV  632



>gb|KDO48788.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
Length=627

 Score =   276 bits (705),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 236/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  246   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  305

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P     C ++     V+D DR     LL K+++ +   QR+AA E
Sbjct  306   KSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGE  365

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  366   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTD--PRTQEHAVTALLNLSINDSNKGTI  421

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  422   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTP  480

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  481   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEG  540

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+   +P L+ +IR T   RN+EN   +L+AIC+ D  +LK I  E  +   + +L
Sbjct  541   KTAIGQAEPIPVLMEVIR-TGSPRNRENAAAVLWAICTGDAEQLK-IARELDAEEALKEL  598

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             +++GT RAKRKA  +L+ L R
Sbjct  599   SESGTDRAKRKAGSILELLQR  619



>ref|XP_010106453.1| U-box domain-containing protein 13 [Morus notabilis]
 gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis]
Length=664

 Score =   276 bits (707),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 171/429 (40%), Positives = 246/429 (57%), Gaps = 18/429 (4%)
 Frame = +2

Query  5     LQRAVKAVVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS---FPAEFRCPLSGELMKDP  175
             L + +K  V  +  N +A  R +    +  G    + N+     P +FRCP+S ELMKDP
Sbjct  215   LLKKIKDFVQTENPNMDAPAREKSIPASCSGQASTEKNHKTPVIPDDFRCPISLELMKDP  274

Query  176   VVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWFP-  352
             V+VS+GQTY+R  I+KWL +G+  CP+TQQ LS T+LTPN+++R +I+ WC+ NGI  P 
Sbjct  275   VIVSTGQTYERSCIEKWLEAGHGTCPKTQQSLSSTVLTPNYVLRSLIAQWCEANGIEPPK  334

Query  353   ----DPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFRAL  517
                   P +  +       A+R     LL K++S +   QRSAA E+RLL KR    R  
Sbjct  335   RPSSSRPSKTTSACSPAKPAERTKIETLLRKLTSGNPEDQRSAAGEIRLLAKRNADNRVA  394

Query  518   FGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLIDSL  697
               E+   A+P L+S  S  D     QE  +T +LNLSI + NK  +  +  V  + +  L
Sbjct  395   IAEA--GAIPLLVSLLSTPDSR--TQEHAVTALLNLSICEDNKGSIVSSGAVPGI-VHVL  449

Query  698   RSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLC  877
             + G++E R NAAA +F+LS +D NK  IG  GA+ PL+ LL EG     KD A+A+F LC
Sbjct  450   KKGSMEARENAAATLFSLSVVDGNKITIGALGAIPPLVTLLSEGTQRGKKDAATALFNLC  509

Query  878   VLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAIEEMGELGAVPSLL  1051
             +   NK +A+R G V  L+  +       VDE LAILA+L+S+      +G   AVP L+
Sbjct  510   IYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDETLAILAILASHPEGKAAIGAAEAVPVLV  569

Query  1052  SLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKASG  1231
              +I + S  RN+EN   +L  +C+ D+  L E + E    G +  LAQNGT R KRKA+ 
Sbjct  570   EVIGNGS-PRNRENAAAVLVHLCAGDQQHLVEAQ-ELGVMGPLVDLAQNGTDRGKRKAAQ  627

Query  1232  VLDRLNRGV  1258
             +L+R++R V
Sbjct  628   LLERMSRFV  636



>gb|EAY99303.1| hypothetical protein OsI_21270 [Oryza sativa Indica Group]
Length=601

 Score =   275 bits (703),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 234/376 (62%), Gaps = 11/376 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+R  IQKWL+SG++ CP+TQQ LSHT LTPN ++
Sbjct  225   IPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQPLSHTSLTPNFVL  284

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +IS WC+ NGI  P       ++     +D D    + L+ ++ S +   QR+AA E+
Sbjct  285   KSLISQWCEANGIELPKNKQNSRDKKAAKSSDYDHAGLVSLMNRLRSGNQDEQRAAAGEI  344

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S  D  P  QE  +T +LNLSIH++NK  + 
Sbjct  345   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSSD--PRTQEHAVTALLNLSIHENNKASIV  400

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ++   I  +++ L++G++ETR NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  401   DS-HAIPKIVEVLKTGSMETRENAAATLFSLSVVDENKVTIGAAGAIPPLINLLCDGSPR  459

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G V  L+  +++     +DE L++L++L+ N    
Sbjct  460   GKKDAATAIFNLCIYQGNKVRAVKAGIVIHLMNFLVDPTGGMIDEALSLLSILAGNPEGK  519

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               + +   +P L+ +I+ T   RN+EN   IL+ +CSAD  +    K        + +L+
Sbjct  520   IVIAQSEPIPPLVEVIK-TGSPRNRENAAAILWLLCSADTEQTLAAK-AAGVEDALKELS  577

Query  1193  QNGTSRAKRKASGVLD  1240
             + GT RAKRKAS +L+
Sbjct  578   ETGTDRAKRKASSILE  593



>ref|XP_009629379.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
tomentosiformis]
Length=665

 Score =   276 bits (707),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 161/380 (42%), Positives = 233/380 (61%), Gaps = 11/380 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VSSGQTY+R  I+KWL +G+  CP+TQQVL+   LTPN+++
Sbjct  256   IPDDFRCPISLELMKDPVIVSSGQTYERSSIEKWLEAGHSTCPKTQQVLTSNTLTPNYVL  315

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDG-VVTDADRHNFLVLLEKMSSSSCVQR-SAAREL  478
             R +I+ WC+ NG+  P  P    N+     T A+      LL K++S     R SA  E+
Sbjct  316   RSLIAQWCEANGVEPPKRPGSLPNKSASACTPAEHSKIEDLLRKLTSGKPEDRLSATGEI  375

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR    R    E+   A+P L+   S  D    +QE  +T +LNLSI + NK+ + 
Sbjct  376   RLLAKRNADNRVAIAEA--GAIPLLVDLLSTPDSR--VQEHAVTALLNLSICEDNKRSIV  431

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              T   +  ++  L+ G++E R NAAAA+F+LS +D NK +IG  GA+ PL+ LL +G   
Sbjct  432   -TSGAVPGIVHVLKKGSMEARENAAAALFSLSVIDENKVIIGTYGAISPLVTLLSDGTQR  490

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+A+F LC+   NK +A+R G V  L++ +       VDE LAILA+L+S+    
Sbjct  491   GKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGGMVDEALAILAILASHPEGK  550

