BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29188_g1_i1 len=928 path=[906:0-927]

Length=928
                                                                      Score     E

gb|ABB17076.1|  invertase inhibitor                                     124   9e-31   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009604073.1|  PREDICTED: cell wall / vacuolar inhibitor of...    124   2e-30   
ref|XP_009779273.1|  PREDICTED: cell wall / vacuolar inhibitor of...    122   8e-30   
ref|XP_009602450.1|  PREDICTED: cell wall / vacuolar inhibitor of...    121   2e-29   
pdb|2XQR|B  Chain B, Crystal Structure Of Plant Cell Wall Inverta...    117   3e-28   
ref|XP_003556749.1|  PREDICTED: cell wall / vacuolar inhibitor of...    117   6e-28   
pdb|1RJ1|A  Chain A, Crystal Structure Of A Cell Wall Invertase I...    115   1e-27   
ref|XP_009779928.1|  PREDICTED: cell wall / vacuolar inhibitor of...    116   1e-27   
pdb|2CJ4|A  Chain A, Crystal Structure Of A Cell Wall Invertase I...    115   1e-27   
gb|KHN32722.1|  Pectinesterase inhibitor                                115   2e-27   
ref|XP_003556709.1|  PREDICTED: cell wall / vacuolar inhibitor of...    115   3e-27   
gb|AGC94752.1|  putative pectinesterase inhibitor                       114   1e-26   
ref|XP_003556745.1|  PREDICTED: cell wall / vacuolar inhibitor of...    114   1e-26   
gb|KHN32727.1|  Pectinesterase inhibitor                                112   2e-26   
ref|XP_003556739.1|  PREDICTED: cell wall / vacuolar inhibitor of...    112   3e-26   
gb|KHN32720.1|  Pectinesterase inhibitor                                110   7e-26   
ref|XP_003609825.1|  Pectinesterase inhibitor                           111   8e-26   
ref|XP_006349844.1|  PREDICTED: cell wall / vacuolar inhibitor of...    111   9e-26   
ref|XP_002279756.1|  PREDICTED: cell wall / vacuolar inhibitor of...    110   3e-25   Vitis vinifera
ref|XP_009589300.1|  PREDICTED: cell wall / vacuolar inhibitor of...    109   3e-25   
ref|XP_004252930.1|  PREDICTED: cell wall / vacuolar inhibitor of...    109   3e-25   
ref|XP_010549010.1|  PREDICTED: cell wall / vacuolar inhibitor of...    108   6e-25   
gb|ADM49013.1|  putative invertase inhibitor                            108   1e-24   
ref|XP_006605560.1|  PREDICTED: cell wall / vacuolar inhibitor of...    107   2e-24   
gb|KDP27950.1|  hypothetical protein JCGZ_19030                         107   4e-24   
ref|XP_009780950.1|  PREDICTED: cell wall / vacuolar inhibitor of...    106   5e-24   
ref|XP_002519258.1|  Pectinesterase inhibitor, putative                 106   7e-24   Ricinus communis
ref|XP_006349845.1|  PREDICTED: cell wall / vacuolar inhibitor of...    105   7e-24   
ref|NP_001234791.1|  tomato invertase inhibitor precursor               105   9e-24   
gb|AFI47460.1|  invertase inhibitor                                     105   1e-23   
emb|CDO98741.1|  unnamed protein product                                105   2e-23   
gb|KHN03269.1|  Putative invertase inhibitor                            103   7e-23   
ref|NP_001235420.1|  uncharacterized protein LOC100306719 precursor     103   8e-23   
gb|AFI47461.1|  invertase inhibitor                                     102   1e-22   
gb|KHN32725.1|  Pectinesterase inhibitor                                101   1e-22   
gb|AFI47463.1|  invertase inhibitor                                     102   1e-22   
gb|AAX63190.1|  putative invertase inhibitor precursor                  102   2e-22   Solanum tuberosum [potatoes]
gb|ADM49012.1|  putative invertase inhibitor                            101   2e-22   
ref|XP_010110653.1|  Pectinesterase inhibitor                         99.8    1e-21   
ref|XP_002273484.2|  PREDICTED: cell wall / vacuolar inhibitor of...  99.4    2e-21   Vitis vinifera
ref|XP_007154411.1|  hypothetical protein PHAVU_003G117300g           99.4    2e-21   
ref|XP_008223387.1|  PREDICTED: cell wall / vacuolar inhibitor of...  99.0    3e-21   
ref|XP_007223575.1|  hypothetical protein PRUPE_ppa012287mg           99.0    3e-21   
ref|XP_010098776.1|  Pectinesterase inhibitor 2                       97.8    3e-21   
ref|XP_009590146.1|  PREDICTED: cell wall / vacuolar inhibitor of...  98.6    4e-21   
ref|XP_007154412.1|  hypothetical protein PHAVU_003G117400g           98.6    4e-21   
ref|XP_003609812.1|  Pectinesterase inhibitor                         98.2    4e-21   
ref|XP_002279801.1|  PREDICTED: cell wall / vacuolar inhibitor of...  97.8    5e-21   Vitis vinifera
emb|CDY20929.1|  BnaC06g01490D                                        97.4    7e-21   
gb|AGC75063.1|  vacuolar invertase inhibitor                          97.4    8e-21   
ref|XP_006406762.1|  hypothetical protein EUTSA_v10021672mg           97.1    9e-21   
ref|XP_010461598.1|  PREDICTED: cell wall / vacuolar inhibitor of...  95.9    2e-20   
ref|XP_011071366.1|  PREDICTED: cell wall / vacuolar inhibitor of...  96.3    2e-20   
gb|AFK44620.1|  unknown                                               96.3    2e-20   
ref|XP_006303367.1|  hypothetical protein CARUB_v10010500mg           95.9    3e-20   
ref|XP_009148010.1|  PREDICTED: cell wall / vacuolar inhibitor of...  95.5    3e-20   
emb|CDY39016.1|  BnaC01g34800D                                        95.9    4e-20   
ref|XP_007154410.1|  hypothetical protein PHAVU_003G117200g           95.9    4e-20   
emb|CDX93634.1|  BnaA06g04140D                                        95.1    5e-20   
ref|XP_008340696.1|  PREDICTED: cell wall / vacuolar inhibitor of...  95.1    5e-20   
ref|XP_002894085.1|  hypothetical protein ARALYDRAFT_891603           94.0    1e-19   
ref|XP_004252929.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.4    1e-19   
emb|CDY35000.1|  BnaA01g27340D                                        94.0    1e-19   
ref|XP_009114400.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.0    1e-19   
ref|XP_011041481.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.4    1e-19   
ref|XP_009763718.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.0    2e-19   
ref|XP_004508122.1|  PREDICTED: cell wall / vacuolar inhibitor of...  93.2    2e-19   
ref|XP_011096732.1|  PREDICTED: cell wall / vacuolar inhibitor of...  93.2    3e-19   
ref|XP_008390421.1|  PREDICTED: cell wall / vacuolar inhibitor of...  93.2    3e-19   
ref|XP_004305718.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.4    3e-19   
gb|EYU19077.1|  hypothetical protein MIMGU_mgv1a015091mg              92.8    3e-19   
ref|XP_010465742.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.8    3e-19   
gb|KDP27949.1|  hypothetical protein JCGZ_19029                       92.0    5e-19   
ref|XP_010479199.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.0    5e-19   
ref|XP_010500306.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.0    5e-19   
gb|KDO71995.1|  hypothetical protein CISIN_1g037982mg                 92.0    5e-19   
ref|XP_002314521.1|  hypothetical protein POPTR_0010s07350g           92.4    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007154409.1|  hypothetical protein PHAVU_003G117100g           92.4    6e-19   
ref|XP_006488813.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.0    7e-19   
ref|XP_006393505.1|  hypothetical protein EUTSA_v10011825mg           91.7    8e-19   
gb|AGS32044.1|  invertase inhibitor                                   91.7    1e-18   
gb|KFK26435.1|  hypothetical protein AALP_AA8G248000                  90.5    2e-18   
ref|XP_004508125.1|  PREDICTED: cell wall / vacuolar inhibitor of...  90.9    2e-18   
gb|AAG51534.1|AC051631_14  hypothetical protein; 80318-81409          90.1    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505027.1|  PREDICTED: cell wall / vacuolar inhibitor of...  89.7    3e-18   
ref|XP_006419340.1|  hypothetical protein CICLE_v10006791mg           89.7    4e-18   
ref|XP_004508119.1|  PREDICTED: cell wall / vacuolar inhibitor of...  88.6    9e-18   
ref|XP_006296761.1|  hypothetical protein CARUB_v10015473mg           88.6    1e-17   
gb|ACO35696.1|  invertase inhibitor                                   87.8    2e-17   Solanum tuberosum [potatoes]
ref|XP_010487590.1|  PREDICTED: cell wall / vacuolar inhibitor of...  87.4    2e-17   
gb|EYU45482.1|  hypothetical protein MIMGU_mgv1a014923mg              87.0    4e-17   
ref|XP_006349846.1|  PREDICTED: cell wall / vacuolar inhibitor of...  85.9    9e-17   
gb|ACO35698.1|  invertase inhibitor                                   85.9    1e-16   Solanum tuberosum [potatoes]
gb|ACO35694.1|  invertase inhibitor                                   85.9    1e-16   Solanum tuberosum [potatoes]
ref|XP_004288885.1|  PREDICTED: cell wall / vacuolar inhibitor of...  84.0    3e-16   
gb|KHN03268.1|  Pectinesterase inhibitor                              84.0    5e-16   
ref|NP_001237215.1|  uncharacterized protein LOC100500640 precursor   84.0    5e-16   
ref|XP_002279817.1|  PREDICTED: cell wall / vacuolar inhibitor of...  83.6    6e-16   Vitis vinifera
gb|AIT42248.1|  invertase inhibitor                                   83.6    6e-16   
ref|XP_008390458.1|  PREDICTED: cell wall / vacuolar inhibitor of...  82.4    8e-16   
ref|NP_564516.2|  cell wall / vacuolar inhibitor of fructosidase 1    84.0    8e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79657.1|  hypothetical protein VITISV_014507                   83.2    9e-16   Vitis vinifera
ref|XP_002313933.1|  hypothetical protein POPTR_0009s08690g           82.4    2e-15   Populus trichocarpa [western balsam poplar]
gb|EYU45481.1|  hypothetical protein MIMGU_mgv1a021463mg              80.1    5e-15   
ref|XP_011002592.1|  PREDICTED: cell wall / vacuolar inhibitor of...  80.1    9e-15   
gb|KHN02871.1|  Pectinesterase inhibitor 2                            80.1    9e-15   
ref|XP_003529510.2|  PREDICTED: cell wall / vacuolar inhibitor of...  80.5    9e-15   
ref|XP_007035858.1|  Cell wall / vacuolar inhibitor of fructosida...  79.3    2e-14   
ref|XP_010027116.1|  PREDICTED: cell wall / vacuolar inhibitor of...  79.3    2e-14   
ref|XP_009372102.1|  PREDICTED: cell wall / vacuolar inhibitor of...  79.3    2e-14   
ref|XP_010027117.1|  PREDICTED: cell wall / vacuolar inhibitor of...  78.6    3e-14   
ref|XP_004298183.1|  PREDICTED: cell wall / vacuolar inhibitor of...  77.4    4e-14   
ref|XP_009780951.1|  PREDICTED: cell wall / vacuolar inhibitor of...  77.4    5e-14   
ref|XP_003609813.1|  Pectinesterase inhibitor                         78.2    5e-14   
ref|XP_009372103.1|  PREDICTED: cell wall / vacuolar inhibitor of...  78.2    6e-14   
gb|AFK40449.1|  unknown                                               77.4    1e-13   
gb|AFK48395.1|  unknown                                               77.4    1e-13   
gb|KHN02873.1|  hypothetical protein glysoja_009739                   77.0    1e-13   
ref|XP_008229307.1|  PREDICTED: cell wall / vacuolar inhibitor of...  73.9    1e-12   
ref|XP_007035859.1|  Cell wall / vacuolar inhibitor of fructosida...  74.3    1e-12   
ref|XP_007019911.1|  Cell wall / vacuolar inhibitor of fructosida...  75.1    2e-12   
ref|XP_010110654.1|  Putative invertase inhibitor                     73.9    2e-12   
ref|XP_010045344.1|  PREDICTED: putative invertase inhibitor          73.2    3e-12   
gb|KFK39050.1|  hypothetical protein AALP_AA3G194200                  72.4    4e-12   
ref|XP_010098775.1|  Pectinesterase inhibitor                         72.8    5e-12   
ref|XP_007217364.1|  hypothetical protein PRUPE_ppa022749mg           72.0    9e-12   
ref|XP_003609816.1|  hypothetical protein MTR_4g122800                71.6    1e-11   
ref|XP_004508255.1|  PREDICTED: cell wall / vacuolar inhibitor of...  71.6    1e-11   
ref|XP_010042127.1|  PREDICTED: cell wall / vacuolar inhibitor of...  71.2    1e-11   
ref|XP_010045343.1|  PREDICTED: cell wall / vacuolar inhibitor of...  71.2    2e-11   
ref|XP_008368958.1|  PREDICTED: cell wall / vacuolar inhibitor of...  70.1    3e-11   
ref|XP_007147385.1|  hypothetical protein PHAVU_006G119800g           70.5    4e-11   
ref|XP_007223451.1|  hypothetical protein PRUPE_ppa011560mg           70.5    5e-11   
gb|ADZ54777.1|  invertase inhibitor 2                                 69.7    5e-11   
ref|NP_001238267.1|  uncharacterized protein LOC100527840 precursor   70.1    5e-11   
gb|ADZ54776.1|  invertase inhibitor 2                                 69.3    5e-11   
gb|KCW61322.1|  hypothetical protein EUGRSUZ_H04069                   69.7    6e-11   
ref|XP_003609811.1|  Pectinesterase inhibitor                         69.7    7e-11   
gb|AAX63191.1|  putative invertase inhibitor precursor                68.9    7e-11   Solanum tuberosum [potatoes]
ref|XP_007154406.1|  hypothetical protein PHAVU_003G116900g           69.3    8e-11   
ref|XP_010042126.1|  PREDICTED: cell wall / vacuolar inhibitor of...  68.9    9e-11   
gb|ADM49016.1|  putative invertase inhibitor                          68.6    9e-11   
gb|AAM94391.1|  invertase inhibitor-like protein                      69.3    1e-10   Ipomoea batatas [batate]
gb|KDO71996.1|  hypothetical protein CISIN_1g047345mg                 68.9    1e-10   
ref|XP_008390420.1|  PREDICTED: cell wall / vacuolar inhibitor of...  68.6    2e-10   
ref|XP_002517758.1|  C, putative                                      67.4    2e-10   Ricinus communis
gb|KDP27948.1|  hypothetical protein JCGZ_19028                       67.8    3e-10   
ref|XP_008345204.1|  PREDICTED: uncharacterized protein LOC103408118  69.7    3e-10   
ref|XP_008223407.1|  PREDICTED: cell wall / vacuolar inhibitor of...  68.2    3e-10   
ref|XP_010052514.1|  PREDICTED: putative invertase inhibitor          67.4    4e-10   
ref|XP_003550936.1|  PREDICTED: cell wall / vacuolar inhibitor of...  67.4    4e-10   
gb|ADZ54775.1|  invertase inhibitor 2                                 67.0    4e-10   
ref|XP_008340697.1|  PREDICTED: cell wall / vacuolar inhibitor of...  66.2    5e-10   
ref|XP_004517182.1|  PREDICTED: cell wall / vacuolar inhibitor of...  67.0    5e-10   
gb|KHN03271.1|  hypothetical protein glysoja_004297                   66.6    7e-10   
ref|XP_009372099.1|  PREDICTED: cell wall / vacuolar inhibitor of...  65.9    1e-09   
ref|XP_004514989.1|  PREDICTED: cell wall / vacuolar inhibitor of...  65.5    1e-09   
ref|XP_008370564.1|  PREDICTED: cell wall / vacuolar inhibitor of...  64.7    2e-09   
ref|XP_003546307.1|  PREDICTED: uncharacterized protein LOC100791177  65.5    2e-09   
gb|AFK48253.1|  unknown                                               64.3    2e-09   
ref|XP_008367865.1|  PREDICTED: cell wall / vacuolar inhibitor of...  64.7    2e-09   
ref|XP_006419339.1|  hypothetical protein CICLE_v10006511mg           65.1    3e-09   
emb|CDO98740.1|  unnamed protein product                              64.3    5e-09   
ref|XP_007035856.1|  Plant invertase/pectin methylesterase inhibi...  64.3    5e-09   
ref|XP_004508127.1|  PREDICTED: cell wall / vacuolar inhibitor of...  64.3    5e-09   
gb|ABI17897.1|  invertase inhibitor                                   64.3    5e-09   Coffea canephora [robusta coffee]
ref|XP_011019524.1|  PREDICTED: uncharacterized protein LOC105122226  63.9    5e-09   
gb|KDP29028.1|  hypothetical protein JCGZ_16417                       63.9    6e-09   
gb|AFK46429.1|  unknown                                               64.3    6e-09   
ref|XP_003594702.1|  Pectinesterase inhibitor                         63.9    6e-09   
gb|AFK35451.1|  unknown                                               63.5    1e-08   
ref|XP_002525233.1|  Pectinesterase inhibitor, putative               63.2    1e-08   Ricinus communis
ref|XP_008390454.1|  PREDICTED: cell wall / vacuolar inhibitor of...  62.4    1e-08   
ref|XP_004508124.1|  PREDICTED: cell wall / vacuolar inhibitor of...  62.8    2e-08   
ref|XP_008351148.1|  PREDICTED: cell wall / vacuolar inhibitor of...  62.4    2e-08   
ref|XP_004501778.1|  PREDICTED: pectinesterase inhibitor-like         62.0    3e-08   
ref|XP_006379439.1|  hypothetical protein POPTR_0008s01400g           62.0    3e-08   
ref|XP_008390456.1|  PREDICTED: cell wall / vacuolar inhibitor of...  61.6    3e-08   
ref|XP_004486535.1|  PREDICTED: cell wall / vacuolar inhibitor of...  62.0    4e-08   
ref|XP_008223467.1|  PREDICTED: cell wall / vacuolar inhibitor of...  61.6    4e-08   
ref|XP_010685378.1|  PREDICTED: cell wall / vacuolar inhibitor of...  60.8    9e-08   
ref|XP_004296231.1|  PREDICTED: cell wall / vacuolar inhibitor of...  60.5    9e-08   
ref|XP_011032948.1|  PREDICTED: cell wall / vacuolar inhibitor of...  60.5    1e-07   
ref|XP_002525501.1|  C, putative                                      60.5    1e-07   Ricinus communis
ref|XP_007208900.1|  hypothetical protein PRUPE_ppa026908mg           60.1    2e-07   
ref|NP_188339.1|  plant invertase/pectin methylesterase inhibitor...  58.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44617.1|  unknown                                               60.1    2e-07   
ref|XP_008368766.1|  PREDICTED: cell wall / vacuolar inhibitor of...  59.7    2e-07   
dbj|BAA94992.1|  invertase inhibitor-like protein                     59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188340.3|  plant invertase/pectin methylesterase inhibitor...  59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011095862.1|  PREDICTED: cell wall / vacuolar inhibitor of...  59.7    2e-07   
ref|XP_004508126.1|  PREDICTED: cell wall / vacuolar inhibitor of...  59.3    3e-07   
ref|XP_006488812.1|  PREDICTED: cell wall / vacuolar inhibitor of...  59.3    3e-07   
ref|XP_007048339.1|  Cell wall / vacuolar inhibitor of fructosida...  60.1    3e-07   
ref|XP_002311377.2|  invertase/pectin methylesterase inhibitor fa...  58.9    3e-07   Populus trichocarpa [western balsam poplar]
gb|AGX27452.1|  cell wall and vascular inhibitor of beta-fructosi...  58.9    4e-07   
ref|XP_009372129.1|  PREDICTED: cell wall / vacuolar inhibitor of...  58.2    8e-07   
ref|XP_004296225.1|  PREDICTED: cell wall / vacuolar inhibitor of...  57.0    1e-06   
ref|XP_007221576.1|  hypothetical protein PRUPE_ppa1027160mg          57.0    1e-06   
ref|XP_004293424.1|  PREDICTED: cell wall / vacuolar inhibitor of...  57.8    2e-06   
ref|XP_009376582.1|  PREDICTED: uncharacterized protein LOC103965273  56.6    2e-06   
ref|XP_008340695.1|  PREDICTED: uncharacterized protein LOC103403627  57.8    2e-06   
ref|XP_008370626.1|  PREDICTED: putative invertase inhibitor          56.6    2e-06   
ref|XP_007224999.1|  hypothetical protein PRUPE_ppa020400mg           56.2    2e-06   
ref|XP_008808258.1|  PREDICTED: putative invertase inhibitor          55.5    5e-06   
ref|XP_010649385.1|  PREDICTED: cell wall / vacuolar inhibitor of...  55.5    6e-06   
ref|XP_002885188.1|  hypothetical protein ARALYDRAFT_318477           54.3    7e-06   
ref|XP_004508123.1|  PREDICTED: cell wall / vacuolar inhibitor of...  55.1    8e-06   
emb|CDM80068.1|  unnamed protein product                              55.1    9e-06   
ref|XP_010024810.1|  PREDICTED: cell wall / vacuolar inhibitor of...  54.7    1e-05   
ref|XP_010487591.1|  PREDICTED: pectinesterase inhibitor-like         54.3    1e-05   
ref|XP_004502921.1|  PREDICTED: cell wall / vacuolar inhibitor of...  54.3    1e-05   
ref|XP_006419341.1|  hypothetical protein CICLE_v10006032mg           54.3    1e-05   
ref|XP_004300864.1|  PREDICTED: uncharacterized protein LOC101308973  53.1    2e-05   
ref|NP_001078166.1|  putative pectinesterase inhibitor                53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010649645.1|  PREDICTED: pectinesterase inhibitor              53.9    2e-05   
emb|CAN67807.1|  hypothetical protein VITISV_037797                   54.3    2e-05   Vitis vinifera
ref|XP_010940964.1|  PREDICTED: putative invertase inhibitor          53.1    3e-05   
ref|XP_002883047.1|  enzyme inhibitor/ pectinesterase                 53.1    3e-05   
ref|XP_006449974.1|  hypothetical protein CICLE_v10017450mg           53.1    4e-05   
ref|XP_010660323.1|  PREDICTED: pectinesterase inhibitor-like         53.1    4e-05   
ref|XP_010906021.1|  PREDICTED: putative invertase inhibitor          52.8    4e-05   
ref|XP_010444399.1|  PREDICTED: cell wall / vacuolar inhibitor of...  52.8    5e-05   
ref|XP_010906022.1|  PREDICTED: putative invertase inhibitor          52.4    6e-05   
ref|XP_011040101.1|  PREDICTED: cell wall / vacuolar inhibitor of...  52.8    6e-05   
ref|XP_003602589.1|  Pectinesterase inhibitor                         52.4    7e-05   
ref|XP_008224683.1|  PREDICTED: pectinesterase inhibitor-like         52.0    8e-05   
ref|XP_006373555.1|  hypothetical protein POPTR_0016s00350g           52.0    9e-05   
ref|XP_002517248.1|  Pectinesterase inhibitor, putative               52.0    1e-04   Ricinus communis
ref|XP_004508256.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.6    1e-04   
ref|XP_008782576.1|  PREDICTED: cell wall / vacuolar inhibitor of...  52.0    1e-04   
ref|XP_010468224.1|  PREDICTED: pectinesterase inhibitor-like         51.6    1e-04   
sp|P83326.2|PMEI_ACTDE  RecName: Full=Pectinesterase inhibitor; A...  51.6    1e-04   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010462937.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.6    1e-04   
gb|KHN09600.1|  Pectinesterase inhibitor                              50.8    1e-04   
pdb|1XG2|B  Chain B, Crystal Structure Of The Complex Between Pec...  50.8    1e-04   
gb|EMS54103.1|  hypothetical protein TRIUR3_04186                     51.2    1e-04   
ref|XP_010505073.1|  PREDICTED: pectinesterase inhibitor-like         51.2    2e-04   
ref|XP_008235482.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.2    2e-04   
ref|XP_010096509.1|  Pectinesterase inhibitor                         51.2    2e-04   
ref|XP_010484247.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.8    2e-04   
ref|XP_003589451.1|  Pectinesterase inhibitor                         51.2    2e-04   
ref|XP_007137711.1|  hypothetical protein PHAVU_009G149400g           50.4    3e-04   
ref|NP_001235392.1|  uncharacterized protein LOC100306461 precursor   50.4    3e-04   
ref|XP_007206622.1|  hypothetical protein PRUPE_ppa021753mg           50.4    3e-04   
ref|XP_008808257.1|  PREDICTED: putative invertase inhibitor          50.4    3e-04   
ref|XP_008799039.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.4    3e-04   
dbj|BAC54965.1|  pectinmethylesterase inhibitor                       50.4    4e-04   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003526858.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.1    4e-04   
ref|XP_010908086.1|  PREDICTED: cell wall / vacuolar inhibitor of...  49.7    5e-04   
ref|XP_004508121.1|  PREDICTED: cell wall / vacuolar inhibitor of...  48.5    6e-04   
gb|KDO78638.1|  hypothetical protein CISIN_1g042338mg                 50.1    6e-04   
ref|XP_003609810.1|  Pectinesterase inhibitor                         51.2    6e-04   
ref|XP_006440545.1|  hypothetical protein CICLE_v10023580mg           49.3    7e-04   
ref|XP_006492567.1|  PREDICTED: pectinesterase inhibitor-like         49.3    8e-04   
ref|XP_010468223.1|  PREDICTED: pectinesterase inhibitor-like         49.3    9e-04   



>gb|ABB17076.1| invertase inhibitor [Nicotiana langsdorffii x Nicotiana sanderae]
Length=165

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 102/169 (60%), Gaps = 6/169 (4%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            M+NLI +++ L++L T  N     V+  CK T NY+LC++ + +D R+   D  TLA+IM
Sbjct  1    MKNLIFLMMFLILLQTNAN---NLVETTCKNTPNYQLCLKTLLSDKRSETGDITTLALIM  57

Query  327  IDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
            +D +K+K+      I +L  S+P    K PL+ CA+ Y+V++  +L + A + +  GDPK
Sbjct  58   VDAIKSKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPE-AIEALTKGDPK  116

Query  501  FAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            FAE+ M         CE +F G KSP + LN  V +L+DV R ++RNLL
Sbjct  117  FAEDGMVGSSGDAQECEEYFKGSKSPFSALNDAVHQLSDVGRAIVRNLL  165



>ref|XP_009604073.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
Length=169

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 100/169 (59%), Gaps = 4/169 (2%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            M+ L+  V L + L    + D+  V+  CK T N +LC++ + ADPR+   D  TLA+I+
Sbjct  2    MKTLV-YVALFLSLVLQTSADKNLVQNTCKNTPNVQLCLKTLLADPRSANGDVNTLALII  60

Query  327  IDTVKAKSKVTDKLIKRLLKSHPDLK--VPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
            +D +K ++      I +L +S+P     VPL+ CA+ Y+V++  ++ + A + +  GDPK
Sbjct  61   VDAIKVQATQAAATISKLQQSNPPAAWIVPLKNCAFSYKVILTASMPE-ATEALTKGDPK  119

Query  501  FAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            FAE+A+         CE +F G+ SPLT LN  V EL+DV R +IR LL
Sbjct  120  FAEDAVVGSSGDADQCEKNFGGNNSPLTALNTAVRELSDVARAIIRTLL  168



>ref|XP_009779273.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana sylvestris]
Length=166

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 103/170 (61%), Gaps = 7/170 (4%)
 Frame = +3

Query  147  MRNLICVVILL-MMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAII  323
            M+NLI +++LL ++L T  N     V+  CK T NY+LC++ + +D R+   D  TLA+I
Sbjct  1    MKNLIVLMMLLTILLQTNAN---NLVETTCKNTPNYQLCLKTLLSDKRSETGDITTLALI  57

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +K+K+      I +L  S+P    K PL+ CA+ Y+V++  +L + A + +  GDP
Sbjct  58   MVDAIKSKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPE-AIEALTKGDP  116

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F G KSP + LN  V EL+DV R ++RNLL
Sbjct  117  KFAEDGMVGSSGDAQECEEYFKGSKSPFSALNVAVHELSDVGRAIVRNLL  166



>ref|XP_009602450.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
 emb|CAA73333.1| invertase inhibitor [Nicotiana tabacum]
Length=166

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 101/170 (59%), Gaps = 7/170 (4%)
 Frame = +3

Query  147  MRNLICVVILL-MMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAII  323
            M+NLI + + L ++L T  N     V+  CK T NY+LC++ + +D R+   D  TLA+I
Sbjct  1    MKNLIFLTMFLTILLQTNAN---NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALI  57

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +KAK+      I +L  S+P    K PL+ CA+ Y+V++  +L + A + +  GDP
Sbjct  58   MVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPE-AIEALTKGDP  116

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F G KSP + LN  V EL+DV R ++RNLL
Sbjct  117  KFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL  166



>pdb|2XQR|B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|D Chain D, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|F Chain F, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|H Chain H, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|J Chain J, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|L Chain L, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
Length=149

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 89/150 (59%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL  383
            G    V+  CK T NY+LC++ + +D R+   D  TLA+IM+D +KAK+      I +L 
Sbjct  1    GANNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLR  60

Query  384  KSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
             S+P    K PL+ CA+ Y+V++  +L + A + +  GDPKFAE+ M         CE +
Sbjct  61   HSNPPAAWKGPLKNCAFSYKVILTASLPE-AIEALTKGDPKFAEDGMVGSSGDAQECEEY  119

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F G KSP + LN  V EL+DV R ++RNLL
Sbjct  120  FKGSKSPFSALNIAVHELSDVGRAIVRNLL  149



>ref|XP_003556749.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 93/147 (63%), Gaps = 4/147 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ CK T N  LC++ + ADPRAP AD   LA+I++D +KAK+   +K IK+LLK
Sbjct  33   DLKLIEETCKRTPNPNLCLQLLKADPRAPSADIAGLALILVDVIKAKATEAEKTIKQLLK  92

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               + K  L +CA DY+  ILK  +  A   V  G+PKFAE A++        CEN F G
Sbjct  93   QGGNKKA-LSECADDYD-GILKLDVPTATRAV-RGNPKFAENAVSDCAVEADSCENGFHG  149

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLTH+N  + ++A+V R +IRNLL
Sbjct  150  -KSPLTHVNNGMHDVANVARAIIRNLL  175



>pdb|1RJ1|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco
 pdb|1RJ4|A Chain A, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
 pdb|1RJ4|B Chain B, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
 pdb|1RJ4|C Chain C, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
 pdb|1RJ4|D Chain D, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
Length=151

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = +3

Query  210  RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKS  389
               V+  CK T NY+LC++ + +D R+   D  TLA+IM+D +KAK+      I +L  S
Sbjct  5    NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHS  64

