BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29129_g1_i1 len=196 path=[1:0-195]

Length=196
                                                                      Score     E

ref|NP_001058508.2|  Os06g0704400                                     49.7    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66321.1|  hypothetical protein OsJ_22559                        49.3    9e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81277.1|  hypothetical protein OsI_24382                        49.3    9e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006656458.1|  PREDICTED: uncharacterized protein LOC102711269  47.4    4e-04   
ref|XP_010041340.1|  PREDICTED: uncharacterized protein LOC104430285  47.4    4e-04   
ref|XP_006648604.1|  PREDICTED: uncharacterized protein LOC102718904  46.6    6e-04   
ref|XP_006589845.1|  PREDICTED: uncharacterized protein LOC102666747  45.4    0.001   



>ref|NP_001058508.2| Os06g0704400 [Oryza sativa Japonica Group]
 dbj|BAF20422.2| Os06g0704400 [Oryza sativa Japonica Group]
Length=804

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    KQFKKAMTNYVVYSKRNIYFVRNEPKRVSFACD*P-CPFQAHGS*DDTFKCFQLQTVTTE  179
            KQFKKA+T Y +  ++ I FV+++PKRV   CD P CP+    S +     +Q+ T+   
Sbjct  133  KQFKKAITAYGLAERKAINFVKDDPKRVRARCDWPSCPWVCLLSKNSRTDGWQIATLENS  192

Query  180  HMC  188
            H+C
Sbjct  193  HLC  195



>gb|EEE66321.1| hypothetical protein OsJ_22559 [Oryza sativa Japonica Group]
Length=1360

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    KQFKKAMTNYVVYSKRNIYFVRNEPKRVSFACD*P-CPFQAHGS*DDTFKCFQLQTVTTE  179
            KQFKKA+T Y +  ++ I FV+++PKRV   CD P CP+    S +     +Q+ T+   
Sbjct  615  KQFKKAITAYGLAERKAINFVKDDPKRVRARCDWPSCPWVCLLSKNSRTDGWQIATLENS  674

Query  180  HMC  188
            H+C
Sbjct  675  HLC  677



>gb|EEC81277.1| hypothetical protein OsI_24382 [Oryza sativa Indica Group]
Length=1267

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    KQFKKAMTNYVVYSKRNIYFVRNEPKRVSFACD*P-CPFQAHGS*DDTFKCFQLQTVTTE  179
            KQFKKA+T Y +  ++ I FV+++PKRV   CD P CP+    S +     +Q+ T+   
Sbjct  641  KQFKKAITAYGLAERKAINFVKDDPKRVRARCDWPSCPWVCLLSKNSRTDGWQIATLENS  700

Query  180  HMC  188
            H+C
Sbjct  701  HLC  703



>ref|XP_006656458.1| PREDICTED: uncharacterized protein LOC102711269 [Oryza brachyantha]
Length=807

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    KQFKKAMTNYVVYSKRNIYFVRNEPKRVSFACD*P-CPFQAHGS*DDTFKCFQLQTVTTE  179
            KQFK A+T Y +  +R I F++++PKRV   CD P CP+    S +     +Q+ T+   
Sbjct  133  KQFKNAITTYALAERRAINFIKDDPKRVRARCDWPSCPWVCLLSKNSRTDGWQIATLENS  192

Query  180  HMC  188
            H C
Sbjct  193  HAC  195



>ref|XP_010041340.1| PREDICTED: uncharacterized protein LOC104430285 [Eucalyptus grandis]
Length=904

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +3

Query  3    KQFKKAMTNYVVYSKRNIYFVRNEPKRVSFAC-D*PCPFQAHGS*DDTFKCFQLQTVTTE  179
            +QFK+A+  Y V  +R I F++NE K V   C    CP++  GS D     F ++T  +E
Sbjct  297  RQFKEALIKYSVVERREIKFIKNEKKCVRAKCVSESCPWRISGSIDARSGSFHVKTYHSE  356

Query  180  HMCNL  194
            H C++
Sbjct  357  HTCSI  361



>ref|XP_006648604.1| PREDICTED: uncharacterized protein LOC102718904 [Oryza brachyantha]
Length=500

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +3

Query  3    KQFKKAMTNYVVYSKRNIYFVRNEPKRVSFACD-*PCPFQAHGS*DDTFKCFQLQTVTTE  179
            KQFKKA+T Y +  ++ I FV+++PKRV   CD   CP+    S + T   +Q+ T+   
Sbjct  127  KQFKKAITTYALAERKVINFVKDDPKRVRAKCDWSSCPWVCLLSKNSTCDSWQIATLVNF  186

Query  180  HMC  188
            H C
Sbjct  187  HAC  189



>ref|XP_006589845.1| PREDICTED: uncharacterized protein LOC102666747 [Glycine max]
Length=306

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +3

Query  6    QFKKAMTNYVVYSKRNIYFVRNEPKRVSFACD*PCPFQAHGS*DDTFKCFQLQTVTTEHM  185
            +FK+A+  Y V S RN+ F RN+ +RV   C   C +  + + +   K +Q++T+  EH 
Sbjct  199  EFKEAVMTYGVQSGRNVKFDRNDKERVRVGCKEGCRWSIYLAKNKNEKTWQIRTLKDEHT  258

Query  186  CN  191
            C+
Sbjct  259  CS  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520786521752