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +G  GAVP L+++I + S  RNKEN + +L  +CS D+  + E+++ E   G +  L 
Sbjct  551   AAIGAAGAVPVLVNVIANGS-PRNKENAVAVLVHLCSGDQHHIVEVQELE-VMGPLLDLV  608

Query  1193  QNGTSRAKRKASGVLDRLNR  1252
             QNGT R KRKA+ +L+R+NR
Sbjct  609   QNGTDRGKRKATQLLERINR  628



>ref|XP_008446840.1| PREDICTED: U-box domain-containing protein 14 [Cucumis melo]
Length=627

 Score =   276 bits (705),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 233/381 (61%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM+DPV+VS+GQTY+R  IQKWL++G++ CP++QQ L HT LTPN+++
Sbjct  246   IPDDFRCPISLELMRDPVIVSTGQTYERSCIQKWLDAGHKTCPKSQQALLHTALTPNYVL  305

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV--VTDADRHNFLVLLEKMSSSSCVQ-RSAARE  475
             + +I+ WC+ NG+  P     C N+     V+D DR     LL  + + S  Q RSAA E
Sbjct  306   KSLIALWCENNGVELPKKQGSCRNKKAGNNVSDCDRSAIDALLVNLVNGSPEQKRSAAGE  365

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+D NK+ +
Sbjct  366   LRLLAKRNSDNRICIAEA--GAIPFLVELLSSNDTRT--QEHAVTALLNLSINDGNKRTI  421

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
              +  R I  +++ LR+G++E R NAAA +F+LS +D NK  IG +GA+  LI LL EG  
Sbjct  422   VDL-RAIPAVVEVLRNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALISLLREGTP  480

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARAIR G V  L+   K      VDE LAILA+L+++H  
Sbjct  481   RGKKDAATAIFNLSIYQGNKARAIRAGIVNPLMGFLKDAGGGMVDEALAILAILATHHEG  540

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +GE   +  LL  IR T   RN+EN   +L+++CS D  +LK +  E  +   + ++
Sbjct  541   KTAIGEAEPMTILLEFIR-TGSPRNRENAAAVLWSLCSTDFEQLK-LAREHGAEEALKEV  598

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++NGT RAKRKA  +L+   R
Sbjct  599   SENGTERAKRKAGSILELFQR  619



>dbj|BAK01935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   276 bits (705),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 159/383 (42%), Positives = 237/383 (62%), Gaps = 16/383 (4%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P +FRCP+S +LM+DPV+VS+GQTY+R FIQ+W++ GNR CP+TQQ L +  LTPN++
Sbjct  266   AMPEDFRCPISLDLMRDPVIVSTGQTYERAFIQRWIDGGNRTCPKTQQKLQNLTLTPNYV  325

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVV-TDADRHNFLVLLEKMSSSSCVQR-SAARE  475
             +R +I  WC+  GI   +PP +   E   V    DR     L+  +S SS  +R SAA E
Sbjct  326   LRSLILQWCEEKGI---EPPTRSKYEGSSVEVGEDRLAIEALVRNLSCSSLDERKSAAAE  382

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +R L K+    R L  ES   A+P L+   S  D  P  QE  +T++LNLSI+D NK+L+
Sbjct  383   IRSLAKKSTDNRMLLAES--GAIPALVKLLSSKD--PKTQEHAVTSLLNLSIYDQNKELI  438

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKS-GALKPLIDLLEEGH  832
                  ++ + I  LR+G++E R NAAAAIF+LS +D NK +IG + GA++ L++LL+ G 
Sbjct  439   VVGGAIVPI-IQVLRTGSMEARENAAAAIFSLSLIDDNKIMIGSTPGAIEALVELLKSGS  497

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH---VDELLAILAMLSSNH  1003
             S   KD A+A+F LC+   NK RA+R G +  LV+ + +       DE L IL++L S+H
Sbjct  498   SRGRKDAATALFNLCIYQANKVRAVRAGILSPLVQMLQDSSSTGATDEALTILSVLVSHH  557

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  + +   +P L+ L+R +S ARNKEN   IL A+C  D   L  I     +   ++
Sbjct  558   ECKTAIAKAHTIPFLIDLLR-SSQARNKENAAAILLALCKKDAQNLACI-GRLGAQIPLT  615

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +L++ G+ RAKRKA+ +L+ L++
Sbjct  616   ELSKTGSDRAKRKATSLLEHLSK  638



>gb|KEH30143.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=662

 Score =   276 bits (706),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 158/382 (41%), Positives = 229/382 (60%), Gaps = 12/382 (3%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P++F+CP+S ELM DPV+VS+GQTY+R  I+KWL  G+  CP+TQQ L+ T+LTPN++
Sbjct  254   AIPSDFKCPISLELMMDPVIVSTGQTYERSCIEKWLQDGHGTCPKTQQSLTSTVLTPNYV  313

Query  302   IRGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAAR  472
             +R +I  WC+ NGI  P  P   +        T A+R     L++K++S     QRSAA 
Sbjct  314   LRSLIEQWCEANGIEPPKRPSTSEPSKSASACTPAERSKIESLIQKLTSGGPEDQRSAAG  373

Query  473   ELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKL  652
             E+RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI++SNK  
Sbjct  374   EIRLLAKRNADNRVAIAEA--GAIPLLVGLLSVPDSR--TQEHAVTALLNLSIYESNKGS  429

Query  653   VAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
             +  +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG 
Sbjct  430   IVSSGAVPGI-VHVLKRGSMEARENAAATLFSLSVIDENKVTIGSSGAISPLVTLLSEGT  488

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHR  1006
                 KD A+A+F LC+   NK +A+R G +  L+  +       VDE LAILA+L+S+  
Sbjct  489   QRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAILAILASHPE  548

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G   AVP L+  I + S  RNKEN   +L  +CS DR  + + + E      + +
Sbjct  549   GKAAIGAAEAVPVLVKFIGNGS-PRNKENAAAVLVHLCSGDRQYIAQAQ-ELGVMAPLLE  606

Query  1187  LAQNGTSRAKRKASGVLDRLNR  1252
             LAQNGT R KRKA+ +++R++R
Sbjct  607   LAQNGTDRGKRKATQLIERMSR  628



>ref|XP_002311996.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE89363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=628

 Score =   275 bits (704),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 239/384 (62%), Gaps = 18/384 (5%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P  P  C ++     ++D DR     LL+K+ + S   QRSAA E
Sbjct  307   KSLIALWCESNGVELPKQPGACRSKKVGSSMSDCDRAAVTTLLDKLGNGSLEQQRSAAGE  366