Query  390  HPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA  563
            +P    K PL+ CA+ Y+V++  +L + A + +  GDPKFAE+ M         CE +F 
Sbjct  65   NPPAAWKGPLKNCAFSYKVILTASLPE-AIEALTKGDPKFAEDGMVGSSGDAQECEEYFK  123

Query  564  GHKSPLTHLNKLVGELADVTRDVIRNLL  647
            G KSP + LN  V EL+DV R ++RNLL
Sbjct  124  GSKSPFSALNIAVHELSDVGRAIVRNLL  151



>ref|XP_009779928.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana sylvestris]
Length=171

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 93/160 (58%), Gaps = 3/160 (2%)
 Frame = +3

Query  174  LLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSK  353
            L + L    + D+  V+  CK T N +LC++ + ADPR+   D  T+A+I++D +K ++ 
Sbjct  10   LFLTLVLQTSADKNLVQNTCKNTPNVQLCLKTLLADPRSANGDVHTMALIIVDAIKVQAT  69

Query  354  VTDKLIKRLLKSHPDLK--VPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKL  527
                 I +L +S+P     VPL+ CA+ Y+V  L T +  A + +  G+PKFAE+A+   
Sbjct  70   QATATISKLQQSNPPAAWIVPLKNCAFSYKVT-LTTSVPEAIEALTKGNPKFAEDAIVGS  128

Query  528  PFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                  CE  F G+ SPLT LN ++ EL+DV R +IR LL
Sbjct  129  FGDADQCEKIFGGNNSPLTALNTVMHELSDVARAIIRTLL  168



>pdb|2CJ4|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco At Ph 4.6
 pdb|2CJ4|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco At Ph 4.6
 pdb|2CJ5|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 5.0)
 pdb|2CJ6|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 7.5)
 pdb|2CJ7|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (ph 9.0)
 pdb|2CJ8|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 9.5)
 pdb|2CJ8|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 9.5)
Length=150

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = +3

Query  210  RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKS  389
               V+  CK T NY+LC++ + +D R+   D  TLA+IM+D +KAK+      I +L  S
Sbjct  4    NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHS  63

Query  390  HPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA  563
            +P    K PL+ CA+ Y+V++  +L + A + +  GDPKFAE+ M         CE +F 
Sbjct  64   NPPAAWKGPLKNCAFSYKVILTASLPE-AIEALTKGDPKFAEDGMVGSSGDAQECEEYFK  122

Query  564  GHKSPLTHLNKLVGELADVTRDVIRNLL  647
            G KSP + LN  V EL+DV R ++RNLL
Sbjct  123  GSKSPFSALNIAVHELSDVGRAIVRNLL  150



>gb|KHN32722.1| Pectinesterase inhibitor [Glycine soja]
Length=155

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ CK T N  LC++ + ADPRAP AD   LA+I++D +KAK+   +K IK+LLK
Sbjct  13   DLKLIEETCKRTPNPNLCLQLLKADPRAPSADIAGLALILVDVIKAKATEAEKTIKQLLK  72

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               + K  L +CA DY+ +++  +        + GDPKFAE  ++        CEN F G
Sbjct  73   QGGNKKA-LSECADDYDGILMLDVPTATR--AVRGDPKFAENTVSDCAVEADSCENGFHG  129

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLTH+N  + ++A+V R +IRNLL
Sbjct  130  -KSPLTHVNNGMRDVANVARAIIRNLL  155



>ref|XP_003556709.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ CK T N  LC++ + ADPRAP AD   LA+I++D +KAK+   +K IK+LLK
Sbjct  33   DLKLIEETCKRTPNPNLCLQLLKADPRAPSADIAGLALILVDMIKAKATEAEKTIKQLLK  92

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               + K  L +CA DY+ +++  +        + GDPKFAE  ++        CEN F G
Sbjct  93   QGGNKKA-LSECADDYDGILMLDVPTATR--AVRGDPKFAENTVSDCAVEADSCENGFHG  149

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLTH+N  + ++A+V R +IRNLL
Sbjct  150  -KSPLTHVNNGMRDVANVARAIIRNLL  175



>gb|AGC94752.1| putative pectinesterase inhibitor [Euphorbia lathyris]
Length=172

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 92/161 (57%), Gaps = 1/161 (1%)
 Frame = +3

Query  165  VVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKA  344
             +IL++     +  + + + + CK T  Y LC+ ++ ADPR+  AD + LA+IM+D +K 
Sbjct  13   AIILILTQFKTVQSNPQTISQTCKQTPYYNLCLNHLTADPRSSTADVKGLALIMVDLLKG  72

Query  345  KSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTK  524
            K+  + + IK++    PDL+  L++CA  Y+ VIL   I VA + +  GDPKFAE  M  
Sbjct  73   KTTRSAQFIKQITGKRPDLQKLLKECARKYD-VILTANIPVAIEALEKGDPKFAEGGMND  131

Query  525  LPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                   CE+ F G KSPL+  NKL+ + + V   + R LL
Sbjct  132  AAIEVNSCESSFRGTKSPLSSYNKLLHDTSLVASAIARQLL  172



>ref|XP_003556745.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 93/148 (63%), Gaps = 4/148 (3%)
 Frame = +3

Query  204  GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL  383
             D K +++ CK T    LC++ +  DPRAP ADT +LA+I++D +KAK+   +K IK+LL
Sbjct  32   NDLKLIEETCKRTPKPNLCLQLLKGDPRAPSADTASLALILVDVIKAKANEAEKTIKQLL  91

Query  384  KSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA  563
            K   + K  L +CA DY+ +++  + +      + GDPKFA++A++        CEN F 
Sbjct  92   KQGGNKKA-LSECAVDYKGILILDIPQATR--AVRGDPKFADDAVSDCAVEADICENRFN  148

Query  564  GHKSPLTHLNKLVGELADVTRDVIRNLL  647
            G KSPLTH+N  + ++A+V R +IR LL
Sbjct  149  G-KSPLTHVNNGMRDVANVARAIIRTLL  175



>gb|KHN32727.1| Pectinesterase inhibitor [Glycine soja]
Length=155

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ CK T    LC++ +  DPRAP ADT  LA+I++D +KAK+   +K IK+LLK
Sbjct  13   DLKLIEETCKRTPKPNLCLQLLKGDPRAPSADTAGLALILVDVIKAKANEAEKTIKQLLK  72

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               + K  L +CA DY+ +++  + +      + GDPKFAE  ++        CEN F G
Sbjct  73   QGGNKKA-LSECAVDYKGILILDIPQATR--AVRGDPKFAENTVSDCAVEADSCENGFHG  129

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLTH+N  + ++A+V R +IR LL
Sbjct  130  -KSPLTHVNNGMRDVANVARAIIRTLL  155



>ref|XP_003556739.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 92/147 (63%), Gaps = 4/147 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ CK T    LC++ +  DPRAP ADT  LA+I++D +KAK+   +K IK+LLK
Sbjct  33   DLKLIEETCKRTPKPNLCLQLLKGDPRAPSADTAGLALILVDVIKAKANEAEKTIKQLLK  92

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               + K  L +CA DY+ +++  + +      + GDPKFA++A++        CEN F G
Sbjct  93   QGGNKKA-LSECAVDYKGILILDIPQATR--AVRGDPKFADDAVSDCAVEADICENRFNG  149

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLTH+N  + ++A+V R +IR LL
Sbjct  150  -KSPLTHVNNGMRDVANVARAIIRTLL  175



>gb|KHN32720.1| Pectinesterase inhibitor [Glycine soja]
Length=155

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 92/147 (63%), Gaps = 4/147 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ CK T    LC++ +  DPRAP ADT  LA+I++D +KAK+   +K IK+LLK
Sbjct  13   DLKLIEETCKRTPKPNLCLQLLKGDPRAPSADTAGLALILVDVIKAKANEAEKTIKQLLK  72

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               + K  L +CA DY+ +++  + +      + GDPKFA++A++        CEN F G
Sbjct  73   QGGNKKA-LSECAVDYKGILILDIPQATR--AVRGDPKFADDAVSDCAVEADICENRFNG  129

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLTH+N  + ++A+V R +IR LL
Sbjct  130  -KSPLTHVNNGMRDVANVARAIIRILL  155



>ref|XP_003609825.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92022.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=175

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 95/165 (58%), Gaps = 3/165 (2%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            ++C  +++    T    D   +++ CK T NY LC++Y+ +DP+AP AD R L++IM++ 
Sbjct  13   ILCTFLVVTQSRTIQPNDANLIQQTCKNTPNYALCIQYLNSDPKAPSADIRGLSLIMVNV  72

Query  336  VKAKSKVTDKLIKRLLK-SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEE  512
            +K K+  T   I++LLK S P  K  L  C   Y  +I+  + + A + +  G+PKFAE+
Sbjct  73   IKTKATATLNKIRQLLKTSPPSQKGALTSCESKYNTIIVADVAE-ATEALQKGNPKFAED  131

Query  513  AMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
              +        CE  F+G+ SPLT  N ++  +A + R +IRNLL
Sbjct  132  GASDADVEQEACEGGFSGN-SPLTADNNVMHNVATIARAIIRNLL  175



>ref|XP_006349844.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum tuberosum]
Length=168

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 96/167 (57%), Gaps = 7/167 (4%)
 Frame = +3

Query  165  VVILLMMLTTPI---NGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMID  332
            ++I LMM  T +   NG  K V+  CK T NY+LC++    D R+  A D +TLA+IM+D
Sbjct  3    ILIFLMMFLTLVLVTNGINKLVETTCKNTPNYDLCVKTFSLDKRSETAGDIKTLALIMVD  62

Query  333  TVKAKSKVTDKLIKRLLKSHPDLK--VPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +K+K+     +I  L  S P      PL++CA+ Y+V IL   I  A + +  GDPKFA
Sbjct  63   AIKSKANHAFSIISNLRHSSPPQAWIHPLKECAFSYKV-ILTVSIPEAIEALTKGDPKFA  121

Query  507  EEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            E+AM         CE++F     PL+ LN  V +L+D+ R +IRNLL
Sbjct  122  EDAMVGTSGDAQECEDNFKSKSPPLSKLNIDVHDLSDINRAIIRNLL  168



>ref|XP_002279756.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Vitis vinifera]
Length=169

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 92/166 (55%), Gaps = 5/166 (3%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            L+CVV L +      + D   VK+ C+ T NY+LC++ + +DPR+  AD   LA++M+D 
Sbjct  7    LLCVVGLSLTQIQFSSAD--LVKQTCRQTPNYDLCVQTLRSDPRSSHADVAGLAMVMVDM  64

Query  336  VKAKSKVTDKLIKRLLKS--HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAE  509
            +KAKS  T   I  LL +  HP  K  L +CA  Y+  +LK  I  A + +  G+PKFAE
Sbjct  65   IKAKSIATLHRISELLGTAPHPKTKATLRRCAELYDNAVLKADIPSAMEALKTGNPKFAE  124

Query  510  EAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            +           CE  F+G  SP+T  N+ V +L+ V   +IR LL
Sbjct  125  QGANDAANEADSCERAFSG-ASPITSFNRSVSDLSRVASAIIRLLL  169



>ref|XP_009589300.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
Length=169

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 90/146 (62%), Gaps = 3/146 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V+  CK T NY LC++ + +D R+   D  TLA+I++D +KAK+    K+I +L +S+P
Sbjct  25   LVETTCKNTPNYNLCLKTLLSDKRSASGDITTLALIVVDAIKAKANQAAKIISKLRQSNP  84

Query  396  DL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
                +VPL++C + Y+V++  +L + A + +  G+PKFAE+ M      +  CE +F   
Sbjct  85   PAAWRVPLKKCGFSYKVILTVSLPE-AIEALTKGNPKFAEDGMVGCFGDSQDCEENFKSS  143

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
             SPL+ LN  V EL+ V R +IRNLL
Sbjct  144  FSPLSGLNTAVHELSVVGRAIIRNLL  169



>ref|XP_004252930.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum lycopersicum]
Length=168

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 96/167 (57%), Gaps = 7/167 (4%)
 Frame = +3

Query  165  VVILLMMLTTPI---NGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMID  332
            ++I LMM  T +   NG    V+  CK T NY+LC++    D R+ +A D +TLA+IM+D
Sbjct  3    ILIFLMMFFTLVLVTNGINNLVETTCKNTPNYDLCVKTFSLDKRSEKAGDIKTLALIMVD  62

Query  333  TVKAKSKVTDKLIKRLLKSHPDLK--VPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +K+K+     +I +L  S+P      PL++CA+ Y+V IL   I  A + +  G+PKFA
Sbjct  63   AIKSKANQAFSIISKLRHSNPPQAWIHPLKECAFSYKV-ILTASIPEAIEALTKGNPKFA  121

Query  507  EEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            E+AM         CEN+F      LT LN  V  L+D+ R +IRNLL
Sbjct  122  EDAMVGTSGDAQECENNFKSKSLQLTKLNIDVHNLSDINRAIIRNLL  168



>ref|XP_010549010.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Tarenaya 
hassleriana]
Length=169

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 96/171 (56%), Gaps = 6/171 (4%)
 Frame = +3

Query  147  MRNLICV----VILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTL  314
            MR   C+     +++M + + +  D  F++K CK T NY LC+  + +DPR   ADT  L
Sbjct  1    MRKQWCLFGVAAVVVMTMMSGVRSDEVFIEKTCKQTPNYNLCVSLLKSDPRGSSADTTGL  60

Query  315  AIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGD  494
            A+I++D +KA +  T K I RL K   +L+ PL  C   Y+  IL+  +  A + +  G 
Sbjct  61   ALILVDHIKATATETLKKISRLYKKRRELREPLVSCTSKYK-AILEADVPSAVEALSKGV  119

Query  495  PKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            PK+AE+A+         CE  F G KSPLT L K + +++DV R ++R LL
Sbjct  120  PKYAEDAVVDAGVEASICERGFHG-KSPLTALTKSLEDISDVARPIVRMLL  169



>gb|ADM49013.1| putative invertase inhibitor [Solanum tuberosum]
Length=168

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 96/167 (57%), Gaps = 7/167 (4%)
 Frame = +3

Query  165  VVILLMMLTTPI---NGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMID  332
            + I LMM  T +   NG  K V+  CK T NY+LC++    D R+  A D +TLA+IM+D
Sbjct  3    IFIFLMMFLTLVLVTNGINKLVETTCKNTPNYDLCVKTFSLDKRSETAGDIKTLALIMVD  62

Query  333  TVKAKSKVTDKLIKRLLKSH-PDLKV-PLEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +K+K+     +I  L  S  P   + PL++CA+ Y+V IL   I  A + +  GDPKFA
Sbjct  63   AIKSKANHAFSIISNLRHSSTPQAWIHPLKECAFSYKV-ILTVSIPEAIEALTKGDPKFA  121

Query  507  EEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            E+AM         CE++F     PL+ LN  V +L+D+ R ++RNLL
Sbjct  122  EDAMVGTSGDAQECEDNFKSKSPPLSKLNIDVHDLSDINRAIVRNLL  168



>ref|XP_006605560.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=155

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = +3

Query  204  GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL  383
             D K +++ CK T    LC++ +  DPRAP AD   LA+I++D ++AK+   +K IK+LL
Sbjct  12   NDLKLIEETCKRTPKPNLCLQLLKGDPRAPSADIAGLALILVDVIQAKANEAEKTIKQLL  71

Query  384  KSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA  563
            K   + K  L +CA DY+ +++  + +      + GDPKFA++A++        CEN F 
Sbjct  72   KQGGNKKA-LSECAVDYKRILILDIPEATR--AVRGDPKFADDAVSDCAVEADICENRFN  128

Query  564  GHKSPLTHLNKLVGELADVTRDVIRNLL  647
            G KSPLTH+N  + ++A+V R +IR LL
Sbjct  129  G-KSPLTHVNNGMRDVANVARAIIRILL  155



>gb|KDP27950.1| hypothetical protein JCGZ_19030 [Jatropha curcas]
Length=175

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 91/164 (55%), Gaps = 1/164 (1%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            L+  V LL      +  D   + + CK + NY LC+  + +D R+ +AD++ LA+IM+  
Sbjct  13   LVISVTLLGTQFVTVQSDANLIVQTCKNSPNYNLCVNSLRSDSRSTKADSQGLALIMVHV  72

Query  336  VKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA  515
            +K ++  T ++IK+ LK +P L+  L  C  +Y+V IL   I VA + +  GDPKFAE A
Sbjct  73   LKNRATETLQVIKQELKRNPRLRKELSSCVENYDVGILSADIPVAIEALEKGDPKFAETA  132

Query  516  MTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                      CE +F G+ SPLT  NK+V E   V   +IR LL
Sbjct  133  ARDAADEASFCEENFNGN-SPLTKYNKVVHETGAVAAAIIRPLL  175



>ref|XP_009780950.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X1 [Nicotiana sylvestris]
Length=169

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (61%), Gaps = 3/146 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V+  CK T NY LC++ + +D R+   D  TLA+I++D +K K+    + I +L +S+P
Sbjct  25   LVETTCKNTPNYNLCLKTLLSDKRSAGGDITTLALIVVDAIKVKANQAAEFISKLRQSNP  84

Query  396  DL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
                +VPL++CA+ Y+V++  +L + A + +  G+PKFAE+ M      +  CE +F   
Sbjct  85   PTAWRVPLKKCAFSYKVILTVSLPE-AVEALTKGNPKFAEDGMVVCFGDSQDCEENFKSS  143

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
             SPLT LN  V EL+ V R +IRNLL
Sbjct  144  FSPLTGLNTAVLELSVVGRAIIRNLL  169



>ref|XP_002519258.1| Pectinesterase inhibitor, putative [Ricinus communis]
 gb|EEF43122.1| Pectinesterase inhibitor, putative [Ricinus communis]
Length=178

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 88/163 (54%), Gaps = 2/163 (1%)
 Frame = +3

Query  159  ICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTV  338
            I ++ LL+  ++ +  D   +  ICK T NY LC+  + +DPR+ +ADT  LA+IM+D +
Sbjct  18   IFIIFLLLTQSSFVQSDASLISNICKQTPNYNLCVTSLNSDPRSAKADTTGLALIMVDII  77

Query  339  KAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAM  518
            KA++  +   I+      P LK  L  CA  Y+  IL   I  AY+ +  G PKFA++A 
Sbjct  78   KARATASLNFIRHQYHKSPRLKKQLTSCAHGYD-AILTLDIPEAYEALQKGVPKFAQDAA  136

Query  519  TKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                     CE  F G+ SP+  LN LV + + V   VIR LL
Sbjct  137  NDAAVEANSCEGGFHGN-SPMKKLNVLVHDTSAVASAVIRLLL  178



>ref|XP_006349845.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum tuberosum]
 gb|AAX63189.1| putative invertase inhibitor precursor [Solanum tuberosum]
Length=171

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 98/173 (57%), Gaps = 8/173 (5%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAII  323
            M+  I +++ L ML    NG+   V+  CK T NY LC++ +  D R+  A D  TLA+I
Sbjct  1    MKIFIFLMMFLAMLLV-TNGNNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDITTLALI  59

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +K+K+      I +L  S+P    K PL+ CA+ Y+V++  ++ + A + +  GDP
Sbjct  60   MVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPE-AIEALTKGDP  118

Query  498  KFAEEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>ref|NP_001234791.1| tomato invertase inhibitor precursor [Solanum lycopersicum]
 emb|CAA09420.1| tomato invertase inhibitor [Solanum lycopersicum]
Length=171

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 98/173 (57%), Gaps = 8/173 (5%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAII  323
            M+ LI +++ L ML    +G+   V+  CK T NY LC++ +  D R+ +A D  TLA+I
Sbjct  1    MKILIFLIMFLAMLLV-TSGNNNLVETTCKNTPNYNLCVKTLSLDKRSEKAGDITTLALI  59

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +K+K+      I +L  S+P    K PL+ CA+ Y+ VIL   +  A + +  GDP
Sbjct  60   MVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYK-VILPASMPEALEALTKGDP  118

Query  498  KFAEEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKATTIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|AFI47460.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 98/173 (57%), Gaps = 8/173 (5%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAII  323
            M+ L+ +++ L ML     G+   V+  CK T NY LC+E +  D R+  A D  TLA+I
Sbjct  1    MKILLFLMMFLAMLIV-TKGNNNLVETTCKNTPNYNLCVETLSLDKRSQTAGDITTLALI  59

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +K+K+      I +L  S+P    K PL+ CA+ Y+V++  ++ + A + +  GDP
Sbjct  60   MVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPE-AIEALTKGDP  118

Query  498  KFAEEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>emb|CDO98741.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 81/144 (56%), Gaps = 1/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             ++  C+ T +Y+LC   + +DPR+ +ADT  L +I++D +K K+      I RL  S+P
Sbjct  43   LIENTCRNTPDYQLCFSTLLSDPRSFDADTYGLGLIIVDALKDKATSAVNAINRLKGSNP  102

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +   PL +C+  Y   ILK  I  A +G+  G PKFAE  M        GCEN F    S
Sbjct  103  EFIRPLIKCSISYN-AILKADIPEAIEGLRKGVPKFAEYGMADTAVEVQGCENSFKQSNS  161

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT LNK V +L+ V + +IR LL
Sbjct  162  PLTDLNKQVYDLSIVAKSIIRMLL  185



>gb|KHN03269.1| Putative invertase inhibitor [Glycine soja]
Length=179

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 93/169 (55%), Gaps = 11/169 (7%)
 Frame = +3

Query  171  ILLMMLTTPINGDR--------KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            ++L  ++ P    R          +++ CK T +++LC++Y+ +DPR+ EAD   LA+IM
Sbjct  12   LVLATISVPATNSRIIHQKNNANLIEETCKQTPHHDLCIQYLSSDPRSTEADVTGLALIM  71

Query  327  IDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
            ++ +K K+      I +LL+ +P+   K PL  CA  Y+ ++ +  +  A   +  GDPK
Sbjct  72   VNVIKIKANNALDKIHQLLQKNPEPSQKEPLSSCAARYKAIV-EADVAQAVASLQKGDPK  130

Query  501  FAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            FAE+           CEN F+  KSPLT+ N  + ++A +T  ++R LL
Sbjct  131  FAEDGANDAAIEATTCENSFSAGKSPLTNHNNAMHDVATITAAIVRQLL  179



>ref|NP_001235420.1| uncharacterized protein LOC100306719 precursor [Glycine max]
 gb|ACU15029.1| unknown [Glycine max]
Length=182

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 87/150 (58%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL  383
             +   +++ CK T +++LC++Y+ +DPR+ EAD   LA+IM++ +K K+      I +LL
Sbjct  34   NNANLIEETCKQTPHHDLCIQYLSSDPRSTEADVTGLALIMVNVIKIKANNALDKIHQLL  93

Query  384  KSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
            + +P+   K PL  CA  Y+ ++ +  +  A   +  GDPKFAE+           CEN 
Sbjct  94   QKNPEPSQKEPLSSCAARYKAIV-EADVAQAVASLQKGDPKFAEDGANDAAIEATTCENS  152

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F+  KSPLT+ N  + ++A +T  ++R LL
Sbjct  153  FSAGKSPLTNHNNAMHDVATITAAIVRQLL  182



>gb|AFI47461.1| invertase inhibitor [Solanum tuberosum]
 gb|AFI47462.1| invertase inhibitor [Solanum tuberosum]
 gb|AIT42247.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 95/170 (56%), Gaps = 9/170 (5%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMID  332
            L  ++ L M+L T   G    V+  CK T NY LC++ +  D R+  A D  TLA+IM+D
Sbjct  5    LFLMMFLAMLLVT--KGKNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDITTLALIMVD  62

Query  333  TVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +K+K+      I +L  S+P    K PL+ CA+ Y+V++  ++ + A + +  GDPKFA
Sbjct  63   AIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPE-AIEALTKGDPKFA  121

Query  507  EEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            E+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  122  EDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|KHN32725.1| Pectinesterase inhibitor, partial [Glycine soja]
Length=134

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = +3

Query  234  KTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPL  413
            K T    LC++ +  DPRAP AD   LA+I+++ +KAK+K  +K IK+LLK   + K  L
Sbjct  1    KRTPEPNLCLQLLKGDPRAPSADIAGLALILVEVIKAKAKEAEKTIKQLLKQGGNKKA-L  59

Query  414  EQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLN  593
             +CA DY+ +++  + +      + GDPKFA++A++        CEN F G KSPLTH+N
Sbjct  60   SECAVDYKGILILDIPQATR--AVRGDPKFADDAVSDCAVEADICENRFNG-KSPLTHVN  116

Query  594  KLVGELADVTRDVIRNLL  647
              + ++A+V R +IR LL
Sbjct  117  NGMRDVANVARAIIRILL  134



>gb|AFI47463.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 94/170 (55%), Gaps = 9/170 (5%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMID  332
            L  ++ L M+L T   G    V+  CK T NY LC+  +  D R+  A D  TLA+IM+D
Sbjct  5    LFLMMFLAMLLVT--KGKNNLVETTCKNTPNYNLCVRTLSLDKRSETAGDITTLALIMVD  62

Query  333  TVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +K+K+      I +L  S+P    K PL+ CA+ Y+V++  ++ + A + +  GDPKFA
Sbjct  63   AIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPE-AIEALTKGDPKFA  121

Query  507  EEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            E+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  122  EDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|AAX63190.1| putative invertase inhibitor precursor [Solanum tuberosum]
 gb|ADZ54774.1| invertase inhibitor 1 [Solanum tuberosum]
 gb|AFI47459.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 97/173 (56%), Gaps = 8/173 (5%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAII  323
            M+ L+ +++ L ML     G+   V+  CK T NY LC++ +  D R+  A D  TLA+I
Sbjct  1    MKILLFLMMFLAMLIV-TKGNNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDITTLALI  59

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +K K+      I +L  S+P    K PL+ CA+ Y+V++  ++ + A + +  GDP
Sbjct  60   MVDAIKYKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPE-ATEALTKGDP  118

Query  498  KFAEEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|ADM49012.1| putative invertase inhibitor [Solanum tuberosum]
 gb|ADM49014.1| putative invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 96/173 (55%), Gaps = 8/173 (5%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAII  323
            M+  I +++ L ML     G+   V+  CK T NY LC++ +  D R+  A D  TLA+I
Sbjct  1    MKIFIFLMMFLAMLIV-TKGNNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDITTLALI  59

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            M+D +K K+      I +L  S+P    K PL+ CA+ Y+V++  ++ + A + +  GDP
Sbjct  60   MVDAIKYKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPE-ATEALTKGDP  118

Query  498  KFAEEAMTKLPFTTIGCENHFAG---HKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE +F       SPL+ LN  V EL+DV R ++RNLL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>ref|XP_010110653.1| Pectinesterase inhibitor [Morus notabilis]
 gb|EXC27498.1| Pectinesterase inhibitor [Morus notabilis]
Length=178

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 91/165 (55%), Gaps = 6/165 (4%)
 Frame = +3

Query  165  VVILLMMLTTPINGD--RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTV  338
            +V+L  + TT          +++ CK T NY LC+  + +DPR+ +AD R LA+IM+  +
Sbjct  14   IVLLFALYTTQSRASPANNAIEQTCKRTPNYNLCVSSLRSDPRSSDADVRGLALIMVGVI  73

Query  339  KAKSKVTDKLIKRLLKSHP--DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEE  512
            +AK+K T   IK L+K+ P  D K PL  CA DY   I+   +  A   +  G+ KFAE+
Sbjct  74   EAKAKETLSHIKDLIKASPKRDEKQPLSSCA-DYYNAIITADVPQATQALKTGNYKFAEQ  132

Query  513  AMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                       CE  F+G +SPLT +NKLV ++A +   + R LL
Sbjct  133  GTDDTENEADFCEKSFSG-RSPLTEMNKLVHDVAAIAAAMTRILL  176



>ref|XP_002273484.2| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Vitis 
vinifera]
Length=169

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 86/163 (53%), Gaps = 7/163 (4%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRK-FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMID  332
            L+CVV L +   T I   R   V + CK T NY+LC++ + ADPR+  AD   LA++ +D
Sbjct  7    LLCVVSLSL---TQIQFSRADLVDQTCKQTPNYDLCVKTLRADPRSSTADVTGLALVTVD  63

Query  333  TVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +KAK+  T   I  LL + PD   K  L  C   Y+  +LK  I  A + +  G+PKFA
Sbjct  64   AIKAKATATLDRINGLLGTTPDPKTKAALSHCGELYDNAVLKADIPSAIEALKKGNPKFA  123

Query  507  EEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVI  635
            E+ +         CE  F G  SP+T  N+ V +L+ V   +I
Sbjct  124  EQGVNDAANEADSCERAFGG-ASPITSFNRSVSDLSRVASAII  165



>ref|XP_007154411.1| hypothetical protein PHAVU_003G117300g [Phaseolus vulgaris]
 gb|ESW26405.1| hypothetical protein PHAVU_003G117300g [Phaseolus vulgaris]
Length=180

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 81/149 (54%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   ++  CK T NY LC++Y+ A P +  AD   LA+IM++ +KAK+    K+I  L K
Sbjct  34   DESLIESTCKKTPNYNLCLQYLKASPGSSTADVSGLALIMVNVIKAKANDALKIIHDLQK  93

Query  387  --SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHF  560
                P  +  L  CA +Y  V++  + K  Y  +  GDPKFAE+           CEN F
Sbjct  94   KGGGPKQQGALSSCASNYNAVLVGDVPKATY-ALQAGDPKFAEDGANDAANEATYCENGF  152

Query  561  AGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            +G+ SPLT  N  + ++A VT  ++R LL
Sbjct  153  SGN-SPLTKQNNAMHDVAVVTAAIVRLLL  180



>ref|XP_008223387.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=176

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 9/153 (6%)
 Frame = +3

Query  156  LICVVILLMMLTTPING------DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
            L+C  +L+ +L   +        D   + + CK T NY LC+  + +DPR+  AD   L 
Sbjct  10   LVCCTLLVFLLPVALCSRVVFPTDANLIDQTCKQTPNYALCVSSLKSDPRSSTADVSGLG  69

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            +I++D VKAKS  T   I  LLK  P  +  L+ CA  Y+ V+ + L+  A  G  LG+P
Sbjct  70   VILVDIVKAKSTDTLNKINTLLKQRPGNQA-LKSCARFYDTVV-EALVPEAQQGFSLGNP  127

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNK  596
            KFAE+ M         CE+ F+G KSPLT  NK
Sbjct  128  KFAEQGMNDAAGEAETCEDGFSG-KSPLTDNNK  159



>ref|XP_007223575.1| hypothetical protein PRUPE_ppa012287mg [Prunus persica]
 gb|EMJ24774.1| hypothetical protein PRUPE_ppa012287mg [Prunus persica]
Length=176

