BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c29008_g1_i1 len=1524 path=[1502:0-1523]

Length=1524
                                                                      Score     E

ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    666   0.0      
ref|XP_009606311.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    661   0.0      
emb|CDO97382.1|  unnamed protein product                                634   0.0      
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    625   0.0      
ref|XP_002323718.1|  hypothetical protein POPTR_0017s07030g             559   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011043118.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    559   0.0      
ref|XP_010030919.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       493   5e-167   
ref|XP_002320817.1|  hypothetical protein POPTR_0014s08440g             442   3e-147   Populus trichocarpa [western balsam poplar]
ref|XP_011023290.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    440   2e-146   
ref|XP_006852901.1|  hypothetical protein AMTR_s00033p00222830          438   1e-145   
ref|XP_011036928.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    437   2e-145   
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    437   3e-145   
ref|XP_002302598.1|  hypothetical protein POPTR_0002s16380g             437   4e-145   Populus trichocarpa [western balsam poplar]
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    433   2e-143   
ref|XP_006852904.1|  hypothetical protein AMTR_s00033p00224400          432   4e-143   
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    431   6e-143   
ref|XP_002275824.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    420   2e-138   Vitis vinifera
ref|XP_002275850.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    414   4e-136   Vitis vinifera
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    413   8e-136   
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    412   2e-135   
ref|XP_002511902.1|  UDP-glucosyltransferase, putative                  411   4e-135   Ricinus communis
ref|XP_010905696.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    409   5e-134   
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    408   9e-134   
gb|AGU14093.1|  UDP-glycosyltransferase                                 406   6e-133   
ref|XP_010277530.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       405   2e-132   
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    404   7e-132   
ref|XP_006444980.1|  hypothetical protein CICLE_v10019998mg             402   1e-131   
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       402   3e-131   
ref|XP_008788932.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    402   4e-131   
gb|KDO86267.1|  hypothetical protein CISIN_1g036520mg                   400   1e-130   
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    400   1e-130   
gb|KHN46708.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            397   1e-129   
gb|KDP28588.1|  hypothetical protein JCGZ_14359                         394   5e-129   
ref|XP_008232998.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    395   9e-129   
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    395   1e-128   
ref|XP_003548650.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    394   5e-128   
ref|XP_007217954.1|  hypothetical protein PRUPE_ppa005180mg             392   1e-127   
ref|XP_008233032.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    389   1e-126   
ref|XP_007051734.1|  UDP-Glycosyltransferase superfamily protein,...    389   1e-126   
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    389   1e-126   
ref|XP_011093242.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    389   3e-126   
ref|XP_009366540.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    388   4e-126   
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    388   7e-126   
ref|XP_009343124.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    387   8e-126   
ref|XP_006852898.1|  hypothetical protein AMTR_s00033p00222540          386   8e-126   
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    387   1e-125   Fragaria x ananassa
ref|XP_004250156.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    387   1e-125   
ref|XP_008346201.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    386   4e-125   
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g             386   5e-125   Populus trichocarpa [western balsam poplar]
ref|XP_009408288.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       385   6e-125   
ref|XP_011093243.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    385   7e-125   
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             384   2e-124   
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    384   2e-124   
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    385   2e-124   
ref|XP_007220939.1|  hypothetical protein PRUPE_ppa025376mg             383   5e-124   
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    383   7e-124   
gb|KHN26938.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            382   1e-123   
ref|XP_008386125.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    381   2e-123   
ref|XP_011084238.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    381   3e-123   
emb|CDP04856.1|  unnamed protein product                                380   4e-123   
gb|KHN26937.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            379   6e-123   
gb|KEH17945.1|  UDP-glucosyltransferase family protein                  380   8e-123   
ref|XP_007047762.1|  UDP-Glycosyltransferase superfamily protein,...    381   2e-122   
gb|KEH17952.1|  UDP-glucosyltransferase family protein                  379   2e-122   
ref|XP_004306714.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    379   3e-122   
ref|XP_006360400.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    377   6e-122   
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    377   1e-121   
gb|KHN26940.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            377   1e-121   
ref|XP_008346533.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    377   2e-121   
emb|CDP01584.1|  unnamed protein product                                376   2e-121   
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    376   2e-121   
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    376   3e-121   
gb|KDO60536.1|  hypothetical protein CISIN_1g011765mg                   375   4e-121   
emb|CDP01582.1|  unnamed protein product                                374   9e-121   
emb|CDP21084.1|  unnamed protein product                                374   1e-120   
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       374   1e-120   
emb|CDP21083.1|  unnamed protein product                                374   2e-120   
emb|CDP20375.1|  unnamed protein product                                374   2e-120   
ref|XP_006466331.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       374   3e-120   
ref|XP_004306716.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    373   3e-120   
ref|XP_006426251.1|  hypothetical protein CICLE_v10025508mg             373   4e-120   
ref|XP_008352352.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    372   1e-119   
gb|EYU30925.1|  hypothetical protein MIMGU_mgv1a005472mg                372   1e-119   
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         371   1e-119   
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             372   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_009767381.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    371   2e-119   
emb|CDP21820.1|  unnamed protein product                                370   3e-119   
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            370   4e-119   
emb|CDP01583.1|  unnamed protein product                                370   4e-119   
ref|XP_008346552.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    371   6e-119   
ref|XP_008438010.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       370   6e-119   
ref|XP_007012761.1|  UDP-Glycosyltransferase superfamily protein        372   1e-118   
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    368   3e-118   
ref|XP_003635105.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       369   3e-118   
gb|KDP29778.1|  hypothetical protein JCGZ_18713                         367   6e-118   
emb|CDP00928.1|  unnamed protein product                                367   1e-117   
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         366   3e-117   
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein        365   3e-117   
ref|XP_011092852.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       365   3e-117   
ref|XP_004287583.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       367   5e-117   
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    366   7e-117   
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       365   8e-117   
ref|XP_009767882.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    364   9e-117   
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            364   1e-116   
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          363   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    363   2e-116   
emb|CDP00929.1|  unnamed protein product                                363   2e-116   
ref|XP_009624393.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    363   2e-116   
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    363   3e-116   
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             362   4e-116   
gb|KHN26939.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            362   5e-116   
ref|XP_011073572.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    361   1e-115   
emb|CBI40428.3|  unnamed protein product                                360   1e-115   
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    361   2e-115   
ref|XP_004134320.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       359   8e-115   
ref|XP_010047533.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       358   1e-114   
ref|XP_008242170.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       358   2e-114   
ref|XP_002270260.1|  PREDICTED: UDP-glycosyltransferase 91A1            358   3e-114   Vitis vinifera
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            357   7e-114   
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  357   1e-113   Ricinus communis
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    356   1e-113   
ref|XP_009587012.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    356   1e-113   
ref|XP_009623239.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    355   2e-113   
ref|XP_008242383.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       355   2e-113   
gb|EYU23564.1|  hypothetical protein MIMGU_mgv1a026446mg                355   3e-113   
ref|XP_008779257.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    353   3e-113   
gb|AAM12787.1|  putative anthocyanidine rhamnosyl-transferase           355   5e-113   Capsicum annuum
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       355   5e-113   
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    355   6e-113   
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    354   8e-113   
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         354   8e-113   
ref|XP_006339794.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    353   2e-112   
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       354   2e-112   
ref|XP_010047531.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       351   6e-112   
ref|XP_009623238.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       352   7e-112   
ref|XP_009768273.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       352   8e-112   
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       352   9e-112   
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    351   9e-112   
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         351   1e-111   
ref|XP_004233155.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       351   2e-111   
gb|AHL38585.1|  glycosyltransferase                                     363   2e-111   
ref|XP_007051735.1|  UDP-Glycosyltransferase superfamily protein,...    350   2e-111   
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    350   2e-111   
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         350   2e-111   
ref|XP_010942592.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    350   2e-111   
ref|XP_009768930.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       350   3e-111   
ref|XP_006353158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       350   3e-111   
ref|XP_002270294.1|  PREDICTED: UDP-glycosyltransferase 91A1            350   3e-111   Vitis vinifera
ref|XP_009803298.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       350   3e-111   
ref|XP_008362977.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    350   3e-111   
ref|XP_004306715.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    348   7e-111   
ref|XP_008362978.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    349   7e-111   
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    349   7e-111   
ref|XP_002533517.1|  UDP-glucosyltransferase, putative                  346   2e-110   Ricinus communis
dbj|BAJ84800.1|  predicted protein                                      348   2e-110   
ref|XP_002532392.1|  UDP-glucosyltransferase, putative                  348   2e-110   Ricinus communis
ref|XP_010482257.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    347   2e-110   
ref|XP_007156463.1|  hypothetical protein PHAVU_003G288100g             348   2e-110   
ref|XP_007222833.1|  hypothetical protein PRUPE_ppa005106mg             348   3e-110   
ref|NP_565540.4|  UDP-glycosyltransferase 91A1                          347   3e-110   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ99561.1|  predicted protein                                      347   4e-110   
ref|XP_010023433.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       347   4e-110   
gb|AAD15567.1|  putative anthocyanidin-3-glucoside rhamnosyltrans...    347   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623233.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       347   5e-110   
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  347   6e-110   Ricinus communis
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        347   6e-110   
ref|XP_006415140.1|  hypothetical protein EUTSA_v10007607mg             346   7e-110   
ref|XP_006353004.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       346   1e-109   
ref|XP_006396998.1|  hypothetical protein EUTSA_v10028640mg             346   1e-109   
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                     345   1e-109   
ref|XP_010050451.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       347   7e-109   
ref|XP_008378603.1|  PREDICTED: UDP-glycosyltransferase 91C1            344   8e-109   
ref|XP_008388229.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       343   1e-108   
ref|XP_009361645.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       343   1e-108   
ref|XP_008342850.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       343   1e-108   
ref|XP_010047532.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       343   1e-108   
ref|XP_010431575.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       343   1e-108   
ref|XP_003564684.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    343   2e-108   
ref|XP_010442438.1|  PREDICTED: UDP-glycosyltransferase 91C1            343   2e-108   
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     343   2e-108   
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       343   3e-108   
ref|XP_009795659.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       342   3e-108   
ref|XP_002270331.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    342   4e-108   Vitis vinifera
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg             342   4e-108   
ref|XP_008236324.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       342   5e-108   
ref|XP_006353156.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       342   6e-108   
ref|XP_009108218.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       342   7e-108   
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       342   7e-108   
ref|XP_008362434.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       341   7e-108   
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                    341   7e-108   
gb|KHN06911.1|  UDP-glycosyltransferase 91A1                            341   7e-108   
ref|XP_009351087.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       341   9e-108   
ref|XP_009615005.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       341   1e-107   
ref|XP_002297733.1|  glycosyltransferase family protein                 341   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       341   1e-107   
emb|CAN80742.1|  hypothetical protein VITISV_015059                     341   1e-107   Vitis vinifera
ref|XP_003551309.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       340   1e-107   
gb|KDP41496.1|  hypothetical protein JCGZ_15903                         341   1e-107   
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    340   2e-107   
gb|KCW59684.1|  hypothetical protein EUGRSUZ_H02443                     340   2e-107   
ref|XP_008388212.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       340   2e-107   
ref|XP_010023430.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       340   3e-107   
dbj|BAO45905.1|  UDP-glycosyltransferase                                340   3e-107   
ref|XP_002303861.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    340   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_008219240.1|  PREDICTED: UDP-glycosyltransferase 91C1            340   3e-107   
ref|XP_004253507.2|  PREDICTED: UDP-glycosyltransferase 91A1-like       340   3e-107   
ref|XP_006353157.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       339   5e-107   
ref|XP_006353155.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       339   7e-107   
ref|XP_003615305.1|  Anthocyanidin 3-O-glucosyltransferase              338   7e-107   
ref|XP_011020572.1|  PREDICTED: UDP-glycosyltransferase 91C1            339   7e-107   
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  338   8e-107   
ref|XP_011000621.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       338   9e-107   
ref|XP_009361641.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       338   1e-106   
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    337   2e-106   
gb|KCW82044.1|  hypothetical protein EUGRSUZ_C03414                     337   3e-106   
ref|XP_010419269.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       337   3e-106   
gb|ACU24590.1|  unknown                                                 337   3e-106   Glycine max [soybeans]
gb|AFJ53032.1|  UDP-glycosyltransferase 1                               337   3e-106   
ref|XP_010051441.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       337   4e-106   
gb|KFK32801.1|  hypothetical protein AALP_AA6G289900                    337   4e-106   
ref|XP_008354446.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       337   5e-106   
ref|XP_010047534.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       336   5e-106   
ref|XP_007156464.1|  hypothetical protein PHAVU_003G288200g             336   5e-106   
ref|XP_006294142.1|  hypothetical protein CARUB_v10023135mg             336   6e-106   
ref|XP_007205156.1|  hypothetical protein PRUPE_ppa005394mg             336   6e-106   
ref|XP_002270369.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    336   7e-106   Vitis vinifera
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         336   8e-106   
ref|XP_009151459.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       335   1e-105   
gb|KCW79477.1|  hypothetical protein EUGRSUZ_C00864                     334   2e-105   
ref|XP_010271397.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       335   2e-105   
ref|XP_008337731.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       335   2e-105   
gb|AIE12480.1|  UGT3                                                    335   2e-105   
ref|XP_004250158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       335   2e-105   
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            334   5e-105   
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       333   7e-105   
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     333   7e-105   
ref|XP_003552084.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       333   1e-104   
ref|XP_010417017.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       333   1e-104   
gb|KCW79469.1|  hypothetical protein EUGRSUZ_C00854                     332   2e-104   
gb|KGN48689.1|  hypothetical protein Csa_6G497390                       332   2e-104   
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       332   2e-104   
gb|KEH20104.1|  UDP-glucosyltransferase family protein                  332   2e-104   
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       332   3e-104   
ref|XP_004143439.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       332   3e-104   
gb|AFK35814.1|  unknown                                                 332   3e-104   
ref|XP_006404721.1|  hypothetical protein EUTSA_v10000154mg             332   4e-104   
gb|ACU23401.1|  unknown                                                 328   4e-104   Glycine max [soybeans]
ref|XP_010472246.1|  PREDICTED: UDP-glycosyltransferase 91A1            332   4e-104   
ref|XP_004250160.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       331   8e-104   
gb|AES79436.2|  UDP-glucosyltransferase family protein                  328   3e-103   
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       330   3e-103   Stevia rebaudiana
ref|XP_009351089.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       328   4e-103   
ref|XP_008440525.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       328   6e-103   
ref|XP_002459516.1|  hypothetical protein SORBIDRAFT_02g005940          329   7e-103   Sorghum bicolor [broomcorn]
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    328   7e-103   
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       328   7e-103   
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            328   8e-103   Stevia rebaudiana
ref|NP_001051624.1|  Os03g0804900                                       328   1e-102   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150609.1|  anthocyanidin 3-O-glucosyltransferase              328   1e-102   Zea mays [maize]
dbj|BAK04512.1|  predicted protein                                      327   3e-102   
tpg|DAA56691.1|  TPA: anthocyanidin 3-O-glucosyltransferase             328   3e-102   
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              329   4e-102   
ref|XP_008440526.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       327   4e-102   
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                326   5e-102   
ref|XP_010671540.1|  PREDICTED: UDP-glycosyltransferase 91C1            326   6e-102   
ref|XP_004972263.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    327   6e-102   
ref|XP_002532389.1|  UDP-glucosyltransferase, putative                  325   6e-102   Ricinus communis
gb|AFJ53031.1|  UDP-glycosyltransferase 1                               326   7e-102   
ref|XP_007148435.1|  hypothetical protein PHAVU_006G208400g             325   1e-101   
gb|KEH23150.1|  UDP-glucosyltransferase family protein                  324   1e-101   
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       323   2e-101   
gb|EPS70335.1|  hypothetical protein M569_04423                         324   2e-101   
ref|XP_008440527.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       324   3e-101   
gb|AFJ53033.1|  UDP-glycosyltransferase 1                               324   3e-101   
gb|EEE55719.1|  hypothetical protein OsJ_04191                          324   4e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010312900.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       324   4e-101   
ref|NP_001044898.1|  Os01g0865400                                       324   4e-101   Oryza sativa Japonica Group [Japonica rice]
gb|ACE87855.1|  UDP-glucosyltransferase                                 323   6e-101   Stevia rebaudiana
emb|CAN73977.1|  hypothetical protein VITISV_022298                     322   9e-101   Vitis vinifera
ref|XP_004485549.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    323   9e-101   
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       323   1e-100   
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    322   1e-100   
emb|CBI40427.3|  unnamed protein product                                330   2e-100   
ref|XP_004489092.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    321   4e-100   
ref|XP_008466142.1|  PREDICTED: UDP-glycosyltransferase 91C1            321   4e-100   
ref|NP_001147674.1|  anthocyanidin 3-O-glucosyltransferase              321   5e-100   
ref|XP_009376199.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    320   8e-100   
gb|EAZ03129.1|  hypothetical protein OsI_25275                          321   1e-99    
ref|XP_007148434.1|  hypothetical protein PHAVU_006G208300g             320   1e-99    
dbj|BAJ89368.1|  predicted protein                                      320   2e-99    
ref|XP_004143546.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       320   2e-99    
ref|XP_010927293.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    319   2e-99    
ref|XP_004143545.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       319   2e-99    
ref|XP_004160942.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    319   2e-99    
tpg|DAA56689.1|  TPA: anthocyanidin 3-O-glucosyltransferase             320   2e-99    
gb|KHN33503.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            319   2e-99    
ref|XP_007134322.1|  hypothetical protein PHAVU_010G037600g             318   3e-99    
ref|XP_003547595.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    319   3e-99    
ref|XP_002463705.1|  hypothetical protein SORBIDRAFT_01g004570          319   4e-99    
ref|XP_003559278.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    319   4e-99    
ref|XP_002458815.1|  hypothetical protein SORBIDRAFT_03g040830          318   6e-99    
gb|EAZ03128.1|  hypothetical protein OsI_25274                          319   8e-99    
ref|NP_201358.1|  UDP-glycosyltransferase 91B1                          317   1e-98    
gb|KCW59686.1|  hypothetical protein EUGRSUZ_H02446                     316   1e-98    
ref|XP_007134314.1|  hypothetical protein PHAVU_010G036800g             316   2e-98    
dbj|BAC43110.1|  putative anthocyanidin-3-glucoside rhamnosyltran...    317   2e-98    
ref|XP_004151488.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       317   2e-98    
gb|EEC81695.1|  hypothetical protein OsI_25291                          323   4e-98    
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             315   4e-98    
ref|XP_010506988.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       316   5e-98    
ref|XP_004970691.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    316   5e-98    
ref|XP_008378602.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       316   7e-98    
ref|XP_007134316.1|  hypothetical protein PHAVU_010G037000g             314   9e-98    
ref|XP_002463702.1|  hypothetical protein SORBIDRAFT_01g004560          314   3e-97    
ref|XP_007148436.1|  hypothetical protein PHAVU_006G208500g             313   5e-97    
emb|CDY67034.1|  BnaCnng53280D                                          311   8e-97    
ref|XP_003593143.1|  UDP-glucosyltransferase                            311   2e-96    
emb|CAN70983.1|  hypothetical protein VITISV_027120                     316   2e-96    
dbj|BAK03755.1|  predicted protein                                      311   4e-96    
ref|XP_007219269.1|  hypothetical protein PRUPE_ppa018245mg             311   4e-96    
ref|XP_004955936.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    311   6e-96    
gb|AAS07237.1|  putative UDP-glucoronosyl and UDP-glucosyl transf...    310   9e-96    
ref|NP_001240857.1|  soyasaponin III rhamnosyltransferase               310   9e-96    
ref|XP_009408752.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    307   1e-95    
ref|XP_007012766.1|  UDP-Glycosyltransferase superfamily protein        310   2e-95    
ref|XP_004136252.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    309   2e-95    
ref|XP_008674785.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    309   2e-95    
ref|XP_002458816.1|  hypothetical protein SORBIDRAFT_03g040840          309   2e-95    
ref|XP_006657538.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    310   3e-95    
ref|XP_006292848.1|  hypothetical protein CARUB_v10019108mg             309   3e-95    
ref|XP_003570831.2|  PREDICTED: UDP-glycosyltransferase 91C1-like       308   5e-95    
ref|XP_009767885.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    306   5e-95    
ref|XP_010502543.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       307   8e-95    
emb|CDX73276.1|  BnaC05g28300D                                          306   8e-95    
ref|XP_011001966.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       306   1e-94    
ref|XP_004485550.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    307   1e-94    
ref|XP_010506987.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       307   1e-94    
ref|XP_010099555.1|  UDP-glycosyltransferase 91C1                       306   2e-94    
ref|XP_004981372.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    306   3e-94    
ref|NP_001059133.1|  Os07g0201500                                       307   4e-94    
gb|AFJ53030.1|  UDP-glycosyltransferase 1                               305   5e-94    
ref|XP_010518639.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       305   6e-94    
gb|KCW66654.1|  hypothetical protein EUGRSUZ_F00432                     304   7e-94    
ref|XP_003593144.1|  Glucosyltransferase                                305   1e-93    
ref|XP_010492649.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       304   2e-93    
ref|XP_004955765.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    304   3e-93    
gb|AFK37289.1|  unknown                                                 303   6e-93    
gb|EAZ28971.1|  hypothetical protein OsJ_13015                          302   1e-92    
ref|XP_006645072.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    302   1e-92    
ref|XP_003619079.1|  Anthocyanidin 3-O-glucosyltransferase              302   1e-92    
dbj|BAJ86656.1|  predicted protein                                      301   3e-92    
ref|XP_002460289.1|  hypothetical protein SORBIDRAFT_02g026040          301   5e-92    
dbj|BAJ97320.1|  predicted protein                                      300   1e-91    
ref|XP_002325254.2|  hypothetical protein POPTR_0018s13720g             298   1e-91    
gb|EAZ03144.1|  hypothetical protein OsI_25293                          300   2e-91    
ref|XP_003560669.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    298   2e-91    
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            298   3e-91    
ref|XP_003593142.1|  Glucosyltransferase                                298   3e-91    
gb|EPS66584.1|  hypothetical protein M569_08191                         297   4e-91    
ref|XP_007206476.1|  hypothetical protein PRUPE_ppa019000mg             294   4e-91    
ref|NP_001175095.1|  Os07g0201200                                       298   1e-90    
ref|XP_004955764.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    297   1e-90    
dbj|BAC83826.1|  putative UDP-glucosyltransferase                       298   1e-90    
ref|XP_003564213.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       296   1e-90    
ref|XP_008804284.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    296   2e-90    
gb|KEH32398.1|  UDP-glucosyltransferase family protein                  296   2e-90    
ref|NP_001059134.1|  Os07g0202000                                       296   4e-90    
gb|KHN27169.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            295   7e-90    
ref|XP_003535899.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    295   7e-90    
ref|XP_004143544.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       293   2e-89    
ref|XP_006650455.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       293   2e-89    
gb|EEC76369.1|  hypothetical protein OsI_13968                          293   4e-89    
emb|CAN80741.1|  hypothetical protein VITISV_015058                     292   5e-89    
ref|NP_001051007.2|  Os03g0702000                                       292   5e-89    
gb|ABR18376.1|  unknown                                                 292   7e-89    
ref|XP_004982379.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       291   1e-88    
ref|XP_008391056.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       291   2e-88    
ref|XP_002532391.1|  UDP-glucosyltransferase, putative                  288   1e-87    
gb|ABR16160.1|  unknown                                                 288   2e-87    
ref|XP_008804286.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    287   2e-87    
ref|XP_010928970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    285   2e-87    
ref|XP_003560664.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       288   3e-87    
dbj|BAJ89506.1|  predicted protein                                      288   5e-87    
gb|KEH37740.1|  UDP-glucosyltransferase family protein                  287   5e-87    
dbj|BAJ92561.1|  predicted protein                                      288   6e-87    
ref|XP_004955982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    287   6e-87    
ref|XP_006650454.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       286   8e-87    
gb|EMT10636.1|  Anthocyanidin 3-O-glucosyltransferase                   285   1e-86    
ref|XP_006658379.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    288   1e-86    
ref|NP_001051010.1|  Os03g0702500                                       286   1e-86    
ref|XP_003571408.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    286   2e-86    
gb|EAY91547.1|  hypothetical protein OsI_13181                          286   2e-86    
emb|CDP01580.1|  unnamed protein product                                298   2e-86    
ref|XP_004955768.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    286   2e-86    
dbj|BAJ98242.1|  predicted protein                                      285   3e-86    
dbj|BAJ94055.1|  predicted protein                                      285   4e-86    
ref|XP_010227258.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       284   5e-86    
emb|CDY54711.1|  BnaA09g52430D                                          283   8e-86    
ref|XP_004955767.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    285   1e-85    
dbj|BAJ91449.1|  predicted protein                                      283   1e-85    
gb|KCW79473.1|  hypothetical protein EUGRSUZ_C00858                     282   1e-85    
gb|AAS07253.1|  putative UDP-glucoronosyl and UDP-glucosyl transf...    291   2e-85    
dbj|BAJ96765.1|  predicted protein                                      281   2e-84    
ref|XP_010430764.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       279   3e-84    
ref|XP_004980756.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    278   3e-83    
dbj|BAJ93155.1|  predicted protein                                      278   4e-83    
ref|XP_002466606.1|  hypothetical protein SORBIDRAFT_01g010900          276   6e-83    
gb|ABR18123.1|  unknown                                                 277   6e-83    
ref|XP_007012763.1|  UDP-Glycosyltransferase superfamily protein        275   7e-83    
ref|XP_010230871.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       276   8e-83    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050          276   8e-83    
ref|XP_003619124.1|  Anthocyanidin 3-O-glucosyltransferase              276   9e-83    
emb|CDX81291.1|  BnaC09g07020D                                          274   3e-82    
emb|CDP01581.1|  unnamed protein product                                271   4e-82    
ref|XP_010938196.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    273   8e-82    
ref|XP_008793359.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    272   2e-81    
gb|EMT01232.1|  Anthocyanidin 3-O-glucosyltransferase                   271   2e-81    
gb|EEE66761.1|  hypothetical protein OsJ_23476                          271   8e-81    
gb|KGN48693.1|  hypothetical protein Csa_6G498410                       268   3e-80    
gb|EAZ00153.1|  hypothetical protein OsI_22159                          270   3e-80    
ref|XP_003607432.1|  Anthocyanidin 3-O-glucosyltransferase              268   6e-80    
ref|XP_004979741.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    268   2e-79    
ref|XP_007217920.1|  hypothetical protein PRUPE_ppa022969mg             263   4e-79    
ref|XP_004979736.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    266   8e-79    
gb|EEE66760.1|  hypothetical protein OsJ_23475                          265   1e-78    
gb|ABR16053.1|  unknown                                                 265   3e-78    
gb|EEE66752.1|  hypothetical protein OsJ_23460                          264   1e-77    
gb|EAZ39045.1|  hypothetical protein OsJ_23474                          262   2e-77    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          262   3e-77    
ref|XP_008667488.1|  PREDICTED: hypothetical protein isoform X1         259   7e-77    
ref|XP_008237180.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    255   2e-76    
ref|NP_001064066.1|  Os10g0122000                                       260   2e-76    
ref|XP_004982120.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    259   5e-76    
ref|NP_001140739.1|  uncharacterized protein LOC100272814               258   8e-76    
ref|XP_004982059.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       256   1e-75    
ref|XP_004979742.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    257   3e-75    
ref|XP_006836294.1|  hypothetical protein AMTR_s00092p00017910          257   4e-75    
ref|NP_001150595.1|  transferase, transferring glycosyl groups          255   1e-74    
ref|XP_010032103.1|  PREDICTED: crocetin glucoside glucosyltransf...    254   1e-74    
gb|EAY86485.1|  hypothetical protein OsI_07863                          253   2e-74    
tpg|DAA41232.1|  TPA: transferase                                       254   2e-74    
dbj|BAD17459.1|  putative UDP-glucosyltransferase                       253   3e-74    
ref|XP_002878624.1|  At2g22590/T9I22.3                                  253   3e-74    
ref|XP_010032098.1|  PREDICTED: crocetin glucoside glucosyltransf...    252   1e-73    
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    251   1e-73    
ref|XP_010034309.1|  PREDICTED: crocetin glucoside glucosyltransf...    251   2e-73    
ref|XP_003559503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    251   2e-73    
gb|KCW51498.1|  hypothetical protein EUGRSUZ_J01015                     251   2e-73    
dbj|BAJ99464.1|  predicted protein                                      249   9e-73    
dbj|BAH80312.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    249   2e-72    
gb|KCW51496.1|  hypothetical protein EUGRSUZ_J01013                     247   3e-72    
ref|XP_004250486.1|  PREDICTED: crocetin glucoside glucosyltransf...    248   3e-72    
gb|KDO54147.1|  hypothetical protein CISIN_1g019759mg                   244   5e-72    
dbj|BAJ88830.1|  predicted protein                                      246   2e-71    
ref|XP_009624381.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       239   3e-71    
gb|AHK12770.1|  flavanone-O-glucoside 2''-O-beta-L-rhamnosyltrans...    245   4e-71    
ref|XP_006367679.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    244   7e-71    
ref|XP_010034308.1|  PREDICTED: crocetin glucoside glucosyltransf...    242   3e-70    
gb|KCW51492.1|  hypothetical protein EUGRSUZ_J01008                     241   3e-70    
ref|XP_006292348.1|  hypothetical protein CARUB_v10018560mg             238   8e-70    
ref|XP_006378647.1|  hypothetical protein POPTR_0010s18990g             237   8e-70    
ref|XP_002273963.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    236   1e-69    
dbj|BAH80313.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    241   2e-69    
gb|KCW53337.1|  hypothetical protein EUGRSUZ_J02585                     239   3e-69    
gb|EMT03457.1|  Anthocyanidin 3-O-glucosyltransferase                   239   3e-69    
ref|XP_004244816.1|  PREDICTED: crocetin glucoside glucosyltransf...    239   5e-69    
ref|XP_010033637.1|  PREDICTED: crocetin glucoside glucosyltransf...    239   6e-69    
ref|XP_006361439.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    239   6e-69    
dbj|BAD35324.1|  putative UDP-glucosyltransferase                       239   8e-69    
ref|XP_009416585.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    239   8e-69    
ref|XP_007205575.1|  hypothetical protein PRUPE_ppa008811mg             234   9e-69    
ref|XP_009770958.1|  PREDICTED: crocetin glucoside glucosyltransf...    238   1e-68    
gb|AFK79036.1|  glycosyltransferase UGT4                                238   1e-68    
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      239   1e-68    
ref|XP_009796593.1|  PREDICTED: crocetin glucoside glucosyltransf...    238   2e-68    
ref|XP_006352206.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    238   2e-68    
ref|XP_010525697.1|  PREDICTED: crocetin glucoside glucosyltransf...    238   2e-68    
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    238   2e-68    
ref|XP_002271587.2|  PREDICTED: crocetin glucoside glucosyltransf...    236   4e-68    
gb|EMS61554.1|  UDP-glycosyltransferase 91C1                            237   5e-68    
ref|XP_009593691.1|  PREDICTED: crocetin glucoside glucosyltransf...    236   6e-68    
ref|XP_010110161.1|  Cyanidin-3-O-glucoside 2-O-glucuronosyltrans...    237   7e-68    
ref|XP_004249996.1|  PREDICTED: crocetin glucoside glucosyltransf...    236   9e-68    
ref|XP_006355167.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    236   9e-68    
ref|XP_007204467.1|  hypothetical protein PRUPE_ppa023177mg             232   9e-68    
ref|XP_004238624.1|  PREDICTED: crocetin glucoside glucosyltransf...    236   1e-67    
gb|AHZ30598.1|  ufgt                                                    235   1e-67    
ref|XP_008455479.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    235   3e-67    
ref|XP_010658725.1|  PREDICTED: crocetin glucoside glucosyltransf...    234   4e-67    
dbj|BAO51835.1|  UDP-glycosyltransferase 94P1                           234   5e-67    
ref|XP_006360518.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    233   1e-66    
ref|XP_008359348.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    231   2e-66    
gb|EMT28296.1|  Anthocyanidin 3-O-glucosyltransferase                   231   2e-66    
gb|EMT31905.1|  Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltra...    232   2e-66    
ref|XP_010034306.1|  PREDICTED: crocetin glucoside glucosyltransf...    233   2e-66    
ref|XP_009596289.1|  PREDICTED: crocetin glucoside glucosyltransf...    232   4e-66    
ref|XP_003635104.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    226   1e-65    
gb|KFK27016.1|  hypothetical protein AALP_AA8G323600                    231   1e-65    
ref|XP_004144602.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       231   1e-65    
ref|XP_008237191.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    225   1e-65    