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+D NK  +
Sbjct  367   LRLLAKRNADNRVCIAEA--GAVPLLVELLSSTD--PRTQEHAVTALLNLSINDLNKGTI  422

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  423   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIKLLCDGTP  481

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA++ G V  L+  + +     VDE LAILA+L+ +   
Sbjct  482   RGKKDAATAIFNLSIYQGNKARAVKAGIVPPLMRLLRDAGGGMVDEALAILAILAGHQEG  541

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKL---KEIKDEESSHGTI  1180
                +G++  +P L+ +IR T   RN+EN + IL+++C+ D  +L   K+   EE+    +
Sbjct  542   KVAIGQVDPIPVLIEVIR-TGSQRNRENAVAILWSLCTGDSQQLILAKQFGAEEA----L  596

Query  1181  SQLAQNGTSRAKRKASGVLDRLNR  1252
              +L+++GT RAKRKA  +L+ L R
Sbjct  597   KELSESGTDRAKRKAGSILELLQR  620



>tpg|DAA44667.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=726

 Score =   278 bits (710),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 236/382 (62%), Gaps = 14/382 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S +LMKDPV+V++GQTY+R +I+ WL +G+  CP+TQQ L++  LTPN+++
Sbjct  291   IPDDFRCPISLDLMKDPVIVATGQTYERGYIEMWLEAGHDTCPKTQQKLANKSLTPNYVL  350

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELR  481
             R +I+ WC+ NGI  P  P Q  +     + A+  N L LL+K+SS +   QR +A  LR
Sbjct  351   RSLITQWCEANGIEPPKRPAQLRDAPLSCSAAEHSNVLELLQKLSSQNLEDQRGSAGMLR  410

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAE  661
              L KR    RA  G++   A+P L+S  S  DV    QE ++T +LNLSI++ NK  +  
Sbjct  411   QLAKRSAENRACIGDA--GAIPILVSLLSTTDV--STQEHVVTALLNLSIYEENKARIIS  466

Query  662   TPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLA  841
             +  V  + +  L+ G++E R N+AA +F+LS +D NK  IG SGA+  L+ LL  G    
Sbjct  467   SGAVPGI-VHVLKRGSMEARENSAATLFSLSIVDENKVTIGCSGAIPALVQLLSNGSQRG  525

Query  842   MKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRAIE  1015
              KD A+A+F LC+   NK +A+R G V +L+E +M      VDE LAILA+LS +     
Sbjct  526   KKDAATALFNLCIYQGNKGKAVRAGLVPILLELLMETESGMVDEALAILAILSGHPEGKT  585

Query  1016  EMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS---Q  1186
              +G   A+P L+ +IR+ S  RNKEN   ++  +CS ++ +    + +E   G +S   +
Sbjct  586   AIGAASAIPVLVGVIRNGS-PRNKENAAAVMVHLCSGEQQQQHLAEAQE--QGIVSLLEE  642

Query  1187  LAQNGTSRAKRKASGVLDRLNR  1252
             LA++GT R KRKA  +L+R+NR
Sbjct  643   LAESGTDRGKRKAVQLLERMNR  664



>ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 13-like [Fragaria 
vesca subsp. vesca]
Length=676

 Score =   276 bits (707),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 226/382 (59%), Gaps = 16/382 (4%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL  G+  CP+TQQ LS T LTPN+++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEQGHGTCPKTQQTLSSTSLTPNYVL  317

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELR  481
             R +I+ WC+ NGI  P  P +        + A+R     LL K++S++   QRSAA E+R
Sbjct  318   RSLIAQWCEANGIEVPKRPNRPNKTASACSPAERTKIENLLHKLTSANPEDQRSAAGEIR  377

Query  482   LLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV--  655
             LL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI + NK  +  
Sbjct  378   LLAKRNADNRVAIAEA--GAIPLLVGLLSTPDSR--TQEHAVTALLNLSICEDNKGSIIS  433

Query  656   -AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGH  832
                 P ++ V    L+ G +E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG 
Sbjct  434   CGAVPGIVHV----LKHGGMEARENAAATLFSLSVVDENKVRIGASGAIPPLVTLLSEGT  489

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHR  1006
                 KD A+A+F LC+   NK +A+R G V  L+E +       VDE LAILA+L+S+  
Sbjct  490   QRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMELLTETGGGMVDEALAILAILASHPE  549

Query  1007  AIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQ  1186
                 +G   AVP L+ +I  T   RN+EN   +L  +CS D   + + + E     ++  
Sbjct  550   GKAAIGAAEAVPVLVEVI-GTGSPRNRENAAAVLVHLCSGDPQYMVDAQ-ELGVMDSLLD  607

Query  1187  LAQNGTSRAKRKASGVLDRLNR  1252
             L+QNGT R KRKA+ +L+R+NR
Sbjct  608   LSQNGTDRGKRKAAQLLERMNR  629



>ref|XP_011031687.1| PREDICTED: U-box domain-containing protein 14 [Populus euphratica]
Length=628

 Score =   275 bits (704),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 239/384 (62%), Gaps = 18/384 (5%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P  P  C ++     ++D DR     LL+K+ + S   QRSAA E
Sbjct  307   KSLIALWCESNGVELPKQPGACRSKKVGSSMSDCDRAAVTTLLDKLGNGSLEQQRSAAGE  366

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+D NK  +
Sbjct  367   LRLLAKRNADNRVCIAEA--GAVPLLVELLSSTD--PRTQEHAVTALLNLSINDLNKGTI  422

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  423   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIKLLCDGTP  481

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA++ G V  L+  + +     VDE LAILA+L+ +   
Sbjct  482   RGKKDAATAIFNLSIYQGNKARAVKAGIVPPLMRLLRDAGGGMVDEALAILAILAGHQEG  541

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKL---KEIKDEESSHGTI  1180
                +G++  +P L+ +IR T   RN+EN + IL+++C+ D  +L   K+   EE+    +
Sbjct  542   KVAIGQVDPIPVLIEVIR-TGSQRNRENAVAILWSLCTGDSQQLILAKQFGAEEA----L  596

Query  1181  SQLAQNGTSRAKRKASGVLDRLNR  1252
              +L+++GT RAKRKA  +L+ L R
Sbjct  597   KELSESGTDRAKRKAGSILELLQR  620



>ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 ref|XP_006485606.1| PREDICTED: U-box domain-containing protein 14-like [Citrus sinensis]
 gb|ESR49721.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
Length=627

 Score =   275 bits (704),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 166/381 (44%), Positives = 236/381 (62%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  246   IPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVL  305

Query  305   RGMISNWCKVNGIWFPDPPVQCLNED--GVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NG+  P     C ++     V+D DR     LL K+++ +   QR+AA E
Sbjct  306   KSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGE  365

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI+DSNK  +
Sbjct  366   LRLLAKRNADNRVCIAEA--GAIPLLVELLSSTD--PRTQEHAVTALLNLSINDSNKGTI  421

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  ++D L++G++E R NAAA +F+LS +D NK  IG +GA+  LI LL +G  
Sbjct  422   VNAG-AIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTP  480

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+AIF L +   NKARA+R G V  L+   K      VDE LAILA+L+S+   
Sbjct  481   RGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEG  540

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G+   +P L+ +IR T   RN+EN   +L+AIC+ D  +LK I  E  +   + +L
Sbjct  541   KTAIGQAEPIPVLMEVIR-TGSPRNRENAAAVLWAICTGDAEQLK-IARELDAEEALKEL  598

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             +++GT RAKRKA  +L+ L R
Sbjct  599   SESGTDRAKRKAGSILELLQR  619



>ref|XP_007132072.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris]
 gb|ESW04066.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris]
Length=670

 Score =   276 bits (707),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 233/384 (61%), Gaps = 18/384 (5%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+R CP+T+Q L+ T+LTPN+++
Sbjct  265   IPEDFRCPISLELMKDPVIVSTGQTYERSCIEKWLQAGHRTCPKTRQTLTSTVLTPNYVL  324

Query  305   RGMISNWCKVNGIWFPDPP-----VQCLNEDGVVTDADRHNFLVLLEKMSSSSCV-QRSA  466
             R +I+ WC+ NGI   +PP      Q        + A+R     LL+K++S S   QRSA
Sbjct  325   RSLIAQWCEANGI---EPPKRPSSSQPSKSASAYSPAERSKIDGLLQKLTSGSPEDQRSA  381

Query  467   ARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNK  646
             A E+RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI+++NK
Sbjct  382   AGEIRLLAKRNADNRVAIAEA--GAIPLLVGLLSVPDSR--TQEHAVTALLNLSIYENNK  437

Query  647   KLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEE  826
               +  +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL E
Sbjct  438   GSIVSSGAVPGI-VHVLKKGSMEARENAAATLFSLSVIDENKVTIGSSGAIPPLVILLSE  496

Query  827   GHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSN  1000
             G     KD A+A+F LC+   NK +A+R G +  L+  +       VDE LAILA+L+S+
Sbjct  497   GTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAILAILASH  556

Query  1001  HRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTI  1180
                   +    AVP L+  I + S  RNKEN   +L  +CS D+  L + + E    G +
Sbjct  557   PDGKATIRAAEAVPVLVEFIGNGS-PRNKENAAAVLVHLCSGDQQYLAQAQ-ELGVMGPL  614

Query  1181  SQLAQNGTSRAKRKASGVLDRLNR  1252
              +LAQNGT R KRKA+ +L+R++R
Sbjct  615   LELAQNGTDRGKRKAAQLLERISR  638



>ref|XP_010557715.1| PREDICTED: U-box domain-containing protein 14 [Tarenaya hassleriana]
Length=628

 Score =   275 bits (704),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 157/381 (41%), Positives = 231/381 (61%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  IQKWL++G++ CP+TQQ L HT LTPN+++
Sbjct  247   IPDDFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKTQQTLLHTGLTPNYVL  306

Query  305   RGMISNWCKVNGIWFPDPPVQC--LNEDGVVTDADRHNFLVLLEKMSSSSC-VQRSAARE  475
             + +I+ WC+ NGI  P     C         +D D+     LL K++      QR+AA E
Sbjct  307   KSLIALWCESNGIELPKNQGGCRTTKPGSSSSDCDQAFVSALLTKLADGDTEQQRAAAGE  366

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             LRLL KR    R    E+   A+P L+   S  D  P  QE  +T +LNLSI++ NK  +
Sbjct  367   LRLLAKRNADNRVCIAEA--GAVPLLVELLSSPD--PRTQEHAVTALLNLSINEGNKGAI  422

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
                   I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA++ LI LLEEG  
Sbjct  423   VNAG-AIPDIVEVLKNGSMEARENAAATLFSLSVIDDNKVAIGAAGAIQSLISLLEEGTR  481

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVE--KIMNRVHVDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NKARA++ G V  L+   K      VDE LAILA+LS++   
Sbjct  482   RGKKDAATALFNLCIYQGNKARAVKGGIVEPLMRLLKDAGGGMVDEALAILAILSTHQEG  541

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                + +   +P L+ ++R T   RN+EN + +L+ +C  +  +LK I     +   + +L
Sbjct  542   KNMIAQAEPIPVLVEIVR-TGSPRNRENGVAVLWYLCVGNVERLK-IARGVGADAALKEL  599

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             ++NGT RAKRKA+ +L+ L +
Sbjct  600   SENGTDRAKRKAASLLELLQQ  620



>dbj|BAJ97560.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   276 bits (705),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 159/383 (42%), Positives = 237/383 (62%), Gaps = 16/383 (4%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P +FRCP+S +LM+DPV+VS+GQTY+R FIQ+W++ GNR CP+TQQ L +  LTPN++
Sbjct  266   AMPEDFRCPISLDLMRDPVIVSTGQTYERAFIQRWIDGGNRTCPKTQQKLQNLTLTPNYV  325

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVV-TDADRHNFLVLLEKMSSSSCVQR-SAARE  475
             +R +I  WC+  GI   +PP +   E   V    DR     L+  +S SS  +R SAA E
Sbjct  326   LRSLILQWCEEKGI---EPPTRSKYEGSSVEVGEDRLAIEALVRNLSCSSLDERKSAAAE  382

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +R L K+    R L  ES   A+P L+   S  D  P  QE  +T++LNLSI+D NK+L+
Sbjct  383   IRSLAKKSTDNRMLLAES--GAVPALVKLLSSKD--PKTQEHAVTSLLNLSIYDQNKELI  438

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKS-GALKPLIDLLEEGH  832
                  ++ + I  LR+G++E R NAAAAIF+LS +D NK +IG + GA++ L++LL+ G 
Sbjct  439   VVGGAIVPI-IQVLRTGSMEARENAAAAIFSLSLIDDNKIMIGSTPGAIEALVELLKSGS  497