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 9/153 (6%)
 Frame = +3

Query  156  LICVVILLMMLTTPING------DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
            L+C  +L+ +L   +        D   + + CK T NY LC+  + +DPR+  AD   L 
Sbjct  10   LVCCTLLVFLLPVALCSRVVFPTDANLIDQTCKQTPNYALCVSSLKSDPRSSTADVSGLG  69

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            +I++D VKAKS  T   I  LLK  P  +  L+ CA  Y+ V+ + L+  A  G  LG+P
Sbjct  70   VILVDIVKAKSTDTLNKINTLLKQRPGDQA-LKSCARFYDTVV-EALVPEAQQGFSLGNP  127

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNK  596
            KFAE+ M         CE+ F+G KSPLT  NK
Sbjct  128  KFAEQGMNDAAGEAKTCEDGFSG-KSPLTDNNK  159



>ref|XP_010098776.1| Pectinesterase inhibitor 2 [Morus notabilis]
 gb|EXB75679.1| Pectinesterase inhibitor 2 [Morus notabilis]
Length=151

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 84/146 (58%), Gaps = 4/146 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
              ++ CK T NY LC+ ++ ++PR+  AD R LA+IM+  ++AK+K T   IK L+K+ P
Sbjct  6    LFEQTCKRTTNYGLCISFLRSNPRSSGADVRGLALIMVGVIEAKAKGTLSQIKDLIKASP  65

Query  396  --DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
              D K PL  CA  Y+  IL   +  A   +  G+ KFAE+           CEN F+G 
Sbjct  66   QRDDKQPLSSCAEYYD-AILSGDVPEAIQALKTGNYKFAEQGSNNAALEANMCENRFSG-  123

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
            KSPLT +NKLV ++A V   + R LL
Sbjct  124  KSPLTKMNKLVHDVAVVAAAITRVLL  149



>ref|XP_009590146.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
 emb|CAA73334.1| invertase inhibitor homologue [Nicotiana tabacum]
 gb|AAN60076.1| vacuolar invertase inhibitor [Nicotiana tabacum]
 gb|AAT01640.1| invertase inhibitor [Nicotiana tabacum]
Length=172

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 82/144 (57%), Gaps = 6/144 (4%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEA---DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDL  401
            C+ T NY LC+  + +DPR  EA   D  TL ++M+D VK KS    K IK+L KS+P+L
Sbjct  30   CRATTNYPLCLTTLHSDPRTSEAEGADLTTLGLVMVDAVKLKSIEIMKSIKKLEKSNPEL  89

Query  402  KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA--GHKS  575
            ++PL QC   Y  V L   + VA + +  G PKFAE  M  +      CE  F   G  S
Sbjct  90   RLPLSQCYIVYYAV-LHADVTVAVEALKRGVPKFAENGMVDVAVEAETCEFSFKYNGLVS  148

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            P++ +NK + EL+ V + +IR LL
Sbjct  149  PVSDMNKEIIELSSVAKSIIRMLL  172



>ref|XP_007154412.1| hypothetical protein PHAVU_003G117400g [Phaseolus vulgaris]
 gb|ESW26406.1| hypothetical protein PHAVU_003G117400g [Phaseolus vulgaris]
Length=180

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 96/182 (53%), Gaps = 17/182 (9%)
 Frame = +3

Query  147  MRNLICVVILL------MMLTTPINGDRKF-------VKKICKTTENYELCMEYVWADPR  287
            M NL  V++ L      +M T P N  R F       ++  CK T NY LC++Y+ A P 
Sbjct  1    MANLKAVILCLFLEAIVVMNTIPGNECRSFHPNDESLIESTCKKTPNYNLCLQYLKASPG  60

Query  288  APEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLI  461
            +  AD R LA+IM++ +KAK+  T K+I  L K    P  +  L  CA  Y  V++  + 
Sbjct  61   SSTADVRGLALIMVNVIKAKAYDTLKIIHDLQKKGGGPKQQEALSSCASKYNTVLVADVA  120

Query  462  KVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRN  641
            + A + ++ G+PKFAE            CE+ F+G+ SPLT  N  + ++A VT  ++R 
Sbjct  121  Q-ATEALLKGNPKFAENGANDAANEATYCESDFSGN-SPLTKQNNAMHDVAAVTAAIVRL  178

Query  642  LL  647
            LL
Sbjct  179  LL  180



>ref|XP_003609812.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92009.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=173

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 92/173 (53%), Gaps = 7/173 (4%)
 Frame = +3

Query  144  KMRNLICVVILLMMLTTPI-----NGDRKFVKKICKTTENYELCMEYVWADPRAPEADTR  308
            KM  L   +IL  M+++         +   +++ CK T NY  C+ Y+ +DPR+ +AD  
Sbjct  3    KMNPLALAIILCTMVSSHCIIIHPKSNANLIQQTCKQTPNYANCIHYLKSDPRSSDADVT  62

Query  309  TLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
             LA+IM+D +K+K+      I +L+K   D K  L  CA  Y  +++  + K +   +  
Sbjct  63   GLALIMVDIIKSKANTALNKINQLIKGSHDQKEALNSCAGRYRAILVADVPK-SVAALKQ  121

Query  489  GDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            GDPKFAE+    +      CEN F G KSP++  N  + ++A +T  +++ LL
Sbjct  122  GDPKFAEDGANDVAIEATTCENGFKG-KSPISDENIDMHDVAVITAAIVKQLL  173



>ref|XP_002279801.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Vitis 
vinifera]
 emb|CAN79656.1| hypothetical protein VITISV_014506 [Vitis vinifera]
Length=169

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 87/166 (52%), Gaps = 5/166 (3%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            L+CV+ L +        D   VK+ CK T NY+LC++ + +DPR+  AD   LA++M+D 
Sbjct  7    LLCVMGLSLTQIEFSTSD--LVKQTCKHTPNYDLCVKTLLSDPRSSHADVAGLAMVMVDV  64

Query  336  VKAKSKVTDKLIKRLLKS--HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAE  509
            +KAK+  T   I  LL +  +P  K  L +C   Y+  +LK  +  A   +  G PKFAE
Sbjct  65   IKAKTIATLHRISELLGTTRYPKTKAALRRCVELYDNAVLKADLPSAMQALKTGVPKFAE  124

Query  510  EAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            E           CE  F+G  SP+T  N+ V +L  V   +IR LL
Sbjct  125  EGTNDAANEADSCERTFSG-ASPITSFNRYVSDLCRVASAIIRLLL  169



>emb|CDY20929.1| BnaC06g01490D [Brassica napus]
Length=163

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 83/144 (58%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             +++ CK T ++ LC+  + +DPR   ADT  LA+I++D +K  +  T K I  L K  P
Sbjct  22   MIEQTCKETPDFNLCVSLLDSDPRGSSADTSGLALILVDKIKGLATKTLKEINSLYKKRP  81

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L++C+  Y+  ILK  +  A + +  G PKF E+ +         CE  F G KS
Sbjct  82   ELKQALDECSRRYK-TILKADVPEAIEAISKGVPKFGEDGVIDAGVEAAVCEGEFKG-KS  139

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K + ++++VTR ++R LL
Sbjct  140  PLTSLTKSMQKVSNVTRAIVRMLL  163



>gb|AGC75063.1| vacuolar invertase inhibitor [Solanum lycopersicum]
Length=175

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 100/176 (57%), Gaps = 10/176 (6%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRK--FVKKICKTTENYELCMEYVWADPRAPEA----DTR  308
            MRNL  +++LL  L+  I+ +     ++  C+ T  Y LC+  + +DPR+ +A    D  
Sbjct  1    MRNLFPILMLLTNLSLHIDNNNNNNIIRATCRETPYYSLCLSVLESDPRSYKAEGSDDIT  60

Query  309  TLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
            TL +IM+D VK+KS    K +K L KS+P+ +VPL QC   Y  V L+  + VA + +  
Sbjct  61   TLGLIMVDAVKSKSIEIMKKLKELEKSNPEWRVPLNQCYMVYNTV-LRADVTVAVEALKR  119

Query  489  GDPKFAEEAMTKLPFTTIGCE---NHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            G PKFAE+ M  +      CE   N++     P+++++K + EL+ V + +IR LL
Sbjct  120  GVPKFAEDGMDDVVVEAQTCEFSFNYYNKSDFPISNMSKDIVELSKVAKSIIRMLL  175



>ref|XP_006406762.1| hypothetical protein EUTSA_v10021672mg [Eutrema salsugineum]
 gb|ESQ48215.1| hypothetical protein EUTSA_v10021672mg [Eutrema salsugineum]
Length=163

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + K CK T +Y LC+  + +DPR+  ADT  LA+I+ID +KA    T   I    K+ P
Sbjct  22   IIDKTCKQTPDYTLCVSLLRSDPRSSSADTAGLALILIDKIKALGTETLGQINVAYKTKP  81

Query  396  DLKVPLEQCAWDYEVVI---LKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK PL++C   Y++++   + T I       + GDPKFAE+A+         CE+ FA 
Sbjct  82   MLKQPLDECNQRYKIIVDVDVHTAII-----ALKGDPKFAEDAIVDAGVEASVCESGFAK  136

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SPLT L + + ++ DVTR ++R LL
Sbjct  137  GQSPLTGLIQKMEKMCDVTRAIVRMLL  163



>ref|XP_010461598.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=159

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T +++LC+  + +DPR   ADT  LA+I+ID +K  +  T   I  L K  P
Sbjct  18   MIDQTCKQTPDFKLCVSLLNSDPRGSSADTSGLALILIDKIKVLATKTLTEINGLYKKRP  77

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L+QC+  Y+  IL   +  A + +  G PKF E+ +         CE  F G KS
Sbjct  78   ELKQALDQCSRRYK-TILNADVPEAIEAISKGVPKFGEDGVMDAGVEASACEEGFQG-KS  135

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K +  ++ VTR V+R LL
Sbjct  136  PLTSLTKSMQNISSVTRAVVRMLL  159



>ref|XP_011071366.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Sesamum indicum]
Length=178

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 85/156 (54%), Gaps = 4/156 (3%)
 Frame = +3

Query  189  TTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKL  368
            +   N D   V   CK T +Y LC+  +   PR+ +AD   LA+I +  VK +++     
Sbjct  24   SASQNKDPPLVVSTCKNTPHYRLCLAVLRRSPRSAKADVWELALIAVGAVKTEAERAMDA  83

Query  369  IKRLLKSHP--DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTI  542
            IK++ K     ++   L+QC   Y+ V L+  ++ A +G+ LGDPKFAE  M        
Sbjct  84   IKKVRKGGEGKEVAAALKQCEEVYDAV-LEGDVQEAEEGLKLGDPKFAENGMADAVVEAD  142

Query  543  GCENHFAG-HKSPLTHLNKLVGELADVTRDVIRNLL  647
             CE  FAG  KSPL+ +N  V ++A+V R +IRNLL
Sbjct  143  SCEGGFAGVGKSPLSRVNSAVHDIAEVARAIIRNLL  178



>gb|AFK44620.1| unknown [Lotus japonicus]
Length=178

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 76/147 (52%), Gaps = 2/147 (1%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D + V K CK T     C +++ ADPR+  AD   LA+IM+D ++AK+      I +LLK
Sbjct  34   DAQLVAKTCKNTPYPSACPQFLQADPRSSSADVTGLALIMVDVIQAKTNGVLNKISQLLK  93

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
               D K  L  C   Y   ILK  I  A   +  G+PKFAE+ +         CE+ F+ 
Sbjct  94   GGGD-KPALNSCQGRYN-AILKADIPQATQALKTGNPKFAEDGVADASVEANTCESGFSS  151

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLT  N  +    +V R +IRNLL
Sbjct  152  GKSPLTSENNGMHIATEVARAIIRNLL  178



>ref|XP_006303367.1| hypothetical protein CARUB_v10010500mg [Capsella rubella]
 gb|EOA36265.1| hypothetical protein CARUB_v10010500mg [Capsella rubella]
Length=164

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T ++ LC+  + +DPR   ADT  LA+I+ID +K  +  T   I  L K  P
Sbjct  23   MIDQTCKETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLATKTLNEINGLYKKRP  82

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L+QC+  Y+ +I K  +  A + +  G PKF E+ +         CE  F G KS
Sbjct  83   ELKRALDQCSRRYKTII-KADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGFKG-KS  140

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K + ++++VTR ++R LL
Sbjct  141  PLTSLTKSMQKISNVTRAIVRMLL  164



>ref|XP_009148010.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Brassica 
rapa]
Length=162

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             +++ CK T ++ LC+  + +DPR   ADT  LA+I++D +K  +  T K I  L K  P
Sbjct  21   MIEQTCKETPDFNLCVSLLDSDPRGSSADTSGLALILVDKIKGLATKTLKEINSLYKKRP  80

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L++C+  Y   ILK  +  A + +  G PKF E+ +         CE  F G KS
Sbjct  81   ELKQALDECSRRYN-TILKADVPEAIEAISKGVPKFGEDGVIDAGVEAAVCEGEFKG-KS  138

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K + ++++V R ++R LL
Sbjct  139  PLTSLTKSMQKVSNVARAIVRMLL  162



>emb|CDY39016.1| BnaC01g34800D [Brassica napus]
Length=175

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 79/147 (54%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V K CK T +Y LC+  + +DPR+  ADT  L +I++D +KA    T   I    K+ P
Sbjct  34   IVDKTCKQTPDYSLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINMAYKTKP  93

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVIL---GDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK PL++C   Y     KT++ V     I+   G+PKFAE A+         CE  F  
Sbjct  94   MLKKPLDECNLRY-----KTIVDVDVHTAIIAIKGNPKFAEGAIVDAGVEASVCEGGFPK  148

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SP+T L + + E+ DVTR ++R LL
Sbjct  149  GQSPITGLTQKMNEICDVTRAIVRMLL  175



>ref|XP_007154410.1| hypothetical protein PHAVU_003G117200g [Phaseolus vulgaris]
 gb|ESW26404.1| hypothetical protein PHAVU_003G117200g [Phaseolus vulgaris]
Length=197

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 97/187 (52%), Gaps = 17/187 (9%)
 Frame = +3

Query  132  F*KEKMRNLICVVILL------MMLTTPINGDRKF-------VKKICKTTENYELCMEYV  272
            F K  M NL  V++ L      +M T P +  R F       ++  CK T NY LC++Y+
Sbjct  13   FEKITMANLKAVILCLFLQAIVVMNTIPGSECRSFHPNDESLIESTCKKTPNYNLCLQYL  72

Query  273  WADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVP--LEQCAWDYEVVI  446
             A P +  AD R LA+IM++ +KAK+  T K+I  L K     K    L  CA  Y  V+
Sbjct  73   KASPGSSTADVRGLALIMVNVIKAKAYDTLKIIHDLQKKGGGAKQQEVLSSCASRYHTVL  132

Query  447  LKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTR  626
            +  + + A + +  GDPKFAE            CE+ F+G+ SPLT+ N  + ++A VT 
Sbjct  133  VADVAQ-ATEALQKGDPKFAENGANDAANEATYCESDFSGN-SPLTNQNNAMHDVAAVTA  190

Query  627  DVIRNLL  647
             ++R LL
Sbjct  191  AIVRLLL  197



>emb|CDX93634.1| BnaA06g04140D [Brassica napus]
Length=160

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             +++ CK T ++ LC+  + +DPR   ADT  LA+I++D +K  +  T K I  L K  P
Sbjct  19   MIEQTCKETPDFNLCVSLLDSDPRGSSADTSGLALILVDKIKGLATKTLKEINTLYKKRP  78

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L++C+  Y   ILK  +  A + +  G PKF E+ +         CE  F G KS
Sbjct  79   ELKQALDECSRRYN-TILKADVPEAIEAISKGVPKFGEDGVIDAGVEAAVCEGEFKG-KS  136

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K + ++++V R ++R LL
Sbjct  137  PLTSLTKSMQKVSNVARAIVRMLL  160



>ref|XP_008340696.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=174

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 82/162 (51%), Gaps = 13/162 (8%)
 Frame = +3

Query  147  MRNLI--CVVILLMMLTTPIN--------GDRKFVKKICKTTENYELCMEYVWADPRAPE  296
            M+NLI   +  L+ +   P++         D   + + C+ T ++ LC+  + +DPR+  
Sbjct  1    MKNLIPLALTFLIQISLLPVSQCRPVYVPNDATLIDQTCQKTPDHNLCVSSLRSDPRSSS  60

Query  297  ADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYD  476
            AD + L IIM+D VK K+  T   I  LLK  P  K  L  CA  Y  VI    +  A  
Sbjct  61   ADVKGLGIIMVDVVKGKATDTLNQINDLLKQRPGDKS-LSSCAEVYNTVITAD-VPEASQ  118

Query  477  GVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLV  602
            G  LG+PKFAE+ M       + CEN F+G  SPLT  NK V
Sbjct  119  GFSLGNPKFAEQGMNDAAGEAVSCENGFSG-SSPLTDKNKSV  159



>ref|XP_002894085.1| hypothetical protein ARALYDRAFT_891603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70344.1| hypothetical protein ARALYDRAFT_891603 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 2/154 (1%)
 Frame = +3

Query  186  LTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDK  365
            + T +  +   +++ CK T ++ LC+  + +DPR   ADT  LA+I+ID +K  +  T  
Sbjct  1    MVTVMVSEGSIIEQTCKETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLTTKTLN  60

Query  366  LIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG  545
             I  L K  P+LK  L++C+  Y+  IL   +  A + +  G PKF E+ +         
Sbjct  61   EINGLYKKRPELKRALDECSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGVEASV  119

Query  546  CENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            CE  F G KSPLT L K + ++++VTR ++R LL
Sbjct  120  CEGGFKG-KSPLTSLTKSMQKISNVTRAIVRMLL  152



>ref|XP_004252929.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum lycopersicum]
Length=175

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 99/176 (56%), Gaps = 10/176 (6%)
 Frame = +3

Query  147  MRNLICVVILL--MMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA----DTR  308
            MRNL  +++LL  + L    N +   ++  C+ T  Y LC+  + +DPR+ +A    D  
Sbjct  1    MRNLFPILMLLTNLSLNIDNNNNNNIIRATCRETPYYSLCLSVLESDPRSYKAEGSDDIT  60

Query  309  TLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
            TL +IM+D VK+KS    K +K L KS+P+ +VPL QC   Y  V L+  + VA + +  
Sbjct  61   TLGLIMVDAVKSKSIEIMKKLKELEKSNPEWRVPLNQCYMVYNTV-LRADVTVAVEALKR  119

Query  489  GDPKFAEEAMTKLPFTTIGCE---NHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            G PKFAE+ M  +      CE   N++     P+++++K + EL+ V + +IR LL
Sbjct  120  GVPKFAEDGMDDVVVEAQTCEFSFNYYNKSDFPISNMSKDIVELSKVAKSIIRMLL  175



>emb|CDY35000.1| BnaA01g27340D [Brassica napus]
Length=159

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V K CK T +Y LC+  + +DPR+  ADT  L +I++D +KA    T   I    K+ P
Sbjct  18   IVDKTCKQTPDYSLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINMAYKTKP  77

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVIL---GDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK PL++C   Y     KT++ V     I+   G+PKFAE A+         CE  F  
Sbjct  78   MLKKPLDECNLRY-----KTIVDVDVHTAIIAIRGNPKFAEGAIVDAGVEASVCEGGFPK  132

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SP+T L + + ++ DVTR ++R LL
Sbjct  133  GQSPITGLTQKMNKICDVTRAIVRMLL  159



>ref|XP_009114400.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Brassica 
rapa]
Length=160

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V K CK T +Y LC+  + +DPR+  ADT  L +I++D +KA    T   I    K+ P
Sbjct  19   IVDKTCKQTPDYSLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINMAYKTKP  78

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVIL---GDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK PL++C   Y     KT++ V     I+   G+PKFAE A+         CE  F  
Sbjct  79   MLKKPLDECNLRY-----KTIVDVDVHTAIIAIRGNPKFAEGAIVDAGVEASVCEGGFPK  133

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SP+T L + + ++ DVTR ++R LL
Sbjct  134  GQSPITGLTQKMNKICDVTRAIVRMLL  160



>ref|XP_011041481.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011041482.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X2 [Populus euphratica]
Length=178

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T  Y LC+  + + P++  AD + LA+IM+D V+AK+    + I + LK  P
Sbjct  37   LIAQTCKHTPYYSLCVTSLKSVPKSSGADVQGLALIMVDIVRAKASTALRFINQELKRSP  96

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
             L+ PL  CA  Y+  IL   I  A + +  GDPKFAE            CE+ F G KS
Sbjct  97   GLRRPLRFCASCYD-AILTADIPEAIEALQKGDPKFAENGTNDAAIEATSCEDGFHG-KS  154

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT+LN++V + + V   + R LL
Sbjct  155  PLTNLNRVVHDTSVVASAITRLLL  178



>ref|XP_009763718.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana sylvestris]
Length=172

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 6/144 (4%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEA---DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDL  401
            C+ T NY LC+  + +DPR  EA   D  TL ++M+D VK KS    +  K+L KS+P+L
Sbjct  30   CRATPNYPLCLTTLQSDPRTSEAEGADLTTLGLVMVDAVKLKSIEIMENFKKLEKSNPEL  89

Query  402  KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA--GHKS  575
            ++PL QC   Y  V L   + VA + +  G PKFAE  M  +      CE  F   G  S
Sbjct  90   RLPLSQCYIVYYAV-LHADVTVAVEALKRGVPKFAENGMVDVAVEAETCEFSFKYNGLVS  148

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            P++ +N+ + EL+ V + +IR LL
Sbjct  149  PVSDVNREIIELSSVAKSIIRMLL  172



>ref|XP_004508122.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=175

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 9/175 (5%)
 Frame = +3

Query  144  KMRNLICVVILLMML-----TTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTR  308
            K++ L  + I+L  L     +T    +   + + CK T NY +C++Y+ ADPR+  +D  
Sbjct  3    KLKPLALLAIILYTLIVTSHSTNPKSNTNLIHQTCKHTPNYAICIKYLEADPRSSTSDVT  62

Query  309  TLAIIMIDTVKAKSKVTDKLIKRLLKS--HPDLKVPLEQCAWDYEVVILKTLIKVAYDGV  482
             LA+IM+D +K K+  +   IK L+K    P+ K  L  C   Y  ++   + K     +
Sbjct  63   GLALIMVDVIKTKANSSLNKIKHLIKGTHEPNKKEALNSCGGRYRAIVEADVPKCVA-AL  121

Query  483  ILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
              GDPKFAE+           CEN F G KSPL+  N  + ++A +T  +++ LL
Sbjct  122  KEGDPKFAEDGANDAAIEATACENGFFG-KSPLSDDNIAMQDVAAITATIVKQLL  175



>ref|XP_011096732.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Sesamum indicum]
Length=169

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 90/166 (54%), Gaps = 7/166 (4%)
 Frame = +3

Query  168  VILLMMLTTPIN-----GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMID  332
            VILL +L T         D+  ++  C++T N++LC+  + A+P +  AD   LA+I++D
Sbjct  5    VILLAILHTHAGLITQMNDQTLIETTCRSTSNFQLCLSTLLANPLSATADVAELALIIVD  64

Query  333  TVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEE  512
             VKAK++     I+ L   HP+L   L QC+  Y+ V LK  +  A   +  G PKFAE 
Sbjct  65   AVKAKTETALSGIEELKWLHPELTDALGQCSNSYKAV-LKADVPEAVAALTRGVPKFAEF  123

Query  513  AMTKLPFTTIGCENHFAG-HKSPLTHLNKLVGELADVTRDVIRNLL  647
             M    +    CE  F    +SPL+ LN+ + +LA V   +I+NLL
Sbjct  124  GMVDAAWEAEICEGSFERVAESPLSELNRDIHDLAVVAAGIIKNLL  169



>ref|XP_008390421.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=175

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 87/170 (51%), Gaps = 8/170 (5%)
 Frame = +3

Query  153  NLICVVILLMMLTTPING-----DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
             LIC+V++ + L+          D   + + CK T NY LC+  + +DPR+ +AD   L 
Sbjct  9    QLICLVLVFLPLSHCRRAVIFPMDANLIDQTCKKTPNYNLCVSSLKSDPRSVKADVAGLG  68

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
             I +D  K K+  T   I  LLK  P  +  L+ CA  Y  +++   +  A  G  LG+P
Sbjct  69   FITVDIAKDKATDTANRINELLKQSPSDQR-LKTCATFYHTILVAD-VPEASQGFKLGNP  126

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M      T  CE  F+  KSPLT  NK+V +L+ +   + R LL
Sbjct  127  KFAEQGMNDAADATEACEKEFSS-KSPLTDKNKVVHDLSSIAAAIARLLL  175



>ref|XP_004305718.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=145

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K +++ C  T +  LC+  + +DPR+  AD   LA+IM+D V  K K   K +  LLK
Sbjct  2    DAKLIEQTCNKTPHPILCVYSLKSDPRSARADVPGLALIMVDVVSGKVKGILKKLDTLLK  61

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
              P  K  L+ C  DY +V L   I  A   + LGDPKFAE+ M     +   CE  F G
Sbjct  62   QSPSNKA-LQNCNQDYHIV-LNIEISAAKGAITLGDPKFAEQYMNDASNSADSCEREFKG  119

Query  567  HKSPLTHLNKLVGELADVTR  626
             +SPLT LNK   ++ DV+R
Sbjct  120  -RSPLTKLNK---DIVDVSR  135



>gb|EYU19077.1| hypothetical protein MIMGU_mgv1a015091mg [Erythranthe guttata]
Length=168

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 78/145 (54%), Gaps = 2/145 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             ++  C+ T NY+LC+  + A P +  AD   L +I++D +KAK++     I  + + HP
Sbjct  25   LIESTCRNTPNYQLCISILRASPHSGTADMAGLGLILVDAIKAKTEAALLAIDEVKQLHP  84

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG-HK  572
            +L   LE+C   Y  V LK  I  A  G+  G PKFAE  M    +    CE  F    +
Sbjct  85   ELTQALEECRRTYNAV-LKADIPEAVAGLKKGVPKFAESGMVDTAWEADICEGSFGSVAQ  143

Query  573  SPLTHLNKLVGELADVTRDVIRNLL  647
             PL+ +NK + +LA+V   VIRNLL
Sbjct  144  PPLSGVNKDLHDLAEVAASVIRNLL  168



>ref|XP_010465742.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=165

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 78/147 (53%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V   CK T +Y LC+  + +DPR+  ADT  L +I++D +KA    T   I    K+ P
Sbjct  24   IVDTTCKQTPDYTLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINAAYKTKP  83

Query  396  DLKVPLEQCAWDYEVVI---LKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK  L++C   Y+ ++   + T I       I G+PKFAE A+         CE  F  
Sbjct  84   MLKRALDECNQRYKTIVDVDVHTAIT-----AIKGNPKFAEGAVVDAGVEASVCEGGFPK  138

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SPLT L + +G++ DVTR +IR LL
Sbjct  139  GQSPLTGLTQRMGKICDVTRAIIRMLL  165



>gb|KDP27949.1| hypothetical protein JCGZ_19029 [Jatropha curcas]
Length=153

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 84/164 (51%), Gaps = 24/164 (15%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            L+  ++LL    + +  D   +++ CK T NY LC+  + +D R+  ADTR LA+IM+D 
Sbjct  14   LVISIVLLGTYFSIVQSDANLIEQTCKRTPNYNLCVTSLKSDSRSSTADTRGLALIMVDV  73

Query  336  VKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA  515
            +K ++  T ++I +LL++ P                       VA + +  GDPKFAE A
Sbjct  74   LKNRATETLQVINQLLQNIP-----------------------VAIEALEKGDPKFAETA  110

Query  516  MTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                 +    CE++F G  SPLT  N LV +   V   +IRNLL
Sbjct  111  AMDAAYEASYCEDNFNG-SSPLTKHNTLVHDTGAVAAAIIRNLL  153



>ref|XP_010479199.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=159

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T ++ LC+  + +DPR   AD   LA+I+ID +K  +  T   I  L K  P
Sbjct  18   MIDQTCKQTPDFNLCVSLLNSDPRGSSADISGLALILIDKIKVLATKTLNEINGLYKKRP  77

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L+QC+  Y+  IL   +  A + +  G PKF E+ +         CE  F G KS
Sbjct  78   ELKQALDQCSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGFQG-KS  135

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K +  ++ VTR V+R LL
Sbjct  136  PLTSLTKSMQNISSVTRAVVRMLL  159



>ref|XP_010500306.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=159

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 78/144 (54%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T +++LC+  + +DPR   AD   LA+I+ID +K  +  T   I  L K  P
Sbjct  18   MIDQTCKQTPDFKLCVSLLNSDPRGSSADISGLALILIDKIKVLATKTLTEINGLYKKRP  77

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L+QC+  Y+  IL   +  A + +  G PKF E+ +         CE  F G KS
Sbjct  78   ELKQALDQCSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGFQG-KS  135

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K +  ++ VTR V+R LL
Sbjct  136  PLTSLTKSMQNISSVTRAVVRMLL  159



>gb|KDO71995.1| hypothetical protein CISIN_1g037982mg [Citrus sinensis]
Length=169

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSH  392
             +++ CK T  Y LC+  + +DPR+  A D + +A+IM+D +KAK+  + + I++L + +
Sbjct  27   LIEQTCKQTPYYGLCVTSLKSDPRSKTAGDVQAIALIMVDIIKAKAGGSLQHIEKLKQKY  86

Query  393  PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHK  572
            P L+VPL  C   +  +I+  + + A + +  GDPKFA +A          CE  F+G K
Sbjct  87   PALRVPLSACKDRFNAIIIGDVPQ-AVEALTKGDPKFAVDAANDAALEADSCERGFSG-K  144

Query  573  SPLTHLNKLVGELADVTRDVIRNLL  647
            SP+T +NKL  +++ +T  +++ +L
Sbjct  145  SPITQMNKLNHDISIITASIVKTML  169



>ref|XP_002314521.1| hypothetical protein POPTR_0010s07350g [Populus trichocarpa]
 gb|EEF00692.1| hypothetical protein POPTR_0010s07350g [Populus trichocarpa]
Length=178

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 78/144 (54%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T  Y LC+  + + P++  AD + LA+IM+D V+AK+    + I + LK  P
Sbjct  37   LIAQTCKHTPYYNLCVTSLKSVPKSSGADVQGLALIMVDIVRAKASTALRFINQELKRSP  96

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
             L+ PL  CA  Y+  IL   I  A + +  GDPKFAE            CE+ F G KS
Sbjct  97   GLRRPLRFCASCYD-AILTADIPEAIEALQKGDPKFAENGTNDAAVEATSCEDGFHG-KS  154

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT+LN+ V + + V   + R LL
Sbjct  155  PLTNLNREVHDTSVVASAITRLLL  178



>ref|XP_007154409.1| hypothetical protein PHAVU_003G117100g [Phaseolus vulgaris]
 gb|ESW26403.1| hypothetical protein PHAVU_003G117100g [Phaseolus vulgaris]
Length=177