>ref|XP_009788298.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=468

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/465 (69%), Positives = 381/465 (82%), Gaps = 8/465 (2%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA +  HVM+FPWLAFGHMLP LE +KKLAAKG RVSFVSTPKNLQRLPP+ +S  +++ 
Sbjct  1     MATKNYHVMVFPWLAFGHMLPFLELSKKLAAKGTRVSFVSTPKNLQRLPPVHSSLGDKIK  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             + EI LPSV GLP NCEATVDL Q E++Q+LK AYD++  PFEEL+  +LP+LIL+DFA 
Sbjct  61    MLEIPLPSVDGLPVNCEATVDL-QPEEIQYLKKAYDKLALPFEELLLENLPDLILIDFAP  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
              W+PEIA +YGV+T F SVYTA+TLAYLG P EL++G LR  PEHF  PP WFNFHSLVA
Sbjct  120   FWIPEIAAKYGVSTAFFSVYTASTLAYLGPPVELKNGTLRTRPEHFVHPPPWFNFHSLVA  179

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             HRPDYAPTMMRNTH PDASGV SGQR++ ++EGC FV+VRSC EFE +YI+L+E+LY+RP
Sbjct  180   HRPDYAPTMMRNTHCPDASGVPSGQRIAKIVEGCKFVVVRSCNEFEEKYINLIEELYQRP  239

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL IG+LPP     T  QP T+ S WS  F WL+ Q+ KSVVFVGFGSEYKMPI QIHEL
Sbjct  240   VLPIGILPPA--PETGTQPQTD-SGWSYIFRWLNKQKSKSVVFVGFGSEYKMPIKQIHEL  296

Query  960   ASALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             A ALELS  PFLWILRKP G++   Y  +LPT F++R SNQG V LGWAPQQ+ILAHP+I
Sbjct  297   ACALELSEQPFLWILRKPEGVE---YQEVLPTGFLSRVSNQGIVSLGWAPQQDILAHPSI  353

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMV  1316
             GGCLFHSGWGTIIE+L FGH L+L+PMVADQGLNAKLLVEKEIG+EVPR EDGSF +D+V
Sbjct  354   GGCLFHSGWGTIIEALSFGHRLVLIPMVADQGLNAKLLVEKEIGHEVPRNEDGSFCKDIV  413

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             ANSIR VM + EGE +RL+ AQ+  IF NH +HD+YIDQFI++ +
Sbjct  414   ANSIRLVMNTEEGEKLRLRTAQVQKIFSNHRVHDSYIDQFIQHIK  458



>ref|XP_009606311.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/465 (69%), Positives = 378/465 (81%), Gaps = 8/465 (2%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA +  HVM+FPWLAFGHMLP LE +KKLAAKG RVSFVSTPKNLQRLPPIP+S  +R+ 
Sbjct  1     MATKNYHVMVFPWLAFGHMLPFLELSKKLAAKGIRVSFVSTPKNLQRLPPIPSSLGDRIK  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             L EI LPS+ GLP NCEATVDL Q E++Q+LK AYD++  PFEEL+  +LP+LIL+DFA 
Sbjct  61    LLEIPLPSIGGLPVNCEATVDL-QPEEIQYLKKAYDKLALPFEELLLENLPDLILIDFAP  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
              W+PEIA +YGV+T F SVYTA+TLAYLGSP EL++G LR  PEHF  PP WFNFHSLVA
Sbjct  120   FWIPEIAAKYGVSTAFFSVYTASTLAYLGSPVELKNGTLRTRPEHFVHPPPWFNFHSLVA  179

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             HRPDYA TMM NTH PDASGVSSGQR++ ++EGC FV+VRSC EFE +YI+L+E LY+RP
Sbjct  180   HRPDYASTMMHNTHCPDASGVSSGQRIAKIVEGCKFVVVRSCNEFEEKYINLIEDLYQRP  239

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL IG+L P     T  QP T+ S WS  F WLD Q+ KSVVFVGFGSEYKMP  +IHEL
Sbjct  240   VLPIGILSPA--PETGTQPQTD-SGWSHIFRWLDKQKSKSVVFVGFGSEYKMPNKEIHEL  296

Query  960   ASALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             A ALELS   FLWILRKP G++   Y  +LPT F++R SNQG V LGWAPQQ+ILAHP+I
Sbjct  297   ACALELSEQTFLWILRKPEGVE---YQEVLPTGFLSRVSNQGIVSLGWAPQQDILAHPSI  353

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMV  1316
             GGCLFHSGWGTIIE+L FGH LIL+PMVADQGLNAKLLVEKEIG+EVPR EDGSF +D+V
Sbjct  354   GGCLFHSGWGTIIEALSFGHRLILIPMVADQGLNAKLLVEKEIGHEVPRNEDGSFCKDIV  413

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             ANSIR VM + EGE +R +AAQ+  IF +H LHD+Y+DQFI++ +
Sbjct  414   ANSIRLVMNTDEGEKLRSRAAQVQKIFSDHRLHDSYVDQFIQHIK  458



>emb|CDO97382.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/466 (66%), Positives = 365/466 (78%), Gaps = 9/466 (2%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MAA+Q H+M+FPWLAFGH+LP LEF+KKLA KG ++SFVSTPKNL RLPPIPA  ++R+ 
Sbjct  1     MAAQQHHLMMFPWLAFGHLLPFLEFSKKLATKGVKISFVSTPKNLCRLPPIPADLSDRIK  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             L  + LP V GLPENCEAT+D+ Q EQ QFLK AYDR+  P E+L++++ P+LILVDFA 
Sbjct  61    LLAVPLPLVDGLPENCEATIDV-QPEQTQFLKKAYDRLAEPMEKLLQQESPDLILVDFAA  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
              W+PE A ++G++  F S YTAATLA+LG P EL SG LR + EHFT PP WF F SLVA
Sbjct  120   GWIPETAAKFGISVAFFSAYTAATLAFLGPPGELISGTLRKTAEHFTRPPDWFTFPSLVA  179

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             HRP YAPT  +N H PD SG+SSGQR++ V+ GC FV V+SCKEFEGEYI+L+E+LY+RP
Sbjct  180   HRPHYAPTAFKNLHIPDLSGLSSGQRIAKVVRGCSFVAVKSCKEFEGEYINLVEELYQRP  239

Query  780   VLAIGLLPPRLNLNTAIQP--GTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             VL IG+LPP       IQ     N SSWS  F+WLD Q+PKSVVFVGFGSEYKMPI QIH
Sbjct  240   VLPIGVLPPP---PETIQESHSDNDSSWSTTFQWLDKQKPKSVVFVGFGSEYKMPIEQIH  296

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             ELA A+ELS + F+WILRKP  D      LLP  F++RTSNQG V LGW PQ  ILAHPA
Sbjct  297   ELAFAVELSGLAFIWILRKPLADTVN---LLPPGFLDRTSNQGIVCLGWVPQIEILAHPA  353

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             IGGCLFHSGWG+IIE LGFGHPLIL+PMV DQ LNAKLL EKE+GYEVPR  DGSFSR+ 
Sbjct  354   IGGCLFHSGWGSIIECLGFGHPLILMPMVYDQTLNAKLLAEKEVGYEVPRDIDGSFSREC  413

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             VA SIR VM   EGE IR+KAAQM N+FGN +LHDNYI++FI++ +
Sbjct  414   VAASIRRVMVEAEGEQIRVKAAQMKNVFGNQDLHDNYINKFIQHLE  459



>ref|XP_011092703.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=470

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/467 (66%), Positives = 369/467 (79%), Gaps = 13/467 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M   + H+M+FPWLAFGHM+P LE +K+LAAKG  VS+VSTP+NLQRLPPI  +   ++ 
Sbjct  1     MEGGKYHIMMFPWLAFGHMIPFLELSKRLAAKGIFVSYVSTPRNLQRLPPIALNLEGKVK  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             L EI +P V GLPENCEATVD+ Q EQ+ +LK AYDR+  PFE L++   P+LIL+DFA 
Sbjct  61    LVEIPMPQVDGLPENCEATVDI-QLEQIPYLKKAYDRLAEPFERLLQTVRPDLILIDFAP  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +W+ EIA ++G+ T F SVYTAATLAYLG P EL+SGK RP+PEHFT PP W  F SL+A
Sbjct  120   YWILEIAAKFGIRTAFFSVYTAATLAYLGPPAELKSGKRRPTPEHFTRPPDWIPFPSLIA  179

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             HRPDYAP MMRNTH PDASG+SSGQR + ++E C FV+VRS +  EGEYI L+++LYKRP
Sbjct  180   HRPDYAPRMMRNTHFPDASGMSSGQRAAKILEECSFVVVRSSEAVEGEYIGLIQELYKRP  239

Query  780   VLAIGLLPP---RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             VL IG+L P       NTAI     +SSWS   +WL+ Q+PKSV+FVGFGSEYKMP+ QI
Sbjct  240   VLPIGVLAPVPEENKNNTAI-----NSSWSHTHQWLEGQKPKSVLFVGFGSEYKMPVEQI  294

Query  951   HELASALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             HELA +LELSR+PFLWILRKP G+D+     LLP  F NRT +QG V+LGWAPQ  ILAH
Sbjct  295   HELAYSLELSRLPFLWILRKPQGVDSSD---LLPPGFANRTLSQGVVLLGWAPQLEILAH  351

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             PAIGGCLFHSGWGTIIESLGFGHPL+LLPM+ADQGLNAKLLVEKE+GYEVPR EDGSFSR
Sbjct  352   PAIGGCLFHSGWGTIIESLGFGHPLVLLPMIADQGLNAKLLVEKEVGYEVPRNEDGSFSR  411

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             D+VA SIR V+ + EGE +RL+AA M ++F NH   DNYI++FIE+ 
Sbjct  412   DVVAESIRRVVIAPEGEQLRLRAAHMRSVFDNHESQDNYINKFIEHL  458



>ref|XP_002323718.1| hypothetical protein POPTR_0017s07030g [Populus trichocarpa]
 gb|EEF03851.1| hypothetical protein POPTR_0017s07030g [Populus trichocarpa]
Length=465

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/464 (58%), Positives = 342/464 (74%), Gaps = 7/464 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A + HV +FPW AFGH+LP LEF+K+LAAKG  +SF+STP+N++RLP IP + + +    
Sbjct  2     ASKSHVFMFPWFAFGHILPYLEFSKQLAAKGIHISFISTPRNIKRLPSIPQNISGKFKFI  61

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             EI LP V GLPENCEAT+DL   EQ+Q+LK AYD +  PFE LV+++ PE+IL DFA  W
Sbjct  62    EIQLPIVDGLPENCEATIDL-SPEQIQYLKQAYDALKVPFESLVQKEAPEMILFDFAACW  120