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH---VDELLAILAMLSSNH  1003
             S   KD A+A+F LC+   NK RA+R G +  LV+ + +       DE L IL++L S+H
Sbjct  498   SRGRKDAATALFNLCIYQANKVRAVRAGILSPLVQMLQDSSSTGATDEALTILSVLVSHH  557

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  + +   +P L+ L+R +S ARNKEN   IL A+C  D   L  I     +   ++
Sbjct  558   ECKTAIAKAHTIPFLIDLLR-SSQARNKENAAAILLALCKKDAQNLACI-GRLGAQIPLT  615

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +L++ G+ RAKRKA+ +L+ L++
Sbjct  616   ELSKTGSDRAKRKATSLLEHLSK  638



>ref|XP_010920613.1| PREDICTED: protein spotted leaf 11-like [Elaeis guineensis]
Length=682

 Score =   276 bits (707),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 166/401 (41%), Positives = 236/401 (59%), Gaps = 21/401 (5%)
 Frame = +2

Query  77    ALCALRGLHPEQNNNSFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQ  256
             A+  L   H +      P +FRCP+S ELMKDPV+V++GQTYDR  I+KWL +G+  CP+
Sbjct  248   AIPKLLPFHEKSKVPVIPDDFRCPISLELMKDPVIVATGQTYDRECIEKWLEAGHNTCPK  307

Query  257   TQQVLSHTILTPNHLIRGMISNWCKVNGIWFPDPPVQCLNEDGVVT---DADRHNFLVLL  427
             TQQ L +T LTPN+++R +I+ WC+ NG+   DPP++    D  ++     +    + LL
Sbjct  308   TQQKLRNTSLTPNYVLRSLITQWCEANGM---DPPIRPTQPDKALSACFSGEHAKVMELL  364

Query  428   EKMSSSSCV-QRSAARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDI  604
              K+SS +   QR AA ELRLL KR    R    E+   A+P L+S     D     QE  
Sbjct  365   RKLSSQNIEDQRLAAGELRLLAKRNADNRVCIAEA--GAIPLLVSLLPTFDAR--TQEHA  420

Query  605   ITTILNLSIHDSNKK---LVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKA  775
             +T +LNLSI + NK     +   P ++ V    L+ G++E R NAAA +F+LS +D NK 
Sbjct  421   VTALLNLSICEENKGKIIFLGAVPGIVHV----LKRGSMEARENAAATLFSLSVVDENKI  476

Query  776   LIGKSGALKPLIDLLEEGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMN-R  952
              IG SGA+ PL+ LL EG     KD A+A+F LC+   NK +AIR G V  L+  +    
Sbjct  477   TIGASGAIPPLVSLLSEGSQRGKKDAATALFNLCIYQGNKGKAIRAGVVPTLMGLLTEPG  536

Query  953   VHVDELLAILAMLSSNHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADR  1132
               VDE LAILA+LSS+      +G   AVP L+ +IR  S  RNKEN   +L  +C+ ++
Sbjct  537   GMVDEALAILAILSSHPEGKLAIGAAEAVPVLVDVIRSGS-PRNKENAAAVLVHLCNGEQ  595

Query  1133  TKLKEIKDEESS-HGTISQLAQNGTSRAKRKASGVLDRLNR  1252
              +    + +E    G + +LAQ+GT R KRKA+ +L+R+NR
Sbjct  596   QQQHLAEAQECGVMGPLEELAQSGTDRGKRKAAQLLERMNR  636



>ref|XP_004505870.1| PREDICTED: U-box domain-containing protein 13-like [Cicer arietinum]
Length=661

 Score =   276 bits (706),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 160/385 (42%), Positives = 234/385 (61%), Gaps = 18/385 (5%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P++F+CP+S ELMKDPV+VS+GQTY+R  I+KWL  G+  CP+TQQ L+ T+LTPN++
Sbjct  254   TIPSDFKCPISLELMKDPVIVSTGQTYERSCIEKWLQDGHGTCPKTQQSLTSTVLTPNYV  313

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVV-----TDADRHNFLVLLEKMSSSSCV-QRS  463
             +R +I  WC+ NGI   +PP +  + +        + A+R     L++K++S S   QRS
Sbjct  314   LRSLIEQWCEANGI---EPPKRPSSSEPSKSASACSPAERSKIESLIQKLTSGSPEDQRS  370

Query  464   AARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSN  643
             AA E+RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI++SN
Sbjct  371   AAGEIRLLAKRNADNRVAIAEA--GAIPLLVGLLSVPDSR--TQEHAVTALLNLSIYESN  426

Query  644   KKLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLE  823
             K  +  +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL 
Sbjct  427   KGSIVSSGAVPGI-VHVLKRGSMEARENAAATLFSLSVIDENKVTIGSSGAISPLVTLLS  485

Query  824   EGHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSS  997
             EG     KD A+A+F LC+   NK +A+R G +  L+  +       VDE LAILA+L+S
Sbjct  486   EGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPTGGMVDEALAILAILAS  545

Query  998   NHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGT  1177
             +      +G   AVP L+  I + S  RNKEN   +L  +CS DR  L + + E      
Sbjct  546   HPDGKAAIGAAEAVPVLVEFIGNGS-PRNKENAAAVLVHLCSGDRQYLVQAQ-ELGVMAP  603

Query  1178  ISQLAQNGTSRAKRKASGVLDRLNR  1252
             + +LAQNGT R KRKA+ +++R++R
Sbjct  604   LLELAQNGTDRGKRKATQLIERMSR  628



>ref|NP_001056535.2| Os06g0102700 [Oryza sativa Japonica Group]
 dbj|BAD67947.1| putative cell death-related protein SPL11 [Oryza sativa Japonica 
Group]
 dbj|BAF18449.2| Os06g0102700 [Oryza sativa Japonica Group]
Length=604

 Score =   275 bits (702),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 236/381 (62%), Gaps = 11/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+R  IQKWL+SG++ CP+TQQ LSHT LTPN ++
Sbjct  228   IPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQPLSHTSLTPNFVL  287

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +IS WC+ NGI  P       ++     +D D    + L+ ++ S +   QR+AA E+
Sbjct  288   KSLISQWCEANGIELPKNKQNSRDKKAAKSSDYDHAGLVSLMNRLRSGNQDEQRAAAGEI  347