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 12/164 (7%)
 Frame = +3

Query  162  CVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVK  341
            C VILL             +++ CK T ++ LC++Y+ +DPR+ +AD   LA+IM++ +K
Sbjct  24   CRVILL--------NKGNLIEETCKQTPHHNLCIQYLSSDPRSADADIAGLALIMVNVIK  75

Query  342  AKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA  515
             K+      I +LL+  P+   K  L  CA  Y+  IL+  +  A   +  GDPKFAE+ 
Sbjct  76   TKANNALDKIHQLLQGSPEPAQKEALISCADRYK-AILEADVAQAIAALQKGDPKFAEDG  134

Query  516  MTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                      CE+ F+G KSPLT+ N ++ ++A  T  ++R LL
Sbjct  135  ANDAAIEATSCESGFSG-KSPLTNENNVMHDVAATTGAIVRQLL  177



>ref|XP_006488813.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Citrus sinensis]
Length=169

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSH  392
             +++ CK T  Y LC+  + +DPR+  A D + +A+IM+D +KAK+  + + I++L + +
Sbjct  27   LIEQTCKQTPYYGLCVTSLKSDPRSKTAGDVQAIALIMVDIIKAKAGGSLQHIEKLKQKY  86

Query  393  PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHK  572
            P L+VPL  C   +  +I+  + + A + +  GDPKFA +A          CE  F+G K
Sbjct  87   PALRVPLSACKDRFNAIIIGDVPQ-AVEALTKGDPKFAVDAANDAALEADSCERGFSG-K  144

Query  573  SPLTHLNKLVGELADVTRDVIRNLL  647
            SP+T +NKL  +++ +T  V++ +L
Sbjct  145  SPITQMNKLNHDISIITASVVKMML  169



>ref|XP_006393505.1| hypothetical protein EUTSA_v10011825mg [Eutrema salsugineum]
 gb|ESQ30791.1| hypothetical protein EUTSA_v10011825mg [Eutrema salsugineum]
Length=170

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 87/158 (55%), Gaps = 7/158 (4%)
 Frame = +3

Query  174  LLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSK  353
            +++M++ P       +++ CK T ++ LC+  + +DPR   ADT  LA+I++D +K  + 
Sbjct  20   MMVMVSEP-----NMIEQTCKETPDFNLCVSLLDSDPRGSSADTSGLALILVDKIKGLAT  74

Query  354  VTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPF  533
             T   I  L K  P+LK  L++C+  Y+  IL   +  A + +  G PKF E+ +     
Sbjct  75   KTLNEINGLYKRRPELKHALDECSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGV  133

Query  534  TTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                CE  F G KSPLT+L K +  +++V R ++R LL
Sbjct  134  EASVCERGFIG-KSPLTNLTKSMQRISNVARAIVRMLL  170



>gb|AGS32044.1| invertase inhibitor [Solanum torvum]
Length=176

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 97/177 (55%), Gaps = 11/177 (6%)
 Frame = +3

Query  147  MRNLICVVILL---MMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEA----DT  305
            MRNL  +++L+    +     N +  F+ + C+ T NY LC+  + +DPR  E     D 
Sbjct  1    MRNLFPILMLITNLALNNDSNNNNNNFIDETCRATPNYSLCLTTLQSDPRTYEVKEGDDI  60

Query  306  RTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVI  485
             TL ++M+D VK KS    K++K L KSHP+ + PL QC   Y  V L+  + VA + + 
Sbjct  61   TTLGLVMVDAVKLKSIEIIKMLKDLEKSHPEWRGPLSQCYVAYNAV-LRADVTVAVEALK  119

Query  486  LGDPKFAEEAMTKLPFTTIGCENHFAGHKS---PLTHLNKLVGELADVTRDVIRNLL  647
             G PKFA+ +M  +      CE+ F+ +     P+ +L++ + EL+ V + +I+ LL
Sbjct  120  KGVPKFADHSMDDVVVEAQTCESSFSYYYKLDFPIFNLSRDIIELSKVAKSIIKMLL  176



>gb|KFK26435.1| hypothetical protein AALP_AA8G248000 [Arabis alpina]
Length=159

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 80/147 (54%), Gaps = 2/147 (1%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            +   + + CK T ++ LC+  + +DPR   ADT  LA+I++D +K  +  T   I  L K
Sbjct  15   ESSMIDQTCKETPDFNLCVSLLNSDPRGSSADTSGLALILVDKIKVLATKTLHEINGLYK  74

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
              P+LK  L +C+  Y+  IL   +  A + +  G PKF E+ +         CE  F G
Sbjct  75   KRPELKQALGECSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGFKG  133

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPLT L K + ++++VTR ++R LL
Sbjct  134  -KSPLTSLTKSMQKISNVTRAIVRMLL  159



>ref|XP_004508125.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=170

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 83/164 (51%), Gaps = 3/164 (2%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            ++C ++++    T    +   +++ C+ T NY LC++Y+   P +  AD   LA IM++ 
Sbjct  10   ILCTIVVVTQGKTVTTNNANLIQQTCRKTPNYGLCIQYLNGSPGSSTADVNGLAQIMVNV  69

Query  336  VKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA  515
            +K K+ +    I +++      KV L  C   Y  V++   I  A   +  G+PKFAE+ 
Sbjct  70   IKTKASIALNKIHQIIGRSAQ-KVALNSCVDKYNAVLVAD-IPQAIQALQRGNPKFAEDG  127

Query  516  MTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                      CEN F+G KSPLT  N+   + A +T  ++R LL
Sbjct  128  ANDAAVEANSCENGFSG-KSPLTAENRATQDAAAITAAIVRLLL  170



>gb|AAG51534.1|AC051631_14 hypothetical protein; 80318-81409 [Arabidopsis thaliana]
 gb|AAL06571.1|AF412119_1 At1g47960/T2J15_13 [Arabidopsis thaliana]
 gb|AAL07005.1| At1g47960/T2J15_13 [Arabidopsis thaliana]
 gb|AAL90926.1| At1g47960/T2J15_13 [Arabidopsis thaliana]
 gb|AAM60881.1| unknown [Arabidopsis thaliana]
Length=166

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 79/144 (55%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             ++  CK T ++ LC+  + +DPR   ADT  LA+I+ID +K  +  T   I  L K  P
Sbjct  25   IIEPTCKETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLATKTLNEINGLYKKRP  84

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            +LK  L++C+  Y+  IL   +  A + +  G PKF E+ +         C+  F G  S
Sbjct  85   ELKRALDECSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCQGGFNGS-S  142

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT L K + ++++VTR ++R LL
Sbjct  143  PLTSLTKSMQKISNVTRAIVRMLL  166



>ref|XP_010505027.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
 ref|XP_010505065.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=162

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V   C+ T  Y LC+  + +DPR+  ADT  L +I++D +KA    T   I    K+ P
Sbjct  21   IVDTTCRQTPEYSLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINAAYKTKP  80

Query  396  DLKVPLEQCAWDYEVVI---LKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK  L++C   Y+ ++   + T I       I G+PKFAE A+         CE  F  
Sbjct  81   MLKRALDECNLRYKTIVDFDVHTAIT-----AIKGNPKFAEGAVVDAGVEASVCEGEFPK  135

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SPLT L + + ++ DVTR +IR LL
Sbjct  136  GQSPLTGLTQRINKICDVTRAIIRMLL  162



>ref|XP_006419340.1| hypothetical protein CICLE_v10006791mg [Citrus clementina]
 gb|ESR32580.1| hypothetical protein CICLE_v10006791mg [Citrus clementina]
Length=169

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 85/145 (59%), Gaps = 3/145 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSH  392
             ++  CK T  Y LC+  + +DPR+  A D + +A+IM+D +KAK+    + I++L + +
Sbjct  27   LIEHTCKQTPYYGLCVTSLKSDPRSKTAGDVQAIALIMVDIIKAKAGGALQHIEKLKQKY  86

Query  393  PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHK  572
            P L+VPL  C   +  +I+  + + A + +  GDPKFA +A          CE  F+G K
Sbjct  87   PALRVPLSACKDRFNAIIIGDVPQ-AVEALTKGDPKFAVDAANDAALEADSCERGFSG-K  144

Query  573  SPLTHLNKLVGELADVTRDVIRNLL  647
            SP+T +NKL  +++ +T  +++ +L
Sbjct  145  SPITQMNKLNHDISIITASIVKMML  169



>ref|XP_004508119.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=170

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 82/164 (50%), Gaps = 3/164 (2%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            ++C ++++    T        +++ C+ T NY LC++Y+   P +  AD   LA IM++ 
Sbjct  10   ILCTIVVVTQGKTVTTNYANLIQQTCRKTPNYGLCIQYLNGSPGSSTADVNGLAQIMVNV  69

Query  336  VKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA  515
            +K K+ +    I +++      KV L  C   Y  V++   I  A   +  G+PKFAE+ 
Sbjct  70   IKTKASIALNKIHQIIGRSAQ-KVALNSCVDKYNAVLVAD-IPQAIQALQRGNPKFAEDG  127

Query  516  MTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
                      CEN F+G KSPLT  N+   + A +T  ++R LL
Sbjct  128  ANDAAVEANSCENGFSG-KSPLTAENRATQDAAAITAAIVRLLL  170



>ref|XP_006296761.1| hypothetical protein CARUB_v10015473mg [Capsella rubella]
 gb|EOA29659.1| hypothetical protein CARUB_v10015473mg [Capsella rubella]
Length=162

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 78/148 (53%), Gaps = 8/148 (5%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSH  392
              V   CK T +Y LC+  + +DPR+  ADT  LA+I++D +KA    T   I    K+ 
Sbjct  20   SIVDMTCKQTPDYTLCLSLLRSDPRSSSADTVGLALILVDKIKALGTETLGRINEAYKTK  79

Query  393  PDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL---GDPKFAEEAMTKLPFTTIGCENHFA  563
              LK  L++C   Y     KT++ V     I+   G+PKFAE+A+         CE  F 
Sbjct  80   TMLKRALDECNLRY-----KTIVDVNVHTAIIAIKGNPKFAEDAVVDSGVEASVCEGGFP  134

Query  564  GHKSPLTHLNKLVGELADVTRDVIRNLL  647
              +SPLT L + + ++ DVTR ++R LL
Sbjct  135  KGQSPLTELTQRMDKICDVTRAIVRMLL  162



>gb|ACO35696.1| invertase inhibitor [Solanum tuberosum]
Length=180

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 81/146 (55%), Gaps = 8/146 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEAD----TRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  36   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDVVKSKSIEIMEKIKELEKSNPE  95

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS-  575
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M  +      CE  F  H   
Sbjct  96   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTCEYSFNYHNKL  154

Query  576  --PLTHLNKLVGELADVTRDVIRNLL  647
              P+++L++ + EL+ V + +IR LL
Sbjct  155  DFPISNLSREIIELSKVAKSIIRMLL  180



>ref|XP_010487590.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=164

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 8/147 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V   CK T +Y LC+  + +DPR+  ADT  L +I++D +KA    T   I    K+ P
Sbjct  23   IVDTTCKQTPDYTLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINAAYKTKP  82

Query  396  DLKVPLEQCAWDYEVVI---LKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
             LK  L++C   Y+ ++   + T I       I G+PKFAE A+         C   F  
Sbjct  83   MLKRALDECNLRYKTIVDVDVHTAIT-----AINGNPKFAEGAVVDAGVEASVCAGGFPK  137

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SPLT L + + ++ DVTR +IR LL
Sbjct  138  GQSPLTGLTQRMNKICDVTRAIIRMLL  164



>gb|EYU45482.1| hypothetical protein MIMGU_mgv1a014923mg [Erythranthe guttata]
Length=174

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 90/170 (53%), Gaps = 10/170 (6%)
 Frame = +3

Query  159  ICVVILLMMLTTPINGD------RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAI  320
            I V +++  L++ ++ D      +  ++  CK T  YELC+  + ADP +  AD   LA+
Sbjct  8    ISVFLVITTLSSSVSVDTMAKSQQNLIESTCKNTPIYELCIATLRADPGSDAADVAGLAL  67

Query  321  IMIDTVKAKSK-VTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
            IMI  V+AKSK     + K L       +  L+QC   Y+ V L+  + VA   V  G+P
Sbjct  68   IMIGAVEAKSKEALSAVKKLLKGGGGGDREALKQCKDKYKAV-LEGDVPVAKRAV-RGNP  125

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE  M         CE+ F G KSPLT +N  V +LA V R +IRNLL
Sbjct  126  KFAEGGMADAKVEADDCEDAFGG-KSPLTKVNGDVRDLAVVARAIIRNLL  174



>ref|XP_006349846.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum tuberosum]
 gb|ACO35697.1| invertase inhibitor [Solanum tuberosum]
Length=178

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 8/146 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEAD----TRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  34   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEKSNPE  93

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE---NHFAGH  569
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M  +      CE   N++   
Sbjct  94   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTCEYSFNYYNKL  152

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
              P+++L++ + EL+ V + +IR LL
Sbjct  153  DFPISNLSREIIELSKVAKSIIRMLL  178



>gb|ACO35698.1| invertase inhibitor [Solanum tuberosum]
Length=178

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 83/150 (55%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  VKKICKTTENYELCMEYVWADPRAPEAD----TRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            +   C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L K
Sbjct  30   IHSTCRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEK  89

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE---NH  557
            S+P+ + PL QC   Y  V L+  + VA + +  G PKFAE+ M  +      CE   N+
Sbjct  90   SNPEWQAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTCEYSFNY  148

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            +     P+++L++ + EL+ V + +IR LL
Sbjct  149  YNKLDFPISNLSREIIELSKVAKSIIRMLL  178



>gb|ACO35694.1| invertase inhibitor [Solanum tuberosum]
 gb|ACO35695.1| invertase inhibitor [Solanum tuberosum]
 gb|ADM49015.1| putative invertase inhibitor [Solanum tuberosum]
 gb|AFF27602.1| invertase inhibitor [Solanum tuberosum]
Length=181

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 8/146 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEAD----TRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  37   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDVVKSKSIEIMEKIKELEKSNPE  96

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE---NHFAGH  569
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M  +      CE   N++   
Sbjct  97   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTCEYSFNYYNKL  155

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
              P+++L++ + EL+ V + +IR LL
Sbjct  156  DFPISNLSREIIELSKVAKSIIRMLL  181



>ref|XP_004288885.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=146

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 9/149 (6%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K + + C+ T N  LC+  + +DPR+  AD + L IIM+D VKAK+ +    +  LLK
Sbjct  2    DAKLIDETCRKTPNPNLCVSSLKSDPRSSGADVKGLGIIMVDVVKAKAIIGQNKVSGLLK  61

Query  387  SHP-DLKVPLEQCAWDYEVVILKTL--IKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
              P DL+  L+ C+ DY+ +    +    +A+   I   P  AEE M++       CE  
Sbjct  62   QSPGDLR--LKVCSGDYDAISNHQVPNASLAFSRDI---PHIAEEDMSEAADEARACELS  116

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNL  644
            F+G +SPLT +N  V ++A +T  + + L
Sbjct  117  FSG-RSPLTDVNNAVADVASITAAIAKQL  144



>gb|KHN03268.1| Pectinesterase inhibitor [Glycine soja]
Length=184

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 77/151 (51%), Gaps = 5/151 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            + K ++  CK T NY +C+E + A P +  AD   LA IM+  +KAK+    K I+ L +
Sbjct  35   NEKLIENTCKKTPNYNVCLESLKASPGSSSADVTGLAQIMVKEMKAKANDALKRIQELQR  94

Query  387  ---SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
               S P  +  L  CA  Y+ V++   +  A + +  GDPKFAE+           CE  
Sbjct  95   VGASGPKQRRALSSCADKYKAVLIAD-VPQATEALQKGDPKFAEDGANDAANEATYCETD  153

Query  558  F-AGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F A   SPLT  N  + ++A VT  ++R LL
Sbjct  154  FSAAGNSPLTKQNNAMHDVAAVTAAIVRLLL  184



>ref|NP_001237215.1| uncharacterized protein LOC100500640 precursor [Glycine max]
 gb|ACU15780.1| unknown [Glycine max]
Length=184

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 77/151 (51%), Gaps = 5/151 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            + K ++  CK T NY +C+E + A P +  AD   LA IM+  +KAK+    K I+ L +
Sbjct  35   NEKLIENTCKKTPNYNVCLESLKASPGSSSADVTGLAQIMVKEMKAKANDALKRIQELQR  94

Query  387  ---SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
               S P  +  L  CA  Y+ V++   +  A + +  GDPKFAE+           CE  
Sbjct  95   VGASGPKQRRALSSCADKYKAVLIAD-VPQATEALQKGDPKFAEDGANDAANEATYCETD  153

Query  558  F-AGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F A   SPLT  N  + ++A VT  ++R LL
Sbjct  154  FSAAGNSPLTKQNNAMHDVAAVTAAIVRLLL  184



>ref|XP_002279817.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Vitis vinifera]
Length=177

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 78/147 (53%), Gaps = 6/147 (4%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK---  386
            FV KICK T  + LC++ + +DPR+  AD R LAIIM+D +K  +      I  LLK   
Sbjct  34   FVDKICKQTPYHALCLKTLLSDPRSAGADVRGLAIIMVDVIKRDTVSILSRINELLKKGG  93

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
            + P  +  L  C   Y  V LK  +  A + +  GD KFAE+  T        CE +F  
Sbjct  94   TDPHTRGALLDCIDKYNAV-LKGDVPEAMEALEKGDYKFAEQGATDASLEARVCEENF--  150

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
              SP+T++NKLV  ++ V   ++R LL
Sbjct  151  ETSPITNMNKLVHHVSLVAASIVRMLL  177



>gb|AIT42248.1| invertase inhibitor [Solanum tuberosum]
Length=179

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 81/146 (55%), Gaps = 8/146 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEAD----TRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DP + E +      TL +IM+D VK+KS    + IK+L KS+P+
Sbjct  35   CRETPYYSLCLTTLQSDPHSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKKLEKSNPE  94

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE---NHFAGH  569
             + PL QC   Y  V L+  + VA + +  G PKFAE  M  +      CE   N++   
Sbjct  95   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAENGMDDVVVEAQTCEYSFNYYNKL  153

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
              P+++L++ + EL+ V + +IR LL
Sbjct  154  DFPISNLSREIIELSKVAKSIIRMLL  179



>ref|XP_008390458.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=145

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T NY+LC+  + +DPR+  AD   L +I+++    K+      I+ LLK +P
Sbjct  5    LIDQTCKVTPNYDLCVSSLESDPRSAYADVAGLGLIIVNVATVKATDVVNKIEELLKQNP  64

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
            + K PL+ C   Y  V L+  I  A  G   G+PKFAEE M         C++ F+G KS
Sbjct  65   EEK-PLKYCTRYYRKV-LEADIPEASQGFRSGNPKFAEEGMIGATGEAESCQSSFSG-KS  121

Query  576  PLTHLNK  596
            PLT +NK
Sbjct  122  PLTDMNK  128



>ref|NP_564516.2| cell wall / vacuolar inhibitor of fructosidase 1 [Arabidopsis 
thaliana]
 sp|F4HWQ8.1|CVIF1_ARATH RecName: Full=Cell wall / vacuolar inhibitor of fructosidase 
1; Short=AtC/VIF1; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32232.1| cell wall / vacuolar inhibitor of fructosidase 1 [Arabidopsis 
thaliana]
Length=205

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 76/143 (53%), Gaps = 2/143 (1%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            +   ++  CK T ++ LC+  + +DPR   ADT  LA+I+ID +K  +  T   I  L K
Sbjct  22   EGSIIEPTCKETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLATKTLNEINGLYK  81

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
              P+LK  L++C+  Y+  IL   +  A + +  G PKF E+ +         C+  F G
Sbjct  82   KRPELKRALDECSRRYK-TILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCQGGFNG  140

Query  567  HKSPLTHLNKLVGELADVTRDVI  635
              SPLT L K + ++++VTR + 
Sbjct  141  S-SPLTSLTKSMQKISNVTRAIF  162



>emb|CAN79657.1| hypothetical protein VITISV_014507 [Vitis vinifera]
Length=177

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 78/147 (53%), Gaps = 6/147 (4%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK---  386
            FV KICK T  + LC++ + +DPR+  AD R LAIIM+D +K  +      I  LLK   
Sbjct  34   FVDKICKQTPYHALCLKTLLSDPRSAVADVRGLAIIMVDVIKRDTVSILSRINELLKKGG  93

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
            + P  +  L  C   Y  V LK  +  A + +  GD KFAE+  T        CE +F  
Sbjct  94   TDPHTRGALLDCIDKYNAV-LKGDVPEAMEALEKGDYKFAEQGATDASLEARVCEENF--  150

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
              SP+T++NKLV  ++ V   ++R LL
Sbjct  151  ETSPITNMNKLVHHVSLVAASIVRMLL  177



>ref|XP_002313933.1| hypothetical protein POPTR_0009s08690g [Populus trichocarpa]
 gb|EEE87888.1| hypothetical protein POPTR_0009s08690g [Populus trichocarpa]
Length=175

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 9/172 (5%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGD------RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
            L+  ++ ++    P+N           ++K CK T  Y+LC+  + + PR+   D   LA
Sbjct  5    LVIFLVFIIYFIFPVNASLPSILGNNLIEKTCKQTPYYDLCVRSLISSPRSFNTDVEGLA  64

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
             IM+ T+ A++  T   I +LL+   D  +K  L+ CA  Y+ +I K  I  +   + LG
Sbjct  65   KIMVHTINARATHTLHRINKLLQHRQDTNMKRALQSCASRYDAII-KEDIPESLQALRLG  123

Query  492  DPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            + KFAE       F    CE  F   KSPL  +N++V +++ V   +++ ++
Sbjct  124  NYKFAEAGTVDAAFEARLCEKEFRRCKSPLADMNRVVHDVSIVAASIVQTIV  175



>gb|EYU45481.1| hypothetical protein MIMGU_mgv1a021463mg, partial [Erythranthe 
guttata]
Length=137

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 5/140 (4%)
 Frame = +3

Query  180  MMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVT  359
            M+++  I  D+  +   CK T NY LC+  + AD  +  AD   L +IM+  VK KSK  
Sbjct  1    MLISEEIK-DQNLIATTCKNTPNYRLCINTLQADRGSAAADVAGLGLIMVAAVKEKSKEA  59

Query  360  DKLIKRLL-KSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFT  536
               + +LL KS  + K  L+QC   Y+ V+   + +      + G+PKFAE  M  +   
Sbjct  60   LSTVNKLLVKSGSNPKKALQQCRDAYKAVLEGDVPEAEQS--LRGNPKFAENGMADVAVE  117

Query  537  TIGCENHFAGHKSPLTHLNK  596
               CE  F G KSPLT +NK
Sbjct  118  ADSCEAAFGG-KSPLTVVNK  136



>ref|XP_011002592.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Populus euphratica]
Length=175

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 86/172 (50%), Gaps = 9/172 (5%)
 Frame = +3

Query  156  LICVVILLMMLTTPING------DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
            L+  ++ ++    P+N           ++K CK T  Y+LC+  + + PR+   D   LA
Sbjct  5    LVIFLVFIIYFIFPVNAFLPSILGNNLIEKTCKQTPYYDLCVRSLISSPRSFNTDVEGLA  64

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
             IM+ T+ A++  T + I +LL+   D  +K  L+ CA  Y+ +I K  I  +   + LG
Sbjct  65   KIMVHTINARATHTLRRINKLLQHRQDTNMKRALQSCASRYDAII-KEDIPESLQALRLG  123

Query  492  DPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            + KFAE            CE  F   KSPL  +N++V +++ V   +++ ++
Sbjct  124  NYKFAEAGTMDAALEARLCEKEFRRCKSPLADMNRVVHDVSIVAASIVQTIV  175



>gb|KHN02871.1| Pectinesterase inhibitor 2 [Glycine soja]
Length=164

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 4/150 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            + K ++  C+ T NY +C+E + A P +  AD   LA IM+  +KAK+    K I+ L +
Sbjct  16   NEKLIENTCRKTPNYNVCLESLKASPGSSSADVTGLAQIMVKEMKAKANYALKRIQELQR  75

Query  387  --SHPD-LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
              + P+  +  L  C   Y+ V++  + + A + +  GDPKFAE+           CE  
Sbjct  76   VGAGPNKQRRALSSCVDKYKTVLIADVPQ-ATEALQKGDPKFAEDGANDAANEATFCEAD  134

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F+   SPLT  N  + ++A VT  ++R LL
Sbjct  135  FSAGNSPLTKQNNAMHDVAAVTAAIVRLLL  164



>ref|XP_003529510.2| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 isoform 
1 [Glycine max]
Length=191

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 77/150 (51%), Gaps = 4/150 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            + K ++  C+ T NY +C+E + A P +  AD   LA IM+  +KAK+    K I+ L +
Sbjct  43   NEKLIENTCRKTPNYNVCLESLKASPGSSSADVTGLAQIMVKEMKAKANYALKRIQELQR  102

Query  387  --SHPD-LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
              + P+  +  L  C   Y+ V++   +  A + +  GDPKFAE+           CE  
Sbjct  103  VGAGPNKQRRALSSCVDKYKTVLIAD-VPQATEALQKGDPKFAEDGANDAANEATFCEAD  161

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F+   SPLT  N  + ++A VT  ++R LL
Sbjct  162  FSAGNSPLTKQNNAMHDVAAVTAAIVRLLL  191



>ref|XP_007035858.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
 gb|EOY06784.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
Length=173

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = +3

Query  147  MRNLICVVILLMMLT-TPINGD---RKFVKKICKTTENYELCMEYVWADPRAPEADTRTL  314
            M N+I +VIL   ++ + + G       ++  CK T  ++LC+  + +DPR+  AD   L
Sbjct  1    MANMIPLVILQAAISFSFLPGSYSASNLIETTCKQTPFFDLCVSSLQSDPRSSNADVAGL  60

Query  315  AIIMIDTVKAKSKVTDKLIKRLL--KSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
            A I  D V  K+    + I  LL   + P+L+  L+ C   Y  +I +  I VA + ++ 
Sbjct  61   AHIAADNVNVKATANLQQITGLLGGATDPELQKALQGCVDKYNAII-QADIPVAIEAILK  119

Query  489  GDPKFAEEAMTKLPFTTIGCENHFAG-HKSPLTHLNKLVGELADVTRDVIRNLL  647
            G+PKFA  + T        CE  FA   KSP++  NK+V +L+ V + +   LL
Sbjct  120  GNPKFAVSSATDAANEAQSCEKGFANPPKSPISDSNKVVNQLSLVLQSIASLLL  173



>ref|XP_010027116.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
 ref|XP_010042128.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
 gb|KCW61321.1| hypothetical protein EUGRSUZ_H04068 [Eucalyptus grandis]
Length=171

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 66/128 (52%), Gaps = 4/128 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V   CK T + + C+  + +DPR+  ADT TL +IM+D V A +K T   IK LL+  P
Sbjct  28   LVDYTCKKTPHADFCISALRSDPRSSTADTATLGLIMVDKVDANAKSTVTKIKDLLRKSP  87

Query  396  D--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
            D   K  L  C   Y+  I   L+  + + +  GDPKFA + M +       CE  F G 
Sbjct  88   DRGTKQALTSCEESYKYCI-SALVPSSKESLTKGDPKFAVDNMRQEAIQASSCEEGFGG-  145

Query  570  KSPLTHLN  593
            KSPL+  N
Sbjct  146  KSPLSGSN  153



>ref|XP_009372102.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Pyrus x bretschneideri]
Length=175

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 85/170 (50%), Gaps = 8/170 (5%)
 Frame = +3

Query  153  NLICVVILLMMLTTPING-----DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
             L+C++++ + L+          D   + + CK T NY LC+  + +D R+ +AD   L 
Sbjct  9    QLVCLLLVFLPLSHCRRAVIFPMDANLIDQTCKKTPNYNLCVSSLKSDLRSGKADVAGLG  68

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP  497
             I +D  K K+  T   I  LLK  P  +  L+ CA  Y  +++   +  A  G  LG+P
Sbjct  69   FITVDIAKDKATDTANRINELLKQSPSDQ-RLKTCATFYHTILVAD-VPEASQGFKLGNP  126

Query  498  KFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            KFAE+ M         CE  F+  KSPLT  NK+V +L+ +   + R LL
Sbjct  127  KFAEQGMNDAADAAEACEKEFSS-KSPLTDKNKVVHDLSSIAAAIARLLL  175



>ref|XP_010027117.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=172

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 72/143 (50%), Gaps = 5/143 (3%)
 Frame = +3

Query  171  ILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKS  350
            +LL+ +  P + D   V   CK T N + C+  +  DPR+  ADT+TL +IM+D V+A +
Sbjct  15   LLLITILPPASAD--LVDDTCKKTPNVDFCVTILSLDPRSSTADTKTLGLIMVDKVEAHA  72

Query  351  KVTDKLIK--RLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTK  524
            K T   IK  R   +HP  K  L  C   Y  ++   ++  + + +  GD KFA E M  
Sbjct  73   KSTLTKIKYLRGKAAHPRTKQALPSCEQSYGFIV-SAMVPPSKESLTKGDYKFAVEYMNA  131

Query  525  LPFTTIGCENHFAGHKSPLTHLN  593
                   CE  F G KSP++  N
Sbjct  132  AVNDVQECEAGFGGSKSPISDSN  154



>ref|XP_004298183.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=142

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 77/142 (54%), Gaps = 9/142 (6%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D K + + C+ T N  LC+  + +DPR+  AD + L IIM+D VKAK+ +    +  LLK
Sbjct  2    DAKLIDETCQKTPNPNLCVSSLKSDPRSSGADVKGLGIIMVDVVKAKAIIGQNKVSGLLK  61

Query  387  SHP-DLKVPLEQCAWDYEVVILKTL--IKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
              P DL+  L+  + DY+ +    +    +A+   I   P  AEE M++       CE  
Sbjct  62   QSPGDLR--LKVGSGDYDAISNHQVPNASLAFSRDI---PHIAEEDMSEAADEARACELS  116

Query  558  FAGHKSPLTHLNKLVGELADVT  623
            F+G +SPLT +N  V ++A +T
Sbjct  117  FSG-RSPLTDVNNAVADVAAIT  137



>ref|XP_009780951.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X2 [Nicotiana sylvestris]
Length=135

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 70/146 (48%), Gaps = 37/146 (25%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V+  CK T NY LC++ + +D R+   D  TLA+I++D +K K+    + I +L +S+P
Sbjct  25   LVETTCKNTPNYNLCLKTLLSDKRSAGGDITTLALIVVDAIKVKANQAAEFISKLRQSNP  84

Query  396  DL--KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
                +VPL++CA+ Y+                                    CE +F   
Sbjct  85   PTAWRVPLKKCAFSYK-----------------------------------DCEENFKSS  109

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
             SPLT LN  V EL+ V R +IRNLL
Sbjct  110  FSPLTGLNTAVLELSVVGRAIIRNLL  135



>ref|XP_003609813.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92010.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=176