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             +P IA RYG+ +VF S  +AA+ AYLG P+EL S +LR  PE +   P W  F SLVA+R
Sbjct  121   IPAIAARYGITSVFFSPLSAASSAYLGPPDELHSFRLRTRPEDYARAPEWIPFPSLVAYR  180

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             PD     M++ + PD SG+S+GQR +  +  CD V VRSC+EFE  Y+++LE++Y++PVL
Sbjct  181   PDQGTRYMQHVYIPDVSGISTGQRRAKTLAECDMVAVRSCREFEDSYLNVLEEIYQKPVL  240

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP    N    P   SS++S  F+WLD Q  KSVVFVGFGSEYKMP+  IHELA 
Sbjct  241   PIGLLPPNFVENKTSHP--ESSNFSSTFKWLDKQEQKSVVFVGFGSEYKMPVETIHELAY  298

Query  966   ALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +ELS +PF+WIL+KP GID+     LLPT FV+R S++G V  GWAPQ  ILAHP+IGG
Sbjct  299   GIELSGLPFMWILKKPEGIDSQD---LLPTGFVSRISDRGIVSFGWAPQLEILAHPSIGG  355

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVAN  1322
             CLFHSGWG+IIESLGFGHPLIL+PMV DQ LNAKLLVEK  G+EVPR +DGSF+RDMVA 
Sbjct  356   CLFHSGWGSIIESLGFGHPLILMPMVNDQTLNAKLLVEKSAGFEVPRNKDGSFNRDMVAK  415

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R VM  +EGE IRLK +++  IF + +L D+YI +FI Y  S
Sbjct  416   SMRLVMVDKEGEPIRLKTSELQAIFSSQHLQDDYISKFIRYTSS  459



>ref|XP_011043118.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=465

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/464 (58%), Positives = 341/464 (73%), Gaps = 7/464 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A + HV +FPWLAFGH+LP LEF+K+LAAKG  +SF+STP N++R P IP   + R    
Sbjct  2     ASKSHVFMFPWLAFGHILPYLEFSKQLAAKGIHISFISTPINIKRFPSIPQDISGRFKFI  61

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             EI LP V GLPENCEAT+DL   EQ+Q+LK AYD +  PFE LV+++ P++IL DFA  W
Sbjct  62    EIQLPIVDGLPENCEATIDL-SPEQIQYLKQAYDALKVPFESLVQKEAPQMILFDFAACW  120

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             +P IA RYG+ +VF S  +AA+ AYLG P+ELRS +LR  PE +   P W  F SLVA+R
Sbjct  121   IPAIAARYGITSVFFSPLSAASSAYLGPPDELRSFRLRTRPEDYARAPEWIPFPSLVAYR  180

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             PD     M++ + PD SG+S+GQR +  +  CD V VRSC+EFE  Y+++LE++Y++PVL
Sbjct  181   PDQGTRFMQHVYIPDVSGISTGQRRAKTLAECDLVAVRSCREFEDSYLNVLEEIYQKPVL  240

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP    N    P   SS++  AF+WLD Q  KSVVFVGFGSEYKMP+  IHELA 
Sbjct  241   PIGLLPPNFVENKTSYP--ESSNFYGAFKWLDKQEQKSVVFVGFGSEYKMPVETIHELAY  298

Query  966   ALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +ELS +PF+WIL+KP GID+     LLPT FV+R S++G V  GWAPQQ ILAHP+IGG
Sbjct  299   GIELSGLPFMWILKKPEGIDSQD---LLPTGFVSRISDRGIVSFGWAPQQEILAHPSIGG  355

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVAN  1322
             CLFHSGWG+IIESLGFGHPLIL+PMV DQ LNAKLLVEK  G+EVPR +DGSF+RDMVA 
Sbjct  356   CLFHSGWGSIIESLGFGHPLILMPMVNDQTLNAKLLVEKSAGFEVPRNKDGSFNRDMVAK  415

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R VM + EGE IR K +++  IF + +L D+YI +FI Y  S
Sbjct  416   SMRLVMVAEEGETIRRKTSELQAIFASQHLQDDYISKFIRYTSS  459



>ref|XP_010030919.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW56939.1| hypothetical protein EUGRSUZ_I02617 [Eucalyptus grandis]
Length=469

 Score =   493 bits (1269),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 309/448 (69%), Gaps = 3/448 (1%)
 Frame = +3

Query  51    NITMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE  230
              I  A++Q  +M+FPWLAFGH+LP  E AK+LA+KG  +SF+STP+N+QRLPP+P +  E
Sbjct  11    KIQKASKQYEIMMFPWLAFGHILPYFELAKRLASKGIHISFISTPRNIQRLPPVPDNLIE  70

Query  231   RLSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVD  410
              + L +I L SV GLPEN EAT+DL   E  ++L+ A D +    E+L+ +  P+LIL D
Sbjct  71    NIKLVQIPLTSVDGLPENSEATIDLPL-ECTEYLRKACDGLREALEQLLCKISPDLILFD  129

Query  411   FATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHS  590
             F   W+P+IA ++ V +   S Y A TLA+LG P EL S      PE F V P WF   S
Sbjct  130   FVQCWIPQIAAKFSVPSGNFSAYAACTLAFLGPPAELESFGRGKKPEDFAVTPDWFPLTS  189

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
             LV+  P  A  M +N + PD S +S  QR ++ + GC+FV VRSC EFEGEY++LL  LY
Sbjct  190   LVSQGPHLAQKMFKNLYFPDKSSLSCSQRWAATLHGCEFVAVRSCSEFEGEYLNLLRGLY  249

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++PVL +GLLPP L+ N A    T S+ WS   +WLD Q  KSV+FVGFG+EYKMP+ +I
Sbjct  250   RKPVLPVGLLPP-LSKNKACDQATGSN-WSHISKWLDKQARKSVLFVGFGTEYKMPLEEI  307

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             HELA  LELS MPF WILRKPG        LLP  F+ RTS +  V +GWAPQ  IL HP
Sbjct  308   HELAYGLELSEMPFFWILRKPGGLEFDSSELLPDGFLERTSERSMVSIGWAPQLAILGHP  367

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             AIGGCL+HSGW +IIESLGFGHP I +PMV DQGLNAKLLVEK +G+EVPR EDGSF RD
Sbjct  368   AIGGCLYHSGWSSIIESLGFGHPQITMPMVDDQGLNAKLLVEKGVGFEVPRNEDGSFHRD  427

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANI  1394
              VA SIR V+   +GEG+R+KAA +  I
Sbjct  428   AVAKSIRLVLLEDQGEGLRVKAAHIQKI  455



>ref|XP_002320817.1| hypothetical protein POPTR_0014s08440g [Populus trichocarpa]
 gb|EEE99132.1| hypothetical protein POPTR_0014s08440g [Populus trichocarpa]
Length=467

 Score =   442 bits (1138),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 225/471 (48%), Positives = 310/471 (66%), Gaps = 13/471 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             AE+ H+++ PW+AFGHM+P  + +  LA  G +VSFVSTP+N++RLP IP S  + +   
Sbjct  2     AEKLHIVMLPWIAFGHMIPFFQLSIDLAKAGIKVSFVSTPRNIKRLPKIPPSLADLVKFV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             E  LPS+    LPE+ EATVD+   E++++LK AYD +  P ++ +   LP+ I++D   
Sbjct  62    EFPLPSLDNDILPEDGEATVDIPA-EKIEYLKIAYDLLQHPLKQFIADQLPDWIIIDMIP  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG----KLRPSPEHFTVPPGWFNFH  587
             +W+ EIA+   V  +  SV++A    +LG PE L  G    +LRPS    T  P W +F 
Sbjct  121   YWMVEIARDKKVPLIHFSVFSAVAYVFLGHPECLLVGDGQKRLRPSWTSMTSKPEWVDFP  180

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S VA+R   A  +    +  +ASG++ G+R+S ++ GC  + VRSC EFEG+Y++L E++
Sbjct  181   SSVAYRNHEAVGVFEWIYKGNASGITDGERVSKILHGCQALAVRSCAEFEGDYLNLFERV  240

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
               +PV+ +GLLP           G     W E F+WLD+Q+PKSVVFVGFGSEYK+   Q
Sbjct  241   IGKPVIPVGLLPQEKPERKEFTDG----RWGEIFKWLDDQKPKSVVFVGFGSEYKLTRDQ  296

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             ++E+A  LELS +PFLW LRKPG  N    AL P+ F  RTS++G V +GWAPQ  IL H
Sbjct  297   VYEIAHGLELSGLPFLWALRKPGWANDDLDAL-PSGFGERTSDRGIVCMGWAPQMEILGH  355

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P+IGG LFHSGWG+IIESL FGH LILLP + DQ LNA+ LVEK +G EV R EDGSF+R
Sbjct  356   PSIGGSLFHSGWGSIIESLQFGHTLILLPFIIDQPLNARYLVEKGLGVEVQRGEDGSFTR  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSK  1457
             D VA ++   M S EG+G+R KA++ A IFGN  LH D YI +F+++ + K
Sbjct  416   DGVAKALNLAMISAEGKGLREKASEAAAIFGNQKLHQDYYIGKFVDFLKKK  466



>ref|XP_011023290.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=467

 Score =   440 bits (1132),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/471 (47%), Positives = 304/471 (65%), Gaps = 12/471 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A   H++IFPW AFGH+LP   F+K LA  G  VSFVSTP+N+QRLP I  +    ++L 
Sbjct  2     ASDLHIVIFPWSAFGHILPFFHFSKALAEAGVHVSFVSTPRNIQRLPAISPTLAPLINLV  61

Query  246   EIALPSVP---GLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
             E+  P++    GLPE  EATVD+   E++Q+LK AYD +  PF++ V    P  I+ DF 
Sbjct  62    ELPFPALDVKYGLPEGAEATVDI-PAEKIQYLKIAYDLLQHPFKQFVAEKSPNWIIADFC  120

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEE-LRSGKLR--PSPEHFTVPPGWFNFH  587
             +HW  +IAK YG+  ++LS+++ AT A++G P   +  G+ R   SPE  T PP W  F 
Sbjct  121   SHWAVDIAKEYGIPLIYLSIFSGATRAFMGHPGNFVGDGQKRFWGSPESLTSPPEWLTFP  180

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S VA R   A  M       +ASG+   +R++    GC  + VRSC EFEGEY+D+ +KL
Sbjct  181   SSVAFRSYEAKIMYPGIFGENASGIRDAERIAKTGCGCQAIAVRSCTEFEGEYMDVYQKL  240

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
               + V+ IGLLPP       I  GT    W+  FEWLDNQ  +SVVFVGFGSE K+   +
Sbjct  241   VSKQVIPIGLLPPEKPEKREITDGT----WNTIFEWLDNQEHESVVFVGFGSECKLTKDE  296

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             ++E+A  LELS++PFLW LRKP         +LP +F N+TS +G V +GWAPQ  +L+H
Sbjct  297   VYEIAYGLELSKLPFLWALRKPNWAATDLD-VLPPEFNNKTSEKGIVSIGWAPQLELLSH  355

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P+IGG LFHSGWG++IE+L +GH LI+LP +ADQGLNA+LLVEK +  EV R+EDGSFSR
Sbjct  356   PSIGGSLFHSGWGSVIETLQYGHCLIVLPFIADQGLNARLLVEKGLAVEVDRKEDGSFSR  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
               +A S+R  M S EG  ++ +A   A IF N  LH +YI++F++Y +  +
Sbjct  416   HDIAKSLRLAMVSEEGSQLKTRAKDAATIFQNRKLHQDYINRFVKYLKDGV  466



>ref|XP_006852901.1| hypothetical protein AMTR_s00033p00222830 [Amborella trichopoda]
 gb|ERN14368.1| hypothetical protein AMTR_s00033p00222830 [Amborella trichopoda]
Length=469

 Score =   438 bits (1127),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 227/473 (48%), Positives = 305/473 (64%), Gaps = 14/473 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  E  HV++ PWLAFGHM+P  E +K LA KG  VSF+STP+NLQRLPP P     +++
Sbjct  1     MERENVHVVMVPWLAFGHMIPFFELSKALAQKGITVSFISTPRNLQRLPPTPPELAPQIN  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             L    LPSV GLP+N EAT D+  + +V +LK AYD +  PFEELV +  P+ I+VDFA 
Sbjct  61    LVGFPLPSVEGLPKNAEATTDIPLK-KVPYLKKAYDGLRAPFEELVAKVSPDWIVVDFAP  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +W   IA +YGV   + +  + A   +LG P  L+      + +   V P W  F S +A
Sbjct  120   YWATSIASKYGVPCCWFNAVSTAFTVFLGPPHSLKGLCRTTTVDELMVVPEWITFPSTIA  179

Query  600   HRPDYAPTMMRN--THTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
              R   A   ++   T+  + SGVS   R+ S++EGC  V  R+ KEF+G+YIDL EKLY+
Sbjct  180   FRRHEAQAFLQQVLTNLHNGSGVSDWYRVQSILEGCRVVAFRTGKEFDGDYIDLFEKLYE  239

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSS-----SWSEAFEWLDNQRPKSVVFVGFGSEYKMP  938
             + V  +G LPP    + A + G ++S      WS AFEWLD Q  +SVVFVGFGSE ++ 
Sbjct  240   KSVFPLGFLPP----SQAEREGNDNSWIDENKWSTAFEWLDAQPLRSVVFVGFGSECRLS  295

Query  939   IHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNI  1118
             I Q+HE+A  LELS++PF+W LRKP   + G   +LP  F  RT  QG + +GWAPQQ I
Sbjct  296   IEQVHEIAYGLELSKLPFVWALRKPFETHDGL-EILPKGFEGRTERQGIICIGWAPQQRI  354

Query  1119  LAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DG  1295
              AHP+IGGCLFHSGWG+IIE+L  G  LILLP + DQG+NA+LL EK++G+EV R E DG
Sbjct  355   FAHPSIGGCLFHSGWGSIIEALSHGLALILLPFIIDQGINARLLGEKKLGFEVERNEDDG  414

Query  1296  SFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             SF++  +A ++R VM   EGE +R+KA +M  IFGN  L D Y+D F  + ++
Sbjct  415   SFTKVSIAKALRFVMVEEEGEPLRVKAREMKPIFGNKELSDMYLDGFANFLKN  467



>ref|XP_011036928.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=466

 Score =   437 bits (1125),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 219/470 (47%), Positives = 308/470 (66%), Gaps = 12/470 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             AE+ H+++ PW+AFGHM+P  + +  LA  G +VSFVSTP+N++RLP IP S  + ++  
Sbjct  2     AEKLHIVMLPWIAFGHMIPFFQLSIDLAKAGIKVSFVSTPRNIKRLPKIPPSLADLVTFV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             E  LPS+    LPE+ EATVD+   E++++LK ++D +  P ++ +   LP+ I++D   
Sbjct  62    EFPLPSLDNDILPEDGEATVDIPA-EKIEYLKISFDLLQHPLKQFIADQLPDWIIIDMIP  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFHS  590
             +W+ EIA+   V  +  SV++A    +LG PE L      +LRPS    T  P W +F S
Sbjct  121   YWMVEIAREKKVPLIHFSVFSAVAYVFLGHPECLVGDGQRRLRPSWTSMTSKPEWVDFPS  180

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA+R   A  +    +  +ASG++  +R+S ++ GC    VRSC EFEG+Y++L E+L 
Sbjct  181   SVAYRNQEAVGVFEGIYGGNASGITDSERVSKILHGCQAFAVRSCAEFEGDYLNLFERLI  240

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
              +PV+ +GLLP           G     W E F+WLD+Q+PKSVVFVGFGSEYK+   Q+
Sbjct  241   GKPVIPVGLLPQEKPERKEFTDG----RWGEIFKWLDDQKPKSVVFVGFGSEYKLTRDQV  296

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             +E+A  LELS +PFLW LRKPG  N    AL P+ F  RTS++G V +GWAPQ  IL HP
Sbjct  297   YEIAHGLELSGLPFLWALRKPGWANDDLDAL-PSGFGERTSDRGIVCMGWAPQMEILGHP  355

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFHSGWG++IESL FGH LILLP + DQ LNA+ LVEK +G EV R EDGSF+RD
Sbjct  356   SIGGSLFHSGWGSVIESLQFGHTLILLPFIVDQPLNARYLVEKALGVEVQRGEDGSFTRD  415

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSK  1457
              +A +++  M S EG+ +R KA++ A IFGN  LH D YI +F+++ + K
Sbjct  416   GIAKALKLAMVSEEGKSLREKASEAAAIFGNQKLHQDYYIGKFVDFLKKK  465



>ref|XP_010661830.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=473

 Score =   437 bits (1125),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 227/473 (48%), Positives = 302/473 (64%), Gaps = 11/473 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++ PW AFGHM+P    A  +A  G RVS VSTP+N+QRLP  P + +  +   E+
Sbjct  4     KMHVVMLPWSAFGHMIPFFHLAIAIAKAGIRVSLVSTPRNIQRLPKPPPNLSSLIKFVEL  63

Query  252   ALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
               P +     LPE  EATVD+   E++Q+LK A D +  PF++ V    P+ I++DF +H
Sbjct  64    PFPVMENGSILPEGAEATVDM-PFEKIQYLKAALDLLQHPFKQYVADTSPDWIIIDFFSH  122

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFHSL  593
             WV  IA+ +GV  V+ SV++A+TLA+LG    L      +LRPSPE  T PP W +F S 
Sbjct  123   WVSSIAREHGVPLVYFSVFSASTLAFLGPAYSLVGDGRRRLRPSPESMTSPPEWISFPSS  182

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA +   A  +     T +ASG +   R   +I  C  V VRSC E+EGEY++LL  L  
Sbjct  183   VAFKGYEAKAVYSGFFTDNASGTTDAARYVEIINSCQAVAVRSCVEYEGEYLNLLGNLMG  242

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +GLLPP       IQ   N  SW E F+WL+ Q+PKSVVFVGFGSE K+   Q+H
Sbjct  243   KPVIPVGLLPPEKPEGREIQ--INDGSWGENFKWLNEQKPKSVVFVGFGSECKLTKDQVH  300

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PFLW LRKP        AL P+ F +RTS +G V +GWAPQ  IL HP+
Sbjct  301   EIAYGLELSELPFLWALRKPNWAIEDADAL-PSGFSDRTSGRGMVCMGWAPQMEILEHPS  359

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             IGG LFHSGWG++IE+L F H L++LP++ DQGLNA+LLVEK +  EV RREDG+FSR+ 
Sbjct  360   IGGSLFHSGWGSVIETLQFAHCLVVLPIIIDQGLNARLLVEKGLAVEVERREDGTFSRED  419

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKILTQ  1469
             +  S+R  M S EGE +R+ A   A IFG+  LH D+YI  F+EY ++ I  Q
Sbjct  420   ITKSLRLAMVSEEGEKLRIHAKGAAAIFGDPKLHQDHYIGGFVEYLKNGIAKQ  472



>ref|XP_002302598.1| hypothetical protein POPTR_0002s16380g [Populus trichocarpa]
 gb|EEE81871.1| hypothetical protein POPTR_0002s16380g [Populus trichocarpa]
Length=467

 Score =   437 bits (1123),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/471 (46%), Positives = 304/471 (65%), Gaps = 12/471 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A   H++IFPW AFGH+LP   F+K LA  G  VSFVSTP+N+QRLP I  +    ++L 
Sbjct  2     ASDLHIVIFPWSAFGHILPFFHFSKALAEAGVHVSFVSTPRNIQRLPAISPTLAPLINLV  61

Query  246   EIALPSVP---GLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
             E+  P++    GLPE  EAT D+   E++Q+LK AYD +  PF++ V    P  I+VDF 
Sbjct  62    ELPFPALDVKYGLPEGAEATADI-PAEKIQYLKIAYDLLQHPFKQFVAEKSPNWIIVDFC  120

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEE-LRSGKLR--PSPEHFTVPPGWFNFH  587
             +HW  +IAK YG+  ++LS+++    A++G P   +  G+ R   SPE  T PP W  F 
Sbjct  121   SHWAVDIAKEYGIPLIYLSIFSGVMGAFMGHPGYFVGDGQKRYWGSPESLTSPPEWITFP  180

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S VA R   A  M    +  +ASG+   +R++  + GC  + VRSC EFEGEY+D+ +K+
Sbjct  181   SSVAFRSYEAKNMYPGIYGENASGIRDAERVAKTVSGCQAIAVRSCIEFEGEYMDVYQKI  240

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
               + V+ IGLLPP       I  GT    W+  FEWLDNQ  +SVVFVGFGSE K+   +
Sbjct  241   MSKQVIPIGLLPPEKPEEREITDGT----WNTIFEWLDNQEHESVVFVGFGSECKLTKDE  296

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             ++E+A  LELS++PFLW LRKP         +LP +F N+TS +G V +GWAPQ  +L+H
Sbjct  297   VYEIAYGLELSKLPFLWALRKPNWAATDLD-VLPPEFNNKTSEKGIVSIGWAPQLELLSH  355

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P+IGG LFHSGWG++IE+L +GH LI+LP +ADQGLNA+LLVEK +  EV R+EDGSF+R
Sbjct  356   PSIGGSLFHSGWGSVIETLQYGHCLIVLPFIADQGLNARLLVEKGLAVEVDRKEDGSFTR  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
               +A S+R  M S EG  ++ +A   A IF N  LH +YI++F++Y +  +
Sbjct  416   HDIAKSLRLAMVSEEGSQLKTRAKDAATIFQNRKLHQDYINRFVKYLKDGV  466