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S  D  P  QE  +T +LNLSIH++NK  + 
Sbjct  348   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSSD--PRTQEHAVTALLNLSIHENNKASIV  403

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ++   I  +++ L++G++ETR NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  404   DS-HAIPKIVEVLKTGSMETRENAAATLFSLSVVDENKVTIGAAGAIPPLINLLCDGSPR  462

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G V  L+  +++     +DE L++L++L+ N    
Sbjct  463   GKKDAATAIFNLCIYQGNKVRAVKAGIVIHLMNFLVDPTGGMIDEALSLLSILAGNPEGK  522

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +     +P L+ +I+ T   RN+EN   IL+ +CSAD  +    K        + +L+
Sbjct  523   IVIARSEPIPPLVEVIK-TGSPRNRENAAAILWLLCSADTEQTLAAK-AAGVEDALKELS  580

Query  1193  QNGTSRAKRKASGVLDRLNRG  1255
             + GT RAKRKAS +L+ +++ 
Sbjct  581   ETGTDRAKRKASSILELMHQA  601



>ref|XP_006649017.1| PREDICTED: U-box domain-containing protein 11-like [Oryza brachyantha]
Length=618

 Score =   275 bits (702),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/383 (41%), Positives = 237/383 (62%), Gaps = 16/383 (4%)
 Frame = +2

Query  122   SFPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHL  301
             + P +FRCP+S ELM+DPV+VS+GQTY+R FIQ+W++ GNR CP+TQQ L +  LTPN++
Sbjct  242   AIPEDFRCPISLELMRDPVIVSTGQTYERAFIQRWIDCGNRTCPKTQQKLQNLTLTPNYV  301

Query  302   IRGMISNWCKVNGIWFPDPPVQCLNEDGVV-TDADRHNFLVLLEKMSSSSCVQR-SAARE  475
             +R +I +WC+  GI   +PP +  N+   +    +R     L+  +SSSS  +R SAA E
Sbjct  302   LRSLILHWCEEKGI---EPPTRSKNDGSYLEVGGERVAIETLVRNLSSSSLDERKSAAAE  358

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +R L K+    R L   S   A+P L+   S  D+    QE  +T++LNLSI+D NK+L+
Sbjct  359   IRSLAKKSTDNRILLAGS--GAIPALVKLLSSKDLKT--QEHAVTSLLNLSIYDQNKELI  414

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKS-GALKPLIDLLEEGH  832
                  ++ + I  LR G +E R NAAAAIF+LS +D NK  IG + GA++ L++LL+ G 
Sbjct  415   VVAGAIVPI-IQVLRKGGMEARENAAAAIFSLSLIDDNKITIGSTPGAIEALVELLQSGS  473

Query  833   SLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH---VDELLAILAMLSSNH  1003
                 KD A+A+F LC+   NK RA+R G +  L++ + +      +DE L IL++L S+H
Sbjct  474   PRGRKDAATALFNLCIYQANKVRAVRAGILAPLIQMLQDSSRNGAIDEALTILSVLVSHH  533

Query  1004  RAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTIS  1183
                  + +  A+P L+ L+R +S ARNKEN   IL A+C  D   L  I     +   ++
Sbjct  534   ECKTAIAKAHAIPFLIDLLR-SSQARNKENAAAILLALCKKDAENLACI-GRLGAQIPLT  591

Query  1184  QLAQNGTSRAKRKASGVLDRLNR  1252
             +L++ GT RAKRKA+ +LD L++
Sbjct  592   ELSKTGTDRAKRKATSLLDHLSK  614



>ref|XP_006348996.1| PREDICTED: U-box domain-containing protein 13-like [Solanum tuberosum]
Length=664

 Score =   276 bits (705),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 165/385 (43%), Positives = 230/385 (60%), Gaps = 20/385 (5%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELM DPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+   LTPN+++
Sbjct  257   IPDDFRCPISLELMTDPVIVSTGQTYERSCIEKWLEAGHSTCPKTQQALTSKSLTPNYVL  316

Query  305   RGMISNWCKVNGIWFP-----DPPVQCLNEDGVVTDADRHNFLVLLEKMSSSSCVQ-RSA  466
             R +I+ WC+ NGI  P      PP +  +     T A+      LL K+ S S  + RSA
Sbjct  317   RSLIAQWCEANGIEPPKRPGSSPPKKSAS---ACTPAEHSMIENLLRKLKSGSPEEARSA  373

Query  467   ARELRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNK  646
             A E+RLL KR    R    E+   A+P L+   S  D     QE  +T +LNLSI ++NK
Sbjct  374   AGEIRLLAKRNTDNRVAIAEA--GAIPLLVHLLSTPDSR--TQEHAVTALLNLSICENNK  429

Query  647   KLVAETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEE  826
               +  T R +  ++  LR G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL E
Sbjct  430   GHIV-TSRAVPGIVHVLRKGSMEARENAAATLFSLSVIDENKVTIGSSGAIPPLVALLSE  488

Query  827   GHSLAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH---VDELLAILAMLSS  997
             G     KD A+A+F LC+   NK RAIR G V  L++ ++ +     VDE LAILA+LSS
Sbjct  489   GTQRGKKDAATALFNLCIYQGNKGRAIRAGVVPTLMQ-LLTKPQGGMVDEALAILAILSS  547

Query  998   NHRAIEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGT  1177
             +      +G   AVP L+ +I + S  RNKEN   +L  +CS D+  L E +      G 
Sbjct  548   HPEGKAAIGAADAVPVLVDVISNGS-PRNKENAAAVLVHLCSGDQHHLVEAQ-RLGLIGP  605

Query  1178  ISQLAQNGTSRAKRKASGVLDRLNR  1252
             ++ L QNGT R +RKA+ +L+R+NR
Sbjct  606   LTDLVQNGTERGRRKATQLLERMNR  630



>sp|Q5VRH9.1|PUB12_ORYSJ RecName: Full=U-box domain-containing protein 12; AltName: Full=Plant 
U-box protein 12; Short=OsPUB12 [Oryza sativa Japonica 
Group]
 dbj|BAD67946.1| putative cell death-related protein SPL11 [Oryza sativa Japonica 
Group]
 dbj|BAG90500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=611

 Score =   275 bits (702),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 236/381 (62%), Gaps = 11/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+R  IQKWL+SG++ CP+TQQ LSHT LTPN ++
Sbjct  228   IPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQPLSHTSLTPNFVL  287

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +IS WC+ NGI  P       ++     +D D    + L+ ++ S +   QR+AA E+
Sbjct  288   KSLISQWCEANGIELPKNKQNSRDKKAAKSSDYDHAGLVSLMNRLRSGNQDEQRAAAGEI  347

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S  D  P  QE  +T +LNLSIH++NK  + 
Sbjct  348   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSSD--PRTQEHAVTALLNLSIHENNKASIV  403

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
             ++   I  +++ L++G++ETR NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  404   DS-HAIPKIVEVLKTGSMETRENAAATLFSLSVVDENKVTIGAAGAIPPLINLLCDGSPR  462

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G V  L+  +++     +DE L++L++L+ N    
Sbjct  463   GKKDAATAIFNLCIYQGNKVRAVKAGIVIHLMNFLVDPTGGMIDEALSLLSILAGNPEGK  522

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               +     +P L+ +I+ T   RN+EN   IL+ +CSAD  +    K        + +L+
Sbjct  523   IVIARSEPIPPLVEVIK-TGSPRNRENAAAILWLLCSADTEQTLAAK-AAGVEDALKELS  580

Query  1193  QNGTSRAKRKASGVLDRLNRG  1255
             + GT RAKRKAS +L+ +++ 
Sbjct  581   ETGTDRAKRKASSILELMHQA  601



>gb|KHN32120.1| U-box domain-containing protein 13 [Glycine soja]
Length=662

 Score =   275 bits (704),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 161/381 (42%), Positives = 229/381 (60%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+ T+LTPN+++
Sbjct  257   IPDDFRCPISLELMKDPVIVSTGQTYERTCIEKWLQAGHGTCPKTQQTLTSTVLTPNYVL  316

Query  305   RGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKM-SSSSCVQRSAARE  475
             R +I+ WC+ NGI  P  P   Q        + A++     LL+K+ S S   QRSAA E
Sbjct  317   RSLIAQWCEANGIEPPKRPSGSQPSKSASAYSPAEQSKIGSLLQKLISVSPEDQRSAAGE  376

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+S  S  D     QE  +T +LNLSI+++NK  +
Sbjct  377   IRLLAKRNADNRVAIAEA--GAIPLLVSLLSVPDSR--TQEHAVTALLNLSIYENNKGSI  432

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
               +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG  GA+ PL+ LL EG  
Sbjct  433   VSSGAVPGI-VHVLKKGSMEARENAAATLFSLSVIDENKVTIGSLGAIPPLVTLLSEGSQ  491

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G +  L+  +       VDE LAILA+L+S+   
Sbjct  492   RGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAILAILASHPEG  551

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +    AVP L+  I + S  RNKEN   +L  +CS D+  L + + E    G + +L
Sbjct  552   KVTIRASEAVPVLVEFIGNGS-PRNKENAAAVLVHLCSGDQQYLAQAQ-ELGVMGPLLEL  609

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             AQNGT R KRKA  +L+R++R
Sbjct  610   AQNGTDRGKRKAGQLLERMSR  630



>ref|XP_003539679.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max]
Length=662

 Score =   275 bits (704),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 161/381 (42%), Positives = 229/381 (60%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL +G+  CP+TQQ L+ T+LTPN+++
Sbjct  257   IPDDFRCPISLELMKDPVIVSTGQTYERTCIEKWLQAGHGTCPKTQQTLTSTVLTPNYVL  316

Query  305   RGMISNWCKVNGIWFPDPP--VQCLNEDGVVTDADRHNFLVLLEKM-SSSSCVQRSAARE  475
             R +I+ WC+ NGI  P  P   Q        + A++     LL+K+ S S   QRSAA E
Sbjct  317   RSLIAQWCEANGIEPPKRPSGSQPSKSASAYSPAEQSKIGSLLQKLISVSPEDQRSAAGE  376

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+S  S  D     QE  +T +LNLSI+++NK  +
Sbjct  377   IRLLAKRNADNRVAIAEA--GAIPLLVSLLSVPDSR--TQEHAVTALLNLSIYENNKGSI  432

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
               +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG  GA+ PL+ LL EG  
Sbjct  433   VSSGAVPGI-VHVLKKGSMEARENAAATLFSLSVIDENKVTIGSLGAIPPLVTLLSEGSQ  491

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRVH--VDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G +  L+  +       VDE LAILA+L+S+   
Sbjct  492   RGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAILAILASHPEG  551

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +    AVP L+  I + S  RNKEN   +L  +CS D+  L + + E    G + +L
Sbjct  552   KVTIRASEAVPVLVEFIGNGS-PRNKENAAAVLVHLCSGDQQYLAQAQ-ELGVMGPLLEL  609

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             AQNGT R KRKA  +L+R++R
Sbjct  610   AQNGTDRGKRKAGQLLERMSR  630



>ref|XP_007016448.1| Plant U-box 13 isoform 2 [Theobroma cacao]
 gb|EOY34067.1| Plant U-box 13 isoform 2 [Theobroma cacao]
Length=666

 Score =   275 bits (704),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 162/381 (43%), Positives = 227/381 (60%), Gaps = 12/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P +FRCP+S ELMKDPV+VS+GQTY+R  I+KWL  G+  CP+TQQ LS   LTPN+++
Sbjct  258   IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLQQGHGTCPKTQQTLSSPALTPNYVL  317

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGVVT--DADRHNFLVLLEKMSSSSCV-QRSAARE  475
             R +I+ WC+ NGI  P  P          T   A+R    +LL K++SS+   QR AA E
Sbjct  318   RSLIAQWCEANGIEPPKRPSSSRPSKTTSTCSPAERTKIDILLRKLTSSNPEDQRMAAGE  377

Query  476   LRLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLV  655
             +RLL KR    R    E+   A+P L+S  S  D     QE  +T +LNLSI + NK  +
Sbjct  378   IRLLAKRNADNRVAIAEA--GAIPFLVSLLSTPDSR--TQEHAVTALLNLSICEENKGSI  433

Query  656   AETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHS  835
               +  V  + +  L+ G++E R NAAA +F+LS +D NK  IG SGA+ PL+ LL EG  
Sbjct  434   ISSGAVPGI-VQVLKKGSMEARENAAATLFSLSVVDENKVTIGASGAIPPLVTLLSEGTQ  492

Query  836   LAMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRA  1009
                KD A+A+F LC+   NK +A+R G V  L+  +       VDE LAILA+L+S+   
Sbjct  493   RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAILAILASHPEG  552