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 89/176 (51%), Gaps = 10/176 (6%)
 Frame = +3

Query  144  KMRNLICVVILLMMLT---TPIN---GDRKFVKKICKTTENYELCMEYVWADPRAPEADT  305
            KM  L   + L ++++   T IN    +   +++ CK T NY LC++Y+ +DPR  +AD 
Sbjct  3    KMNALALAIFLCIIVSCHCTNINQKTNNATLIQQTCKQTPNYALCIKYLKSDPRTSDADL  62

Query  306  RTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDL--KVPLEQCAWDYEVVILKTLIKVAYDG  479
               A+ M+D +K  +      + +LLK   +L     L  CA  Y  +++  + K +   
Sbjct  63   VNYALYMVDRIKTTTITAYNKVTQLLKGGHELYQTEALSSCAGRYRSILVDVVPK-SIAA  121

Query  480  VILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            +  GDPK AE+           CEN F G KSP++  N  + ++A +T  +++ LL
Sbjct  122  LKQGDPKVAEDGANDAANDATTCENGFKG-KSPISDENIDMHDVAVITAAIVKQLL  176



>ref|XP_009372103.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Pyrus 
x bretschneideri]
Length=176

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 71/134 (53%), Gaps = 3/134 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + CK T NY+LC+  + +DPR+  AD   L +I+++    K+      I+ LLK +P
Sbjct  36   LIDQTCKVTPNYDLCVSSLKSDPRSAYADVAGLGLIIVNVATVKATDVVNKIEELLKQNP  95

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
              K PL  C   Y  V L+  I  A  G    +PKFAEE M         CE+ F+G KS
Sbjct  96   AEK-PLTYCTRYYRKV-LEADIPEASHGFRSDNPKFAEEGMIGATGEAESCESSFSG-KS  152

Query  576  PLTHLNKLVGELAD  617
            PLT +NK   ++++
Sbjct  153  PLTDMNKGFQDVSN  166



>gb|AFK40449.1| unknown [Lotus japonicus]
Length=176

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 77/151 (51%), Gaps = 10/151 (7%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D +FV +ICK T     C++++  DPR+  AD + LA+IM+D +KAK   T   IK+LLK
Sbjct  30   DARFVDEICKQTPYPSDCVQFLRQDPRSSGADVKGLALIMVDVIKAKGTNTVNKIKQLLK  89

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL----GDPKFAEEAMTKLPFTTIGCEN  554
                 K PL  C   Y     K ++++     IL    G    AE+           CE 
Sbjct  90   GSTGEKKPLNICLDRY-----KGVVEINVPEAILTLKAGKITIAEDMAAATSDEAQYCEV  144

Query  555  HFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
             F G KSPLT  N  +   A+VTR +IR+LL
Sbjct  145  IFHG-KSPLTIENNGMHVAAEVTRHIIRHLL  174



>gb|AFK48395.1| unknown [Lotus japonicus]
Length=184

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 83/172 (48%), Gaps = 14/172 (8%)
 Frame = +3

Query  168  VILLMMLTTP--------INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAII  323
             +LL+M++ P        +    K ++  CK T NY +C + + A P    AD   LA I
Sbjct  15   ALLLIMISIPATIHCRTFLPNSGKLIETTCKNTPNYNVCFQSLKASPGGSGADVTGLAQI  74

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDL----KVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
            M+  +KAK+     +I  L K    L    +  L  CA  Y  +++   I  A + +  G
Sbjct  75   MVRVMKAKANDALNVIHELQKVKIGLGTEQRRALSSCADKYRAILIGD-IPQATEALQKG  133

Query  492  DPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            DPKFAE+           CE+ F+G KS LT  N ++ ++A VT  ++R LL
Sbjct  134  DPKFAEDGANDAANEATYCESEFSG-KSLLTKQNNVMHDVAAVTGAIVRMLL  184



>gb|KHN02873.1| hypothetical protein glysoja_009739 [Glycine soja]
Length=182

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 92/170 (54%), Gaps = 7/170 (4%)
 Frame = +3

Query  156  LICVVILLMMLTTPI---NGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            L+ +++L  +L TP    +GD   V +ICK T  Y+LC   + ++P AP++D++ +A+IM
Sbjct  12   LLHILLLSCILFTPTHSSDGDGDLVDQICKKTPFYDLCSSILHSNPLAPKSDSKGMALIM  71

Query  327  IDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
            ++ + A +  T   I+ L+K   D  L+  L  CA  Y + ++K ++  A D +  G   
Sbjct  72   VNDILANATDTLSYIEELIKQTSDEQLEQQLAFCAESY-IPVVKYILPQAADAINQGRFG  130

Query  501  FAEEAMTKLPFTTIGCENHFAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
            FA   +         C+  F+G  ++PL+  N ++ +L DV   +++ LL
Sbjct  131  FASYCIVDAQKEVNACDKKFSGSTQAPLSDRNDIMQKLVDVAAAIVKLLL  180



>ref|XP_008229307.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=146

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 2/139 (1%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVP  410
            CK T  Y+LC+  + +DPR+  AD   L ++M D VKAK+  +   I  LLK  P  +  
Sbjct  10   CKKTPYYDLCVISLNSDPRSYTADVGGLGVVMADVVKAKATDSLNKINELLKQSPGDR-S  68

Query  411  LEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHL  590
            L  C  DY   +++  + +A +    G+ K A++ M+        CE+ F+   SPLT  
Sbjct  69   LTICV-DYYKTVIEGDVSLANEAFASGNAKLADQGMSDAGIVIDLCESQFSEGSSPLTDK  127

Query  591  NKLVGELADVTRDVIRNLL  647
            NK   ++A V   + R +L
Sbjct  128  NKAAHDVAAVGAAIARTML  146



>ref|XP_007035859.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
 gb|EOY06785.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
Length=181

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 87/182 (48%), Gaps = 16/182 (9%)
 Frame = +3

Query  147  MRNLICVVILLMMLT---TPIN---------GDRKFVKKICKTTENYELCMEYVWADPRA  290
            M+N+I +V+L +  +    P++         G    V+  CK T  Y LC+  + +DPR+
Sbjct  1    MKNIIPLVLLQIAFSFTFLPVSALELQGGRGGANNLVETTCKKTPFYNLCLSTLQSDPRS  60

Query  291  PEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKS--HPDLKVPLEQCAWDYEVVILKTLIK  464
              AD   L  I  D VKA++  T + I  LL++   P L+  L  C   Y+ +I K  + 
Sbjct  61   SRADLAGLVHIGADKVKARATATLRQIIGLLRAAKDPKLQTALRDCVDLYDTII-KYDMP  119

Query  465  VAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG-HKSPLTHLNKLVGELADVTRDVIRN  641
            V  + V  G+PKF  +  T        CE  F    KSP++  NK V +L+ +   + + 
Sbjct  120  VTIEAVAKGNPKFGVQGATDAANEADDCERRFGNPPKSPISGSNKAVHDLSAIVASIAQL  179

Query  642  LL  647
            LL
Sbjct  180  LL  181



>ref|XP_007019911.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 
1 [Theobroma cacao]
 gb|EOY17136.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 
1 [Theobroma cacao]
Length=263

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 79/150 (53%), Gaps = 7/150 (5%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTV-KAKSKVTDKLIKRLLKS  389
              +++ C+ T  Y+LC+  +  +P +  AD + LA IM+D+V K K+  T  LI  LL+ 
Sbjct  113  NLIERTCRQTPFYDLCVWSLKTNPESRNADVKKLARIMVDSVLKNKASDTLDLIDELLQD  172

Query  390  ----HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
                 P L   L  CA  Y V+I   + ++  + +  GD KFAE            CE  
Sbjct  173  GFTLDPALHKALSSCAERYSVIIGGDVPEI-IEALETGDYKFAERGTNDAAMEANSCEVE  231

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            F G KSPLTH+NK+V +++ V   +++ +L
Sbjct  232  FPG-KSPLTHMNKVVHDVSVVAASIVKIIL  260



>ref|XP_010110654.1| Putative invertase inhibitor [Morus notabilis]
 gb|EXC27499.1| Putative invertase inhibitor [Morus notabilis]
Length=191

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 78/147 (53%), Gaps = 4/147 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             ++K CK T +Y+LC+  + ++P +  AD R LA IM+D V +K+  T   I+ LLK  P
Sbjct  44   LIEKTCKRTPHYDLCVSSLESNPESSGADLRGLARIMVDLVLSKATETLDYIRSLLKQEP  103

Query  396  D--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA-G  566
            D  L+  L  CA  Y + ++K  +  A D ++ G   FA   ++        C+ +F+  
Sbjct  104  DPELEKSLAYCAELY-IPVVKYSLPQAIDALLGGHFGFANYGISDAAKQANACDKNFSKS  162

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
              SPL   N L+ +L++V   +I  LL
Sbjct  163  STSPLAEKNSLLNDLSEVAAAIISILL  189



>ref|XP_010045344.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
Length=180

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 74/151 (49%), Gaps = 4/151 (3%)
 Frame = +3

Query  204  GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL  383
            G    +   C  T  Y LC + + +DPR+  AD + LA+IM++   A++  T   IK L+
Sbjct  29   GAGDLIDGTCGQTLYYGLCAKSLRSDPRSASADLKGLAVIMLNVTTAEAADTLSYIKALV  88

Query  384  KSH--PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
            K    P    PLE CA  Y  +   TL  +A   +I G  +FA+  + +       CE  
Sbjct  89   KRKVDPAEAKPLEYCAGLYSPMARLTL-PLAAKALIQGRYRFADYRLAEAAMQPPTCEGR  147

Query  558  FAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
            F G  +SPLT  N L  +L  V+ D++  L+
Sbjct  148  FGGAVESPLTDRNVLAHDLCAVSMDIVNQLM  178



>gb|KFK39050.1| hypothetical protein AALP_AA3G194200 [Arabis alpina]
Length=152

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 2/116 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
            FV K CK T +Y LC+  + +DP +  A+T  L++ ++D +KA    T + I R  +  P
Sbjct  21   FVDKTCKQTPHYTLCLSLLRSDPSSSTANTAGLSLFLVDKIKALGITTLRHIDRAYEMKP  80

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA  563
             LK PL++C   Y+ ++    +K A    I G+PKFAE A+         CE  FA
Sbjct  81   MLKRPLDKCNSRYKRIV-GEYVKTAIT-AIKGNPKFAEGAIASFSIEASLCEEGFA  134



>ref|XP_010098775.1| Pectinesterase inhibitor [Morus notabilis]
 gb|EXB75678.1| Pectinesterase inhibitor [Morus notabilis]
Length=186

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 75/145 (52%), Gaps = 5/145 (3%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P++ +  F+++ CK T  Y+LC   + +DPR+ +AD + L  I +   +AK+K T   I+
Sbjct  31   PMDANN-FIEQTCKQTAYYDLCTSILRSDPRSSDADVKGLTFIEVGVWEAKAKETLSHIE  89

Query  375  RLLKSHP--DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             L+K  P  D K  L  CA +Y  +I  T I  A  G+   D K  E +          C
Sbjct  90   ELIKGSPKQDEKAALSSCANNYNAII-TTDIPKAIGGLDANDFKTTEVSAEDACRKADSC  148

Query  549  ENHFAGHKSPLTHLNKLVGELADVT  623
               F+G  SPL+ +NKLV + A +T
Sbjct  149  AESFSG-SSPLSEMNKLVHDTAALT  172



>ref|XP_007217364.1| hypothetical protein PRUPE_ppa022749mg [Prunus persica]
 gb|EMJ18563.1| hypothetical protein PRUPE_ppa022749mg [Prunus persica]
Length=181

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 2/139 (1%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVP  410
            CK T  Y+LC+  + +DPR+  AD   L ++M D VKAK+  +   I  LL   P  +  
Sbjct  45   CKKTPYYDLCVISLNSDPRSYTADVAGLGVVMADVVKAKATDSLNKINELLTQSPGDR-S  103

Query  411  LEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHL  590
            L  C  DY   +++  + +A +    G+ K A++ M+        CE+ F+   SPLT  
Sbjct  104  LTTCV-DYYKTVIEADVPLANEAFASGNAKLADQGMSDAGIVIDLCESQFSEGSSPLTDK  162

Query  591  NKLVGELADVTRDVIRNLL  647
            NK   ++A V   + R +L
Sbjct  163  NKAAHDVAAVGAGIARTML  181



>ref|XP_003609816.1| hypothetical protein MTR_4g122800 [Medicago truncatula]
 gb|ACJ85961.1| unknown [Medicago truncatula]
 gb|AES92013.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
 gb|AFK46417.1| unknown [Medicago truncatula]
 gb|AFK48537.1| unknown [Medicago truncatula]
Length=182

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 68/144 (47%), Gaps = 2/144 (1%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             ++  CK T NY +C + + A       D   LA IM+  +KAK+      I +L +   
Sbjct  41   LIENTCKKTPNYNVCFQSLKAYSGTSAGDVTGLAQIMVKVMKAKANDGLNKIHQLQRLGN  100

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
              +  L  C   Y  +++   I  A + +  GDPKFAE+           CE+ F G KS
Sbjct  101  GARKALSSCGDKYRAILIAD-IPQAIEALEKGDPKFAEDGANDAANEATYCESEFNG-KS  158

Query  576  PLTHLNKLVGELADVTRDVIRNLL  647
            PLT  N  + +++ VT  ++R LL
Sbjct  159  PLTKQNNAMHDVSAVTSSIVRQLL  182



>ref|XP_004508255.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=176

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 91/174 (52%), Gaps = 14/174 (8%)
 Frame = +3

Query  144  KMRNLICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAII  323
            +M   + V++   ++ T  N +   V++ CK T+NY LC++ + +DPR+  +D   LA+I
Sbjct  2    RMLKSLAVILCSFLVVTECNAN--LVEETCKKTQNYNLCIKCLNSDPRSSTSDLNGLALI  59

Query  324  MIDTVKAKSKVTDKLIKRLLKS-----HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
            M++T+K K++ T   I++++++      P  K  L  C  +Y   IL   +  AY  +  
Sbjct  60   MVNTIKLKAQTTLIKIRQVIETIGDKLTPPQKQTLNSCTTNYN-TILNVDVHDAYIALQQ  118

Query  489  GDPKFAEEAMTKLPFTTIGCENHFAGHKSP-----LTHLNKLVGELADVTRDVI  635
            G+P+ A++ +         CEN F+  K P     L    K++ ++A V  ++I
Sbjct  119  GNPRAAKDGVNDAATKGSTCENDFS-RKFPDGIGILGDTIKIMNDVATVASNII  171



>ref|XP_010042127.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=174

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 67/143 (47%), Gaps = 3/143 (2%)
 Frame = +3

Query  171  ILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKS  350
            ILL+ +    +     V   C+ T     C   +  DPR+  ADT+TL +IM+D V+A +
Sbjct  15   ILLITVLPFASASTDLVNYTCRKTPYTVFCAAALGLDPRSSTADTKTLGLIMVDKVEAHA  74

Query  351  KVTDKLIKRLL--KSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTK  524
            K T   IK L    +HP  K  L  C   Y  ++   ++  + + +  GD KFA E M  
Sbjct  75   KSTLTKIKYLRGKAAHPRTKQALTSCEQSYGFIV-SAMVPPSKESLTKGDYKFAVEYMNA  133

Query  525  LPFTTIGCENHFAGHKSPLTHLN  593
                   CE  F G KSP++  N
Sbjct  134  AVNDVQECEAGFGGSKSPISDSN  156



>ref|XP_010045343.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=188

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 74/147 (50%), Gaps = 5/147 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             +++ C+ T  Y+LC+  + +DP +  AD R LA IM  +V A +  T   I+ LL   P
Sbjct  39   LIEQTCRLTPFYDLCLSSLKSDPTSSAADIRGLARIMAGSVLASASHTLDQIQELLGQAP  98

Query  396  DLKV--PLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
            D +   PL  CA  Y + ++K  +  A D +  G   FA   ++        CE +F+G 
Sbjct  99   DPETEKPLAYCAELY-IPVVKYTLPQALDALNKGQLGFAVYGLSDAGTEAEECEKNFSGQ  157

Query  570  --KSPLTHLNKLVGELADVTRDVIRNL  644
               SP+T  NKLV  L DV   +++ L
Sbjct  158  GGGSPVTQGNKLVRNLVDVALAIVKIL  184



>ref|XP_008368958.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 73/146 (50%), Gaps = 3/146 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   + + C  T   +LC+  + +DPR+ +AD + L IIM+D VKAK++  + L++ L+ 
Sbjct  2    DANLIAQTCNQTPYPDLCVSTLQSDPRSAKADVKGLGIIMVDAVKAKAREABLLVEELVD  61

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
                  V    C ++Y   I +  I  A +    GD K AE AMT +      CE  F+G
Sbjct  62   KELG-NVAASNCRFNYS-DIFQLDIPQAVEAFPKGDYKSAELAMTNVVANADSCERGFSG  119

Query  567  HKSPLTHLNKLVGELADVTRDVIRNL  644
              SP    ++ V ++A V   + + L
Sbjct  120  G-SPFKEQSQAVHDVAYVAAAIAKVL  144



>ref|XP_007147385.1| hypothetical protein PHAVU_006G119800g [Phaseolus vulgaris]
 gb|ESW19379.1| hypothetical protein PHAVU_006G119800g [Phaseolus vulgaris]
Length=188

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 80/152 (53%), Gaps = 4/152 (3%)
 Frame = +3

Query  201  NGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRL  380
            +GD   V +ICK T  Y+LC   + ++P + + D + +A++M++ + A +  T   I+ L
Sbjct  36   DGDGDLVDQICKKTPFYDLCSSILHSNPLSSKPDLKGVALLMVNNIVANATDTLSYIEGL  95

Query  381  LKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCEN  554
            LK  PD  L+  L  CA  Y + ++K ++  A D +  G   FA   ++        C+ 
Sbjct  96   LKQTPDRELEQALAFCAESY-IPLVKYILPQAADAISQGRFGFASYCISDALKEVSSCDK  154

Query  555  HFAG-HKSPLTHLNKLVGELADVTRDVIRNLL  647
             F+G  ++PL   N +V +L D+   +I+ LL
Sbjct  155  KFSGTTQAPLGERNDIVQKLVDLASAIIKLLL  186



>ref|XP_007223451.1| hypothetical protein PRUPE_ppa011560mg [Prunus persica]
 gb|EMJ24650.1| hypothetical protein PRUPE_ppa011560mg [Prunus persica]
Length=206

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P++     ++K CK T +Y+LC+  + ++P++   D   LA I+ D + AK+  T   I 
Sbjct  52   PLDEGGDLIEKTCKKTPHYDLCVSTLQSNPQSSNTDVPGLAHIISDFLLAKATDTLDYIH  111

Query  375  RLLKSHP--DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             LLK  P  +L+  L  CA  Y + ++K  +  A D +  G   FA   ++        C
Sbjct  112  GLLKQSPEAELQKALANCAELY-IPVVKFSLPQAIDALTNGHFGFANYGISDAAKEADAC  170

Query  549  ENHFAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
            E  F+G  KSPLT  NKLV  L+ V   +I NLL
Sbjct  171  EKGFSGSTKSPLTDGNKLVDNLSGVAVAII-NLL  203



>gb|ADZ54777.1| invertase inhibitor 2 [Solanum tuberosum]
Length=158

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEADT----RTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  34   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIGIMEKIKELEKSNPE  93

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAM  518
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M
Sbjct  94   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGM  132



>ref|NP_001238267.1| uncharacterized protein LOC100527840 precursor [Glycine max]
 gb|ACU17031.1| unknown [Glycine max]
 gb|KHN12854.1| Pectinesterase inhibitor [Glycine soja]
Length=189

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 81/152 (53%), Gaps = 4/152 (3%)
 Frame = +3

Query  201  NGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRL  380
            +G+   V ++CK T  Y+LC   + ++P +P+ D + +A++M++ + A +  T   I+ L
Sbjct  37   DGNGDLVDQVCKKTPFYDLCSSILHSNPLSPKPDLKGVALLMVNNILANATDTLSYIEGL  96

Query  381  LKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCEN  554
            +K  PD  L+  L  CA  Y + I+K ++  A D +  G   FA   ++        C+ 
Sbjct  97   IKQTPDRELEQSLAFCAESY-IPIVKYILPQAADAISQGRFGFASYCISDALKEVSSCDK  155

Query  555  HFAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
             F+G  ++PL   N +V +L +V   +++ LL
Sbjct  156  KFSGATQAPLGDRNDIVQKLVNVASAIVKLLL  187



>gb|ADZ54776.1| invertase inhibitor 2 [Solanum tuberosum]
Length=158

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEADT----RTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  34   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEKSNPE  93

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAM  518
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M
Sbjct  94   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGM  132



>gb|KCW61322.1| hypothetical protein EUGRSUZ_H04069 [Eucalyptus grandis]
Length=174

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 61/127 (48%), Gaps = 3/127 (2%)
 Frame = +3

Query  219  VKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK--RLLKSH  392
            V   CK T     C   +  DPR+  ADT+TL +IM+D V+A +K T   IK  R   +H
Sbjct  31   VNYTCKKTPYTVFCAAALSLDPRSSTADTKTLGLIMVDKVEAHAKSTLTKIKYLRGKAAH  90

Query  393  PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHK  572
            P  K  L  C   Y  ++   ++  + + +  GD KFA E M         CE  F G K
Sbjct  91   PRTKQALPSCEQSYGFIV-SAMVPPSKESLTKGDYKFAVEYMNAAVNDVQECEAGFGGSK  149

Query  573  SPLTHLN  593
            SP++  N
Sbjct  150  SPISDSN  156



>ref|XP_003609811.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92008.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
 gb|AFK46179.1| unknown [Medicago truncatula]
Length=179

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 75/146 (51%), Gaps = 3/146 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK--S  389
             V +ICK T  Y+LC   + A+P AP++D + +A+IM++ + A +  T   I+ L+K  +
Sbjct  33   LVDQICKQTPFYDLCSSILHANPLAPKSDPKGMALIMVNDILANATDTLSYIEELIKQTT  92

Query  390  HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
              DL+  L  CA  Y + ++K ++  A D +  G   FA  ++         C   F G 
Sbjct  93   DKDLEQQLAFCAESY-IPVVKYILPQAADAISQGRYGFASYSIVDAEKEIGACNKKFPGS  151

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
             S L   N ++ +L DV   +++ LL
Sbjct  152  SSLLGDRNSIMQKLVDVAAAIVKLLL  177



>gb|AAX63191.1| putative invertase inhibitor precursor [Solanum tuberosum]
Length=153

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEAD----TRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  34   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEKSNPE  93

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAM  518
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M
Sbjct  94   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGM  132



>ref|XP_007154406.1| hypothetical protein PHAVU_003G116900g [Phaseolus vulgaris]
 gb|ESW26400.1| hypothetical protein PHAVU_003G116900g [Phaseolus vulgaris]
Length=188

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 77/147 (52%), Gaps = 4/147 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V +IC+ T  Y+LC   + ++P AP+ D + +A+IM++ ++A +  T   I+ L+K   
Sbjct  41   LVDQICRKTPFYDLCSSILHSNPLAPKTDPKGMALIMVNDIQANATDTLSYIEELIKQTS  100

Query  396  D--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHF-AG  566
            D  L+  L  CA  Y + ++K ++  A D +  G   FA   +         C+  F A 
Sbjct  101  DEQLEQQLAFCAESY-IPVVKYILPQAADAISQGRFGFASYCIVDAQKEVNACDKKFSAS  159

Query  567  HKSPLTHLNKLVGELADVTRDVIRNLL  647
             +SPL+  N ++ +L DV   +++ LL
Sbjct  160  SQSPLSDRNDIMQKLVDVASAIVKLLL  186



>ref|XP_010042126.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=172

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 68/148 (46%), Gaps = 4/148 (3%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            L+    LL++   P+      +   CK   + + C+  + +DPR+  ADT TL +I +DT
Sbjct  9    LVSFAQLLLITILPL-ASADLIDDTCKKMPDVDSCIAILRSDPRSSTADTPTLGLISVDT  67

Query  336  VKAKSKVTDKLIKRLLKSHPDLKV--PLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAE  509
              + ++VT   IK LL   PD K    L  C   Y   I  +L+  + +    GD KFA 
Sbjct  68   ADSNAEVTLDEIKDLLGKSPDSKTKQALTSCEASYG-NIRSSLVPPSRESFTKGDYKFAV  126

Query  510  EAMTKLPFTTIGCENHFAGHKSPLTHLN  593
            + M         CE  F G KSP+   N
Sbjct  127  QYMNDAANAAAVCEAGFGGPKSPIYDAN  154



>gb|ADM49016.1| putative invertase inhibitor [Solanum tuberosum]
Length=153

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +3

Query  231  CKTTENYELCMEYVWADPRAPEADT----RTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            C+ T  Y LC+  + +DPR+ E +      TL +IM+D VK+KS    + IK L KS+P+
Sbjct  34   CRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEKSNPE  93

Query  399  LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAM  518
             + PL QC   Y  V L+  + VA + +  G PKFAE+ M
Sbjct  94   WRAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGM  132



>gb|AAM94391.1| invertase inhibitor-like protein [Ipomoea batatas]
Length=192

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 73/156 (47%), Gaps = 13/156 (8%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPE--ADTRTLAIIMIDTVKAKSKVTDKLIKRLLKS  389
             +   C  T NY LC+  + +DPR      +  TL ++M+D VKAK++   + I+ L KS
Sbjct  38   LINTACNNTPNYALCVSVLASDPRTSSKAVNVETLGLVMVDAVKAKAEEMIETIRELEKS  97

Query  390  HP-DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
             P + ++PL QC + Y   ++   +  A   +  G PKFAE+ M         CE  F  
Sbjct  98   KPVEWRLPLSQC-YIYYYAVVHADVPEAEAALKRGVPKFAEDGMADAAVEAESCEAAFKL  156

Query  567  HK---------SPLTHLNKLVGELADVTRDVIRNLL  647
                       S +   NK V +L+ V   +I+ LL
Sbjct  157  QNEDIILDYSGSAIDETNKDVIQLSAVATSIIKMLL  192



>gb|KDO71996.1| hypothetical protein CISIN_1g047345mg [Citrus sinensis]
Length=176

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 71/143 (50%), Gaps = 3/143 (2%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK--  386
            + +K+ CK TE Y LC+  + +DPR+  AD + LAII+++ ++AK+  T   +  L K  
Sbjct  31   RLIKETCKHTEYYNLCVASLESDPRSLNADVKELAIILVELLQAKANETLWHVGDLFKKV  90

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
            S P L      C  +Y  ++ +  I  A D +  GD   +++           CE  FAG
Sbjct  91   SDPALYRFYGTCIEEYRAIVERQ-IPEAIDALQSGDYMVSKKDAEAAAAHADSCEEQFAG  149

Query  567  HKSPLTHLNKLVGELADVTRDVI  635
               P +  NK V  L+ VT  ++
Sbjct  150  ETQPFSDQNKAVHGLSLVTSSIL  172



>ref|XP_008390420.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=184

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 73/153 (48%), Gaps = 4/153 (3%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P+      ++  CK T +Y LC+  + ++P +  AD   LA+I  D + A +  T   I 
Sbjct  32   PLAKGSDLIQTTCKKTPHYNLCLSTLQSNPDSSNADVPGLALIASDALLANASDTLDYIH  91

Query  375  RLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             LLK  P+  L+  L  CA  Y + I+K  +  A + +  G   FA+  ++        C
Sbjct  92   GLLKQSPEVHLQKALANCAELY-IPIVKFSLPQAIEALXNGHFGFAKYGISDAAKEAEAC  150

Query  549  ENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            E  F G  SPLT  N LV +L+ V    I NLL
Sbjct  151  EKGFGGVXSPLTDRNALVNDLSGVAV-AILNLL  182



>ref|XP_002517758.1| C, putative [Ricinus communis]
 gb|EEF44565.1| C, putative [Ricinus communis]
Length=154

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (50%), Gaps = 19/139 (14%)
 Frame = +3

Query  165  VVILLMMLTTPINGD----RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMID  332
            + ILL+  ++   G        V K+C  T NY  C+  +++DPR P+AD  TLA I + 
Sbjct  12   IFILLLSTSSFTTGSDPAANALVDKVCNQTSNYTFCVGSLYSDPRTPDADRYTLAYISVG  71

Query  333  TVKAKSKVTDKLIKRLLKS----HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
                K+  T   +  LLK+    HPD +  L++CA +Y+  +  +L+ VA + +      
Sbjct  72   LAYGKATATRDNVAELLKNIDPGHPDYRHSLQRCAGNYDKAV--SLLVVAQNDL------  123

Query  501  FAEEAMTKLPF--TTIGCE  551
               E+ ++LP     + CE
Sbjct  124  -NSESFSELPVLARNVSCE  141



>gb|KDP27948.1| hypothetical protein JCGZ_19028 [Jatropha curcas]
Length=176

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 82/164 (50%), Gaps = 6/164 (4%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            +I   ILL   + P       + +ICK T  Y+LC+  +  +P++P +D +T+A  + + 
Sbjct  11   MILFYILLFSTSLPETQCSDLINQICKKTPFYDLCVSSL--NPQSPVSDVKTVASTLANL  68

Query  336  VKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAE  509
            + + +  T   I+ L+K  + P L+ PL  CA  Y  V+   L + A D +  G   F  
Sbjct  69   ILSNATDTLSYIQGLIKEGADPQLQKPLANCAELYIPVVRYNLPQ-AIDALTRGRFGFTS  127

Query  510  EAMTKLPFTTIGCENHFAG-HKSPLTHLNKLVGELADVTRDVIR  638
              ++        CE  F+G ++SPL+  NKLV  L DV   +++
Sbjct  128  YLLSDAGKQADDCEKSFSGSNQSPLSFRNKLVSNLCDVAVAILK  171



>ref|XP_008345204.1| PREDICTED: uncharacterized protein LOC103408118 [Malus domestica]
Length=316

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 3/144 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   + + C  T   +LC+  + +DPR+ +AD + L IIM+D VKAK++  D L++ L+ 
Sbjct  2    DANLIAQTCNQTPYPDLCVSTLQSDPRSAKADVKGLGIIMVDAVKAKAREADLLVEELVD  61

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
                  V    C ++Y   I +  I  A +    GD K AE AMT +      CE  F+G
Sbjct  62   KELG-NVAASNCRFNYS-DIFQLDIPQAVEAFPKGDYKSAELAMTNVVANADSCERGFSG  119

Query  567  HKSPLTHLNKLVGELADVTRDVIR  638
              SP    ++ V ++A V   + +
Sbjct  120  -GSPFKEQSQAVHDVAYVAAAIAK  142



>ref|XP_008223407.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Prunus 
mume]
Length=205

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 78/154 (51%), Gaps = 5/154 (3%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P++     + K CK T +Y+LC+  + ++P++   D   LA I+ D + AK+  T   I 
Sbjct  51   PLDEGGDLIVKTCKKTPHYDLCVSTLQSNPQSSNTDVPGLAHIISDFLLAKATDTLDYIH  110