>ref|XP_010938324.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=469

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 293/470 (62%), Gaps = 7/470 (1%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  E+ H+ + PWLAFGHM+P L  A  LA  G RVSF+STP+N+QRLP IP   T  ++
Sbjct  1     MVEERLHIAMLPWLAFGHMIPFLHLAVALATAGLRVSFLSTPRNIQRLPKIPPHLTSLIT  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
               ++ LP V GLP+  EATVDL   E V  LK AYD +    ++ +  + P+ ++ DF  
Sbjct  61    FIQLPLPRVDGLPDQAEATVDLPTDE-VPLLKIAYDLLQNSVKKFLAEESPDYVIHDFLQ  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFHS  590
             +W    A+  GV ++F SVY+A TLA+ G PE L      KLRP+PE  T PP W    S
Sbjct  120   YWAAAAARDMGVQSIFFSVYSATTLAFFGPPEALTEDGRRKLRPTPESLTSPPDWLPSGS  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R   A        T ++SG++   R   V+E C  V +R+C E+EG+Y++++ +LY
Sbjct  180   TVAFRRREAEVFYSAAFTMNSSGITDIDRFRLVVESCTAVAIRTCPEYEGDYLEIVRRLY  239

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++PV+ +GL+ P      A         W+  F WLD+Q PKSVVFV FGSEYKM   ++
Sbjct  240   RKPVIPVGLILPS---PPAAGGEEGDDRWARVFRWLDSQTPKSVVFVSFGSEYKMERREL  296

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             HELA  LEL+ +PFLW+LR+P   N      LP  F++RT ++G +  GWAPQ  ILAHP
Sbjct  297   HELAHGLELANVPFLWVLRRPSWCNGSDEEALPAGFIDRTKSRGTLCFGWAPQLEILAHP  356

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             ++GG LFHSGWG+IIE+L  GH L++LP + DQ LNA+LLVEK I  EV R++DGSF+RD
Sbjct  357   SVGGSLFHSGWGSIIETLRHGHTLVVLPCMVDQSLNARLLVEKGIAVEVERQDDGSFTRD  416

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
              +  ++   M S +GE +R K  +MA +F +  L D Y+ +F++Y    +
Sbjct  417   GIVKALDVAMVSGQGEELRTKTREMATLFADQELDDKYVREFVDYLLKAV  466



>ref|XP_006852904.1| hypothetical protein AMTR_s00033p00224400 [Amborella trichopoda]
 gb|ERN14371.1| hypothetical protein AMTR_s00033p00224400 [Amborella trichopoda]
Length=467

 Score =   432 bits (1111),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 301/465 (65%), Gaps = 2/465 (0%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  E  HV +  + AFGH++P LE +K LA KG +VSF+STP+N+ RLP IP +    ++
Sbjct  1     MTDEVLHVAVLSFSAFGHLIPFLELSKILAQKGHKVSFISTPRNIDRLPKIPPNLATLIN  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             L +  LP   GLPEN EAT+DL   E++QFL  AYD++  P E  V  + P+ ++ D   
Sbjct  61    LVKFELPPTHGLPENAEATMDL-PIEKLQFLTAAYDKLHEPIENFVSEESPDWLIHDLFA  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
              W P +A ++G+ + F SV+TA+TL + G P+ L     R +PE +   P W  F S+VA
Sbjct  120   PWAPCLAAKFGIPSCFCSVFTASTLVFFGPPDGLVGAHQRLTPESYAKAPEWVPFPSIVA  179

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
              R   A  + +  +  +ASG+SS QR +  IEGCDFV VRSC EFEG+Y++LL +LY +P
Sbjct  180   LRMHEAARVSQLGNKVEASGMSSHQRFAMTIEGCDFVAVRSCYEFEGKYLELLRELYGKP  239

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL  GL+P           G N + +S  F WLD +   S+VFVGFG+E ++ + ++HE+
Sbjct  240   VLPFGLVPSPPVEKRGAGEGGNGNEYSRIFSWLDEKAKGSIVFVGFGTETRLSMDEVHEM  299

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PF+W+L+KP     G   LLP  F  R SN+G V +GWAPQ  +LAHPAIG
Sbjct  300   AFGLELSGLPFVWLLKKPQEGCEGMD-LLPQGFETRISNRGVVHVGWAPQAQLLAHPAIG  358

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVA  1319
             GCLFHSGWG++IE+L +GH LI+LP V DQGLNAKLLVEK I  E+ R +DGSF+++ VA
Sbjct  359   GCLFHSGWGSVIEALQWGHTLIVLPFVFDQGLNAKLLVEKGIALEIERNKDGSFTKEAVA  418

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
               +R  M   EGE +R+KA +   IF +  LHD Y++ FI+Y Q 
Sbjct  419   KGLRQAMVEEEGEPLRVKAREAEAIFADRGLHDRYMNDFIKYLQD  463



>ref|XP_010938322.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=469

 Score =   431 bits (1109),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 294/473 (62%), Gaps = 7/473 (1%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  E+ H+ + PWLAFGHM+P L  A  LA  G RVSF+STP+N+QRLP IP   T  ++
Sbjct  1     MVEERLHIAMLPWLAFGHMIPFLHLAVALATAGLRVSFLSTPRNIQRLPKIPPHLTSLIT  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
               ++ LP V GLP+  EATVDL   E V  LK AYD +    ++ +  + P+ ++ DF  
Sbjct  61    FIQLPLPRVDGLPDQAEATVDLPTDE-VPLLKIAYDLLQNSVKKFLAEESPDYVIHDFLQ  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFHS  590
             +W    A+  GV ++F SVY+AATLA+ G PE L      KLRP+PE  T PP W    S
Sbjct  120   YWAAAAARDMGVQSIFFSVYSAATLAFFGPPEALTEDGRRKLRPTPESLTSPPDWLPSGS  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R   A        T ++SG++   R   V+E C  V +R+C E+EGEY++++ +LY
Sbjct  180   TVAFRRREAEVFYSAAFTMNSSGITDIDRFRLVVESCTAVAIRTCPEYEGEYLEIVRRLY  239

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++PV+ +GL+ P   L  + + G +   W+    WLD Q P SVVFV FGSEYKM   ++
Sbjct  240   RKPVIPVGLILPS-PLAASGEEGDDR--WARVIRWLDAQTPMSVVFVSFGSEYKMERREL  296

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             HELA  LEL+ +PFLW+LR+P   N      LP  F++RT  +G +  GWAPQ  ILAHP
Sbjct  297   HELAHGLELANVPFLWVLRRPSWCNGSDEEALPAGFIDRTKGRGTLCFGWAPQLEILAHP  356

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFHSGWG+IIESL  GH L++LP + DQ LNA+LLVEK I  EV R+ DGSF+RD
Sbjct  357   SIGGSLFHSGWGSIIESLRHGHALVVLPCMVDQSLNARLLVEKGIAVEVERQGDGSFTRD  416

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
              +  ++   M S +GE +R K  +MA +F +  L D Y+ +F++Y    + T 
Sbjct  417   GIVKALDMAMVSGQGEELRTKTRKMATLFADQELDDKYVREFVDYLLKAVDTN  469



>ref|XP_002275824.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=465

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/471 (45%), Positives = 300/471 (64%), Gaps = 11/471 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A   HV++ PWLAFGHM+P L+ A  LA  G  VSF+STP+N+QRLP +  +    ++L 
Sbjct  2     AGNMHVVMVPWLAFGHMIPHLQLAIALAEAGIHVSFISTPRNIQRLPKLSPTLLPLINLV  61

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              + LP+V GLPE CEATV+L   E++++LK AY  +  P +  +    P+ ++VD    W
Sbjct  62    ALPLPAVLGLPEGCEATVEL-PFEKIKYLKIAYALLKQPLKRFLEGASPDWMIVDLPVDW  120

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFHSLV  596
               E A+   V  +  +++T+A+  + G PE L      ++RPSPE  T PP W  F SLV
Sbjct  121   AAEAARECAVPLLAFTMFTSASNVFFGPPEYLTGDGQRRVRPSPESMTTPPEWVTFPSLV  180

Query  597   AHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
             A+R   A       +  ++SG +   R+++ +  CD V +RSC+EFEGEY+ + +K+ ++
Sbjct  181   AYREFEARGAHPGFYGDNSSGTTDADRIATTLSACDAVAIRSCREFEGEYLSIYQKMLRK  240

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+ +GLLP   +     Q      +W + F+WLD Q+PKSVVFVGFGSE K+   Q+HE
Sbjct  241   PVIPVGLLPREGSHEITNQ------AWRKIFKWLDEQKPKSVVFVGFGSECKLSQDQVHE  294

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             +A  LELS + FLW LRKP        AL P+ + +RTS +G V + WAPQ  ILAHP+I
Sbjct  295   IAYGLELSELTFLWALRKPNWAIEDVDAL-PSGYSDRTSGRGVVCMEWAPQMEILAHPSI  353

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMV  1316
             GG LFHSGWG+ IE++ FGH  I+LP V DQGLNA+LLVEK +  E+ R +DGSFSRD +
Sbjct  354   GGSLFHSGWGSAIETMQFGHCPIVLPFVIDQGLNARLLVEKGMAVEIERGDDGSFSRDDI  413

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
             A S+R  M   EGE +R++A ++A IFG+  LH +YID+ ++Y +  I  +
Sbjct  414   AKSLRLAMVMEEGEKLRIRAREVAMIFGDQKLHQSYIDELVKYLKGGIAKE  464



>ref|XP_002275850.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=468

 Score =   414 bits (1064),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 219/468 (47%), Positives = 301/468 (64%), Gaps = 14/468 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++ PWLAFGHM+P L+ +  LA  G RVSFVSTP+N++RLP +P      +S  E+ L
Sbjct  5     HVVMVPWLAFGHMIPFLQLSIALAKAGVRVSFVSTPRNIRRLPKLPPDLEPLISFVELPL  64

Query  258   PSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
             P+V G  LPE+ EATVD+   E++Q+LK AYD +  PF++ V    P+ I+ D   HWV 
Sbjct  65    PAVDGGLLPEDAEATVDV-PTEKIQYLKLAYDLLQHPFKKFVADQSPDWIISDTMAHWVV  123

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSG----KLRPSPEHFTVPPGWFNFHSLVA  599
             E A+ + + ++   ++++A   ++G P E   G    ++RPSPE  T  P W +F S VA
Sbjct  124   ETAEEHRIPSMAFILFSSAAAVFVG-PNECLIGEGRRRVRPSPESLTSSPEWVSFPSSVA  182

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
              R   A T        + SG++   R++ V   C  V VRSC EFEGEY+++ EK+  +P
Sbjct  183   FRGYEARTCYAGFFGENVSGITDAHRVAKVCHACKAVAVRSCIEFEGEYLNIHEKIMGKP  242

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             V+ +G LPP           T   SWSE F+WLD Q+PKSVVFVGFGSE K+   Q+HE+
Sbjct  243   VIPVGFLPPEKQGGRE----TTEGSWSEIFKWLDEQKPKSVVFVGFGSECKLTKDQVHEI  298

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PFLW LRKP        AL P+ F +RTS +G V +GWAPQ  ILAHP+IG
Sbjct  299   AYGLELSELPFLWALRKPNWTMEDIDAL-PSCFSDRTSGKGIVWMGWAPQMEILAHPSIG  357

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVA  1319
             G LFHSGWG++IE+L FGH L+LLP + DQGLNA+LLVEK +  E+ R EDGSFSR+ +A
Sbjct  358   GSLFHSGWGSVIETLQFGHCLVLLPFIVDQGLNARLLVEKGLAVEIERSEDGSFSREDIA  417

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNL-HDNYIDQFIEYFQSKI  1460
              S+R  M S EGE +R +A + A IF +  L  ++YI   ++Y ++++
Sbjct  418   KSLRVAMVSEEGEKLRARAREAAAIFIDKRLQQEHYIGGLVKYLKAEV  465



>ref|XP_010910495.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=472

 Score =   413 bits (1062),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 294/464 (63%), Gaps = 7/464 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLAFGHMLP LE +K LA +G R+SF+STP+N++RLP IP      + L  + L
Sbjct  7     HVVVFPWLAFGHMLPFLELSKSLAKRGHRISFLSTPRNIRRLPNIPPQIASLVDLVSLPL  66

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRR--DLPELILVDFATHWVP  431
             P V GLPE+ EAT DL   E VQ+LK A+D +  PF   ++     P+ I+ DF  HW+ 
Sbjct  67    PKVDGLPEDAEATTDLPPPE-VQYLKKAFDGLDEPFARFLQEVSPKPDWIIHDFCHHWIS  125

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
              IA R  V   F S+  +++L +LG P E++ G LR +PE FT PP W +F S  A R  
Sbjct  126   PIASRSKVPCAFFSIIPSSSLVFLGPPSEMKLGGLRRTPEQFTKPPEWISFPSSAAFRLH  185

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY-KRPVLA  788
              A   M + +  +ASG S  QRL  +I+GC+ V +RSCKEFE +++ LLE+LY K+ V+ 
Sbjct  186   EARVFMEH-YRDNASGFSDIQRLERIIQGCELVAIRSCKEFESDWLALLEELYEKKTVVP  244

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +GLLPP +         TN++  ++ FEWL+ Q P SVV+V  GSE  + +  +HELA  
Sbjct  245   VGLLPPHVQERIE-DVHTNTTGAAQVFEWLNGQTPGSVVYVALGSEAMLSVELMHELALG  303

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LELS +PF+W LRKP     G   +LP  F +RT   G V  GW PQ ++LAHP++GG L
Sbjct  304   LELSEVPFVWALRKPAGMGAGDVEILPEGFEDRTRGLGVVAKGWIPQLSVLAHPSVGGFL  363

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANS  1325
              H GW +IIE L FGH LILLP+  DQGL A+++ EK+IG EVPR  EDGSFS++ VA +
Sbjct  364   THCGWSSIIEGLQFGHALILLPLFVDQGLIARIMEEKKIGLEVPRNEEDGSFSKEGVAKA  423

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             IR +M   E E  R KA  +  +F ++   + Y+D F+   +++
Sbjct  424   IRLIMVEEEAEPFRCKAGDLKEVFSDNGSQERYVDNFVRCLKNR  467



>ref|XP_008807755.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=473

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/471 (45%), Positives = 291/471 (62%), Gaps = 13/471 (3%)
 Frame = +3

Query  54    ITMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTER  233
             + M  ++ H+ + PWLAFGHM+P L  A  LA  G RVSF+S+P+N +RLP IP   T  
Sbjct  1     MAMGEQRLHIAMLPWLAFGHMIPYLHLAFALATAGHRVSFLSSPRNNRRLPKIPPHLTPL  60

Query  234   LSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             ++  ++ LP V GLPE  EATVD+   ++   LK AYD +  P ++ +  + P++IL DF
Sbjct  61    IAFVDLPLPRVDGLPEEAEATVDV-PADKGPLLKIAYDFLQNPVKKFLADESPDVILHDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL-RSGKLR--PSPEHFTVPPGWFNF  584
               +WVP  A+  GV  V L  + AA+  + G PE L   G+ R  PSPE  T PP WF  
Sbjct  120   LPYWVPAAARDLGVLPVLLFAFNAASTGFTGPPEVLAEEGRRRRWPSPESMTSPPEWFPP  179

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              S VA R   A        T + SG++  +R    +EGC  + +R+C E+EGEY+D+L +
Sbjct  180   GSTVAFRRREAEQFYSEVFTTNTSGIADVERFRLAVEGCTAIALRTCPEYEGEYLDVLRR  239

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTNSSS---WSEAFEWLDNQRPKSVVFVGFGSEYKM  935
             +Y++PV  +GL+P       A  P  ++     W + F WLD Q PKSVVFV FGSEYK+
Sbjct  240   IYRKPVFPVGLIP------LATSPAASADRHGRWGQIFGWLDAQPPKSVVFVSFGSEYKL  293

Query  936   PIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
                ++ ELA  LELS + FLW LR+P     G    LP  F  RT  +G V  GWAPQ  
Sbjct  294   SESEVRELAYGLELSNVRFLWALRRPAWVTGGDEEALPKGFAARTEGRGAVCFGWAPQLE  353

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDG  1295
             ILAHP++GG LFHSGWG+IIE+L +G+ LI+LP + DQGLNA+LLVEK I  EV R +DG
Sbjct  354   ILAHPSVGGSLFHSGWGSIIETLRYGNALIVLPNIFDQGLNARLLVEKGIAVEVERGDDG  413

Query  1296  SFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             S+ RD VA +++ VM S E EG+R KA +MA +F +  LHD Y+ +FI + 
Sbjct  414   SYDRDGVAKALQMVMLSNEVEGLRRKAREMAAVFADKELHDRYLKEFINFL  464



>ref|XP_002511902.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF50571.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=466

 Score =   411 bits (1057),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 214/467 (46%), Positives = 294/467 (63%), Gaps = 9/467 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A+  HVMI PW AFGH++P  + +  LA  G  VSFVSTP N++RLP IP +    + L 
Sbjct  2     AKNLHVMILPWSAFGHLIPFFQLSIALAKAGVSVSFVSTPNNIRRLPKIPQNLETLIKLV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
             EI LP++    LP   EATVDL   +++  LK AYD +  P ++ V     + I++D   
Sbjct  62    EIPLPTLESQSLPIGAEATVDLPS-DKIDHLKIAYDLLQYPLKQYVMDQQLDWIIIDVIP  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             HW+ EIA    +  +  SVY+A+   +L  P  L    +R S E  T P    NF S VA
Sbjct  121   HWMVEIAVEMKIPLMHFSVYSASAYLFLCDPGCLAGDNMRTSWESMTSPAERINFPSSVA  180

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R   A       +  +ASG++  +R++ ++  C  + +RSC EFE + ++  +KL  +P
Sbjct  181   YRKHEAIGAFEGIYGTNASGITDAERVAKILNSCQAIAIRSCTEFEIDSLNSFQKLMGKP  240

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             V+ +GLLP        I  G    SW E F+WLD Q+ KSVVFV FGSE+K+   Q++E+
Sbjct  241   VVPVGLLPLEKPKAREITDG----SWGEVFKWLDQQKTKSVVFVSFGSEFKLSQEQVYEI  296

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PFLW LRKP   N G+  +LP+ F  RTS +G V +GWAPQ  IL H AIG
Sbjct  297   AYGLELSGLPFLWALRKPSWANHGFD-VLPSGFRERTSGKGVVSIGWAPQMEILGHRAIG  355

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVA  1319
             G LFHSGWG+IIE+L FGH L+LLP + DQ LNA+LLVEKE+G EV R EDGSF+RD VA
Sbjct  356   GSLFHSGWGSIIETLQFGHSLVLLPFIIDQPLNARLLVEKELGVEVERSEDGSFNRDGVA  415

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSK  1457
             N++R  M S EG+ +R  A++ A +FGN+NLH D YI++F+E+ ++K
Sbjct  416   NALRLAMVSEEGKKLRAGASEAAQVFGNNNLHQDYYIEKFVEFLRNK  462



>ref|XP_010905696.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=474

 Score =   409 bits (1051),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 215/477 (45%), Positives = 294/477 (62%), Gaps = 7/477 (1%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  E+ HV + PWLAFGHM+P L  A  LAA G RVSF+STP+N +RLP IP   T  ++
Sbjct  1     MGEERLHVALLPWLAFGHMIPFLHLAVALAAAGLRVSFLSTPRNNRRLPKIPPHLTSLIT  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
               ++ LP + GLP+  EATVD+  +++V  LK A D +  PF++ + +  P+ +L DF  
Sbjct  61    FVDLPLPPIDGLPDQAEATVDI-PEDKVPLLKNACDLLQDPFKDFLAQKSPDFLLHDFFH  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFHS  590
             HW    A   GV +VF  V++A   A+ G PE L      K  PSPE  T PP W    S
Sbjct  120   HWAVAAAHDVGVPSVFFVVFSATATAFSGPPEALMEDGGKKSWPSPESMTSPPEWLPSGS  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R   A  +  +     + G++   R+   +EGC  + VRSC+E+EGEY+D++ +++
Sbjct  180   TVAFRRREAELLYLSAFAMTSMGLTDVDRMRLAVEGCAALAVRSCREYEGEYLDVVRRIF  239

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++PV+ +GLLPP     T    G    +W   F WLD+Q PKSVVFV FGSEYK+   ++
Sbjct  240   RKPVIPVGLLPPPPPPPTG---GDRDDNWGRIFGWLDDQPPKSVVFVSFGSEYKLTESEV  296

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             HELA  LELS +PFLW LR+P   +      LP  F  RT  +G V  GWAPQ  ILAHP
Sbjct  297   HELAYGLELSNVPFLWALRRPSWASGSDEEALPEGFQTRTEGRGVVSFGWAPQLEILAHP  356

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFHSGWG+IIE+LG+GH L+++P + DQGLNA+LLVEK I  EV R +D  F R+
Sbjct  357   SIGGSLFHSGWGSIIETLGYGHALVVMPNIIDQGLNARLLVEKGIAVEVERGDDDCFHRN  416

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKRG  1481
              +A +++  M S EGEG+R KA + A +F + +LHD YI +F++Y       Q   G
Sbjct  417   EIAKALQMAMVSSEGEGLRRKARETATVFADRDLHDKYIKEFVDYLLKTRNNQSIEG  473



>ref|XP_010934416.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=465

 Score =   408 bits (1048),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 212/470 (45%), Positives = 294/470 (63%), Gaps = 14/470 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M      ++ FPWLAFGHMLP L+ +K LA +G R+SF+STP+NLQRLP IP      + 
Sbjct  1     MEGGSLRIVFFPWLAFGHMLPFLDLSKSLAKRGHRISFLSTPRNLQRLPKIPPDLAPLIH  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDF  413
                + LP V GLPE  E+T D+ + ++VQFLK A+D +  PF + +      P+ I+ DF
Sbjct  61    FVSLPLPKVEGLPEAAESTTDV-RPDEVQFLKKAFDGLAIPFSKFLEESSPKPDWIIHDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
               HW+P IA  + +   FLS+  A+ +A++G P E++    R +PE FT PP W +F + 
Sbjct  120   GHHWLPPIASGFHIPCAFLSILPASFIAFVGPPSEMKRSSRR-TPEQFTKPPEWISFPTS  178