Query  1010  IEEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQL  1189
                +G   AVP L+ ++ + S  RN+EN   +L  +C+ D+  L E + E    G +  L
Sbjct  553   KAAIGAAEAVPVLVDVVGNGS-PRNRENAAAVLVHLCAGDQQHLAEAQ-ELGVMGPLVAL  610

Query  1190  AQNGTSRAKRKASGVLDRLNR  1252
             AQNGT R KRKA+ +L+R++R
Sbjct  611   AQNGTDRGKRKAAQLLERMSR  631



>gb|AGT17414.1| hypothetical protein SHCRBa_140_J14_R_360 [Saccharum hybrid cultivar 
R570]
Length=585

 Score =   273 bits (699),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 154/381 (40%), Positives = 236/381 (62%), Gaps = 11/381 (3%)
 Frame = +2

Query  125   FPAEFRCPLSGELMKDPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLI  304
              P EFRCP+S ELM+DPV+VSSGQTY+R  IQKWL+SG++ CP+TQQ+LSHT LTPN ++
Sbjct  209   IPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQLLSHTSLTPNFVL  268

Query  305   RGMISNWCKVNGIWFPDPPVQCLNEDGV-VTDADRHNFLVLLEKM-SSSSCVQRSAAREL  478
             + +I+ WC+ NGI  P       ++     +D D    + L+ ++ S S   QR+AA E+
Sbjct  269   KSLIAQWCEANGIELPKNKANSRDKKAAKSSDYDHAGLVSLMNRLRSGSQDEQRAAAGEI  328

Query  479   RLLTKRMPSFRALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVA  658
             RLL KR  + R    E+   A+P L++  S  D  P  QE  +T +LNLSIH++NK  + 
Sbjct  329   RLLAKRNVNNRICIAEA--GAIPLLVNLLSSSD--PRTQEHAVTALLNLSIHENNKASIV  384

Query  659   ETPRVISVLIDSLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSL  838
              +   I  +++ L++G++E R NAAA +F+LS +D NK  IG +GA+ PLI+LL +G   
Sbjct  385   SS-HAIPKIVEVLKTGSMEARENAAATLFSLSVVDENKVTIGGAGAIPPLINLLCDGSPR  443

Query  839   AMKDVASAIFVLCVLHENKARAIRDGAVRVLVEKIMNRV--HVDELLAILAMLSSNHRAI  1012
               KD A+AIF LC+   NK RA++ G V  L+  +++     +DE L +LA+L+ N  A 
Sbjct  444   GKKDAATAIFNLCIYQGNKIRAVKAGIVIHLMNFLVDPTGGMIDEALTLLAILAGNPEAK  503

Query  1013  EEMGELGAVPSLLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLA  1192
               + +   +P L+ +I+ T   RNKEN   +L+++C  D  + +  K    +   + +L+
Sbjct  504   AVIAQSDPIPPLVEVIK-TGSPRNKENAAAVLWSLCCTDVEQTRAAK-AAGAEDALKELS  561

Query  1193  QNGTSRAKRKASGVLDRLNRG  1255
              +GT RAKRKAS +L+ + + 
Sbjct  562   DSGTERAKRKASSILELMRQA  582



>ref|XP_010253199.1| PREDICTED: U-box domain-containing protein 13-like [Nelumbo nucifera]
Length=652

 Score =   275 bits (702),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 172/429 (40%), Positives = 243/429 (57%), Gaps = 30/429 (7%)
 Frame = +2

Query  26    VVSEDGVNAEAIDRAQQALCALRGLHPEQNNNS------------FPAEFRCPLSGELMK  169
             VV+  G   E+I++    L  ++     QN +              P +FRCP+S ELMK
Sbjct  198   VVASGGDPGESIEKMSMLLKKIKDFVQTQNPDMGAPANEKTEIPVIPEDFRCPISLELMK  257

Query  170   DPVVVSSGQTYDRPFIQKWLNSGNRICPQTQQVLSHTILTPNHLIRGMISNWCKVNGIWF  349
             DPV+VS+GQTY+R  I+KWL +G+  CP+TQQ LS T LTPN+++R +I+ WC+ NG+  
Sbjct  258   DPVIVSTGQTYERACIEKWLEAGHVTCPKTQQKLSSTALTPNYVLRSLIAQWCEANGM--  315

Query  350   PDPPVQCLNE-----DGVVTDADRHNFLVLLEKMSSSSCV-QRSAARELRLLTKRMPSFR  511
              +PP +  N          + A+     +LL K++S +   QRSAA ELRLL KR    R
Sbjct  316   -EPPKRLSNSRPSKAASTCSPAELAKIDILLRKLTSVNIEDQRSAAGELRLLAKRNADNR  374

Query  512   ALFGESMGAAMPKLLSPFSRVDVHPDLQEDIITTILNLSIHDSNKKLVAETPRVISVLID  691
                 E+   A+P L+   S  D  P  QE  +T +LNLSI + NK  +  +  V  + + 
Sbjct  375   VCIAEA--GAIPFLVGLLSTTD--PQTQEHAVTALLNLSICEDNKGSIISSGAVPGI-VH  429

Query  692   SLRSGAIETRSNAAAAIFTLSALDSNKALIGKSGALKPLIDLLEEGHSLAMKDVASAIFV  871
              L+ G++E R NAAA +F+LS +D NK  IG  GA+  L+ LL EG     KD A+A+F 
Sbjct  430   VLKKGSMEARENAAATLFSLSVVDENKVTIGAFGAIPALVTLLGEGSQRGKKDAATALFN  489

Query  872   LCVLHENKARAIRDGAVRVLVEKIM--NRVHVDELLAILAMLSSNHRAIEEMGELGAVPS  1045
             LC+   NK RA+R G V  L+  +       VDE LAILA+L+S+      +G   AVP 
Sbjct  490   LCIYQGNKGRAVRAGVVPTLMRLLTEPGGGMVDEALAILAILASHAEGKAAIGAAEAVPV  549

Query  1046  LLSLIRDTSCARNKENCIVILYAICSADRTKLKEIKDEESSHGTISQLAQNGTSRAKRKA  1225
             L+ +I + S  RN+EN   +L  +CS D   L E + E    G +  LAQNGT R KRKA
Sbjct  550   LVEVIGNGS-PRNRENAAAVLVHLCSGDPKHLAEAQ-ELGVMGPLLDLAQNGTDRGKRKA  607

Query  1226  SGVLDRLNR  1252
             + ++DR+NR
Sbjct  608   AQLIDRMNR  616



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5881052329368