Query  375  RLLKSHP--DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             LLK  P  +L+  L  CA  Y + ++K  +  A D +  G   FA   ++        C
Sbjct  111  GLLKQSPEAELQKALANCAELY-IPVVKFSLPQAIDALTNGHFGFANYGISDAAKEADAC  169

Query  549  ENHFAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
            E  F+G  +SPLT  NKLV  L+ V   +I NLL
Sbjct  170  EKEFSGSTESPLTDRNKLVDNLSGVAVAII-NLL  202



>ref|XP_010052514.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
 gb|KCW76579.1| hypothetical protein EUGRSUZ_D00968 [Eucalyptus grandis]
Length=178

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 73/166 (44%), Gaps = 18/166 (11%)
 Frame = +3

Query  153  NLICVVILLMMLTTP---INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAII  323
            NL  VV+L  +          D   V K+CK T +Y+ C + + +DPR P AD  TLA +
Sbjct  12   NLAFVVLLASIAAQSPRIAAADSGLVDKVCKQTPDYKFCSDALNSDPRTPGADQITLARV  71

Query  324  MIDTVKAKSKVTDKLIKRLLK-SHPDLKVPLEQCAWDYEVVI------LKTLIKVAYDGV  482
                  +K+  T   I  LL  S   +   LEQC  DY   +      L  L    Y G+
Sbjct  72   AFSLANSKASSTQGEITSLLSNSTGPVHQHLEQCQGDYATAVAKIQEALTNLDSETYAGL  131

Query  483  ILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADV  620
                    +   TK       CE+ F G +SPLT  NK++  L+++
Sbjct  132  --------DVLATKAGDAADDCESAFKGTESPLTESNKVLKGLSEI  169



>ref|XP_003550936.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Glycine max]
Length=184

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 77/147 (52%), Gaps = 4/147 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V +ICK T  Y+LC   + ++P AP++D + +A+IM++ +   +  T   I+ L+K   
Sbjct  37   LVDQICKKTPFYDLCSSILHSNPLAPKSDPKGMALIMVNGILTNATDTLSYIEELIKQTS  96

Query  396  D--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
            D  L+  L  CA  Y + ++K ++  A D +  G   FA   +         C+  F+G 
Sbjct  97   DEQLEQQLAFCAESY-IPVVKYILPQAADAINQGRFGFASYCIVDAQKEVNACDKKFSGS  155

Query  570  -KSPLTHLNKLVGELADVTRDVIRNLL  647
             ++PL+  N ++ +L DV   +I+ LL
Sbjct  156  TQAPLSDRNDIMQKLVDVAAAIIKLLL  182



>gb|ADZ54775.1| invertase inhibitor 2 [Solanum tuberosum]
Length=153

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 5/104 (5%)
 Frame = +3

Query  219  VKKICKTTENYELCMEYVWADPRAPEADT----RTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            +   C+ T  Y LC   + +DPR+ E +      TL +IM+D VK+KS    + IK L K
Sbjct  30   IHSTCRETPYYSLCPTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEK  89

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAM  518
            S+P+ + PL QC   Y  V L+  + VA + +  G PKFAE+ M
Sbjct  90   SNPEWQAPLSQCYVAYNAV-LRADVTVAVEALKKGVPKFAEDGM  132



>ref|XP_008340697.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=136

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 56/109 (51%), Gaps = 3/109 (3%)
 Frame = +3

Query  312  LAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
            L  I +D  KAK+  T   I  LLK  P  +  L+ CA  Y  +++   I  A  G  LG
Sbjct  4    LGFITVDMAKAKATDTANRINELLKQSPSDQT-LKSCATFYHTILVAD-IPEASQGFKLG  61

Query  492  DPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIR  638
            +PKFAE+ M         CE  F+G KSPLT  NK+  +L+ +T  + R
Sbjct  62   NPKFAEQGMNDAAGAAEACEKEFSG-KSPLTDKNKVFHDLSSITATIAR  109



>ref|XP_004517182.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=176

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 12/172 (7%)
 Frame = +3

Query  159  ICVVILLMMLT------TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAI  320
            ICV  L + +        P N D   V ++C+ T NY LC+  + ++P+A   DT+ +A+
Sbjct  6    ICVSFLFLNILHVSCSLVPQNND--LVDQVCRKTPNYNLCISTLQSNPQAHNTDTKGIAL  63

Query  321  IMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGD  494
            IM++ +      T K  + L+K   D  L+  L+ CA  Y + ++K ++  A D V    
Sbjct  64   IMVNDIVLNVNDTLKFTEGLIKKSTDVGLQKKLDFCAETY-IPLVKYVLPQAGDAVNQSR  122

Query  495  PKFAEEAMTKLPFTTIGCENHF-AGHKSPLTHLNKLVGELADVTRDVIRNLL  647
             K+A  +++        C N F A   SPL+  N  + +L D+   +++ LL
Sbjct  123  FKYASYSISYAGKEIGSCNNKFSASTTSPLSDRNGTIQKLFDIASAILKLLL  174



>gb|KHN03271.1| hypothetical protein glysoja_004297 [Glycine soja]
Length=184

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 77/147 (52%), Gaps = 4/147 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V +ICK T  Y+LC   + ++P AP++D + +A+IM++ +   +  T   I+ L+K   
Sbjct  37   LVDQICKKTPFYDLCSSILHSNPLAPKSDPKGMALIMVNGILTNATDTLSYIEELIKQTS  96

Query  396  D--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
            D  L+  L  CA  Y + ++K ++  A D +  G   FA   +         C+  F+G 
Sbjct  97   DEQLEQQLAFCAESY-IPVVKYILPQAADAINQGRFGFASYCIVDAQKEVNACDKKFSGS  155

Query  570  -KSPLTHLNKLVGELADVTRDVIRNLL  647
             ++PL+  N ++ +L DV   +++ LL
Sbjct  156  TQAPLSDRNDIMQKLVDVAAAIVKLLL  182



>ref|XP_009372099.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Pyrus 
x bretschneideri]
Length=184

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P++     ++  CK T +Y LC+  + ++P +  AD   LA I  D + A +  T   I 
Sbjct  32   PLDKGSNLIQTTCKKTPHYNLCLSTLQSNPDSSNADVPRLARIASDALLANASDTLDYIH  91

Query  375  RLLKSHPDLKV--PLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             LLK   ++++   L  CA  Y + I+K  +  A + +  G   FA+  ++        C
Sbjct  92   GLLKQSREVQLQKALANCAELY-IPIVKFSLPQAIEALGNGHFGFAKYGISDAATEAEAC  150

Query  549  ENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            E  F G KSPLT  N LV +L+ V   ++ NLL
Sbjct  151  EKGFGGVKSPLTDRNALVNDLSGVAVAIL-NLL  182



>ref|XP_004514989.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
 ref|XP_004514990.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=173

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 83/169 (49%), Gaps = 12/169 (7%)
 Frame = +3

Query  159  ICVVILLMMLT------TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAI  320
            ICV  L + +        P N D   V ++C+ T NY LC+  + ++P+A   DT+ +A+
Sbjct  6    ICVSFLFLNILHVSCSLVPQNND--LVDQVCRKTPNYNLCISTLQSNPQAHNTDTKGIAL  63

Query  321  IMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGD  494
            IM++ +      T K  + L+K   D  L+  L+ CA  Y + ++K ++  A D V    
Sbjct  64   IMVNDIVLNVNDTLKFTEGLIKKSTDVGLQKKLDFCAETY-IPLVKYVLPQAGDAVNQSR  122

Query  495  PKFAEEAMTKLPFTTIGCENHF-AGHKSPLTHLNKLVGELADVTRDVIR  638
             K+A  +++        C N F A   SPL+  N  + +L D+   +++
Sbjct  123  FKYASYSISYAGKEIGSCNNKFSASTTSPLSDRNGTIQKLFDIASAILK  171



>ref|XP_008370564.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
 ref|XP_008367867.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 3/136 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   + + C  T   +LC+  + +DPR+ +AD + L IIMID V+AK++  ++ ++ L+ 
Sbjct  2    DANLIAQTCNQTPCPDLCVSTLQSDPRSTKADVKGLGIIMIDAVRAKARDANRQLEELIN  61

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
                  VP  +C ++Y   I +  I  A +     D K AE AMT +      CE  F+G
Sbjct  62   RDVG-NVPAGKCRFNYS-DIFQLDIPQAIEAFPKDDYKSAELAMTNVVANADSCERGFSG  119

Query  567  HKSPLTHLNKLVGELA  614
              SP    ++ + ++A
Sbjct  120  G-SPFKDESQALHDVA  134



>ref|XP_003546307.1| PREDICTED: uncharacterized protein LOC100791177 [Glycine max]
 gb|KHN24851.1| Pectinesterase inhibitor [Glycine soja]
Length=188

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 80/152 (53%), Gaps = 4/152 (3%)
 Frame = +3

Query  201  NGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRL  380
            +G+   V +ICK T  Y+LC   + ++P +P+ D + +A++M++ + A +  T   I+ L
Sbjct  36   DGNGDLVDQICKKTPFYDLCSSILHSNPPSPKPDLKGVALLMVNNILANATDTLSYIEGL  95

Query  381  LKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCEN  554
            +K   D  L+  L  CA  Y + I+K ++  A D +  G   FA   ++        C+ 
Sbjct  96   IKQTSDRELEQALAFCAELY-IPIVKYILPQAADAISQGRFGFASYCISDALKEVSSCDK  154

Query  555  HFAG-HKSPLTHLNKLVGELADVTRDVIRNLL  647
             F+G  ++PL   N +V +L +V   +++ LL
Sbjct  155  KFSGAAQAPLGDRNDIVQKLVNVAAAIVKLLL  186



>gb|AFK48253.1| unknown [Lotus japonicus]
Length=132

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 4/100 (4%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKS-KVTDKLIKRLLK-  386
              +++ CK T +++LC+ Y+ +DP++ + D   LA+IMI+T+K ++    DK+   LL+ 
Sbjct  33   NLIEETCKQTPHHDLCIHYLKSDPQSSKKDVTGLALIMINTMKTQANNALDKIHHLLLQG  92

Query  387  -SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKF  503
             S P LK  L +CA  Y  ++ +  +  A  G+  GDPKF
Sbjct  93   SSEPALKQALNECAGRYRAIV-EADVAQANAGLQKGDPKF  131



>ref|XP_008367865.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 3/136 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   + + C  T   +LC+  + +DPR+ +AD + L IIM+D VKAK+      ++ L+ 
Sbjct  2    DANLIAQTCNQTPYPDLCVSTLQSDPRSAKADVKGLGIIMVDAVKAKAHEASLQVEELVD  61

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
              P   V L+ C ++Y+  I +  I  A +     D K AE  MT +      CE  F+G
Sbjct  62   KDPG-NVALQDCRFNYD-DIFQLDIPQAVEAFDKDDYKSAELGMTNVVANEDSCERRFSG  119

Query  567  HKSPLTHLNKLVGELA  614
              SP    ++ + ++A
Sbjct  120  -GSPFKDESQALHDVA  134



>ref|XP_006419339.1| hypothetical protein CICLE_v10006511mg [Citrus clementina]
 gb|ESR32579.1| hypothetical protein CICLE_v10006511mg [Citrus clementina]
Length=176

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 70/143 (49%), Gaps = 3/143 (2%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK--  386
            + +++ CK T+ Y LC+  + +DPR+  AD + LAII+++ ++A +  T   +  L K  
Sbjct  31   RLIQETCKHTDYYNLCVASLESDPRSLNADVKELAIILVELLQANANETLWHVGDLFKKV  90

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
            S P L      C  +Y  ++ +  I  A D +  GD   +++           CE  FAG
Sbjct  91   SDPALYRFYGTCIEEYRAIVERQ-IPEAIDALQSGDYMVSKKDAEAAAAHADSCEEQFAG  149

Query  567  HKSPLTHLNKLVGELADVTRDVI  635
               P +  NK V  L+ VT  ++
Sbjct  150  ETQPFSDQNKAVHGLSLVTSSIL  172



>emb|CDO98740.1| unnamed protein product [Coffea canephora]
Length=178

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 72/145 (50%), Gaps = 3/145 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + C  T N  LC++ +  D R+ +AD   LA++ ++ V+ K+  T + IK L +S+ 
Sbjct  29   LISETCDQTPNDRLCVKILRKDNRSLDADVAGLALVAVEAVRDKANSTLQSIKELKRSNL  88

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG-HK  572
             L   L +C  +Y V++   + K    G +  +P+ AE  M        GCE       +
Sbjct  89   TLANALMECQENYYVILRIDVPKAV--GSMRENPRLAEHGMADAVIEAQGCEASLNKLEQ  146

Query  573  SPLTHLNKLVGELADVTRDVIRNLL  647
            SPL  +N  V +L+ V   +IR LL
Sbjct  147  SPLADVNAAVYDLSVVALSIIRILL  171



>ref|XP_007035856.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY06782.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=181

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 79/151 (52%), Gaps = 6/151 (4%)
 Frame = +3

Query  204  GDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL  383
            GD   V +ICK T  Y+LC+  + ++ +  E+D + LA ++ D + A +  T   I+  +
Sbjct  32   GD--LVDQICKQTPFYDLCISTLRSNSKGTESDVKGLASVVADILLANATDTLNYIRAQI  89

Query  384  K--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENH  557
               S P+++  L  CA  Y + ++K  +  A + +  G  +FA + ++        CE  
Sbjct  90   NQASDPEMERALAYCAELY-IPVVKYNLPQAIEALSKGQFEFASDGLSDAAKEADACEKK  148

Query  558  FAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
            F+G   SPL+  NKL+  L+DV   +++ LL
Sbjct  149  FSGSMASPLSDRNKLLHSLSDVAVAIVKILL  179



>ref|XP_004508127.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=173

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 82/169 (49%), Gaps = 12/169 (7%)
 Frame = +3

Query  159  ICVVILLMMLT------TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAI  320
            ICV  L + L        P N D   V ++CK T  Y+LC+  + ++P+A   DT+ +A+
Sbjct  6    ICVSFLFINLLHVSCSLVPQNND--LVDQVCKKTPYYDLCISTLQSNPQAKNTDTKGIAL  63

Query  321  IMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGD  494
            IM+  + +    T    + L+K   D  LK  L+ CA  Y + ++K ++  A D V    
Sbjct  64   IMVKDIVSNLNDTLNFTQGLIKKTSDVGLKKNLDFCAETY-IPLVKYVLPQAADAVNQSR  122

Query  495  PKFAEEAMTKLPFTTIGCENHFAGH-KSPLTHLNKLVGELADVTRDVIR  638
             ++A  ++         C N F+G   SPL+  N  + +L D+   +++
Sbjct  123  FEYANYSINDAGKEIGSCNNKFSGSTTSPLSDRNVTIQKLFDIASAILK  171



>gb|ABI17897.1| invertase inhibitor [Coffea canephora]
Length=178

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 72/145 (50%), Gaps = 3/145 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + + C  T N  LC++ +  D R+ +AD   LA++ ++ V+ K+  T + IK L +S+ 
Sbjct  29   LISETCDQTPNDRLCVKILRKDNRSLDADVAGLALVAVEAVRDKANSTLQSIKELKRSNL  88

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG-HK  572
             L   L +C  +Y V++   + K    G +  +P+ AE  M        GCE       +
Sbjct  89   TLANALMECQENYYVILRIDVPKAV--GSMRENPRLAEHGMADAVIEAQGCEASLNKLEQ  146

Query  573  SPLTHLNKLVGELADVTRDVIRNLL  647
            SPL  +N  V +L+ V   +IR +L
Sbjct  147  SPLADVNAAVYDLSVVALSIIRIML  171



>ref|XP_011019524.1| PREDICTED: uncharacterized protein LOC105122226 [Populus euphratica]
Length=175

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 75/151 (50%), Gaps = 7/151 (5%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P+      V KICK T  Y+LC+  +   P +   D ++LA  M + V +    T   I+
Sbjct  23   PLTQCGDLVDKICKKTPFYDLCV--LSLQPNS-GTDVKSLASKMANLVLSNVTDTLNFIQ  79

Query  375  RLLKSH--PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             L+K      L+ PL +CA  Y + ++K  +  A D +I G   FA    + +      C
Sbjct  80   GLVKQETGTSLERPLAECAELY-IPVVKYNLPQAIDALIRGRYGFANYVFSDVSKQADAC  138

Query  549  ENHFAG-HKSPLTHLNKLVGELADVTRDVIR  638
            E HF+G ++SPLT  NKL+  L+DV   +I 
Sbjct  139  EKHFSGENESPLTERNKLISNLSDVAVAIIN  169



>gb|KDP29028.1| hypothetical protein JCGZ_16417 [Jatropha curcas]
Length=173

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 68/136 (50%), Gaps = 4/136 (3%)
 Frame = +3

Query  192  TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLI  371
            +P +   K V K+CK T NY  C+E +++D RA +AD  TLA I +      +  T  LI
Sbjct  19   SPSDAATKLVDKVCKQTWNYSFCVESLYSDSRAGQADEYTLAFISVGLAYTNATDTRDLI  78

Query  372  KRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE  551
             +LL +    + PLE C  DY+  +  + ++VAY+ +            T+   +   CE
Sbjct  79   SKLLINKGKSE-PLETCFRDYKKAV--SSLEVAYNDLNSETFFVIANLTTQAARSANHCE  135

Query  552  NHFAGHK-SPLTHLNK  596
              F G++  PL + NK
Sbjct  136  TAFKGNEWRPLGNRNK  151



>gb|AFK46429.1| unknown [Medicago truncatula]
Length=192

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 84/176 (48%), Gaps = 5/176 (3%)
 Frame = +3

Query  168  VILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAK  347
            +ILL  +    +     + +ICK T  Y+LC   + ++P AP+ D + +A++M++ +   
Sbjct  15   IILLASIPFTSSQSNDLIDQICKKTPFYDLCSSILNSNPLAPKTDFKGVALVMVNNILTN  74

Query  348  SKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMT  521
            +  T   I+ L+K   D  ++  L  CA  Y  V+  TL + A D +      FA   ++
Sbjct  75   ASDTLNYIESLIKKTTDREMEKALAFCAESYIPVVKYTLPQAA-DAINQNRFGFASYCIS  133

Query  522  KLPFTTIGCENHFAG-HKSPLTHLNKLVGELADVTRDVIRNLL*LARQTYKLNITT  686
                    C   F+G   SPL   N +V +L DV   +I+ LL      Y LN+T+
Sbjct  134  DAVKEVNSCNKKFSGVGMSPLGDRNGIVQKLVDVASAIIKQLL-KGLICYLLNLTS  188



>ref|XP_003594702.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|ABN09094.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES64953.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=178

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 78/163 (48%), Gaps = 4/163 (2%)
 Frame = +3

Query  168  VILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAK  347
            +ILL  +    +     + +ICK T  Y+LC   + ++P AP+ D + +A++M++ +   
Sbjct  15   IILLASIPFTSSQSNDLIDQICKKTPFYDLCSSILNSNPLAPKTDLKGVALVMVNNILTN  74

Query  348  SKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMT  521
            +  T   I+ L+K   D  ++  L  CA  Y  V+  TL + A D +      FA   ++
Sbjct  75   ASDTLNYIESLIKKTTDREMEKALAFCAESYIPVVKYTLPQAA-DAINQNRFGFASYCIS  133

Query  522  KLPFTTIGCENHFAG-HKSPLTHLNKLVGELADVTRDVIRNLL  647
                    C   F+G   SPL   N +V +L DV   +I+ LL
Sbjct  134  DAVKEVNSCNKKFSGVGMSPLGDRNGIVQKLVDVASAIIKQLL  176



>gb|AFK35451.1| unknown [Lotus japonicus]
Length=188

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 73/147 (50%), Gaps = 4/147 (3%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V +ICK T  Y+LC   + ++P  P+ D + +A+IM++ + A +  T   I+ L+K   
Sbjct  41   LVDQICKKTPFYDLCSTILHSNPLTPKTDPKGMALIMVNNILANATDTLNYIEMLIKQTS  100

Query  396  D--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
            D  L+  L  CA  Y + ++K ++  A D +  G   FA   +         C   F+G 
Sbjct  101  DQQLEQQLAFCAESY-IPVVKYILPQAADAINQGRFGFANYCIFDAEKELDACNKKFSGS  159

Query  570  -KSPLTHLNKLVGELADVTRDVIRNLL  647
             KSPL     +V +L DV   +++ L+
Sbjct  160  AKSPLGDRTSIVQQLVDVAEAIVKLLI  186



>ref|XP_002525233.1| Pectinesterase inhibitor, putative [Ricinus communis]
 gb|EEF37199.1| Pectinesterase inhibitor, putative [Ricinus communis]
Length=175

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (49%), Gaps = 7/125 (6%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSH  392
            K V K+C+ T +Y  C+  +++D R P+AD  TLA I +    A +  T   I  LLK+H
Sbjct  28   KLVDKVCQQTSSYSFCVNSLYSDSRTPDADEYTLAFISVGLAYANATSTRDHISELLKNH  87

Query  393  PD-LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA--MTKLPFTTIGCENHFA  563
             D  + PL++C  +Y   I  +L+ +A +   L    F E A    +       C+  F 
Sbjct  88   HDHYQQPLQRCVRNYNKAI--SLLAMADND--LNSETFFELADLANQASRAATDCDAAFK  143

Query  564  GHKSP  578
            G  SP
Sbjct  144  GIPSP  148



>ref|XP_008390454.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=149

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 67/136 (49%), Gaps = 3/136 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAK-SKVTDKLIKRL  380
            D   V + CK T N++LC   + +DPR+  A D + LA IM+D V+AK +K  DK+   L
Sbjct  2    DAALVDQTCKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKINDLL  61

Query  381  LKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHF  560
             KS    +     C  +Y  +I    I  A +     D   AE+ +  + F    C+  F
Sbjct  62   NKSPVKNQALFTSCIDNYNTII-DDDIPQASEAFSNDDNITAEDRLKDITFEVDLCDKQF  120

Query  561  AGHKSPLTHLNKLVGE  608
            +G  +PL  +NK V +
Sbjct  121  SGLSNPLKDVNKDVHD  136



>ref|XP_004508124.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cicer arietinum]
Length=176

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 82/172 (48%), Gaps = 12/172 (7%)
 Frame = +3

Query  159  ICVVILLMMLT------TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAI  320
            ICV  L + +        P N D   V ++CK T  Y+LC+  + ++P+A   DT+ +A 
Sbjct  6    ICVSFLFLNILHVSCSLVPQNND--LVDQVCKKTPYYDLCISTLQSNPQAKNTDTKGIAF  63

Query  321  IMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGD  494
            IM++ + +    T   I+ L+K+  D  L+  L+ C   Y + ++KT++  A D V    
Sbjct  64   IMVNDIVSNVSGTVNFIEGLMKNTKDKVLEQNLQYCDERY-IPLVKTILPHAADAVNKNR  122

Query  495  PKFAEEAMTKLPFTTIGCENHFAGHKS-PLTHLNKLVGELADVTRDVIRNLL  647
             +FA   M         C   F    S PL+  N ++ ++ DV   ++  LL
Sbjct  123  FQFANYTMIFALSEIDDCNKKFTNSTSLPLSDRNSIIQKMLDVASAILTLLL  174



>ref|XP_008351148.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
 ref|XP_008351149.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=149

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 67/136 (49%), Gaps = 3/136 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAK-SKVTDKLIKRL  380
            D   V + CK T N++LC   + +DPR+  A D + LA IM+D V+AK +K  DK+   L
Sbjct  2    DAALVDQTCKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKINDLL  61

Query  381  LKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHF  560
             KS    +     C  +Y  +I    I  A +     D   AE+ +  + F    C+  F
Sbjct  62   NKSPVKNQALFTSCIDNYNTII-DDDIPQASEAFSNDDNITAEDRLKDVTFEVDLCDKQF  120

Query  561  AGHKSPLTHLNKLVGE  608
            +G  +PL  +NK V +
Sbjct  121  SGLSNPLKDVNKDVHD  136



>ref|XP_004501778.1| PREDICTED: pectinesterase inhibitor-like [Cicer arietinum]
Length=184

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 9/169 (5%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT  335
            ++C  +++       + D   ++K C  T+N+ LC++Y+ A+P++  AD   L +IM D 
Sbjct  14   ILCTTLVVTQSRIMTSNDANLIEKTCNKTQNHTLCLQYLNANPKSSTADEYGLGLIMFDV  73

Query  336  VKAKSKVTDKLIKRLLKS----HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKF  503
            ++ ++  T K I  L+ +     P   + L+ C +D    +L+  +  A   ++  D   
Sbjct  74   IRLRALSTIKKIHELIAAGKFKKPRQPMALKSC-YDKYKTLLEIDVGNANYYLLSRDAIS  132

Query  504  AEEAMTKLPFTTIGCENHFAGH----KSPLTHLNKLVGELADVTRDVIR  638
            AE     +      CEN F G     K  LT  N L+ + A +  D+IR
Sbjct  133  AEYNAMDIIAKANTCENDFFGRFPYGKELLTDDNNLMIDAATIAYDIIR  181



>ref|XP_006379439.1| hypothetical protein POPTR_0008s01400g [Populus trichocarpa]
 gb|ABK93085.1| unknown [Populus trichocarpa]
 gb|ERP57236.1| hypothetical protein POPTR_0008s01400g [Populus trichocarpa]
Length=184

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 71/150 (47%), Gaps = 15/150 (10%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDR--KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMI  329
            L  +V  +++  +P   D+  + V K+C  T NY LC+E +++D R P+AD+ TLA I  
Sbjct  14   LAFLVCFILVHASPAAADKPTELVDKVCNQTSNYTLCVEALYSDSRTPDADSYTLAFISF  73

Query  330  DTVKAKS-KVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGV----IL  488
                  +  + D  I  LLK  S  D    LE C+ DY   + K  ++ AY+ +      
Sbjct  74   GLAYTNANNIRDYYIAELLKNTSSQDYHYRLETCSHDYLRAVSK--LEEAYNDLNSETFF  131

Query  489  GDPKFAEEAMTKLPFTTIGCENHFAGHKSP  578
            G  + A  A       +  C++ F G  SP
Sbjct  132  GLAELAGIASE----ASDHCQDAFKGISSP  157



>ref|XP_008390456.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=149

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 66/136 (49%), Gaps = 3/136 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAK-SKVTDKLIKRL  380
            D   V + CK T N++LC   + +DPR+  A D + LA IM+D V+AK +K  DK+   L
Sbjct  2    DAALVDQTCKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKINDLL  61

Query  381  LKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHF  560
             KS    +     C  +Y  +I    I  A +     D   AE+ +    F    C+  F
Sbjct  62   NKSPVKNQALFTSCIDNYNTII-DDDIPQASEAFSNDDNITAEDRLKDXTFEVDLCDKQF  120

Query  561  AGHKSPLTHLNKLVGE  608
            +G  +PL  +NK V +
Sbjct  121  SGLSNPLKDVNKDVHD  136



>ref|XP_004486535.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=180

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 79/168 (47%), Gaps = 11/168 (7%)
 Frame = +3

Query  174  LLMMLTTPING-----DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTV  338
            +L++++ P        +   + +ICK T  Y+LC   + ++P  P+ D +++A++M++ +
Sbjct  12   ILLLISIPFTSSQTDENNNLIDQICKKTPFYDLCTSILNSNPLTPKTDLKSVALVMVNNI  71

Query  339  KAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEE  512
               +  T   I+ L+K   D  ++  L  CA  Y  V+  TL + A D +      FA  
Sbjct  72   LTNASDTLNYIEGLIKKTSDREMEQALAFCAESYIPVVKYTLPQAA-DAITQNRFGFASY  130

Query  513  AMTKLPFTTIGCENHFAGHK---SPLTHLNKLVGELADVTRDVIRNLL  647
             ++        C   F G     SPL   N +V +L DV   +I+ LL
Sbjct  131  CVSDAVKEVNSCNKKFLGSVTLLSPLGDRNGIVQKLVDVASAIIKQLL  178



>ref|XP_008223467.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=173

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 63/136 (46%), Gaps = 11/136 (8%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPING---------DRKFVKKICKTTENYELCMEYVWADPRAPEA  299
            M+NLI + ++ ++  + +           D   + K CK T NY++C+  + +DPR+  A
Sbjct  1    MKNLISLALIFLIQVSLLPASQCRVYLPMDASLIDKTCKQTPNYDVCVSTINSDPRSTGA  60

Query  300  DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDG  479
            D + L +IM+D VK K+         LLK  P  +  L  C   Y  V L+  +      
Sbjct  61   DVKGLGLIMVDAVKDKATGALNKANELLKQSPGDQA-LLSCVKIYNEV-LQNDVPQGSQA  118

Query  480  VILGDPKFAEEAMTKL  527
               GD K AE+ M  +
Sbjct  119  FTQGDSKSAEQGMNDI  134



>ref|XP_010685378.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Beta vulgaris subsp. vulgaris]
Length=184

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (51%), Gaps = 6/148 (4%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAKSKVTDKLIKRLL-KS  389
             V   CK T +  LC   + +D R+ +A D+  L +IMID VK +   + + ++ L  K+
Sbjct  37   LVTTTCKQTPDPILCEASLRSDSRSSKAADSEGLILIMIDVVKTRFSDSFRYVEDLTRKT  96

Query  390  H-PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
            H PD+   L++C   Y VV L   + +A   V  GDPKF E+AM        GC   F  
Sbjct  97   HDPDVIRALQECKQLYRVV-LDVSVGLAVRAVKQGDPKFGEQAMVDAGNEAEGCRMAFPE  155

Query  567  HKSP--LTHLNKLVGELADVTRDVIRNL  644
             K P  +    +++  +++V   +I++L
Sbjct  156  GKVPGRIVGRTRMLHGVSNVAASMIKSL  183



>ref|XP_004296231.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=174

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (49%), Gaps = 3/146 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             + K CK T  Y+LC+  + + P++  +D   LA IM D V + +  T   I  LLK  P
Sbjct  29   LLSKTCKKTPYYDLCLSSLQSSPQSSNSDIAGLAHIMADLVLSNATDTLDYIHSLLKQSP  88

Query  396  --DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
              DL+ PL  CA  Y + ++K  +  + D +  G   FA   ++        CE  F+G 
Sbjct  89   EADLQKPLANCAELY-IPVVKYTLPQSIDALSNGHYGFANYGISDAAKEAQACEKGFSGS  147

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
              PLT  N LV  L++V   +I  +L
Sbjct  148  TKPLTDRNTLVSCLSEVAVAIINLVL  173



>ref|XP_011032948.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Populus euphratica]
Length=184

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 68/150 (45%), Gaps = 15/150 (10%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDR--KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMI  329
            L  +V  + +  +P   D+  + V ++C  T NY  C+E +++D R P+AD+ TLA I  
Sbjct  14   LTFLVCFIFIHASPAAADKPTELVDQVCNQTSNYTFCVEALYSDSRTPDADSYTLAFISF  73