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+    A  M+      +ASG++  QR    +EGC FV  RSC EFE +++ LLE+LYK
Sbjct  179   VAYHLHEAKWMV-EAFKANASGIADLQRFCLTVEGCHFVAFRSCFEFESDWLRLLEELYK  237

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEA--FEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
             +PV+ +GLLPP+      +Q G+      +A  FEWLD Q PKSVV+V  GSE  + I  
Sbjct  238   KPVIPVGLLPPQ------VQEGSPDDVHGKARIFEWLDTQAPKSVVYVALGSEAMLSIEL  291

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             +HELA  LELS++PFLW LRKP         +LP  F  RT  QG V  GW PQ  +LAH
Sbjct  292   LHELALGLELSKVPFLWALRKPAGMAGDDADILPEGFEERTEGQGVVAKGWIPQIKVLAH  351

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFS  1304
              ++GG L H GWG+IIE L FGH L+LLP+  DQGLNA+++ EK+IG E+ R E DGSF+
Sbjct  352   ASVGGFLTHCGWGSIIEGLRFGHGLMLLPIAVDQGLNARIMGEKKIGLEIQRNEVDGSFN  411

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R+ VA +IRSVM   EGE  R KA ++ ++F + +  + Y++ FI + + 
Sbjct  412   RESVAKAIRSVMVEEEGEPFRFKAQELQHVFADKDSQERYMENFIRHLRD  461



>gb|AGU14093.1| UDP-glycosyltransferase [Cicer arietinum]
Length=467

 Score =   406 bits (1043),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 214/470 (46%), Positives = 299/470 (64%), Gaps = 10/470 (2%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA +  HV++ PWLAFGH++P  + +  LA  G  VS++STPKN+QRLP +P++ +  ++
Sbjct  1     MAEDIIHVVMLPWLAFGHLIPFFKLSIALAKSGVHVSYISTPKNIQRLPKLPSTLSHLIN  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L EI+LPS+    LPE  EAT+D+   +++Q+L+ AYD++  P ++L+   LP+ I+ D+
Sbjct  61    LVEISLPSLNTNLLPEGAEATMDIPI-DKIQYLEEAYDQLQSPVKQLISNWLPDWIICDY  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             + HW+ EIA+ + V  ++ SV +AATL +LG P    + K R SPE  T PP W  F S 
Sbjct  120   SPHWIVEIAQEFHVKLIYYSVVSAATLVFLGPPS--NTMKARFSPESLTAPPEWVTFPSS  177

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+  + A       H  +AS VS  +RL  VI     VI  SC E EGEY+ L  KL +
Sbjct  178   VAYTRNEAIAFSAIVHQKNASEVSGIERLVKVIGAAKAVICCSCYEIEGEYLHLYNKLVQ  237

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ IGLLP  +      +    S S S+ FEWLD Q  KSVVFVGFGSE K+   Q+ 
Sbjct  238   KPVIPIGLLPVEMPQREIFE---ESRSESKIFEWLDKQETKSVVFVGFGSECKLSKEQVF  294

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LE+S++ FLW LRKP   +      LP  F  RTS +G V +GW PQQ ILAH +
Sbjct  295   EIAYGLEVSKLSFLWALRKPNW-SCNDQDFLPIGFGERTSERGLVCMGWIPQQEILAHSS  353

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             IGGCLFHSGWG+ IE+L F + L++LP + DQ LNA+LLV+K +  EV R EDG FSR+ 
Sbjct  354   IGGCLFHSGWGSAIETLQFENNLVVLPFIIDQPLNARLLVDKGLAIEVKRYEDGRFSRNE  413

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             +A S+R  M   EG+ +R+K  + A I GN  LH D+YI +F+++ +  I
Sbjct  414   IAKSLRQAMVLVEGKELRVKTREAAVIVGNLKLHQDHYIAEFVQFLKDGI  463



>ref|XP_010277530.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=481

 Score =   405 bits (1040),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 290/470 (62%), Gaps = 14/470 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M     HV+I PWLAFGH++P L+ +  LA  G RVSF+STP+N+QRLP +P +    + 
Sbjct  1     MTNNNLHVVIVPWLAFGHLIPFLQLSMALAKAGIRVSFISTPRNVQRLPKVPPNLAALVR  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
               E+ LP+V GLP   EATVD+   E +Q LKTAYD +    ++ V  + P+ I+ DF  
Sbjct  61    FVELRLPTVEGLPLGAEATVDVSMDE-IQHLKTAYDLLRHQVKQFVANESPDWIIQDFIP  119

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRS---GKLRPSPEHFTVPPGWFNFHS  590
              WV EIA+ YGV  +  SVY+AATL + G  + L +    K   SPE    PP W  F S
Sbjct  120   FWVAEIAREYGVPLITFSVYSAATLGFHGPLDYLTNDGHAKYWTSPESMMFPPEWVTFPS  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R   A          +AS ++  +R+   +E C  V +RSC E+E +Y++L+EK++
Sbjct  180   SVAFRRHEANAAFAGFFGQNASSITDNERVVVAVEACQAVAIRSCTEYEPDYLNLVEKIW  239

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             +RPV+ +GLLPP     ++ +       W + F+WLD ++P++VVFV FGSE K+   Q+
Sbjct  240   RRPVIPVGLLPP---APSSTEAKEREGEWGKIFKWLDGEKPRTVVFVAFGSECKLSRDQV  296

Query  951   HELASALELSRMPFLWILRKP--GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILA  1124
             +E+A  LELS +PFLW LRKP   +D       LP++F  RT  +G V +GWAPQ  IL 
Sbjct  297   YEIAHGLELSNLPFLWALRKPTWAVDEDD---ALPSEFRRRTEGRGVVCMGWAPQLEILG  353

Query  1125  HPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSF  1301
             HP+IGG LFHSGWG+IIE+L  GH L++LP VADQGLNA+ LVEK +  EV R  EDG F
Sbjct  354   HPSIGGSLFHSGWGSIIETLQHGHALVVLPFVADQGLNARQLVEKGLAVEVERSEEDGRF  413

Query  1302  SRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYF  1448
                 VA +++ VM    GE +R +AA M  +FG+  LH D+YI   ++Y 
Sbjct  414   EGSDVAEALKKVMVDEGGESLRARAASMRAVFGDVKLHQDHYIGGLVQYL  463



>ref|XP_010934404.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=491

 Score =   404 bits (1037),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 292/464 (63%), Gaps = 11/464 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLAFGHMLP L+ +K LA +G R+ F+STP+N+QRLP IP      +    + L
Sbjct  32    HIAVFPWLAFGHMLPFLQLSKSLAKRGHRIYFLSTPRNIQRLPKIPPHLAPLIDFVSLPL  91

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDFATHWVP  431
             P V GLPEN EAT DL +  QVQ+LK A+DR+G P E  +      P+ I++DFA HWVP
Sbjct  92    PKVEGLPENAEATPDLPKY-QVQYLKVAFDRLGGPLENFLEEASPKPDWIILDFACHWVP  150

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             ++A ++GV     SV+TA  LA+    E L  G      E FT PP   +F + V+ R  
Sbjct  151   KLASKFGVPCALFSVFTAPFLAFWRPSESLSRGG-DDVLEEFTSPPKGISFETSVSFRLH  209

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
              A  ++      +ASGV    RL   IEGC  V  RSC+E   +++  L++LYK+PV+ I
Sbjct  210   EARRVIHGYEN-NASGVCDADRLLLTIEGCRVVAPRSCRELHSDWLCYLQELYKKPVIPI  268

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GLLPP  +    +   ++ S+    F WLD Q P SVV+V FGSE  +    +HELA  L
Sbjct  269   GLLPPAPDDGAGVDATSDESN---VFHWLDKQAPGSVVYVAFGSETVLSTEILHELAFGL  325

Query  972   ELSRMPFLWILRKPGIDNPGY-PALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             ELS++PFLW +RKP +D  G    +LP  F +RT + G + +GW  Q  +LAH ++GGCL
Sbjct  326   ELSQVPFLWAIRKP-VDVAGEGKEVLPEGFEDRTRDHGVIAMGWIDQLKVLAHASVGGCL  384

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANS  1325
              HSGW ++IESL FGHPLI+LP + DQG+ A+++ E+ IG EVPR  EDGSFSR+ +A +
Sbjct  385   THSGWSSVIESLQFGHPLIMLPFIVDQGIIARVMEERRIGIEVPRNEEDGSFSREDLAKA  444

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             IR VM   EG   R +A ++  IFGN + H+ Y+++FI Y +++
Sbjct  445   IRLVMVEEEGNQFRSEATELKEIFGNKDYHERYVEEFILYLRNQ  488



>ref|XP_006444980.1| hypothetical protein CICLE_v10019998mg [Citrus clementina]
 ref|XP_006491164.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Citrus sinensis]
 gb|ESR58220.1| hypothetical protein CICLE_v10019998mg [Citrus clementina]
Length=473

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 208/479 (43%), Positives = 297/479 (62%), Gaps = 18/479 (4%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLP-PIPASFTERL-S  239
             A + HV++ PW AFGH++P  + +  LA  G +VSF+STPKN+QRLP P P S    L +
Sbjct  2     ARKLHVVMLPWSAFGHLMPFFQLSIALAKSGVKVSFISTPKNIQRLPKPAPESEVAALIN  61

Query  240   LREIALPSVPGL------PENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELI  401
               E  LP+   L      PE  EATVD+   E +Q+LK AYD +  PF++ V +   + I
Sbjct  62    FVEFPLPASAALDDKLLLPEGAEATVDIPS-ENIQYLKIAYDLLQHPFKQFVAQQSVDWI  120

Query  402   LVDFATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPG  572
             +VD  +HW  +IA+ Y V  +  S Y+AA   ++ +PE L      ++RPS E  T  P 
Sbjct  121   IVDVMSHWAGKIAQEYHVPLLLFSAYSAAAFQFIANPECLVGDGQKRVRPSAESLTAVPE  180

Query  573   WFNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYID  752
             W +F S VA R   A  M    +  +ASG++   R + ++  C  + +RSC EFEGEY++
Sbjct  181   WVDFPSSVALRTFDAIGMHHGFYGMNASGITDAHRTAEILHSCQAMAIRSCPEFEGEYLN  240

Query  753   LLEKLYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYK  932
             LLEKL  +PV+ +GLL P  N              S+ F+WLD Q+P+SVVFVGFGSE K
Sbjct  241   LLEKLTGKPVIPVGLLTPEPN-----SAKGRDHQISKIFQWLDEQKPRSVVFVGFGSECK  295

Query  933   MPIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQ  1112
             +   Q++E+A  LELS +PFLW LRKP        AL P  F +    +G V +GWAPQ 
Sbjct  296   LSKDQVYEIAYGLELSGLPFLWALRKPEWATDDVDAL-PLGFADTIRGKGIVSIGWAPQL  354

Query  1113  NILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED  1292
              ILAHP+IG  LFH+GWG++IE+L FGH L++LP++ DQ LNA+LLV+K++  +V R++D
Sbjct  355   EILAHPSIGTSLFHAGWGSVIETLQFGHSLVVLPLIIDQPLNARLLVDKDLAVQVERKDD  414

Query  1293  GSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
             GSF+RD +A ++R    S EGE +R++A + AN F +  LHD+Y  +F+EY +  + T+
Sbjct  415   GSFTRDGIAKALRLATVSEEGEKLRVRAREAANTFNDKKLHDDYSVRFVEYLKINVATK  473



>ref|XP_010254573.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=483

 Score =   402 bits (1033),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 221/475 (47%), Positives = 285/475 (60%), Gaps = 18/475 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++FPWLAFGHM+P LE +K+LA +G RVSFVSTP+N+QRLP IP S +  + L E+
Sbjct  12    ELHVVMFPWLAFGHMMPFLELSKRLAERGHRVSFVSTPRNIQRLPKIPPSLSSLVHLVEL  71

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              L    GLPEN EATVDL    +VQ+LK A+D +  P    +    P+ IL DFA HW+ 
Sbjct  72    PLSPTDGLPENAEATVDLSYH-KVQYLKKAFDGLEGPLTRFLESSSPDWILHDFAPHWLS  130

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK--LRPSPEHFTVPPGWFNFHSLVAHR  605
              I  + G+ + F S++ A+ LA+ G P  L  G    R  PE FTVPP W  F   +A R
Sbjct  131   PITAKLGLPSAFFSLFNASALAFFGPPNALLGGDDDCRTKPEDFTVPPKWVPFP--LAFR  188

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGE--YIDLLE-KLYKR  776
               Y    M +    +ASGVS   R+ S + GCD V++RSC EFE E   + LLE K+Y +
Sbjct  189   L-YEILRMVDGLDRNASGVSDTYRIGSAVLGCDIVVIRSCMEFESESDCLRLLEEKIYCK  247

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+ +GLLP        +       +  E  +WLD Q   SVV+V FGSE  +    + E
Sbjct  248   PVIPVGLLP--------LAAPAVKDAMGEDDKWLDQQGRGSVVYVAFGSEVTLSQEDVTE  299

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             LA  LELS +PF W+LRKP         LLP  F  RT  +G V  GWAPQQ ILAHP++
Sbjct  300   LAVGLELSELPFFWVLRKPSSLTQEEWGLLPDGFEERTKGRGVVCRGWAPQQRILAHPSV  359

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG L H GW +IIE+L FGH  ILLP +ADQGLNA+LL  +++G E+ R E  GSF+R  
Sbjct  360   GGFLTHCGWSSIIEALEFGHAFILLPYLADQGLNARLLAWRKLGVEIQRDERSGSFTRSS  419

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKR  1478
             VA S+R VM S EG  +R  A +MA + GN  LHD Y+D  I Y Q    +   R
Sbjct  420   VAESLRLVMVSDEGAELRANARKMAEMVGNKQLHDQYVDHLISYMQENRRSHVTR  474



>ref|XP_008788932.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=494

 Score =   402 bits (1033),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 212/470 (45%), Positives = 288/470 (61%), Gaps = 8/470 (2%)
 Frame = +3

Query  57    TMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERL  236
             TM     HV++FPWLAFGHMLP LE +K LA +G R+SF+STP+N+QRLP IP+     +
Sbjct  23    TMDDGPLHVVVFPWLAFGHMLPFLELSKSLAKRGHRISFLSTPRNIQRLPKIPSQIASLV  82

Query  237   SLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVD  410
              L  + LP V GLPE+ EAT D+     VQ+L  A+D +  PF   +R     P+ I+ D
Sbjct  83    DLVSLPLPKVDGLPEDAEATTDIPPP-MVQYLMKAFDGLDEPFTRFLREASPKPDWIIHD  141

Query  411   FATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHS  590
             F+ HW+P IA  + V   F S++ ++TL ++G P E++ G LR +PE FT PP W +F S
Sbjct  142   FSHHWIPPIASMFEVPCAFFSIFPSSTLVFIGPPSEMKLGGLRRTPEQFTKPPEWISFPS  201

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
               A R  Y   +    +  +ASG S  +RL  VI+ C  V VRSCKEFE +++ LLE+LY
Sbjct  202   SAAFR-LYEARLFTAHYRDNASGFSEFRRLELVIQRCKLVAVRSCKEFESDWLPLLEELY  260

Query  771   -KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
              K+PV+  GLLPP L         TN++  ++ F WL+ Q   SVV V  GSE  + +  
Sbjct  261   EKKPVVPAGLLPPHLQERIE-DVHTNTTGVAQVFGWLNGQTLGSVVCVVLGSEATLSVEL  319

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             +HELA  LELS++PF+W LRKP         +LP  F  RT   G V +GW PQ ++LAH
Sbjct  320   VHELALGLELSKVPFVWALRKPA-GMASDVEILPKGFEVRTRGLGVVAMGWIPQLSVLAH  378

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFS  1304
             P++GG   H GW +IIE L FGHPLILLP+ AD GLNA+++ +K IG EVPR  EDGSF 
Sbjct  379   PSVGGFFTHCGWSSIIEGLQFGHPLILLPIFADHGLNARIMEDKRIGLEVPRDEEDGSFG  438

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R+ VA  IR +M   EG+  R KA ++  +F +    + Y+D  +   Q 
Sbjct  439   REGVAKVIRLIMVEEEGKPFRCKAGKLKEVFSDKESQERYVDNLVRCLQD  488



>gb|KDO86267.1| hypothetical protein CISIN_1g036520mg [Citrus sinensis]
Length=473

 Score =   400 bits (1028),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/479 (43%), Positives = 297/479 (62%), Gaps = 18/479 (4%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLP-PIPASFTERL-S  239
             A + HV++ PW AFGH++P  + +  LA  G +VSF+STPKN+QRLP P P S    L +
Sbjct  2     ARKLHVVMLPWSAFGHLMPFFQLSIALAKSGVKVSFISTPKNIQRLPKPAPESEVAALIN  61

Query  240   LREIALPSVPGL------PENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELI  401
               E  LP+   L      PE  EATVD+   E +Q+LK AYD +  PF++ V +   + I
Sbjct  62    FVEFPLPASAALDDKLLLPEGAEATVDIPS-ENIQYLKIAYDLLQHPFKQFVAQQSVDWI  120

Query  402   LVDFATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPG  572
             +VD  +HW  +IA+ Y V  +  S ++AA   ++ +PE L      ++RPS E  T  P 
Sbjct  121   IVDVMSHWAGKIAQEYHVPLLLFSAFSAAAFQFIANPECLVGDGQKRVRPSAESLTSVPE  180

Query  573   WFNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYID  752
             W +F S VA R   A  M    +  +ASG++   R + ++  C  + +RSC EFEGEY++
Sbjct  181   WVDFPSSVALRTFDAIGMHHGFYGMNASGITDAHRTAEILHSCQAMAIRSCPEFEGEYLN  240

Query  753   LLEKLYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYK  932
             LLEKL  +PV+ +GLL P  N              S+ F+WLD Q+P+SVVFVGFGSE K
Sbjct  241   LLEKLTGKPVIPVGLLTPEPN-----SAKGRDHQISKIFQWLDEQKPRSVVFVGFGSECK  295

Query  933   MPIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQ  1112
             +   Q++E+A  LELS +PFLW LRKP        AL P  F +    +G V +GWAPQ 
Sbjct  296   LSKDQVYEIAYGLELSGLPFLWALRKPEWATDDVDAL-PLGFADTIRGKGIVSIGWAPQL  354

Query  1113  NILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED  1292
              ILAHP+IG  LFH+GWG++IE+L FGH L++LP++ DQ LNA+LLV+K++  +V R++D
Sbjct  355   EILAHPSIGTSLFHAGWGSVIETLQFGHSLVVLPLIIDQPLNARLLVDKDLAVQVERKDD  414

Query  1293  GSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
             GSF+RD +A ++R    S EGE +R++A + AN F +  LHD+Y  +F+EY +  + T+
Sbjct  415   GSFTRDGIAKALRLATVSEEGEKLRVRAREAANTFNDKKLHDDYSVRFVEYLKINVATK  473



>ref|XP_009800982.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=489

 Score =   400 bits (1029),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/466 (44%), Positives = 289/466 (62%), Gaps = 8/466 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ HV++FPWLAFGH++P LE +K +A KG ++SF+STPKN+ RLP +P  F+  ++  
Sbjct  18    TDKLHVVMFPWLAFGHIIPFLELSKFIAQKGHKISFISTPKNIDRLPKLPLEFSNSITFV  77

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP V GLPEN EAT+D+   E++ +LK A D M     + + ++ P+ I+ DFA +W
Sbjct  78    KIPLPKVDGLPENAEATMDI-TTEEIIYLKKAMDGMEKEVTKFLEKNSPDWIIQDFAQYW  136

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEEL--RSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +  I+ + G++ +F  +  A  +A+ GS E +   +    P+ E F VPP W  F +  A
Sbjct  137   LAPISAKLGISRIFYCIINAWFIAFFGSTENMVNTNSGTPPTVEDFLVPPKWIPFETKAA  196

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R   A  M+ ++   + SGVS   R    + G D  I R C EFEG+++ LLE L+  P
Sbjct  197   YRRHEARWMVGSSQK-NVSGVSDLYRNGVTMTGADATIFRHCYEFEGQWLKLLEDLHNIP  255

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             ++  GL+PP +     I    N+ SW    EWLD +   SVV+V  GSE  + ++ I+EL
Sbjct  256   MIPSGLMPPMVK---NIDDEKNNQSWMSIKEWLDEKPKGSVVYVALGSEVTIGLNDINEL  312

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELSR PF W+LRKP       P  LP  F  R   +G V   WAPQ NIL+H ++G
Sbjct  313   ALGLELSRSPFFWVLRKPSKSGNTDPIELPEGFEERIKGRGIVWKSWAPQLNILSHDSVG  372

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
             G L H GW +IIE L FGHPLI+LP + DQGLNA++L +K +G E+PR  EDGS++ D V
Sbjct  373   GFLTHCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEIPRNEEDGSYTSDSV  432

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             ANS+  VM   EG+ IR KA +M +IFGN NLHD YI+  IE+ ++
Sbjct  433   ANSVNLVMVENEGKIIREKAKEMISIFGNKNLHDKYIENLIEFLEN  478



>gb|KHN46708.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=462

 Score =   397 bits (1020),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 291/469 (62%), Gaps = 13/469 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA  + HV++ PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++    + 
Sbjct  1     MAENEIHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSNLAHLVH  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
               ++ LPS+    LPE  EATVD+  +E ++FLK AYD++  P ++ V   LP  I+ DF
Sbjct  61    FVQLPLPSLDKEHLPEGAEATVDIPSEE-IEFLKLAYDKLQHPVKQFVANQLPNWIICDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             + HW+ +IA+ + V  +F SV++AA++          + K   +PE  TVPP W  F S 
Sbjct  120   SPHWIVDIAQEFQVKLIFYSVFSAASMNIFAP----STRKFPVTPESLTVPPEWVTFPSS  175

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+R   A       +  +ASGV   +R+++V      VI RSC E EGEY++  +KL  
Sbjct  176   VAYRIHEAIPFCAGANDVNASGVRDYERMATVCCASKAVIFRSCYEIEGEYLNAFQKLVG  235

Query  774   RPVLAIGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             +PV+ IG+LP    +    I  G+ S    + FEWLD Q  KSVVFVGFGSE K+   Q+
Sbjct  236   KPVIPIGILPADSADREREIIDGSTSG---KIFEWLDEQASKSVVFVGFGSELKLNKDQV  292

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  +E S++PFLW LRKP          LP  F+ RTSN+G V +GW PQQ ILAHP
Sbjct  293   FEIAYGIEESQLPFLWGLRKPSWAT-NDEDFLPVGFIERTSNRGVVCMGWIPQQEILAHP  351

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFHSGWG++IE+L FGH L++LP + DQ LNA+ LVEK +  EV   EDGSF+R+
Sbjct  352   SIGGSLFHSGWGSVIETLQFGHNLVVLPFIIDQPLNARFLVEKGLAIEVKMTEDGSFTRN  411

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQS  1454
              +A S+R  M   EG+ +R+   + A I GN  LH D+YI  F+++ ++
Sbjct  412   EIAKSLRQAMVLEEGKKLRINTGEAAAIVGNLKLHQDHYIAAFVQFLKN  460



>gb|KDP28588.1| hypothetical protein JCGZ_14359 [Jatropha curcas]
Length=430

 Score =   394 bits (1013),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 287/465 (62%), Gaps = 40/465 (9%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE-RLSLREIA  254
             HV+I PW AFGH++P  +FA  LA  G  VSFVSTP+N++RLP + +S  E ++   E+ 
Sbjct  2     HVVILPWSAFGHIMPFFQFAIALAKVGIEVSFVSTPRNIKRLPKLSSSNLETQILFVELP  61

Query  255   LPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             LP++ G   L E  EA VD+   E +Q+LK AYD++  PF++ + R +P  I+VDF ++W
Sbjct  62    LPTLSGKYPLREGGEAIVDI-AAENIQYLKIAYDQLQYPFKQFIARKMPNWIVVDFCSYW  120

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
               +IAK Y +  ++LSV++                                +F S +A R
Sbjct  121   AADIAKEYSIPLLYLSVFS--------------------------------DFPSSIAFR  148

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                A +     +  +ASG+   +R++  +  C   +VRSC EFEGEY+++  K+  +PV+
Sbjct  149   SYEARSFHPGFYGENASGIKDAERVARTMAACRAALVRSCTEFEGEYLNIYRKILGKPVI  208

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP        +  T    W + FEWLDNQ  KSVVF GFGSE K+   Q++E+A 
Sbjct  209   PIGLLPPE---KPDGKRETLDGIWRKIFEWLDNQEEKSVVFAGFGSECKLTKDQVYEIAY  265

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PFLW LRKP         +LP  F +RTS +G+V +GWAPQQ ILAHP+IGG 
Sbjct  266   GLELSELPFLWALRKPSWAVEDNADVLPAGFRDRTSERGKVCIGWAPQQEILAHPSIGGS  325

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANS  1325
             LFHSGWG++IE+L +GH LI+LP + DQG+NAKLLVEK +  EV R+ DGSF+R+ ++ S
Sbjct  326   LFHSGWGSVIETLQYGHCLIVLPFIVDQGVNAKLLVEKGLALEVDRKSDGSFTRNDISKS  385

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
             +R  M S EG+ +R +A + + IFG+ NLH NYI   +EY ++ +
Sbjct  386   LRLAMVSLEGKKLRDRAKEASAIFGDENLHRNYIASLVEYMRNGV  430



>ref|XP_008232998.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Prunus 
mume]
Length=473

 Score =   395 bits (1015),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 212/481 (44%), Positives = 288/481 (60%), Gaps = 27/481 (6%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA +   V++ PW AFGHM+P  + +  LA     V F+STP+N+QRLP I +     + 
Sbjct  1     MAKDHLQVVMLPWSAFGHMMPYFQLSIALAKAKVHVFFISTPRNIQRLPKISSDLEPFVH  60

Query  240   LREIALPSV-PG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L  I  PS+ PG LPE  EA+VD+   E++  LK AYD +  P +  +   LP+ I+ D 
Sbjct  61    LVPIPFPSLEPGFLPEGAEASVDVPF-EKIDNLKAAYDLLQQPIKHFIGEHLPDWIISDS  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR---PSPEHFTVPPGWFNF  584
               HWV +I K YGV   + S ++A T  + GSPE L   K     P+PE  T PP W  F
Sbjct  120   FAHWVVDIGKEYGVPVGYFSPFSAVTSVFFGSPENLLGTKRNHALPTPESLTAPPDWVTF  179

Query  585   HSLVAHR---PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDL  755
              S VA+R     Y P     +H  + SG     RL+ V+ G   + +R+C E EG+Y+++
Sbjct  180   PSKVAYRDYEAVYVPRGFFGSHNGEISGAG---RLAKVVSGSQVLAIRTCNEVEGDYLEV  236

Query  756   LEKLYKRPVLAIGLLPP-----RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFG  920
              +K+  +PV + GLLPP     R     A   G         F+WLD Q+PKSVVFVGFG
Sbjct  237   YKKITGKPVFSTGLLPPEQPPKRAKGEIATDDGI--------FDWLDKQKPKSVVFVGFG  288

Query  921   SEYKMPIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGW  1100
             SE K+   Q+ E+A  LELS++PFLW LRKP   N    AL P  F +RTS +G V  GW
Sbjct  289   SECKLSKEQVFEIAHGLELSKLPFLWALRKPDWANSDADAL-PQGFADRTSEKGLVCFGW  347

Query  1101  APQQNILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVP  1280
              PQ +IL HP+IGG LFH+GWG++IE L FGH L++LP++ DQ LNA+LL EK +  EV 
Sbjct  348   VPQFDILGHPSIGGSLFHAGWGSVIEILQFGHVLVVLPLIIDQPLNARLLEEKGLAVEVK  407

Query  1281  RREDGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSK  1457
             R+EDGSFSRD +A +IR  M   EGE +R  A + A +FG+H LH D+YI QF+ + ++ 
Sbjct  408   RKEDGSFSRDEIAKTIRHAMVEEEGEQLRSNARKAAAVFGDHKLHQDHYIGQFVHFLKNN  467

Query  1458  I  1460
             +
Sbjct  468   V  468



>ref|XP_004287868.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=478

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/467 (44%), Positives = 293/467 (63%), Gaps = 9/467 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +Q HV +FPWLAFGH++P LE AK +A KG +VSF+STP+N+QRLP IP + T  ++L +
Sbjct  10    KQLHVALFPWLAFGHIIPFLEVAKHIARKGHKVSFISTPRNIQRLPKIPETLTPLITLVQ  69

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP V  LPEN EAT+D+   + + +LK A+D +     E ++   P+ I+ DFA HW+
Sbjct  70    IPLPHVENLPENAEATMDV-PHDVIPYLKIAHDGLEQGISEFLQAQSPDWIIHDFAPHWL  128

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSP--EHFTVPPGWFNFHSLVAH  602
             P IA + G++    S++ A+TL +LGS    R  +  P    E +T PP W  F S + +
Sbjct  129   PPIATKLGISNAHFSIFNASTLCFLGSTSPNRVSRYAPRKKLEQYTSPPEWIPFPSKIYY  188

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP-  779
             RP  A  ++    TP+ASGV+   RL S I+GC    +RSC+E EGE++DLLE L+++P 
Sbjct  189   RPFEAKRLVNGILTPNASGVTDHFRLESTIQGCQVYFIRSCREIEGEWLDLLEDLHEKPV  248

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL  GLLPP  +L  + + G   S WS+  EWLD Q    VV+V FGSE  +   + +EL
Sbjct  249   VLPTGLLPP--SLPRSDEDGGKDSDWSKIAEWLDKQEKGKVVYVAFGSELNLSQEEFNEL  306

Query  960   ASALELSRMPFLWILRKPGI-DNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             A  LELS +PF W+LRKP      G    LP  F +RT  +G V   WAPQ  IL+H ++
Sbjct  307   ALGLELSGLPFFWVLRKPSNGSGDGDSVKLPDGFEDRTKGRGHVWTTWAPQLKILSHESV  366

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDM  1313
             GG L H GW +IIESL +G PLI+LP + DQGL A+   + +IG EVPR E+ G F+R+ 
Sbjct  367   GGFLTHCGWSSIIESLQYGRPLIMLPFMYDQGLIARFW-DNKIGAEVPRDEETGWFTRNE  425

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +ANS++ ++   EG+  R  A   + +F +  LHD Y+D+ +EY ++
Sbjct  426   LANSLKLIVVDEEGKQYRDGANDYSKLFRDKELHDRYMDECVEYLET  472



>ref|XP_003548650.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Glycine max]
 gb|KHN46707.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=483

 Score =   394 bits (1011),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 211/473 (45%), Positives = 289/473 (61%), Gaps = 16/473 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA    HV++ PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++    + 
Sbjct  14    MAENAIHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSNLAHLVD  73

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L +  LPS+    LPE  EATVD+   E++++LK AYD++    ++ V   LP  I+ DF
Sbjct  74    LVQFPLPSLDKEHLPEGAEATVDI-PSEKIEYLKLAYDKLQHAVKQFVANQLPNWIICDF  132

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             + HW+ +I   + V  +F +V +A  L   G P    + K   SPE  T PP W  F S 
Sbjct  133   SPHWIVDIVHEFQVKLIFYNVLSAPALTVWGPP---GTRKTPLSPESLTAPPEWVTFPSS  189

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+R   A  +    +  +ASGVS  +RL  V    + VI RSC E EGEY++  +KL  
Sbjct  190   VAYRIHEAIALCAGANPVNASGVSDFERLHKVFNASEAVIFRSCYEIEGEYLNAYQKLVG  249

Query  774   RPVLAIGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             +PV+ IGLLP         I  G  S    + FEWLD Q  KSVVFVGFGSE K+   Q+
Sbjct  250   KPVIPIGLLPADSEERGREIIDGRTSG---KIFEWLDEQASKSVVFVGFGSELKLNKDQV  306

Query  951   HELASALELSRMPFLWILRKP--GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILA  1124
              E+A  +E   +PF+W LRKP   I++  +   LP  F+ RTSN+G V +GW PQQ ILA
Sbjct  307   FEIAYGIEEYELPFIWALRKPSWAINDEDF---LPFGFIERTSNRGVVCMGWIPQQEILA  363

Query  1125  HPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFS  1304
             HP+IGG LFHSGWG++IE+L FGH L++LP + DQ LNA+ LVEK +  EV R EDGSF+
Sbjct  364   HPSIGGSLFHSGWGSVIETLQFGHILVVLPFIIDQPLNARFLVEKGLAIEVKRNEDGSFT  423

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             R+ +A S+R  M   EG+ IR+   + A I GN  LH D+YI +F+++ ++ I
Sbjct  424   RNDIATSLRQAMVLEEGKKIRINTGEAAAIVGNLKLHQDHYIAEFVQFLKNGI  476



>ref|XP_007217954.1| hypothetical protein PRUPE_ppa005180mg [Prunus persica]
 gb|EMJ19153.1| hypothetical protein PRUPE_ppa005180mg [Prunus persica]
Length=473

 Score =   392 bits (1008),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 206/473 (44%), Positives = 286/473 (60%), Gaps = 11/473 (2%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA +   V++ PW AFGHM+P  + +  LA     + F+STP+N+QRLP I +     + 
Sbjct  1     MAKDHLQVVMLPWSAFGHMMPYFQLSIALAKAKVHIFFISTPRNIQRLPKISSELEPFVH  60

Query  240   LREIALPSV-PG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L  I  P + PG LPE  EATVD+   E++  LK AYD +  P +  + + LP+ I+ D 
Sbjct  61    LVPIPFPPLDPGFLPEGAEATVDVPF-EKIDNLKAAYDLLQQPIKHFIGQHLPDWIISDS  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK---LRPSPEHFTVPPGWFNF  584
               HWV +I K YGV   + S ++AA+  + GSPE L   K     P+P   T PP W  F
Sbjct  120   FAHWVVDIGKEYGVPVGYFSPFSAASSVFFGSPENLLGTKRIHALPTPASLTAPPDWVTF  179

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              S VA+R   A  + R         +S   RL+ V+ G   + +R+C E EG+Y+++ +K
Sbjct  180   PSKVAYRDYEAVYVPRGFFGSRNGEISGAGRLAKVVSGSRVLAIRTCNEVEGDYLEVYKK  239

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
             +  +P+ + GLLPP      A    T        F+WLD Q+PKSVVFVGFGSE K+   
Sbjct  240   ITGKPIFSTGLLPPEQPPKRAKGEITTDDG---IFDWLDKQKPKSVVFVGFGSECKLSKE  296

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILA  1124
             Q+ E+A  LELS++PFLW LRKP   N    AL P  F +RTS +G V  GW PQ +IL 
Sbjct  297   QVFEIAHGLELSKLPFLWALRKPNWANSDAGAL-PQGFADRTSEKGLVCFGWVPQFDILG  355

Query  1125  HPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFS  1304
             HP+IGG LFHSGWG++IE+L FGH L++LP++ DQ LNA+LL EK +  EV R+EDGSFS
Sbjct  356   HPSIGGSLFHSGWGSVIETLQFGHVLVVLPLIIDQPLNARLLEEKGLAVEVKRKEDGSFS  415

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             RD +A ++R  M   EGE +R  A + A +FG+H LH D+YI QF+ + ++ +
Sbjct  416   RDEIAKTLRHAMVEEEGEQLRSNARKAAAVFGDHKLHQDHYIGQFVHFLKNNV  468



>ref|XP_008233032.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Prunus mume]
Length=446

 Score =   389 bits (999),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/470 (44%), Positives = 277/470 (59%), Gaps = 32/470 (7%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA +  HV++ PW AFGHM+P    +  LA     VS++STPKN+QRLP I       + 
Sbjct  1     MAKDHLHVVMLPWSAFGHMIPFFRLSIALAKAKVHVSYISTPKNIQRLPKISPDLQPFIQ  60

Query  240   LREIALPS--VPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L  I LP   V  LP   EATVD +  E++  LK AYD +  P ++ +   LP+ +++DF
Sbjct  61    LVPIPLPDLDVDLLPPGAEATVD-DPFEKIDQLKVAYDHLQQPIKQFIGDQLPDWLILDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             A HW  EI + YGV  VF SV +AAT++ LGSPE L         E   V  G F     
Sbjct  120   APHWAVEIGQEYGVPLVFFSVLSAATMSILGSPEHLSEH------EAVRVHKGLFEI---  170

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
                               + SG+   +R + +I     + +RSC EFEGEY+++ +K+  
Sbjct  171   ------------------NGSGIRDSERFAKIISASQVLAMRSCNEFEGEYLEVCQKING  212

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+  G LPP+           N SS +  F+WLD Q+PKSVVFVGFGSE K+   Q+ 
Sbjct  213   KPVIPTGFLPPKKPSAKREISSDNGSSNNVIFDWLDKQKPKSVVFVGFGSECKLSKEQVF  272

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PFLW LRKP   N    AL P  FV RTS +G V LGW PQ  IL HP+
Sbjct  273   EIARGLELSELPFLWALRKPNWANSEADAL-PPGFVERTSEKGLVCLGWVPQMEILGHPS  331

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             +GG LFHSGWG++IE+L FGH L++LP + DQ LNA+LLVEK++  EV R EDGSF +D 
Sbjct  332   VGGSLFHSGWGSVIETLQFGHVLVVLPFIIDQPLNARLLVEKDLAVEVKRTEDGSFCKDD  391

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             +A ++   M + EGE +R  A + A +FG+H LH D Y+ QF+ Y ++ +
Sbjct  392   IAKTLXHAMVAEEGEKLRSNARKAAKVFGDHKLHQDQYLGQFVHYLKNNV  441



>ref|XP_007051734.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX95891.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=470

 Score =   389 bits (1000),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/467 (42%), Positives = 286/467 (61%), Gaps = 10/467 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A   HV++ PW AFGH++P  + +  LA  G +VSF+STP+N+QRLP +P +    + + 
Sbjct  2     ARDLHVVMLPWSAFGHLIPFFQLSIALAKAGVKVSFISTPRNIQRLPKVPPTLATLIDIV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
              + LP +    LPE  EATVD+   E++ +LK AYD +  P ++ +    P+ +  D  +
Sbjct  62    ALPLPVLDNQLLPEGAEATVDIPS-EKIPYLKIAYDLLQHPVKQFISDQRPDWVFTDVIS  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYL---GSPEELRSGKLRPSPEHFTVPPGWFNFHS  590
             +WV E A+   +  +  SV  A+T A+      P        +PSPE  T P  W NF S
Sbjct  121   YWVAEAAQEKQIPVINFSVCPASTNAFFLQKDFPVAAAQEGTKPSPESLTKPLEWGNFQS  180

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              V++R   A    +  +T +ASG++  +R+  VI   + + +R+C E+E EY++  +++ 
Sbjct  181   SVSYRSFEATGTYKGLYTQNASGITDNERVIRVILASNAMAIRTCPEYESEYLNKCKEIT  240

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
              + V+ IGLL P               SWSE FEWLD Q+PKSVVFVGFGSE K+   Q+
Sbjct  241   GKQVIPIGLLLPEKPEEVK---RITDKSWSENFEWLDGQKPKSVVFVGFGSECKLSKEQV  297

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             HE+A  LELS +PFLW LRKP      + AL P  F + T  +G V +GWAPQ  IL HP
Sbjct  298   HEIAHGLELSGLPFLWALRKPDWATDDHDAL-PPGFSDGTRGRGVVCIGWAPQLEILGHP  356

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFH+GWG+IIE+L FGH L++LP++ DQ LNA+LLVEK +  EV R  DGSF+R 
Sbjct  357   SIGGSLFHAGWGSIIETLQFGHCLVVLPLIIDQPLNARLLVEKGLAVEVERSNDGSFTRA  416

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              +A ++R  M S EGE +R++A ++A +FGN NL  NY ++F+EY +
Sbjct  417   DIAKALRLAMVSEEGENLRVRAKEVAEVFGNRNLQHNYFNRFVEYLE  463



>ref|XP_008788945.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=464

 Score =   389 bits (1000),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/461 (43%), Positives = 288/461 (62%), Gaps = 13/461 (3%)
 Frame = +3

Query  81    VMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALP  260
             ++ FPWLAFGHMLP LE +K LA +G R+SF+ST +NL+RLP IP      +    + LP
Sbjct  9     IVFFPWLAFGHMLPFLELSKSLAKRGHRISFLSTRRNLKRLPKIPHDLAPFIHFVYLPLP  68

Query  261   SVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDFATHWVPE  434
              V GL    E+T D+   E VQFLK A+D +  PF E +      P+ I+ DF  HW+P 
Sbjct  69    KVEGLRAAAESTTDVLPDE-VQFLKKAFDGLDIPFSEFLEEASPKPDWIIHDFGHHWLPP  127

Query  435   IAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDY  614
             IA ++ +   FL +  A+ +A++G P E++    R + E FT PP W +F S VA+R   
Sbjct  128   IASKFNIPCAFLCIVPASFIAFIGPPSEMKDSS-RRTAEQFTKPPQWISFPSSVAYRLHE  186

Query  615   APTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIG  794
             A  ++  +   +ASG++  +R    +EGC+F+  RSC EFE +++ LLE+LY++PV+ +G
Sbjct  187   A-RLIVESFKANASGIADIRRFCLTVEGCNFIAFRSCFEFESDWLRLLEELYEKPVIPVG  245

Query  795   LLPPRLNLNTAIQPGTNS-SSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             LLPP+      +Q G++     +  FEWLD Q P +V +   GSE  + +  +HELA  L
Sbjct  246   LLPPQ------VQEGSDDVHGNARIFEWLDKQAPNTVAYAALGSEAMLSVELLHELALGL  299

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS++PFLW LRKP         +LP  F+ RT  QG V +GW PQ  +LAH ++GG L 
Sbjct  300   ELSKVPFLWALRKPASMAGDDADILPEGFLERTGGQGIVAMGWIPQIKVLAHASVGGFLT  359

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANSI  1328
             HSGWG+IIE L FGH L+LLP+  DQGLNA+++ EK+IG E+ R  EDGSF+R+ VA +I
Sbjct  360   HSGWGSIIEGLRFGHGLVLLPISVDQGLNARIMEEKKIGLEIQRNEEDGSFNRESVAKAI  419

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             R VM   EGE  R KA ++  +F + +  + Y++ FI + +
Sbjct  420   RLVMVEEEGELFRCKAMELQRLFADRDSQERYVEDFILHLR  460



>ref|XP_011093242.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=468

 Score =   389 bits (998),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 197/463 (43%), Positives = 290/463 (63%), Gaps = 9/463 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV + PW AFGH++P  + +  LA  G  VSF++TP+N+ RLP IP + +  +    + L
Sbjct  8     HVAMLPWSAFGHLIPFFQLSIALAKSGIHVSFLATPRNILRLPKIPPNLSNLIHFVPLPL  67