Query  330  DTVKAKS-KVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGV----IL  488
                  +   TD  I  L K  S  D    LE C+ DY   + K  ++ AY+ +      
Sbjct  74   GLAYTNANNTTDYYIAELFKNTSSQDYHYRLETCSHDYLRAVSK--LEEAYNDLNSETFF  131

Query  489  GDPKFAEEAMTKLPFTTIGCENHFAGHKSP  578
            G  + A  A       +  C++ F G  SP
Sbjct  132  GLAELAGIASNA----SDHCQDTFKGISSP  157



>ref|XP_002525501.1| C, putative [Ricinus communis]
 gb|EEF36859.1| C, putative [Ricinus communis]
Length=181

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 75/151 (50%), Gaps = 10/151 (7%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLL----  383
             ++K C+ T  Y+LC+  + ++P + +AD   LA IM+ T+ AK+  T   I  LL    
Sbjct  27   LIEKTCRKTPYYQLCISTLVSNPHSFDADIEGLAKIMVHTIDAKATHTLNRINELLEQSQ  86

Query  384  ---KSHPDL-KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE  551
               +SH    +  L  CA  Y   ILK  +  A   +  G+ + A+E         I CE
Sbjct  87   RGSRSHDQKEQQELRDCADRYN-EILKGDVPQAMQALHKGNFRSAKERTFDAAAEAISCE  145

Query  552  NHFAGHKSPLTHLNKLVGELADVTRDVIRNL  644
              F+G +SPL+ +N  V +++ V   +++ +
Sbjct  146  EEFSG-QSPLSDMNMKVHDISVVAASILKQI  175



>ref|XP_007208900.1| hypothetical protein PRUPE_ppa026908mg [Prunus persica]
 gb|EMJ10099.1| hypothetical protein PRUPE_ppa026908mg [Prunus persica]
Length=173

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 61/136 (45%), Gaps = 11/136 (8%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPING---------DRKFVKKICKTTENYELCMEYVWADPRAPEA  299
            M NLI +  + ++  + +           D   + K CK T NY++C+  + +DPR+  A
Sbjct  1    MNNLISLAFIFLIQVSLLPASQCRVYLPMDASLIDKTCKQTPNYDVCVSTLNSDPRSTGA  60

Query  300  DTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDG  479
            D + L +IM+D VK K+         LLK  P  +  L  C   Y  V L+  +      
Sbjct  61   DVKGLGLIMVDAVKDKATGALNKADELLKQSPGDQA-LLSCVKTYNEV-LQNDVPQGSQA  118

Query  480  VILGDPKFAEEAMTKL  527
               GD K AE+ M  +
Sbjct  119  FTQGDSKSAEQGMNDI  134



>ref|NP_188339.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 gb|AEE75909.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=112

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 51/96 (53%), Gaps = 8/96 (8%)
 Frame = +3

Query  369  IKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL---GDPKFAEEAMTKLPFTT  539
            I    K+ P LK PL++C+  Y     KT++ V     I+   G+PKFAE A+       
Sbjct  22   INEAYKTKPMLKKPLDECSMRY-----KTIVDVDVHTAIISIKGNPKFAEGAVVDAGVEA  76

Query  540  IGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
              CE  F   +SPLT L + + ++ DVTR +IR LL
Sbjct  77   SICEGGFTKGQSPLTSLTQRMEKICDVTRAIIRMLL  112



>gb|AFK44617.1| unknown [Lotus japonicus]
Length=184

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 87/167 (52%), Gaps = 7/167 (4%)
 Frame = +3

Query  165  VVILLMMLTTPINGDRK--FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTV  338
            +++LL  +  P++  +    + +ICK T  Y+LC+  + + P +P+ D + LA++M++ +
Sbjct  16   IILLLASIHFPLSQSQSSDLIDQICKKTPFYDLCISTLHSSPLSPKTDLKGLALLMVNQI  75

Query  339  KAKSKVTDKLIKRLLKS--HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEE  512
             A +  T   I+ ++++   P+++  L  CA  Y + ++K ++  A D +      FA  
Sbjct  76   VANASDTLSYIEGMIENTKDPNMEQALAFCAELY-IPVVKYILPQAADAISHNRFVFASY  134

Query  513  AMTKLPFTTIGCENHF--AGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            ++++       C+  F     +SPL     +V +L +V   +I+ LL
Sbjct  135  SVSEAMNELFSCDKKFLSGSAQSPLGDRTSIVQKLVEVGEAIIKLLL  181



>ref|XP_008368766.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 68/146 (47%), Gaps = 3/146 (2%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   + + C  T   +LC+  + +DPR+ +AD + L IIM+D V+AK++  +  ++ L+ 
Sbjct  2    DANLIAQTCNQTPYPDLCVSTLQSDPRSAKADVKGLGIIMVDAVRAKAREANLQVEELID  61

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAG  566
              P    P   C  +Y   I    I  A +     D K  E AM  +      CE  F+G
Sbjct  62   REPG-NTPATNCRLNYS-DIFHLHIPDAVEAFPKDDYKSXELAMXNVVTNADSCERGFSG  119

Query  567  HKSPLTHLNKLVGELADVTRDVIRNL  644
              SP    ++ + ++A V   + + L
Sbjct  120  -GSPFKDESQALHDVAYVAAAIAKVL  144



>dbj|BAA94992.1| invertase inhibitor-like protein [Arabidopsis thaliana]
Length=177

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 82/177 (46%), Gaps = 13/177 (7%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPING-------DRKFVKKICKTTENYELCMEYVWADPRAPEADT  305
            M  L  + ++ M +   ++        + K ++++CK   N  LC+  +  DPR+  ++ 
Sbjct  1    MMKLFSIFVVFMQIQVALSSQPIRYATEPKPIQELCKFNINPSLCVSTLNLDPRSKNSNL  60

Query  306  RTLAIIMIDTVKAK-SKVTDKLI--KRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYD  476
            R LA I ID    K +K+ + LI   + +K   DLK   + C  DY     +  +  A D
Sbjct  61   RELAWISIDATSNKVNKMLNYLISVSKNIKDREDLK-KYKTCIDDYGTAA-RRFLPAALD  118

Query  477  GVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
             +  G    A+  M  +      CE  F G  SPLT  NK   ++A++T D+IR L 
Sbjct  119  DLKAGFFSLAKSDMESVVSIPDHCEAQFGG-SSPLTGRNKATHDIANMTADIIRYLF  174



>ref|NP_188340.3| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAF00369.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75910.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=184

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 82/177 (46%), Gaps = 13/177 (7%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPING-------DRKFVKKICKTTENYELCMEYVWADPRAPEADT  305
            M  L  + ++ M +   ++        + K ++++CK   N  LC+  +  DPR+  ++ 
Sbjct  8    MMKLFSIFVVFMQIQVALSSQPIRYATEPKPIQELCKFNINPSLCVSTLNLDPRSKNSNL  67

Query  306  RTLAIIMIDTVKAK-SKVTDKLI--KRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYD  476
            R LA I ID    K +K+ + LI   + +K   DLK   + C  DY     +  +  A D
Sbjct  68   RELAWISIDATSNKVNKMLNYLISVSKNIKDREDLK-KYKTCIDDYGTAA-RRFLPAALD  125

Query  477  GVILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
             +  G    A+  M  +      CE  F G  SPLT  NK   ++A++T D+IR L 
Sbjct  126  DLKAGFFSLAKSDMESVVSIPDHCEAQFGG-SSPLTGRNKATHDIANMTADIIRYLF  181



>ref|XP_011095862.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Sesamum indicum]
Length=182

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 77/167 (46%), Gaps = 17/167 (10%)
 Frame = +3

Query  156  LICVVILLMMLTTP------INGDR-KFVKKICKTTENYELCMEYVWADPRAPEADTRTL  314
            LI   +L   LT+P         DR +   ++CK T N+  C + +++DPRAP+AD   L
Sbjct  10   LITFSVLSCFLTSPPPLVSATAADRTELATQVCKNTTNFAFCHDAIYSDPRAPDADRYVL  69

Query  315  AIIMIDTVKAKSKVTDKLIKRLLKS---HPDLKVPLEQCAWDYE--VVILKTLIKVAYDG  479
            + I      + +  T   I   +KS    P+  + L++C   YE  V +L  ++      
Sbjct  70   SYIAFGKAYSNATDTKDYIASKIKSGGGKPETLLGLKKCLGYYEEAVRVLAEMLGNLDSE  129

Query  480  VILGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADV  620
               G  K + EA    P     CE  F G +SP+T  N  + ELA++
Sbjct  130  TFSGLDKLSVEA-EGYP---RACEKRFGG-RSPITTRNDNLIELANI  171



>ref|XP_004508126.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=176

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 4/146 (3%)
 Frame = +3

Query  219  VKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            V ++CK T  Y+LC   + ++P+A   DT+ +A+IM+  + +    T    + L+K+  D
Sbjct  30   VDQVCKKTPYYDLCNSTLQSNPQAKNTDTKGIALIMVKDIVSNVNDTLNFTEGLIKNTSD  89

Query  399  --LKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH-  569
              L+  L+ CA  Y + ++K+++  A D V     K+A  ++         C N F+G  
Sbjct  90   VGLEKKLDFCAETY-IPLVKSVLPQAVDAVNQSRFKYANYSIFYAGKEIGYCNNKFSGST  148

Query  570  KSPLTHLNKLVGELADVTRDVIRNLL  647
             SPL+  N  + +L D+   ++  LL
Sbjct  149  TSPLSDRNVTIQKLFDIASAILNLLL  174



>ref|XP_006488812.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Citrus sinensis]
Length=176

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 68/142 (48%), Gaps = 3/142 (2%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK--S  389
             +++ CK T+ Y LC+  + +DPR+  AD + LAII+++ ++A +  T   +  L K  S
Sbjct  32   LIQETCKHTDYYNLCVASLESDPRSLNADVKELAIILVELLQANANETLWHVGDLFKKVS  91

Query  390  HPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGH  569
             P L         +Y  ++ +  I  A D +  GD   +++           CE  FAG 
Sbjct  92   DPALYRFYGTRIEEYRAIVERQ-IPEAIDALQSGDYMVSKKDAEAAAAHADSCEEQFAGE  150

Query  570  KSPLTHLNKLVGELADVTRDVI  635
              P +  NK V  L+ VT  ++
Sbjct  151  TQPFSDQNKAVHGLSLVTSSIL  172



>ref|XP_007048339.1| Cell wall / vacuolar inhibitor of fructosidase 2 [Theobroma cacao]
 gb|EOX92496.1| Cell wall / vacuolar inhibitor of fructosidase 2 [Theobroma cacao]
Length=237

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = +3

Query  108  NPSPQNISF*KEKMRNLICVVILL-MMLTTPINGDRKFVKKICKTTENYELCMEYVWADP  284
            +P  +N      KM +   + IL+ + LT  +NGD   ++K CKTT+ Y+LC+  + +DP
Sbjct  50   SPPQENFILTLSKMGSSFFISILVSLALTISVNGDADLIRKTCKTTKYYDLCVSSLKSDP  109

Query  285  RAPEADTRTLAIIMIDTVKAKSKVTDKLI-KRLLKSHPD--LKVPLEQCAWDY  434
             +  +DT+ LA I++    A +  T   +  +LL +  D  LK  L++C+  Y
Sbjct  110  TSLNSDTKGLATILVGVGMANATATSTFLSSQLLSTTNDTILKKVLKECSDKY  162



>ref|XP_002311377.2| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
 gb|EEE88744.2| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
Length=174

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 72/151 (48%), Gaps = 7/151 (5%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P+      V +ICK T  Y+LC+  +   P +   D +TLA  M + V +    T   I+
Sbjct  22   PLTQCGDLVGQICKKTPFYDLCV--LSLQPNS-GTDVKTLASKMANLVLSNVTDTLNFIQ  78

Query  375  RLLKSH--PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             L+K      L+ PL  CA  Y + ++K  +  A D +I G   FA    + +      C
Sbjct  79   GLVKQETGTSLERPLADCAELY-IPVVKYNLPQAIDALIRGRYGFANYVFSDVSKQADAC  137

Query  549  ENHFAGH-KSPLTHLNKLVGELADVTRDVIR  638
            E +F+G  +SPLT  NKL+  L DV   +I 
Sbjct  138  EKNFSGEDESPLTDRNKLISNLCDVAVAIIN  168



>gb|AGX27452.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27453.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27454.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27455.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27456.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27457.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27458.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27459.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27460.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27461.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27462.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27463.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27464.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27465.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27466.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27467.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27468.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27469.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27470.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27471.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
Length=175

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 72/151 (48%), Gaps = 7/151 (5%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIK  374
            P+      V +ICK T  Y+LC+  +   P +   D +TLA  M + V +    T   I+
Sbjct  23   PLTQCGDLVGQICKKTPFYDLCV--LSLQPNS-GTDVKTLASKMANLVLSNVTDTLSFIQ  79

Query  375  RLLKSH--PDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC  548
             L+K      L+ PL  CA  Y + ++K  +  A D +I G   FA    + +      C
Sbjct  80   GLVKQETGTSLERPLADCAELY-IPVVKYNLPQAIDSLIRGRYGFANYVFSDVSKQADAC  138

Query  549  ENHFAGH-KSPLTHLNKLVGELADVTRDVIR  638
            E +F+G  +SPLT  NKL+  L DV   +I 
Sbjct  139  EKNFSGEDESPLTDRNKLISNLCDVAVAIIN  169



>ref|XP_009372129.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Pyrus x bretschneideri]
Length=177

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 67/139 (48%), Gaps = 4/139 (3%)
 Frame = +3

Query  195  PINGDRKFVKKICKTTENYELCMEYVWADPRAPEA-DTRTLAIIMIDTVKAKSKVTDKLI  371
            P+N     V +  K T N++LC   + +DPR+  A D + LA IM+D V+AK+  +   I
Sbjct  29   PMNA--ALVDQTYKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKI  86

Query  372  KRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE  551
              LLKS  +       C  +Y  +I    I  A +     D   AE+ +  + F    C+
Sbjct  87   NGLLKSPGENLALFTSCIDNYNTII-DDDIPQASEAFSNDDNITAEDRLKDVTFEVDLCD  145

Query  552  NHFAGHKSPLTHLNKLVGE  608
              F+G  +PL  +NK V +
Sbjct  146  KQFSGPSNPLKDVNKDVHD  164



>ref|XP_004296225.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 60/135 (44%), Gaps = 7/135 (5%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             +   CK T    LC+  + ADPR+   D    A IM+  V+ K+    + I RL K+  
Sbjct  31   LIDDTCKGTPKPVLCVSVLRADPRSEGGDVNDFAFIMVGEVEVKASDAMQQIGRLSKTK-  89

Query  396  DLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFAGHKS  575
                P+  C  +Y VV+++  I  A D    GD   A + M  +      CE  F G +S
Sbjct  90   ----PVSDCRENY-VVVVRDDIPQAEDAAKGGDAGKATQLMNDVVGKADSCERGFHG-RS  143

Query  576  PLTHLNKLVGELADV  620
             LT  N  V + A V
Sbjct  144  LLTKWNNAVKDFASV  158



>ref|XP_007221576.1| hypothetical protein PRUPE_ppa1027160mg [Prunus persica]
 gb|EMJ22775.1| hypothetical protein PRUPE_ppa1027160mg [Prunus persica]
Length=174

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 77/172 (45%), Gaps = 11/172 (6%)
 Frame = +3

Query  147  MRNL---ICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
            MR+L   I  + L ++  +  +     V++ C  T NY+LC+  + +DPR+  AD + LA
Sbjct  1    MRSLKWIIACLTLFVLSQSRGSVSTDLVEETCHKTTNYDLCVSSLKSDPRSSTADVKGLA  60

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
             I +D     S  T   I RL     D  ++  L  C  +Y++ + K  I  A   VIL 
Sbjct  61   RIALDQTLTNSVDTQARIARLFNETSDEYIRKGLGTCKDEYDLGVGK--ITEATKNVILS  118

Query  492  DPKFAEEAMTKLPFTTIGCENHFAG----HKSPLTHLNKLVGELADVTRDVI  635
                A   +  +      CE  F+      +SPLT  N ++   A  T ++I
Sbjct  119  RFVDARNDVADVADEVNTCEESFSRGGRWRQSPLTDRNNVIVRFAKFTGEII  170



>ref|XP_004293424.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Fragaria vesca subsp. vesca]
Length=224

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 75/173 (43%), Gaps = 16/173 (9%)
 Frame = +3

Query  162  CVVILLMMLTTPINGDR-----KFVKKIC-KTTENYELCMEYVWADPRAPEADTRTLAII  323
            C   L + + +P    +     K V  +C KT  +Y  C+E +++DPR P AD+  LA I
Sbjct  52   CFFFLFVAIPSPCAATKPLKPTKLVDAVCRKTNSSYSFCVESLYSDPRTPTADSYVLAYI  111

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQ---CAWDYEVVILKTLIKVAYDGVILGD  494
                    +  T   + RLL +       L+Q   C  DY   +  + +++AY+   L  
Sbjct  112  SFGLAYLNASATQHHVARLLNNKTQGGHQLQQLGTCHRDYNKAV--SALQLAYND--LNS  167

Query  495  PKFAEEA--MTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
              F E A            C+  F    SPLT++N+ + +L  +   V+ NL 
Sbjct  168  ETFFELADLAGVASLAAEDCQAAFNTTFSPLTNMNRDLKDLCKICV-VVSNLF  219



>ref|XP_009376582.1| PREDICTED: uncharacterized protein LOC103965273 [Pyrus x bretschneideri]
 ref|XP_009376587.1| PREDICTED: uncharacterized protein LOC103965277 [Pyrus x bretschneideri]
Length=175

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +3

Query  192  TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRT-LAIIMIDTVKAKSKVTDKL  368
            +P N   + V  +C+ + N   CME + +DPR   A T   LA + +D     +K +   
Sbjct  25   SPANASAQLVDVVCQKSINNTQCMEVLHSDPRVKSASTYILLAQVALDLAIGNAKDSQAF  84

Query  369  IKRLLKSHPDLKVPLEQCAWDYEVVI  446
            I  LLKS P    P++QCA  YE+V+
Sbjct  85   INNLLKSDP--TEPIKQCASSYELVV  108



>ref|XP_008340695.1| PREDICTED: uncharacterized protein LOC103403627 [Malus domestica]
Length=236

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 64/149 (43%), Gaps = 35/149 (23%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   + + C+ T NY+LC+  + +DPR  +AD + L IIM+D VKA+   T  LI+ LLK
Sbjct  121  DANLIDQTCQQTPNYDLCVSSLQSDPRRADADVKGLGIIMVDVVKARVTETLNLIE-LLK  179

Query  387  SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA-  563
              P  +              L+ +I V                   +      CEN F  
Sbjct  180  KSPGAEA-------------LRQVINV-------------------VGVKADACENGFTG  207

Query  564  -GHKSPLTHLNKLVGELADVTRDVIRNLL  647
             G  SPL  +NK + +L   T  + R L 
Sbjct  208  GGGGSPLLDMNKAILDLVAATAGIARTLF  236



>ref|XP_008370626.1| PREDICTED: putative invertase inhibitor [Malus domestica]
 ref|XP_008381887.1| PREDICTED: putative invertase inhibitor [Malus domestica]
Length=175

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +3

Query  192  TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRT-LAIIMIDTVKAKSKVTDKL  368
            +P N   + V  +C+ + N   CME + +DPR   A T   LA + +D     +K +   
Sbjct  25   SPANASAQLVDGVCQKSINNTECMEVLHSDPRVKSASTYILLAQVALDLAIGNAKDSQAF  84

Query  369  IKRLLKSHPDLKVPLEQCAWDYEVVI  446
            I  LLKS P    P++QCA  YE+V+
Sbjct  85   INNLLKSDP--TEPIKQCASSYELVV  108



>ref|XP_007224999.1| hypothetical protein PRUPE_ppa020400mg, partial [Prunus persica]
 gb|EMJ26198.1| hypothetical protein PRUPE_ppa020400mg, partial [Prunus persica]
Length=140

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 65/143 (45%), Gaps = 15/143 (10%)
 Frame = +3

Query  147  MRNLICVVILLMMLTT-----------PINGDRKFVKKICKTTENYELCMEYVWADPRAP  293
            M+NLI + ++ ++  +           P++  R  + K  K T NY++C+  + +DPR+ 
Sbjct  1    MQNLISLALIFLIQVSLFAASQCRVYLPMDASR--IDKTRKQTPNYDVCVSSINSDPRST  58

Query  294  EADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAY  473
             AD + L +IM+D VK K+         LLK  P  +  L  C   Y  V L+  +    
Sbjct  59   GADVKGLGLIMVDAVKDKATGALNKADELLKQCPGDQALLS-CVKIYNEV-LQNDVPQGS  116

Query  474  DGVILGDPKFAEEAMTKLPFTTI  542
                 GD K AE+ M  +    I
Sbjct  117  QAFTQGDSKSAEQGMNDIATKQI  139



>ref|XP_008808258.1| PREDICTED: putative invertase inhibitor [Phoenix dactylifera]
Length=175

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 75/166 (45%), Gaps = 21/166 (13%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTE------NYELCMEYVWADPRAPEADTRTLA  317
            L+C +++L   ++ ++     V++ CKT        NY  C+  + ADP++  ADT+ LA
Sbjct  7    LLCFLLILNQSSSLVSAS---VQQTCKTVAERSPNINYNFCVASLSADPKSGSADTQGLA  63

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
            +I     KAK+  T   I  LLK   D   K  L  C+  Y       L+    D V   
Sbjct  64   VIATKLAKAKATTTQSTISNLLKKTRDKATKECLSDCSTMYS-----DLVDTLKDTVRAI  118

Query  492  DPKFAEEAMTKLPFT-TIG--CENHFA--GHKSPLTHLNKLVGELA  614
              K   +A T L     +G  CE+ FA    KSPLT  N    EL+
Sbjct  119  TSKRYSDAKTYLSAALDVGDDCEHEFAELKVKSPLTKENNDSRELS  164



>ref|XP_010649385.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Vitis 
vinifera]
 emb|CAN65563.1| hypothetical protein VITISV_007190 [Vitis vinifera]
Length=182

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKS-KVTDKLIK  374
            ++GD   ++K C++T+ Y+LC+  + +DP +P ADT+ LA+IM+   +A +  ++  L  
Sbjct  26   VSGDYDLIQKTCRSTKYYDLCISSLKSDPNSPNADTKGLAMIMVGIGEANATAISSYLSS  85

Query  375  RLLKSHPD--LKVPLEQCAWDYEV------VILKTLIKVAYD  476
            +L+ S  D  +K  L++C   Y          L+ L   AYD
Sbjct  86   QLVGSANDSSMKKILKECVNRYNYSSDALQASLQALTMEAYD  127



>ref|XP_002885188.1| hypothetical protein ARALYDRAFT_318477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61447.1| hypothetical protein ARALYDRAFT_318477 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = +3

Query  369  IKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL---GDPKFAEEAMTKLPFTT  539
            I    K+ P LK PL++C+  Y     KT++ V     I+   G+PKFAE A+       
Sbjct  22   INEAYKTKPMLKKPLDECSLRY-----KTIVDVDVHTAIIAVKGNPKFAEGAIVDAGVEA  76

Query  540  IGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
              CE  F   +S LT L + + ++ DVTR ++R LL
Sbjct  77   SICEGGFTKGQSTLTSLTQRMEKICDVTRAIVRILL  112



>ref|XP_004508123.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=186

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 76/150 (51%), Gaps = 4/150 (3%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            D   V +ICK T  Y+LC   + ++P  P++D + +A+IM++ + A +  T   I+ L+K
Sbjct  36   DNDLVDQICKKTPFYDLCSSILNSNPLTPKSDPKGIALIMVNDILANATDTLDYIEELIK  95

Query  387  --SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGC-ENH  557
              +  DL+  L  CA  Y + ++K ++  A D +      FA  ++         C +  
Sbjct  96   ETTDKDLEQELAFCAESY-IPVVKYILPQAADAINQSKFGFASYSIVDAEKEIDACSKKF  154

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
             +   SPL + N ++ +L DV   +++ LL
Sbjct  155  SSSTSSPLGNRNNIMQKLVDVAAAIVKLLL  184



>emb|CDM80068.1| unnamed protein product [Triticum aestivum]
 emb|CDM80108.1| unnamed protein product [Triticum aestivum]
Length=180

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 25/177 (14%)
 Frame = +3

Query  165  VVILLMMLTTPI---NGDRKFVKKICKTTENYELCMEYVWADPRAPEADTR-TLAIIMI-  329
            V I+L +++  I   + D  FV + CK T+N  LCM  +  DP++  A T   LA I + 
Sbjct  11   VFIILGIMSFGISVADADASFVARTCKKTKNASLCMSVLHIDPKSTYASTELELANIALK  70

Query  330  ---DTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVI--LKTLIKVAYDGVILGD  494
               DT    +KV D L K+  K  P+  V L  C W Y+     L+  ++    G   GD
Sbjct  71   IAGDTANHNAKVIDDLAKK-KKGTPEGGV-LNVCLWAYQFAGNDLEVNVRTLLHG---GD  125

Query  495  PKFAEEAMTKLPFTTIG----CENHFAG--HKSPLTHLNKLVGELADVTRDVIRNLL  647
               A    +KL   T G    CEN F G   KSP+T++++ + E   V  ++I  L+
Sbjct  126  YITA----SKLVLDTKGVGDHCENAFKGMEKKSPVTNIDREMTERCGVAAELIALLI  178



>ref|XP_010024810.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
 gb|KCW61320.1| hypothetical protein EUGRSUZ_H04067 [Eucalyptus grandis]
Length=179

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 71/149 (48%), Gaps = 9/149 (6%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKS--  389
             +KK CK T   +LC+  + +      A    LA +M+    A +  T   ++ L+    
Sbjct  33   LIKKTCKKTPYPDLCISSLRSHHIRSGATVHDLASMMLKLTLANATDTLSYMEALINQAE  92

Query  390  HPDLKVPLEQCAWDYEVVILKTLIK--VAYDGVILGDPKFAEEAMTKLPFTTIGCENHFA  563
             P L+ PL+ CA  Y  V+  TL +  VA++    G   FAE  ++        CEN F+
Sbjct  93   DPQLERPLDYCAELYIPVVKYTLPQAIVAFNKTQYG---FAEYGVSDAGDQADTCENDFS  149

Query  564  GHK--SPLTHLNKLVGELADVTRDVIRNL  644
              K  SPL + NKLV EL DV   +I+ L
Sbjct  150  KSKVSSPLGNRNKLVSELCDVAVAIIKML  178



>ref|XP_010487591.1| PREDICTED: pectinesterase inhibitor-like [Camelina sativa]
Length=178

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 74/147 (50%), Gaps = 12/147 (8%)
 Frame = +3

Query  222  KKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDL  401
            +++CK T    LC+  +  DPR+  +D +  A I +D    K K   + +  +L+    L
Sbjct  35   QQLCKKTRYQALCISTLNLDPRSRTSDVQEFAWIAVDATTKKVKEMQQYLISVLR-KISL  93

Query  402  KVPLEQ---CAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG---CENHFA  563
            +   E+   C  +Y   I + L  V  D   L   K++ EAM+++         CE+ FA
Sbjct  94   REDFERYGTCIEEYGAAIDRFLPAVVAD---LKAKKYS-EAMSEMNEVVSKPGYCEDQFA  149

Query  564  GHKSPLTHLNKLVGELADVTRDVIRNL  644
              KSPLT  NK V ++AD+T D+I+ +
Sbjct  150  -RKSPLTGRNKAVHDIADMTTDIIKAI  175



>ref|XP_004502921.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cicer arietinum]
Length=182

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 3/87 (3%)
 Frame = +3

Query  186  LTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDK  365
            L T +NGD   +K  CK T+ Y LC   + +DP +P ADT+ LA+IM+      +  T  
Sbjct  21   LCTFVNGDATLIKNTCKNTKYYNLCFSSLKSDPSSPNADTKGLALIMVGIGMTNATSTSS  80

Query  366  LIKRLL---KSHPDLKVPLEQCAWDYE  437
             +   L    ++  LK  L++C   Y 
Sbjct  81   YLSSKLLTPTNNTTLKRVLKECEDKYN  107



>ref|XP_006419341.1| hypothetical protein CICLE_v10006032mg [Citrus clementina]
 ref|XP_006488814.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Citrus sinensis]
 gb|ESR32581.1| hypothetical protein CICLE_v10006032mg [Citrus clementina]
Length=176

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 70/153 (46%), Gaps = 5/153 (3%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKR  377
            I  D   + +IC+ T   +LC+  +  +  +  +D + LA IM + V   +  T   I+ 
Sbjct  21   IQCDDNLINQICRRTPFRDLCIATLEPNTNSSSSDVKGLASIMANIVLGNASDTLNYIEG  80

Query  378  LLKSHPDLKV--PLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE  551
            L+K  PD +    L  CA  Y + +++  +  A D +  G   FA   +         CE
Sbjct  81   LIKQAPDPQQERALANCAELY-IPVVRYELPQAIDALSKGHFGFANYCIADAGKQADACE  139

Query  552  NHFAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
              F+G  KSPL+  N L+  L  +   +I NLL
Sbjct  140  KGFSGSAKSPLSDRNNLLKSLCGIAVAII-NLL  171



>ref|XP_004300864.1| PREDICTED: uncharacterized protein LOC101308973 [Fragaria vesca 
subsp. vesca]
Length=106

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 4/109 (4%)
 Frame = +3

Query  324  MIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKF  503
            M+D VKAK+      I  LLK  P  +  L  C   Y VV L   + VA + +  G+ +F
Sbjct  1    MVDVVKAKAIECANRIDHLLKHRPGDQ-ALRNCKRIYSVV-LTADVTVAVEALTKGNLQF  58

Query  504  AEEAMTKLP-FTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
            AE++M  +  F  + CE+ F G  SP+T LN    +L  V   ++R LL
Sbjct  59   AEQSMDDIAMFEAVLCEDGFIG-ASPMTDLNNASQKLGAVAAAIVRLLL  106



>ref|NP_001078166.1| putative pectinesterase inhibitor [Arabidopsis thaliana]
 dbj|BAA94993.1| invertase inhibitor-like protein [Arabidopsis thaliana]
 gb|AEE75911.1| putative pectinesterase inhibitor [Arabidopsis thaliana]
Length=175

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 75/149 (50%), Gaps = 12/149 (8%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             V+++CK      LC+  +  DPR+  ++ + LA I +D    K  VT      +LK+  
Sbjct  33   LVQRLCKRNRYQALCISTLNVDPRSKTSNLQGLASISLDATTKKFNVTLTYYISVLKNVR  92

Query  396  DLKVPLEQ---CAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG---CENH  557
              +V  E+   C  +Y   + + L  V  D   L   K+  EAM+++         CE+ 
Sbjct  93   G-RVDFERYGTCIEEYGAAVDRFLPAVKAD---LKAKKY-PEAMSEMKDVVAKPGYCEDQ  147

Query  558  FAGHKSPLTHLNKLVGELADVTRDVIRNL  644
            FAG +SP+T  NK V ++AD+T D+I+ L
Sbjct  148  FAG-ESPVTARNKAVHDIADMTADIIKTL  175



>ref|XP_010649645.1| PREDICTED: pectinesterase inhibitor [Vitis vinifera]
Length=177

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 72/157 (46%), Gaps = 7/157 (4%)
 Frame = +3

Query  156  LICVVILLMMLTTP---INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            +I VV+LL+ L++    +   +  V+KIC  TE+   C   + +DPR   A+   LA I 
Sbjct  9    IISVVVLLVDLSSARLNVKVAKDVVEKICAKTEDPSYCSHAIESDPRTGAANLTGLAEIC  68

Query  327  IDTVKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
            ID     +K  + L+  L+K  S P LK     C+ ++ V  ++ L + + D        
Sbjct  69   IDLAGDGAKKAEALVAGLIKNASDPQLKDKYTACSQNF-VAAIEDLGEASEDLRAGNSSG  127

Query  501  FAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGEL  611
             AE  +  L F    C + F       + L  LVG+L
Sbjct  128  VAESGLDGL-FEAQNCRDEFEAPPKDPSDLLGLVGKL  163



>emb|CAN67807.1| hypothetical protein VITISV_037797 [Vitis vinifera]
Length=209

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 72/157 (46%), Gaps = 7/157 (4%)
 Frame = +3

Query  156  LICVVILLMMLTTP---INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            +I VV+LL+ L++    +   +  V+KIC  TE+   C   + +DPR   A+   LA I 
Sbjct  9    IISVVVLLVDLSSARLNVKVAKDVVEKICAKTEDPSYCSHAIESDPRTGAANLTGLAEIC  68

Query  327  IDTVKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPK  500
            ID     +K  + L+  L+K  S P LK     C+ ++ V  ++ L + + D        
Sbjct  69   IDLAGDGAKKAEALVAGLIKNASDPQLKDKYTACSQNF-VAAIEDLGEASEDLRAGNSSG  127

Query  501  FAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGEL  611
             AE  +  L F    C + F       + L  LVG+L
Sbjct  128  VAESGLDGL-FEAQNCRDEFEAPPKDPSDLLGLVGKL  163



>ref|XP_010940964.1| PREDICTED: putative invertase inhibitor [Elaeis guineensis]
Length=170

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 81/173 (47%), Gaps = 11/173 (6%)
 Frame = +3

Query  147  MR-NLIC-VVILLMMLTTPINGD---RKFVKKICKTTENYELCMEYVWADPRAPEADTRT  311
            MR +++C ++I  ++L T ++      K   KI K    Y+ C++ + ADP++  A+ R 
Sbjct  1    MRPSMLCSLLIFFLVLQTSLSASPIIEKACGKIAKGYVGYKFCVQALEADPKSGSANIRG  60

Query  312  LAIIMIDTVKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVI  485
            LA I +    A +  T   I+ LLK  S P +K  L+ C++ Y     K  +K +   + 
Sbjct  61   LASISVKLSIANATSTVSKIRELLKKASDPTIKNSLQACSYLYTNA--KASLKWSEHFIA  118

Query  486  LGDPKFAEEAMTKLPFTTIGCENHFAGHKSPLTHLNKLVGELADVTRDVIRNL  644
              +   A+  +    F    CE  F    SPLT  N   G+L  +   +I +L
Sbjct  119  SKNFTAAKAEIHAAVFVGTFCEEAFTA--SPLTKENDNFGKLTLLATAIINSL  169



>ref|XP_002883047.1| enzyme inhibitor/ pectinesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59306.1| enzyme inhibitor/ pectinesterase [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 82/175 (47%), Gaps = 16/175 (9%)
 Frame = +3

Query  153  NLICVVILLMMLTTPING------DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTL  314
            NL  V ++ + +   ++           V+++CK      LC+  +  DPR+  ++ + L
Sbjct  6    NLFAVFVMFIQIQIALSQAIQSPPGSNLVQQLCKRNRYQALCISTLNLDPRSKTSNLQGL  65

Query  315  AIIMIDTVKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
            A I +D    K  VT   +  +LK  +  +       C  +Y   + + L  V  D   L
Sbjct  66   ASISLDATTKKFNVTLTYLISVLKNVTRREEFETYGTCIEEYGAAVDRFLPAVVAD---L  122

Query  489  GDPKFAEEAMTKLPFTTIG---CENHFAGHKSPLTHLNKLVGELADVTRDVIRNL  644
               K++ EAM+++         CE+ FAG +SPLT  NK V ++AD+T  +I+ L
Sbjct  123  KAKKYS-EAMSEMKDVVAKPGYCEDQFAG-QSPLTARNKAVHDIADMTAGIIKTL  175



>ref|XP_006449974.1| hypothetical protein CICLE_v10017450mg [Citrus clementina]
 gb|ESR63214.1| hypothetical protein CICLE_v10017450mg [Citrus clementina]
Length=187

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 62/137 (45%), Gaps = 27/137 (20%)
 Frame = +3

Query  201  NGDRK---FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMI-----DTVKAKSKV  356
            +G+RK    V K+CK T NY+ C++ +++DPR P+AD  TLA +       + V+ + ++
Sbjct  31   DGNRKVTEIVDKVCKKTSNYKNCVDTLYSDPRTPDADRYTLAYVSFGLAYANAVQTRDRI  90

Query  357  TDKLI--KRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLP  530
             D+L+  K    S  ++   L  C  DY   +                 KF E A+  L 
Sbjct  91   ADELLLHKNDSDSRHEILQNLRICERDYNKAV-----------------KFLESALNDLN  133

Query  531  FTTIGCENHFAGHKSPL  581
              T      +A H + L
Sbjct  134  SETFFTLPSYANHTARL  150



>ref|XP_010660323.1| PREDICTED: pectinesterase inhibitor-like [Vitis vinifera]
Length=181

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +3

Query  174  LLMMLTTPINGD--RKFVK-------KICKTTENYELCMEYVWADPRAPEADTRTLAIIM  326
            +LM+    ING   R  VK       +IC TT++   C++ + +DPR   AD + LA I 
Sbjct  11   MLMVFLLLINGSFSRPSVKIANNELTEICSTTQDPSFCVQALKSDPRTANADLKGLAQIS  70

Query  327  IDTVKAKSKVTDKLIKRLLK--SHPDLKVPLEQCAWDYE  437
            ID  KA +  T  LI  L++  + P LK   E CA +Y+
Sbjct  71   IDLAKASATKTTTLITSLVEKANDPKLKGRYETCAENYD  109



>ref|XP_010906021.1| PREDICTED: putative invertase inhibitor [Elaeis guineensis]
Length=170

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTE-NYELCMEYVWADPRAPEADTRTLAIIMID  332
            L+C +++L   ++ +N     V + CK    NY+ C+  + ADP++  ADT+ LAII  +
Sbjct  7    LLCFLLILNQSSSLVNAS---VSETCKAIGFNYDFCVATLNADPKSASADTQGLAIIATN  63

Query  333  TVKAKSKVTDKLIKRLLKSHPDLKVP--LEQCAWDYEVVI  446
              KA +  T+  I  LLK   D K    L  C+  Y  +I
Sbjct  64   ISKANATSTESTISILLKKTKDNKTSECLNTCSSMYSDLI  103



>ref|XP_010444399.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Camelina sativa]
Length=181

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 3/79 (4%)
 Frame = +3

Query  219  VKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            ++  CKTT NY+ C+  + +DPR+P ADT+ LA IMI      +  T   I   L S  +
Sbjct  32   IESTCKTTNNYKFCVSALKSDPRSPTADTKGLAAIMIGVGMTNATSTATYIAGNLTSAAN  91

Query  399  ---LKVPLEQCAWDYEVVI  446
               LK  L+ C+  Y + +
Sbjct  92   DVVLKKVLQDCSEKYALAV  110



>ref|XP_010906022.1| PREDICTED: putative invertase inhibitor [Elaeis guineensis]
Length=175

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 68/160 (43%), Gaps = 14/160 (9%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTPINGDRKFVKKICKTTE------NYELCMEYVWADPRAPEADTR  308
            M   + ++  L+ L   ++     V + CKT        NY  C+  + ADPR+  ADT+
Sbjct  1    MTAFVALLCFLLTLNQSLSLVNASVMETCKTIAASNPNINYNFCIATLSADPRSALADTQ  60

Query  309  TLAIIMIDTVKAKSKVTDKLIKRLLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVIL  488
             LAII    +KA +  T+  I  LLK   D      QC  D    +   L+    D +  
Sbjct  61   GLAIIATKLIKANATSTELTISNLLKKTTD--NATSQCLSDCS-SMYSGLVDTLNDAISA  117

Query  489  GDPKFAEEAMTKLPFT---TIGCENHFA--GHKSPLTHLN  593
               K   +A + L      +I CE  FA    KSPLT  N
Sbjct  118  ITSKHYLDANSDLSAAIDVSITCETGFAELKVKSPLTKEN  157



>ref|XP_011040101.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Populus euphratica]
Length=186

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 64/151 (42%), Gaps = 22/151 (15%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK---  386
             V K+CK T +Y  C+  +++D R PEAD  TLA I +      +  T   I   L+   
Sbjct  34   LVDKVCKQTSSYPFCVRSLYSDSRTPEADEYTLAYISVGVAYNNATSTQHYISDQLRSIK  93

Query  387  ----SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEA--MTKLPFTTIGC  548
                SH D +  L+ C   Y+  +  + + +A++   L    F E A    K       C
Sbjct  94   VNGSSHHDQQQRLQMCGRGYQRAV--SALTMAHND--LDSETFFELARLAAKASSGANDC  149

Query  549  ENHFAGHKSP---------LTHLNKLVGELA  614
            +  F G  SP         L HL ++ G +A
Sbjct  150  KAAFKGIPSPTSLARGNQDLVHLCEICGVVA  180



>ref|XP_003602589.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES72840.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=178

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  168  VILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMI  329
            +IL +     +NGD   +K  CK T+ Y LC   + ++P +P ADT+ LA+IM+
Sbjct  11   LILFLAHYAFVNGDATLIKSTCKNTKYYNLCFSSLKSNPSSPNADTKGLAVIMV  64



>ref|XP_008224683.1| PREDICTED: pectinesterase inhibitor-like [Prunus mume]
Length=177

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 58/126 (46%), Gaps = 15/126 (12%)
 Frame = +3

Query  159  ICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTV  338
            +C+ + +   T+ I    K V ++C +T +Y LC+E ++ DPR P AD   LA I     
Sbjct  10   VCLALFIFCATSSIQP-TKLVDEVCHSTSSYSLCVESLYTDPRTPSADRYVLAYISFRLA  68

Query  339  KAKSKVTDKLIKRLLK---------SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
               +  T   I +LLK         + P  +V L +C  DY   +  + +  AY+   L 
Sbjct  69   FLNASSTQDHIAKLLKHTKAKAKANTGPTQQV-LRRCYHDYNKAV--SALSSAYND--LN  123

Query  492  DPKFAE  509
               F+E
Sbjct  124  SETFSE  129



>ref|XP_006373555.1| hypothetical protein POPTR_0016s00350g [Populus trichocarpa]
 gb|ERP51352.1| hypothetical protein POPTR_0016s00350g [Populus trichocarpa]
Length=186

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 7/84 (8%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKS--  389
             V K+CK T +Y  C+  +++D R PEAD  TLA I +      +  T   I   L+S  
Sbjct  34   LVDKVCKQTSSYPFCVRSLYSDSRTPEADEYTLAYISVGVAYNNATSTQHYISDQLRSIK  93

Query  390  -----HPDLKVPLEQCAWDYEVVI  446
                 H D +  L+ C+  Y+  +
Sbjct  94   VNGSTHHDQQQRLQMCSRGYQRAV  117



>ref|XP_002517248.1| Pectinesterase inhibitor, putative [Ricinus communis]
 gb|EEF45148.1| Pectinesterase inhibitor, putative [Ricinus communis]
Length=184

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDT-VKAKSKVTDKLIK  374
            +NGD   +++ CK T++Y+LC+  + ++  + +ADT+ LA+IM+   V   +  +  L  
Sbjct  28   VNGDMGLIQQTCKNTKHYDLCVSTLKSNATSSKADTKGLALIMVAAGVANATDTSSYLSS  87

Query  375  RLLKSHPD--LKVPLEQCAWDY  434
            +LL++  D  LK  L++CA  Y
Sbjct  88   QLLRATNDTILKKVLKECADKY  109



>ref|XP_004508256.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=175

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 81/172 (47%), Gaps = 7/172 (4%)
 Frame = +3

Query  150  RNLICVVILLMML---TTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAI  320
            R  IC+ IL++ +   +  +  D     ++C+ T +++LC+  + +DP A  AD + LA+
Sbjct  3    RIWICIFILILEIVDVSCAVKRDDSLKTRVCEQTSSFDLCISIIDSDPNATTADIKGLAL  62

Query  321  IMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILGD  494
            IM+  V    +    L   ++K+  D  LK  L  CA  + V +L +++  A   V    
Sbjct  63   IMVTAVPPYVQNALSLTNSVIKTTTDATLKKKLFVCAKSF-VPLLNSVLPQAAQAVNQKR  121

Query  495  PKFAEEAMTKLPFTTIGCENH-FAGHKSPLTHLNKLVGELADVTRDVIRNLL  647
             K A +++         C +  F   +SP+     L   + +V  D+++ +L
Sbjct  122  FKNASDSIFYADKVIEDCNSQFFTPTQSPIIEKTSLAHGVLNVAEDILKQIL  173



>ref|XP_008782576.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Phoenix dactylifera]
Length=185

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 68/152 (45%), Gaps = 21/152 (14%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             +++ CK T+ +ELC+  + +DP + +AD   L  I +      +  + K + R+     
Sbjct  36   LIQQACKATKYFELCVSTLSSDPDSYKADLYQLTNISLRNSLDYASASFKTVSRMFNDTG  95

Query  396  DLKVP--LEQCAWDYEVVI------LKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIGCE  551
            DL +   L +CA +YE  I      L++L    YD +       ++EA          CE
Sbjct  96   DLNLKKCLIRCAKNYESAIDVVRIALRSLASKKYDDLQTEVGTASDEAA--------ACE  147

Query  552  NHFAGH-----KSPLTHLNKLVGELADVTRDV  632
              F        KSPLT  N ++ EL  ++ D+
Sbjct  148  EAFNNSSPPKIKSPLTERNVIMSELCQISMDI  179



>ref|XP_010468224.1| PREDICTED: pectinesterase inhibitor-like [Camelina sativa]
Length=176

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 70/146 (48%), Gaps = 10/146 (7%)
 Frame = +3

Query  222  KKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDL  401
            +++CK T    LC+  +  DPR+  +  +  A I +D    K K   + +  +L+    L
Sbjct  33   QQLCKKTRYQALCISTLSLDPRSKTSSVQEFAGIAVDATTKKVKEMQQYLISVLR-KIRL  91

Query  402  KVPLEQ---CAWDYEVVILKTLIKVAYDGVILGDPKF--AEEAMTKLPFTTIGCENHFAG  566
            +   E+   C  +Y   I + L  V      L   K+  A   M ++      CE+ FAG
Sbjct  92   REDFERYGTCIEEYGAAIDRFLPAVV---AALKAKKYSVAMSQMNEVVSKPGYCEDQFAG  148

Query  567  HKSPLTHLNKLVGELADVTRDVIRNL  644
             KSPLT  NK V ++AD+T D+I+ +
Sbjct  149  -KSPLTGRNKAVHDIADMTTDIIKTI  173



>sp|P83326.2|PMEI_ACTDE RecName: Full=Pectinesterase inhibitor; AltName: Full=AdPMEI; 
Short=PMEI; AltName: Full=Pectin methylesterase inhibitor; 
Flags: Precursor [Actinidia deliciosa]
 dbj|BAC54964.1| pectinmethylesterase inhibitor [Actinidia deliciosa]
Length=185

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 70/156 (45%), Gaps = 10/156 (6%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKR  377
            +  +   + +IC  T N  LC++ + +DPR+   D + L    ID  +A +K T K+I  
Sbjct  30   VKAENHLISEICPKTRNPSLCLQALESDPRSASKDLKGLGQFSIDIAQASAKQTSKIIAS  89

Query  378  LLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG-C  548
            L    + P LK   E C+ +Y   I    +  A   +  GD   +        F   G C
Sbjct  90   LTNQATDPKLKGRYETCSENYADAI--DSLGQAKQFLTSGDYN-SLNIYASAAFDGAGTC  146

Query  549  ENHFAGHKSPLTHLNKL---VGELADVTRDVIRNLL  647
            E+ F G  +  T L++    + +L D+   VI NLL
Sbjct  147  EDSFEGPPNIPTQLHQADLKLEDLCDIVL-VISNLL  181



>ref|XP_010462937.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Camelina 
sativa]
Length=180

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = +3

Query  216  FVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHP  395
             ++  CKTT NY+ C+  + +DPR+P ADT+ LA IMI      +  T   I   L S  
Sbjct  30   IIESTCKTTNNYKFCVSALKSDPRSPTADTKGLAAIMIGVGMTNATSTATYIAGNLTSAA  89

Query  396  D---LKVPLEQCAWDYEVV  443
            +   LK  L+ C+  Y + 
Sbjct  90   NDVVLKKVLQDCSEKYALA  108



>gb|KHN09600.1| Pectinesterase inhibitor [Glycine soja]
Length=126

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 47/108 (44%), Gaps = 10/108 (9%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKR  377
            + GD   +K+ CK T+ Y LC   + +DP +P AD + LA+IMI      +  T   +  
Sbjct  23   VEGDSSLIKRTCKNTKYYNLCFSSLKSDPSSPNADPKGLAVIMIGIGMTNATSTSSYLSS  82

Query  378  LLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP--KFAEEA  515
                   L  P     W  + V+ +   K +Y G  L D     A EA
Sbjct  83   ------KLPTPSNNTTW--KRVLKECADKYSYAGDALQDSVQDLANEA  122



>pdb|1XG2|B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase 
And Its Inhibitor Protein
Length=153

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 69/153 (45%), Gaps = 10/153 (7%)
 Frame = +3

Query  207  DRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLK  386
            +   + +IC  T N  LC++ + +DPR+   D + L    ID  +A +K T K+I  L  
Sbjct  2    ENHLISEICPKTRNPSLCLQALESDPRSASKDLKGLGQFSIDIAQASAKQTSKIIASLTN  61

Query  387  --SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG-CENH  557
              + P LK   E C+ +Y   I    +  A   +  GD   +        F   G CE+ 
Sbjct  62   QATDPKLKGRYETCSENYADAI--DSLGQAKQFLTSGDYN-SLNIYASAAFDGAGTCEDS  118

Query  558  FAGHKSPLTHLNKL---VGELADVTRDVIRNLL  647
            F G  +  T L++    + +L D+   VI NLL
Sbjct  119  FEGPPNIPTQLHQADLKLEDLCDIVL-VISNLL  150



>gb|EMS54103.1| hypothetical protein TRIUR3_04186 [Triticum urartu]
Length=181

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 74/168 (44%), Gaps = 4/168 (2%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADT-RTLAIIMID  332
            LI VV +   L T   G   F+ + CK T N+ LCM  + A+P++ +A T   LA I + 
Sbjct  12   LIVVVAMSYGLLTTHAGGINFIARTCKKTNNFALCMAVLRANPKSAQASTEHDLASIALQ  71

Query  333  TVKAKSKVTDKLIKRLLKSHPDL-KVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAE  509
                 ++     I  L   H    + P+        V+    LI  A     +GD     
Sbjct  72   IATNTTRKNAAAICDLDYKHQGTPEAPVWHVCVKAHVLAAADLITGAGPSFHVGDYADVL  131

Query  510  EAMTKLPFTTIGCENHF-AGHK-SPLTHLNKLVGELADVTRDVIRNLL  647
            + +++       CEN F A HK SP+T +++   E   +  D+IR LL
Sbjct  132  KIVSEAKGAGDTCENAFKAIHKTSPVTDMDRQTTEHCGLAGDLIRPLL  179



>ref|XP_010505073.1| PREDICTED: pectinesterase inhibitor-like [Camelina sativa]
Length=175

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 69/143 (48%), Gaps = 9/143 (6%)
 Frame = +3

Query  222  KKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPDL  401
            +++CK T    LC+  +  DPR+  ++ +  A I +D    K K   + +  +L+    L
Sbjct  33   QQLCKKTHYQALCISTLNLDPRSKTSNVQEFAWIAVDATTKKVKEMQQYLISVLR-KISL  91

Query  402  KVPLEQ---CAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG-CENHFAGH  569
            +   E+   C  +Y   I + L  V      L    ++E        +  G CE+ FAG+
Sbjct  92   REDFERYGTCIEEYGAAIDRFLPAVV---AALKAKNYSEAIQMNEVVSKPGYCEDQFAGN  148

Query  570  KSPLTHLNKLVGELADVTRDVIR  638
             SPLT  NK V ++AD+T D+I+
Sbjct  149  -SPLTGRNKAVHDIADMTTDIIK  170



>ref|XP_008235482.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Prunus mume]
Length=181

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 10/106 (9%)
 Frame = +3

Query  147  MRNLICVVILLMMLTTP------INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTR  308
            M ++I  + LL +   P      +  D   ++K CK T+ Y LC+  + +DP +  ADT+
Sbjct  1    MGSIIFSLFLLSLAFPPQTHNFFVTADSNLIQKTCKNTKYYGLCVSTLKSDPTSKTADTK  60

Query  309  TLAIIMIDTVKAKSKVTDKLIKRLLKSH----PDLKVPLEQCAWDY  434
             LA+IM+    A +  T   +   L S      ++K  L++CA  Y
Sbjct  61   GLAVIMVGIGMANASATSSYLSSQLVSSKNNDTNMKKVLKECADKY  106



>ref|XP_010096509.1| Pectinesterase inhibitor [Morus notabilis]
 gb|EXB64629.1| Pectinesterase inhibitor [Morus notabilis]
Length=197

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (47%), Gaps = 5/90 (6%)
 Frame = +3

Query  213  KFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSH  392
            + V  +C  T NY  C+  ++ADPR P  D   LA +        +  T  LI +LLK  
Sbjct  48   ELVSDVCNRTSNYTFCVSALYADPRTPTTDAYGLAFVAFGMAYLNASATQDLITKLLKKS  107

Query  393  PDLKVP---LEQCAWDYEVVILKTLIKVAY  473
             +       LE C  DY+  I  + +++AY
Sbjct  108  ANETRQFRHLETCRLDYKKAI--SALEMAY  135



>ref|XP_010484247.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Camelina sativa]
Length=181

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = +3

Query  219  VKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKRLLKSHPD  398
            ++  CKTT NY+ C+  + +DPR+P ADT+ LA IMI      +  T   I   L S  +
Sbjct  32   IESTCKTTNNYKFCVSALKSDPRSPTADTKGLAAIMIGVGMTNATSTATYIAGNLTSAAN  91

Query  399  ---LKVPLEQCAWDYEV  440
               LK  L+ C+  Y +
Sbjct  92   DVVLKKVLKDCSEKYAL  108



>ref|XP_003589451.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92007.2| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=187

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 77/168 (46%), Gaps = 5/168 (3%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGD-RKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMID  332
            L C  + L    T +N +    V  ICK T N +LC   + ++P+A   D + +A IM++
Sbjct  19   LSCFFLKLTQSFTQMNVEVDDLVDDICKKTPNSDLCSSILHSNPQANTTDAKGIAAIMVN  78

Query  333  TVKAKSKVTDKLIKRLLKSHPDLKVP--LEQCAWDYEVVILKTLIKVAYDGVILGDPKFA  506
             +   +  T   I+ L+    D+++      CA  Y + ++KT++  A D +       A
Sbjct  79   DILENATNTLNYIQVLVNQTKDIELQRKFSICAETY-IPLVKTVLPQAIDSINQNKYGLA  137

Query  507  EEAMTKLPFTTIGCENHFAGH-KSPLTHLNKLVGELADVTRDVIRNLL  647
              +M  +      C   F+G   SPL     ++ +L D+   +++ L+
Sbjct  138  AYSMVYVGKEIDSCNKKFSGSTTSPLGDRTDILHKLLDIAAAILKQLI  185



>ref|XP_007137711.1| hypothetical protein PHAVU_009G149400g [Phaseolus vulgaris]
 gb|ESW09705.1| hypothetical protein PHAVU_009G149400g [Phaseolus vulgaris]
Length=178

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMI  329
            +NGD   +K+ CK T+ Y LC   + +DP +P AD + LA+IMI
Sbjct  22   VNGDATLIKRTCKNTKYYNLCFSSLKSDPSSPNADPKGLAVIMI  65



>ref|NP_001235392.1| uncharacterized protein LOC100306461 precursor [Glycine max]
 gb|ACU14652.1| unknown [Glycine max]
 gb|KHN31137.1| Pectinesterase inhibitor [Glycine soja]
Length=179

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (57%), Gaps = 5/60 (8%)
 Frame = +3

Query  165  VVILLMMLT-----TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMI  329
            + I L+ L      T + GD   +K+ CK T+ Y LC   + +DP +P AD + LA+IMI
Sbjct  7    IFIFLLFLAHLHQHTFVKGDSSLIKRTCKNTKYYNLCFSSLKSDPSSPNADPKGLAVIMI  66



>ref|XP_007206622.1| hypothetical protein PRUPE_ppa021753mg [Prunus persica]
 gb|EMJ07821.1| hypothetical protein PRUPE_ppa021753mg [Prunus persica]
Length=181

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 11/103 (11%)
 Frame = +3

Query  159  ICVVILLMMLTTP-------INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLA  317
            I   + L+ L  P       +  D   ++K CK T+ Y LC+  + +DP +  ADT+ LA
Sbjct  4    IIFSLFLLSLAFPHQTHNFFVTADSNLIQKTCKNTKYYGLCVSTLKSDPTSKTADTKGLA  63

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSH----PDLKVPLEQCAWDY  434
            +IM+    A +  T   +   L S      ++K  L++CA  Y
Sbjct  64   VIMVGIGMANATATSSYLSSQLVSSRNNDTNMKKVLKECADKY  106



>ref|XP_008808257.1| PREDICTED: putative invertase inhibitor [Phoenix dactylifera]
Length=175

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 80/177 (45%), Gaps = 22/177 (12%)
 Frame = +3

Query  156  LICVVILLMMLTTPINGDRKFVKKICKTTE------NYELCMEYVWADPRAPEADTRTLA  317
            L+C +++L   ++ ++     V++ CKT        +Y  C+  + ADP++  ADT+ LA
Sbjct  7    LLCFLLILNQSSSLVSAS---VQETCKTVAERSPNFSYNFCVASLSADPKSGSADTQGLA  63

Query  318  IIMIDTVKAKSKVTDKLIKRLLKSHPD--LKVPLEQCAWDYEVVILKTLIKVAYDGVILG  491
            +I    V A +  T   I  LLK   D   K  L  C+  Y       L+ +  D V   
Sbjct  64   VIATKLVNANATSTLSTISNLLKKTSDDATKECLGDCSTMYS-----DLVDMLKDTVSAI  118

Query  492  DPKFAEEAMTKLPFT-TIG--CENHFA--GHKSPLTHLNKLVGELADVTRDVIRNLL  647
              K   +A T L     +G  CE  FA    KSPLT  N    EL+ +   +I NLL
Sbjct  119  TSKRYSDAKTYLSAALDVGDNCEQGFAELQVKSPLTKENNDSRELSTLAL-IITNLL  174



>ref|XP_008799039.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Phoenix dactylifera]
Length=178

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 40/84 (48%), Gaps = 2/84 (2%)
 Frame = +3

Query  192  TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLI  371
            +P       +++ C +T  Y+LC+  + +DP +PEAD R L+ I++    + +  T    
Sbjct  22   SPTTNAPNLIQRTCNSTTYYDLCVASLQSDPESPEADVRGLSTIVVHLAISNATNTSSFA  81

Query  372  KRLLKS--HPDLKVPLEQCAWDYE  437
              L  S   P L+  L  CA  Y 
Sbjct  82   ASLAPSATDPSLRAVLRACAAKYS  105



>dbj|BAC54965.1| pectinmethylesterase inhibitor [Actinidia deliciosa]
Length=185

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 69/155 (45%), Gaps = 8/155 (5%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKR  377
            +  +   + +IC  T N  LC++ + +DPR+   D + L    ID  +A +K T K+I  
Sbjct  30   VKAENHLISEICPKTRNPSLCLQALESDPRSASKDLKGLGQFSIDIAQASAKQTSKIIAS  89

Query  378  LLK--SHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDPKFAEEAMTKLPFTTIG-C  548
            L    + P LK   E C+ ++   I    +  A   +  GD   +        F   G C
Sbjct  90   LTNQATDPKLKGRYETCSENFADAI--DSLGQAKQFLTSGDYN-SLNIYASAAFDGAGTC  146

Query  549  ENHFAGHKSPLTHLNKLVGELADVTRD--VIRNLL  647
            E+ F G  +  T L++   +L D+     VI NLL
Sbjct  147  EDSFEGPPNIPTQLHQADLKLEDLCDIILVISNLL  181



>ref|XP_003526858.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Glycine 
max]
Length=179

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 47/108 (44%), Gaps = 10/108 (9%)
 Frame = +3

Query  198  INGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLIKR  377
            + GD   +K+ CK T+ Y LC   + +DP +P AD + LA+IMI      +  T   +  
Sbjct  23   VEGDSSLIKRTCKNTKYYNLCFSSLKSDPSSPNADPKGLAVIMIGIGMTNATSTSSYLSS  82

Query  378  LLKSHPDLKVPLEQCAWDYEVVILKTLIKVAYDGVILGDP--KFAEEA  515
                   L  P     W  + V+ +   K +Y G  L D     A EA
Sbjct  83   ------KLPTPSNNTTW--KRVLKECADKYSYAGDALQDSVQDLANEA  122



>ref|XP_010908086.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Elaeis guineensis]
Length=179

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 38/84 (45%), Gaps = 2/84 (2%)
 Frame = +3

Query  192  TPINGDRKFVKKICKTTENYELCMEYVWADPRAPEADTRTLAIIMIDTVKAKSKVTDKLI  371
            TP       ++K C TT  Y  C+  + +DP +P+AD R L+ I I    + +  T    
Sbjct  23   TPTTDAPTLIQKTCNTTTYYNFCVSSLQSDPESPKADVRGLSTIAIHLAISNATNTSSFT  82

Query  372  KRLLKS--HPDLKVPLEQCAWDYE  437
              L  S   P L+  L +CA  Y 
Sbjct  83   AALSHSAADPSLRAVLRECAAKYS  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2006933691294