Query  258   P---SVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             P   S P LPE+ EATVD+   +++Q+LK A D +  P    V  + P  I+VDF  HW 
Sbjct  68    PKPESSP-LPESAEATVDI-PADKIQYLKLACDLLQEPVRGFVSENPPHWIIVDFFHHWA  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
              +IA+ + +  V   V +AAT+ + G  +    G  R  P+ +T+PP + +F S VA++ 
Sbjct  126   VDIAQDFNIPIVIFWVVSAATVDFFGVHKVPLDGDKRMLPQSWTLPPEYIDFSSKVAYKK  185

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
               A  M       +ASG+    R++ +I+ C+ + +R+C EFE +Y+ L EKL  +PV  
Sbjct  186   HEAEEMHAGYFGQNASGMPDSSRVAKIIQACNAIALRTCPEFEADYLKLHEKLTGKPVFP  245

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP      +  P +N   WS  F+WLD Q P+SVVFVGFGSE K+   QIHE+A  
Sbjct  246   VGFLPPEKMKRRS--PTSNEEPWSGIFQWLDKQNPRSVVFVGFGSECKLNKDQIHEIAHG  303

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             +ELS +PFLW LRKP   +    A  P  F  RT+ +G   +GWAPQ+ +L+HP++GGCL
Sbjct  304   VELSGLPFLWALRKPDWADDDEDAF-PAGFRERTAARGVAHVGWAPQREVLSHPSVGGCL  362

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANSI  1328
             FH+GWG+IIESL +GH L+ LP + DQ LNA+LLVEK +G+EV R EDGSFSR  +A ++
Sbjct  363   FHAGWGSIIESLQYGHCLVFLPFIIDQPLNARLLVEKGLGWEVERGEDGSFSRYDIAKAL  422

Query  1329  RSVMASREGEGIRLKAAQMAN-IFGNHNLHDNYIDQFIEYFQS  1454
                M  +EGE +R++  +  + IFG+  LH +Y+++F+EY ++
Sbjct  423   EKAMVLKEGEEVRVRGREAGDGIFGDEKLHHSYVEKFVEYLKN  465



>ref|XP_009366540.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Pyrus 
x bretschneideri]
Length=469

 Score =   388 bits (997),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 290/472 (61%), Gaps = 13/472 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              +   V++ P+ AFGH++P  + +  LA     V F+STP+N+QRLP IP+     + L 
Sbjct  2     GKNVRVVMLPYSAFGHIMPYFQLSIALAKSNVHVYFISTPRNIQRLPKIPSDLNPFIHLV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
              I  P +    LPE  EATVDL   E++  LK AYD +  P ++ +  +LP+ IL DFA 
Sbjct  62    PIPFPPLDPDFLPEGAEATVDLPF-EKLDNLKVAYDLLQQPIKQFIGEELPDWILSDFAA  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL----RSGKLRPSPEHFTVPPGWFNFH  587
             HWV +IAK YGV+  + S ++AA   + GS E L    R+  L P+PE  T PP W +F 
Sbjct  121   HWVVDIAKEYGVSIAWFSPFSAACNVFFGSVENLLGTNRNHAL-PTPESLTSPPDWVSFP  179

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S VA+R   AP + R     + SG+S   RL+ ++     + +R+C E EGEY+++ +K+
Sbjct  180   SSVAYRDFVAPYVARGYFGVNKSGMSDSARLAKILSASQALAIRTCDEVEGEYLEVFKKI  239

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
               +PV++ GLLPP      A +     S+    FEWLD ++ KSVVFVGFG+E K+   Q
Sbjct  240   TGKPVISTGLLPPD---QPAQREKGGISTNDGIFEWLDRRKNKSVVFVGFGTECKLSKEQ  296

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             + E+ S LELS +PFLW LRKP   N    AL P  F  RTS +G V  GW PQ  IL H
Sbjct  297   VFEIGSGLELSGLPFLWALRKPNWANSDADAL-PPGFAERTSERGLVCFGWVPQIEILGH  355

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P++GG LFHSGWG++IE+L FGH L++LP++ DQ LNA+LL +K +  EV    DGSFS+
Sbjct  356   PSVGGSLFHSGWGSVIETLQFGHVLVVLPLIIDQPLNARLLEDKGLAVEVQCSGDGSFSK  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             D +A ++R  M   EGE +R  A + A +FG+H LH D+YI QF+ + +SK+
Sbjct  416   DEIAKTLRHAMVEEEGEQLRSNARKAAAVFGDHKLHQDHYIGQFVNFLKSKV  467



>ref|XP_006353159.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=484

 Score =   388 bits (997),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 295/470 (63%), Gaps = 11/470 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ H+++FPWLAFGH++P LE +K +A KG ++SF+STP+N+ RLP IP+ F+  ++  
Sbjct  17    TKKLHIVMFPWLAFGHIIPFLELSKFIARKGHKISFISTPRNIDRLPKIPSEFSNSITFV  76

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP + GLP++ EAT+D+   E++ +LK A D M       + ++ P+ I+ DFA +W
Sbjct  77    KIPLPKIDGLPKDAEATIDIITSEEMTYLKKAMDGMEKDVTNFLEKNCPDWIIQDFAQYW  136

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSP---EHFTVPPGWFNFHSLV  596
             +  I+ + G++ +F S++ A  +++ GS E++ +     SP   E F VPP W  F +  
Sbjct  137   LAPISAKLGISRIFYSIFNAWFISFHGSFEKMINTNNCTSPPKLEDFLVPPKWIPFETKA  196

Query  597   AHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
             A+R   A  M+ ++   + SGVS   R    I G D +IVR C EFEG+++ LLE L+  
Sbjct  197   AYRLHEARWMVGSSQK-NVSGVSDVYRCGVTIRGSDAIIVRHCHEFEGQWLKLLEDLHHI  255

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PVL  GL+PP +  ++       + SW    EWLD +   S+V+V  GSE  +   +I+E
Sbjct  256   PVLPTGLMPPLVESSS----DEKNESWISIKEWLDEKPKGSIVYVALGSEVTVGPSEINE  311

Query  957   LASALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  LELS  PF W+LRKP G++N   P +L   F  RT  QG V   WAPQ  IL+H +
Sbjct  312   LAHGLELSGSPFFWVLRKPSGVENID-PIVLLDGFEERTKGQGIVWKSWAPQMKILSHKS  370

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRD  1310
             +GG L H GW + IE L FGHPLI+LP + DQGLNA++L +K +G EVPR  E+GS++ +
Sbjct  371   VGGFLTHCGWSSTIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEVPRNEENGSYTSN  430

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
              VANS++ VM   +G+ IR KA +M  IFGN  LHD YI+  I++ ++ +
Sbjct  431   SVANSVKLVMVGNDGKLIREKAKEMRAIFGNKELHDRYIENLIKFLENHM  480



>ref|XP_009343124.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Pyrus 
x bretschneideri]
Length=469

 Score =   387 bits (995),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 204/471 (43%), Positives = 286/471 (61%), Gaps = 11/471 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              +   V++ P+ AFGH++P  + +  LA     V F+STP+N+QRLP IP      + L 
Sbjct  2     GKNVRVVMLPYSAFGHIMPFFQLSIALAKYNVHVYFISTPRNIQRLPKIPTDLNPFIHLV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
              I  P +    LPE  EATVDL   E++  LK AYD +  P ++ +  +LP+ IL DFA 
Sbjct  62    PIPFPPLDPDFLPEGAEATVDLPF-EKLDNLKVAYDLLQQPIKQFIGEELPDWILSDFAA  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR---PSPEHFTVPPGWFNFHS  590
             HWV +IAK YGV+    S ++AA   + GS E L         P+PE  T PP W +F S
Sbjct  121   HWVVDIAKEYGVSLACFSPFSAACNVFFGSVENLLGTNRNHAIPTPESLTSPPDWVSFPS  180

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA+R   AP ++R     + SG+S   R++ ++     + VR+C E EGEY+++ +K+ 
Sbjct  181   SVAYRDFVAPYVVRGFFGVNKSGMSDSARIAKILSATQAIAVRTCDEVEGEYLEVFKKIT  240

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
              +PV++ GLLPP      A +     S+    FEWLD ++ KSVVFVGFG+E K+   Q+
Sbjct  241   GKPVISTGLLPPD---QPAQREKGGISTNEGIFEWLDRRKNKSVVFVGFGTECKLSKEQV  297

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+ S LELS +PFLW LRKP   N    AL P  F  RTS +G V  GW PQ  IL HP
Sbjct  298   FEIGSGLELSGLPFLWALRKPNWANSDADAL-PPGFAERTSERGLVCFGWVPQIEILGHP  356

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             ++GG LFHSGWG++IE+L FGH L++LP++ DQ LNA+LL +K +  EV    DGSFS+D
Sbjct  357   SVGGSLFHSGWGSVIETLQFGHVLVVLPLIIDQPLNARLLEDKGLAVEVKCSGDGSFSKD  416

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
              +A ++R  M   EGE +R  A + A +FG+H LH D+YI QF+ + +SK+
Sbjct  417   EIAKTLRHAMVEEEGEQLRSNARKAAAVFGDHKLHQDHYIGQFVNFLKSKV  467



>ref|XP_006852898.1| hypothetical protein AMTR_s00033p00222540 [Amborella trichopoda]
 gb|ERN14365.1| hypothetical protein AMTR_s00033p00222540 [Amborella trichopoda]
Length=431

 Score =   386 bits (992),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 210/451 (47%), Positives = 275/451 (61%), Gaps = 33/451 (7%)
 Frame = +3

Query  114   MLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALPSVPGLPENCEA  293
             +LP  E +K LA KG RVS +STP+NLQRLPPIP     +++L    LP V GLP+N +A
Sbjct  8     ILPFFELSKALALKGIRVSLISTPRNLQRLPPIPQELAPQINLVGFPLPLVEGLPKNAKA  67

Query  294   TVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEIAKRYGVATVFLS  473
             T++    E+VQ+LK AYD +  PFEELV +  P+ ILVDFA +W P IA +YG+   F  
Sbjct  68    TIENISLEKVQYLKKAYDGLRAPFEELVAKVSPDWILVDFAPYWAPAIAFKYGIPCCFFI  127

Query  474   VYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYAPTMMRNT--HTP  647
             V++AA  A+ G+PE L     R   E FTV PGW  F S +A RP     + ++     P
Sbjct  128   VFSAACCAFGGAPESLNGVNERKKVEDFTVVPGWIPFPSTIAFRPHEVHKIFQDASFDIP  187

Query  648   DASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGLLPP-RLNLNT  824
             +ASGVS G R  S IEGC  V VR+C EFE  Y+DLLEKLY++ V+ IG  PP R     
Sbjct  188   NASGVSDGYRFGSTIEGCRVVAVRTCNEFEEGYLDLLEKLYEKSVIPIGFRPPARKEREG  247

Query  825   AIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALELSRMPFLWIL  1004
             +     + + W  AF WLD Q  +SVVFVGFGS              ALE+         
Sbjct  248   SGNSWNDENKWDIAFHWLDAQPLRSVVFVGFGS-------------GALEVQ--------  286

Query  1005  RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHSGWGTIIESL  1184
                  D  G   +L   F +RT  +G V +GWAPQQ+I+AHP+IGGCLFHSGWG+IIE+L
Sbjct  287   -----DGSG---ILSEGFESRTEGRGIVCIGWAPQQSIVAHPSIGGCLFHSGWGSIIEAL  338

Query  1185  GFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIRSVMASREGEG  1361
               G  LI+LP +ADQGLNA+LL EK++ +EV R E DGSF++  +A ++R  M   EGE 
Sbjct  339   THGLALIILPFIADQGLNARLLEEKKLAFEVERNENDGSFTKISIAKALRLAMVEEEGEP  398

Query  1362  IRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +R+KA +M  IFGN  L + Y+D F  + + 
Sbjct  399   LRIKAREMNPIFGNRELSNMYLDGFANFLKD  429



>sp|Q66PF2.1|URT1_FRAAN RecName: Full=Putative UDP-rhamnose:rhamnosyltransferase 1; Short=FaRT1; 
AltName: Full=Glycosyltransferase 4; Short=FaGT4 
[Fragaria x ananassa]
 gb|AAU09445.1| putative UDP-rhamnose:rhamnosyltransferase [Fragaria x ananassa]
Length=478

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/467 (43%), Positives = 291/467 (62%), Gaps = 9/467 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLAFGH++P LE AK +A KG +VSF+STP+N+QRLP IP + T  ++L +
Sbjct  10    KKLHIALFPWLAFGHIIPFLEVAKHIARKGHKVSFISTPRNIQRLPKIPETLTPLINLVQ  69

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP V  LPEN EAT+D+   + + +LK A+D +     E ++   P+ I+ DFA HW+
Sbjct  70    IPLPHVENLPENAEATMDV-PHDVIPYLKIAHDGLEQGISEFLQAQSPDWIIHDFAPHWL  128

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSP--EHFTVPPGWFNFHSLVAH  602
             P IA + G++    S++ A+++ + GS    R  +  P    E FT PP W  F S + H
Sbjct  129   PPIATKLGISNAHFSIFNASSMCFFGSTSPNRVSRYAPRKKLEQFTSPPEWIPFPSKIYH  188

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP-  779
             RP  A  +M  T TP+ASGV+   RL S I+GC    +RSC+E EGE++DLLE L+++P 
Sbjct  189   RPFEAKRLMDGTLTPNASGVTDRFRLESTIQGCQVYFIRSCREIEGEWLDLLEDLHEKPI  248

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL  GLLPP  +L  + + G   S+WS+   WLD Q    VV+  FGSE  +     +EL
Sbjct  249   VLPTGLLPP--SLPRSDEDGGKDSNWSKIAVWLDKQEKGKVVYAAFGSELNLSQEVFNEL  306

Query  960   ASALELSRMPFLWILRKPGI-DNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             A  LELS +PF W+LRKP      G    LP  F +R   +G V   WAPQ  IL+H ++
Sbjct  307   ALGLELSGLPFFWVLRKPSHGSGDGDSVKLPDGFEDRVKGRGLVWTTWAPQLKILSHESV  366

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDM  1313
             GG L H GW +IIESL +G PLI+LP + DQGL A+   + +IG EVPR E+ G F+R+ 
Sbjct  367   GGFLTHCGWSSIIESLQYGCPLIMLPFMYDQGLIARFW-DNKIGAEVPRDEETGWFTRNE  425

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +ANS++ ++   EG+  R  A + + +F +  LHD Y+D+ +EY ++
Sbjct  426   LANSLKLIVVDEEGKQYRDGANEYSKLFRDKELHDRYMDECVEYLET  472



>ref|XP_004250156.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=483

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 291/470 (62%), Gaps = 9/470 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ H+++FPWLAFGH++P LE +K +A KG ++SF+S+P+N+ RLP IP+ F+  ++  
Sbjct  17    TKKLHIVMFPWLAFGHIIPFLELSKFIARKGHKISFISSPRNIDRLPKIPSEFSNSITFV  76

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I L  + GLP++ EAT+D+   E++ +LK A D M       +    P+ I+ DFA +W
Sbjct  77    KIPLAKIDGLPKDAEATIDIITSEEMTYLKKAMDGMEKDVTNFLENSCPDWIIQDFAQYW  136

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSP---EHFTVPPGWFNFHSLV  596
             +  I+ R G++ +F S+  A  L++LGS E + +     SP   E F VPP W  F +  
Sbjct  137   LAPISTRLGISRIFYSIINAWFLSFLGSFENMINTNNCTSPPKLEDFLVPPKWIPFETKA  196

Query  597   AHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
              +R   A  M+ ++   + SGVS   R    IEG D +I+R C EFEG+++ LLE L+  
Sbjct  197   TYRLHEARWMVESSQK-NVSGVSDMYRNGVTIEGADAIIIRHCHEFEGQWLKLLEDLHHM  255

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PVL  GL+PP +  ++       + SW    +WLD +   SVV+V  GSE  +  ++I+E
Sbjct  256   PVLPTGLMPPIVESSSH----EKNESWISIKDWLDEKPKGSVVYVALGSEVTVGQNEINE  311

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             LA  LELS  PF W+LRK        P +LP  F  RT ++G V   WAPQ  IL+H ++
Sbjct  312   LARGLELSGSPFFWVLRKSSGLGSIDPIVLPDGFEERTKDRGIVWKSWAPQLKILSHESV  371

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDM  1313
             GG L H GW +IIE L FGHPLI+LP + DQGLNA++L +K +G EVPR E+ G+++ D 
Sbjct  372   GGLLTHCGWSSIIEGLIFGHPLIMLPFLVDQGLNARILQDKGVGVEVPRNEEGGTYTSDS  431

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKIL  1463
             V NS++ VM   +G+ IR KA +M+ IFGN  LHD YI+  I + +++++
Sbjct  432   VVNSVKLVMVENDGKIIREKAKEMSAIFGNKELHDKYIENLINFLENQLI  481



>ref|XP_008346201.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Malus 
domestica]
Length=472

 Score =   386 bits (991),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 278/469 (59%), Gaps = 11/469 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A+   V++ PW +FGH++P  + +  LA     VS +STPKN+Q+LP         + L 
Sbjct  2     AKDLRVVMLPWSSFGHIIPYFQLSVALAKAKVHVSXISTPKNIQKLPKFSTDLXSFIHLV  61

Query  246   EIALPSV-PG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
              I  P + PG LPE  EATVD+   E+   LK AYD +  P ++ +   LP+ I+ D+A 
Sbjct  62    PIPFPPLDPGFLPEGAEATVDV-PFEKTDNLKIAYDLLQEPIKQFIGEQLPDWIISDYAA  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR---PSPEHFTVPPGWFNFHS  590
             HWV +IAK YG+   + S +  A  A+ G PE L         P+PE  T PP W  F S
Sbjct  121   HWVVDIAKEYGIPVGYFSPFCMAGSAFFGGPENLLGANRNHALPTPESLTSPPDWVAFAS  180

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R   A  + R     + SG+S   RL+ ++ G   + +RSC E EGEY+++ +KL 
Sbjct  181   TVAFREFEAFYVPRGFFGANGSGISDSARLAKIVSGSQVLAIRSCDEVEGEYLEVYKKLT  240

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
              +PV++ GLLPP      A       S+    FEWLD    +SVVFVGFGSE K+   Q+
Sbjct  241   GKPVMSTGLLPPEKPTRRA---KGEISTDDGIFEWLDKHETRSVVFVGFGSECKLSKEQV  297

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  LELS +PFLW LRKP   N    AL P  FV+RTS +G V LGW PQ  ILAHP
Sbjct  298   FEIAYGLELSELPFLWALRKPSWANNDADAL-PVGFVDRTSEKGLVCLGWVPQMEILAHP  356

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFHSGWG+IIE+L FG  L+ LPMV DQ LNA+LL ++ +  EV R  DGSFSRD
Sbjct  357   SIGGSLFHSGWGSIIETLQFGQVLVALPMVFDQPLNARLLEDRGLAVEVKRSRDGSFSRD  416

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQS  1454
              ++  +R  M   EGE +R  A + A +FG+H LH D+YI QF+ + ++
Sbjct  417   EISKKLRHAMVEEEGEKLRSNARKAAAVFGDHKLHQDHYIGQFVNFLKN  465



>ref|XP_002318358.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa]
 gb|EEE96578.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa]
Length=475

 Score =   386 bits (991),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 205/465 (44%), Positives = 287/465 (62%), Gaps = 10/465 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV +FPWLAFGHM+P LE AK  AAKG ++SF+STP+N+ RLP  PA  +  L   +
Sbjct  6     DKIHVAMFPWLAFGHMMPWLELAKLFAAKGHKISFISTPRNIDRLPKPPADVSSTLHFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP + EAT+DL    +VQ+LK A D++  PF +++    P+ I  DFA +W 
Sbjct  66    LPLPQVEGLPPDAEATIDLPAN-KVQYLKIALDKVQEPFAKVLESLNPDWIFYDFAQYWT  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAHR  605
               IA + G+ + + S+  AA +A+LG P  L  G   R  PE FT+PP W +F + VA++
Sbjct  125   GPIAAQLGIKSTYFSICIAAMVAFLGPPSPLIDGDDYRKKPEDFTIPPKWVSFQTTVAYK  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               Y      +    DASGV+  +R    ++ CDF+ VRS  E E E++ +LE ++++PV 
Sbjct  185   Y-YDIMNTFDCVEDDASGVNDLKRWGLCLQSCDFIAVRSSFEIEPEWLQVLETIHEKPVF  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +G LPP   +   ++   NS +WS   +W D Q   SVV+V FGSE K    Q+ ELA 
Sbjct  244   PVGQLPP---VEYELEE-KNSDAWSSMKKWFDMQEKSSVVYVAFGSEAKPSQAQLTELAL  299

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              LELS +PF W+LR + GI +      LP  F  RT  QG V   WAPQ  ILAH +I G
Sbjct  300   GLELSGLPFFWVLRTRRGITDTDLIE-LPPGFEERTKGQGVVCTTWAPQLMILAHESIAG  358

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L HSGW +++E+L F   LILL   +DQG+NA++L EK+IGY +PR E DGSF+RD VA
Sbjct  359   FLTHSGWSSVVEALTFQKALILLTFYSDQGINARVLEEKKIGYSIPRNELDGSFTRDSVA  418

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+R VM S EG+  R KA +M+ +FG+ +  D Y+D  + Y +S
Sbjct  419   ESLRLVMVSEEGKMYRDKAKEMSGLFGDRDRQDKYVDNILIYLKS  463



>ref|XP_009408288.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   385 bits (990),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 282/462 (61%), Gaps = 8/462 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++ PWLAFGH+LP +E +K++A  G RVS + T +N+QRLP +P   +  L   E+ +
Sbjct  7     HIVMLPWLAFGHLLPFMELSKRMAQHGHRVSLLVTKRNIQRLPRVPPHLSSLLQFVELPM  66

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPEL---ILVDFATHWV  428
             PS+  LPEN EA++DL   E   +L+ A+D         +R+ LP +   IL D+A +W 
Sbjct  67    PSIEHLPENAEASIDLPSDELRPYLRQAFDTFQHQLSSFLRQTLPRVPDWILFDYAAYWA  126

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHR  605
             P +A  +GV   +L ++ AA L++ G    L   +  R +PE F   P W  F S V  +
Sbjct  127   PRVAAEFGVPCAYLGLFNAAVLSFFGPSASLMGCEGARETPEQFMELPEWVPFESTVFFK  186

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             P  A  + +    PDASGVS   R    +E C  + VRSC EFE ++  LL KL+KRPV+
Sbjct  187   PYEARELFKPGVLPDASGVSEAYRFGRTLEDCQLISVRSCPEFEPDWFHLLGKLHKRPVI  246

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +G  PP    +   +   +   W   F+WL  Q+P+SVV+V FGSE K+   Q+HE+A 
Sbjct  247   PVGFFPPSPQESDTDE--ESDRRWRSIFQWLAKQKPESVVYVAFGSEVKLTSSQVHEIAL  304

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LE S++PF+W LR P  D+ G PA LP  F  RT  +G V LGW PQ  +LAHP++GG 
Sbjct  305   GLEGSQLPFVWALRAPA-DSHGSPAALPEGFEERTQGRGLVCLGWVPQARLLAHPSMGGF  363

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVAN  1322
             L H+GW +I+E L  G P++L+P++ DQGLNA+ LVE++I  EVPR  EDGSF+ + +A 
Sbjct  364   LTHAGWNSIVEGLALGLPVVLMPLMFDQGLNARNLVERKISVEVPRNEEDGSFTGEGIAT  423

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             ++R VM   +G+ +R KA +   +FG+  L+D ++ +F++Y 
Sbjct  424   TLRLVMVEEQGQPLRAKAKEYREVFGDEKLNDRHVWEFLKYL  465



>ref|XP_011093243.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=468

 Score =   385 bits (989),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 290/463 (63%), Gaps = 9/463 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV + PW AFGH++P L+ +  LA  G  VSF++TP+N+ RLP IP + +  +    + L
Sbjct  8     HVAMLPWSAFGHLIPFLQLSIALAKSGIHVSFLATPRNILRLPKIPPNLSNLIDFVPLPL  67

Query  258   P---SVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             P   S P LPE+ EATVD+   +++Q+LK A D +  P    V  + P  I+VDF  HW 
Sbjct  68    PKPESSP-LPESAEATVDI-PADKIQYLKLACDLLQEPVRGFVSENPPHWIIVDFFHHWA  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
              +IA+ + +  V   V++AAT+ + G  +    G  R  P+ +T+PP + +F S VA++ 
Sbjct  126   VDIAQDFNIPIVTFWVFSAATVDFFGVHKVPLDGDKRMLPQSWTLPPEYIDFSSKVAYKK  185

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
               A  M       +ASG+    R++ +I+  + + +R+C EFE +Y+ L EKL  +PV  
Sbjct  186   HEAEEMHAGYFGQNASGMPDSSRVAKIIQATNAIAIRTCPEFEADYLKLHEKLTGKPVFP  245

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP      +  P +N   WS  F+WLD Q P+SVVFVGFGSE K+   QIHE+A  
Sbjct  246   VGFLPPEKMKRRS--PTSNEEPWSGIFQWLDKQNPRSVVFVGFGSECKLNKDQIHEIAHG  303

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             +ELS +PFLW LRKP   +    A  P  F  RT+ +G   +GWAPQ+ +L+HP++GGCL
Sbjct  304   VELSGLPFLWALRKPDWADDDEDAF-PAGFRERTATRGVAHVGWAPQREVLSHPSVGGCL  362

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANSI  1328
             FH+GWG+IIESL +GH L+ LP + DQ LNA+LLVEK +G+EV R EDGSFSR  +A ++
Sbjct  363   FHAGWGSIIESLQYGHCLVFLPFIIDQPLNARLLVEKGLGWEVERGEDGSFSRYDIAKAL  422

Query  1329  RSVMASREGEGIRLKAAQMAN-IFGNHNLHDNYIDQFIEYFQS  1454
                M  +EGE + ++  +  + IFG+  LH +Y+++F+EY ++
Sbjct  423   EKAMVLKEGEEVMVRGREAGDGIFGDEKLHLSYVEKFVEYLKN  465



>ref|XP_007208586.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
 gb|EMJ09785.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
Length=470

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 284/471 (60%), Gaps = 12/471 (3%)
 Frame = +3

Query  57    TMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERL  236
             T   ++ H+ +FPWLAFGH++P  E AK +A +G +VSF+STP+N+QRLP IP   T  +
Sbjct  4     TTEPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTPLI  63

Query  237   SLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
             +L +I LP V  LPEN EAT+D+     + +LK A+D +       ++   P+ I+ DFA
Sbjct  64    NLVQIPLPRVENLPENAEATMDVPYH-IIPYLKIAHDGLEQGISNFLQTHKPDWIIHDFA  122

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLG--SPEELRSGKLRPSPEHFTVPPGWFNFHS  590
              HW+P IA   G++    S++ A+TL ++G  SPE L    +R  PEHFTVPP W  F S
Sbjct  123   PHWLPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTVPPEWIPFPS  182

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              +  R   A  +   T   +ASGVS   R+ S ++GC   ++RSC+E EGE++DLL++L 
Sbjct  183   NLVFRSFEAKKLFDATKQ-NASGVSDLFRVQSTVQGCQVYLIRSCREIEGEWLDLLQELQ  241

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             + PV+ IGLLPP       +Q   +   WS  ++WLD Q   +VV++  GSE  +     
Sbjct  242   QFPVVPIGLLPP------LVQTREDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQEDF  295

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              ELA  LELS +PF W+LR P          LP  F  RT  +G V   WAPQ  ILAH 
Sbjct  296   TELALGLELSGLPFFWVLRTPSWSGDSDSVKLPDGFEERTKGRGLVWTTWAPQTKILAHD  355

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSR  1307
             +IGG L H GW ++IE+L +G PLI+LP + DQGL A+   +K+IG EVPR  EDGSF+R
Sbjct  356   SIGGFLTHCGWSSLIEALQYGRPLIMLPFLYDQGLIARFW-DKKIGIEVPRNEEDGSFTR  414

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
               +A S+  V+   EG+  R  A +   +F + +LHD Y+D+ +EY ++ +
Sbjct  415   KSLAESLNLVVVDEEGKAYRDGAKEHGEVFKDKDLHDRYMDKCVEYLENHV  465



>ref|XP_004250157.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=474

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/473 (42%), Positives = 291/473 (62%), Gaps = 10/473 (2%)
 Frame = +3

Query  63    AAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSL  242
               ++ H+++FPWLAFGH++P LE +K LA KG ++SF+STP+N+ RLP IP+ F+  ++ 
Sbjct  8     TTKKLHIVMFPWLAFGHIIPFLELSKFLALKGHKISFISTPRNIDRLPKIPSEFSNSITF  67

Query  243   REIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
              +I LP + GLP++ EAT+D+   E++ +LK A D M       +  + P+ I+ DFA +
Sbjct  68    VKIPLPKIDGLPKDAEATMDI-TSEEMTYLKKAMDGMENEVTNFLENNCPDWIIQDFAQY  126

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSP---EHFTVPPGWFNFHSL  593
             W+  I+ R G++ +F S+  A  L++LGS E + +     SP   E F VPP W  F + 
Sbjct  127   WLAPISTRLGISRIFYSIINAWFLSFLGSFENMINTNNCTSPPKLEDFLVPPKWIPFETK  186

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
               +R   A  M+ ++   + SGVS   R    IEG D +I+R C EFEG+++ LLE L+ 
Sbjct  187   ATYRLHEARWMVESSQK-NVSGVSDMYRNGVTIEGADAIIIRHCHEFEGQWLKLLEDLHH  245

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
              PVL  GL+PP +  ++       + SW    EWLD +   SVV+V  GSE  +  ++I+
Sbjct  246   MPVLPTGLMPPIVESSSH----EKNESWISIKEWLDEKPKGSVVYVALGSEVTVGQNEIN  301

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             ELA  LELS  PF W+LRK        P +LP  F  RT ++G V   WAPQ  IL+H +
Sbjct  302   ELARGLELSGSPFFWVLRKSSGLGSIDPIVLPDGFEERTKDRGIVWKSWAPQLKILSHES  361

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRD  1310
             +GG L H GW +IIE L FGH LI+LP + DQGLNA+++ +K +G EVPR  EDGS++ +
Sbjct  362   VGGFLTHCGWSSIIEGLMFGHSLIMLPFLVDQGLNARIIEDKGVGIEVPRNEEDGSYTSN  421

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
              VANS++ VM   +G+ IR KA ++++IF N  LHD YI+  I + +    +Q
Sbjct  422   SVANSVKLVMVKNDGKLIREKAKELSSIFSNKELHDKYIENLINFLEDYKKSQ  474



>ref|XP_011099970.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=502

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/469 (42%), Positives = 286/469 (61%), Gaps = 15/469 (3%)
 Frame = +3

Query  63    AAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSL  242
                Q HV++FPWLAFGHM+P LE +K +A KG +++F+STP+N+ RLP +P      ++ 
Sbjct  39    GGRQLHVVMFPWLAFGHMIPFLELSKFIAGKGHKITFISTPRNIDRLPKLPPDLVSSIAF  98

Query  243   REIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
              +I LP + GLPEN EAT+D+   E+V+ LK AYD M     + +    P++I+ DFA H
Sbjct  99    AKIPLPKLEGLPENAEATMDV-LPEEVEHLKKAYDGMEDDLTQFLENSDPDIIIYDFAPH  157

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVA  599
             W+P IA R  ++  F  ++ A   A+LG+ + + +G   R   E+F  PP W  F + VA
Sbjct  158   WLPAIATRLRISRFFFCIFNAWFFAFLGNTKAMINGLDDRTRLENFLAPPEWVTFETKVA  217

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R  Y   ++      +ASG S   R   VI GC+ +I+R C EFE +++ +LE+L++  
Sbjct  218   YRL-YEADLILCAAVTNASGFSDFYRAGKVIAGCNAMIIRHCNEFESKWLKVLEELHQIE  276

Query  780   VLAIGLLPPRLNLNTAIQPGTNSS--SWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             V+ +GL+PP       +Q  ++SS  +W     WL +Q  +SVV+V  GSE  +   QI 
Sbjct  277   VIPLGLMPPH------VQDTSDSSNEAWVSITNWLCSQIKESVVYVALGSEVVLSRDQIS  330

Query  954   ELASALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             ELA  LELS +PFLW  RKP G     +   LP  F  R   +G V+  WAPQ  IL H 
Sbjct  331   ELAHGLELSGLPFLWAFRKPAGSREADFE--LPDGFEGRIKGRGVVLKNWAPQLKILGHE  388

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             A+G  L H GW +I+E L FGHPLI+LP V DQGLNA++L E+++G E+PR E DGS++R
Sbjct  389   AVGAFLTHCGWSSIVEGLTFGHPLIMLPFVIDQGLNARVLAERQVGVEIPRNEQDGSYTR  448

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             + VA S+R VM   EG+ +R  A  M+ +FG+  LHD Y+  F+EY + 
Sbjct  449   NAVAQSLRRVMVEVEGQKLRDTAKAMSILFGDRELHDRYLHNFVEYLEK  497



>ref|XP_007220939.1| hypothetical protein PRUPE_ppa025376mg [Prunus persica]
 gb|EMJ22138.1| hypothetical protein PRUPE_ppa025376mg [Prunus persica]
Length=475

 Score =   383 bits (984),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 200/472 (42%), Positives = 281/472 (60%), Gaps = 10/472 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              E   V++ PW AFGH +P  + +  LA     V ++STPKN+QRLP I       + L 
Sbjct  2     GESLRVVMLPWSAFGHTMPFFQLSMALAKAEVHVFYISTPKNIQRLPKISPDLQPFIHLV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
              I  P++    LPE  EATVD+  ++   F K AYD +  P ++ +   LP+ I+VDF+ 
Sbjct  62    SIPFPALASGFLPEGAEATVDIPFEKMDNF-KIAYDLLQQPIKQFIGDQLPDWIIVDFSA  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK----LRPSPEHFTVPPGWFNFH  587
             HW  EI K +GV  V+ S + AAT  +L S E +        +  SPE  T P  +  F 
Sbjct  121   HWAVEIGKEFGVPLVYFSAFCAATCVFLTSLENISKANTDHDVLSSPESLTSPRDFGTFR  180

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S +A+R   A  +    +  + SG+S   R + ++  C  V VRSC EFEGEY++  +  
Sbjct  181   STIAYRKHEAVDIYAGFYELNDSGISDSDRHNKILLACQAVAVRSCNEFEGEYLEAYKNK  240

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
               + V+  GLLPP    +   +  ++ S  +  F+WLD Q+PKSVVFVGFGSE K+   Q
Sbjct  241   TGQLVIPTGLLPPE-QPSAKREISSDGSPNNVIFDWLDKQKPKSVVFVGFGSECKLSKEQ  299

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             + E+A  L LS +PFLW LRKP   +    AL P  FV RTS +G V LGW PQ  IL H
Sbjct  300   VFEIAHGLGLSELPFLWALRKPNWADSEADAL-PPGFVERTSEKGLVCLGWVPQMEILGH  358

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P++GG LFHSGWG++IE+L FGH L++LP + DQ LNA+LLVEK++  EV R EDGSF +
Sbjct  359   PSVGGSLFHSGWGSVIETLQFGHVLVVLPFIIDQPLNARLLVEKDLAVEVKRTEDGSFCK  418

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             D +A ++R  M + EGE +R  A + A +FG+H LH D+Y+ QF+ Y ++ +
Sbjct  419   DDIAKTLRHAMVAEEGEKLRSNARKAAKVFGDHKLHQDHYLGQFVHYLKNNV  470



>ref|XP_004288503.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   383 bits (983),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 293/468 (63%), Gaps = 8/468 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +Q H+ +FPWLAFGH++P LE AK +A +G +VSF+STP+N+QRLP IP + T  ++L +
Sbjct  10    KQLHIALFPWLAFGHIIPFLEVAKHIARRGHKVSFISTPRNIQRLPKIPETLTPLITLVQ  69

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP V  LP+N EAT+D+   + + +LK A+D +     + ++   P+ I+ DFA HW+
Sbjct  70    IPLPHVENLPDNAEATMDV-PYDVIPYLKLAHDGLERGLSKFLQAQTPDWIIHDFAPHWL  128

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSP--EHFTVPPGWFNFHSLVAH  602
             P IA + GVA    S++ A++L + GS    R+ +  P    EHFTVPP W  F S +  
Sbjct  129   PPIATKLGVAIGHFSIFNASSLCFFGSTSADRASRYAPRKKLEHFTVPPEWVPFPSKLVM  188

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             RP  A  ++ +   P+ASGV+   R+ S ++GC    +R+C+E EGE++DLLE L+++PV
Sbjct  189   RPFEAARILEDGRKPNASGVNDWFRMISTVQGCQVYFIRTCREVEGEWLDLLEDLHQKPV  248

Query  783   -LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
              L  GLLPP +  +   + G   S WS   +WLD Q    VV+V  GSE  +   + +EL
Sbjct  249   VLPTGLLPPFVPRSDEDEEG--GSDWSRIADWLDKQEKGKVVYVALGSELNLSQEEFNEL  306

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PF W+LRKP   + G    LP  F  RT ++G V   W+PQ  ILAH +IG
Sbjct  307   ALGLELSGLPFFWVLRKPSHVSDGDSVNLPDGFEERTKDRGLVWKTWSPQPKILAHESIG  366

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDMV  1316
             G L H GW ++IE+L +G PLILLP + DQGL A+   +K+IG EV R E+ G+F+R+ +
Sbjct  367   GFLTHCGWSSLIEALQYGRPLILLPFMYDQGLIARFW-DKKIGIEVSRDEESGAFTRNEL  425

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
             A S+  V+   EG+  R  A + + +FG+  LH  Y+D+ +EY ++ +
Sbjct  426   AKSLNLVVVDEEGKPYRDGAKEYSELFGDKELHSRYMDKCVEYLETHV  473



>gb|KHN26938.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=461

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 207/471 (44%), Positives = 288/471 (61%), Gaps = 18/471 (4%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA     V + PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++ +  + 
Sbjct  1     MAENPIRVTMIPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSTLSHLVH  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
               E+ LPS+    LPE  EATVD+  ++  ++LK A+D++    ++ V   LP+ I+ DF
Sbjct  61    FVELPLPSLDNDILPEGAEATVDIPFEKH-EYLKAAFDKLQDAVKQFVANQLPDWIICDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
               HWV +IA+ + V  +  S+ +A    ++G P   R+G L  SPE  T PP W  F S 
Sbjct  120   NPHWVVDIAQEFQVKLILFSILSATGTTFIGPPGT-RAGHL--SPESLTAPPEWVTFPSS  176

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA R   A          ++SGVS  +R+  + +    VI RSC E EGEY++  +KL++
Sbjct  177   VAFRIHEAIHFCAGFDKVNSSGVSDFERVIKIHDASKAVIFRSCYEIEGEYLNAYQKLFE  236

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +P++ IGLLP    +  A+  G + +     FEWLD Q  KSVVFVGFGSE K+   Q+ 
Sbjct  237   KPMIPIGLLP----VERAVVDGCSDN----IFEWLDKQASKSVVFVGFGSELKLSKDQVF  288

Query  954   ELASALELSRMPFLWILRKPGID-NPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             E+A  LE S++PFLW LRKP  + N GY   LP  F+ RTSN+GRV  GW PQ  ILAH 
Sbjct  289   EIAYGLEESQLPFLWALRKPSWESNDGYS--LPVGFIERTSNRGRVCKGWIPQLEILAHS  346

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRD  1310
             +IGG LFHSGWG++IE+L FGH L++LP   DQ L A+ LVEK +  EV R EDGSF+R+
Sbjct  347   SIGGSLFHSGWGSVIENLQFGHTLVVLPFNIDQPLIARFLVEKGLAIEVKRNEDGSFTRN  406

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
              +A S+R  M   EG+ IR    + A I GN  LH D+Y+  F+++ ++ I
Sbjct  407   DIAASLRQAMVLEEGKKIRNNTREAAAIVGNLKLHQDHYVAAFVQFLKNGI  457



>ref|XP_008386125.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Malus 
domestica]
Length=469

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 203/472 (43%), Positives = 285/472 (60%), Gaps = 13/472 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              +   V++ P+ AFGH++P  + +  LA     V F+STP+N+QRLP IP+     + L 
Sbjct  2     GKNLRVVMLPYSAFGHIMPYFQLSIALAKSNVHVYFISTPRNIQRLPKIPSDLNPFIHLV  61

Query  246   EIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFAT  419
              I  P +    LPE  EATVDL   E++  LK AYD +  P ++ +  +LP+ IL DFA 
Sbjct  62    PIPFPPLDPDFLPEGAEATVDLPF-EKLDNLKVAYDLLQQPLKQFIGEELPDWILSDFAA  120

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR---PSPEHFTVPPGWFNFHS  590
             HWV +IAK YGV+  + S ++AA   + GS E           P+PE  T PP W +F S
Sbjct  121   HWVVDIAKEYGVSIAWFSPFSAACNVFFGSMEXXLGTNRNHAIPTPESLTSPPDWVSFPS  180

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA+R   AP + R     + SG+S   RL+ ++     + +R+C E EGEY+++ +K+ 
Sbjct  181   SVAYRDFVAPYVARGFFGVNKSGISDSARLAKILSASQALAIRTCDEVEGEYLEVFKKIT  240

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEA-FEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
              +PV++ GLL P L      Q G    S ++  FEWLD ++ KSVVFVGFGSE K+   Q
Sbjct  241   GKPVISTGLLLPDL----PAQRGKGGISTNDGIFEWLDKRKNKSVVFVGFGSECKLSKEQ  296

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             + E+AS LELS +PFLW LR P   N    AL P  F   TS +G V  GW PQ  IL H
Sbjct  297   VFEIASGLELSGLPFLWALRNPNWANSDADAL-PPGFAEXTSERGLVCFGWVPQIEILGH  355

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P++GG LFHSGWG++IE+L FGH L++LP++ DQ LNA+LL +K +  EV    DGSFS+
Sbjct  356   PSVGGSLFHSGWGSVIETLQFGHVLVVLPLIIDQPLNARLLEDKGLAVEVKCSGDGSFSK  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             D +A ++R  M   EGE +R  A + A +FG+H LH D+YI QF+ + +S +
Sbjct  416   DEIAKTLRHAMVEEEGEQLRSNARKAAAVFGDHKLHQDHYIGQFVNFLKSTV  467



>ref|XP_011084238.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=470

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/467 (41%), Positives = 279/467 (60%), Gaps = 6/467 (1%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  H+ + PWLAFGH++P LE +K +A KG R+SF+STP+N+ RLP +P   +  ++L +
Sbjct  7     QNLHIAVLPWLAFGHIIPYLELSKHIAQKGHRISFISTPRNIDRLPKLPPHLSSSIALVK  66

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP +  LPEN EAT+D+    Q+  LK A+D + P     +    P+ I+ DFA HWV
Sbjct  67    IPLPRIAELPENAEATMDI-HAGQMGLLKKAFDALEPGLTRFLEDSRPDWIIYDFAAHWV  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHR  605
             P +A R G++  F  +  A  L + G+ + L SG   R  PE F VPP W  F + VA R
Sbjct  126   PPVAVRLGISRAFFFIINAWFLGFFGATDTLISGSDYRTKPEDFMVPPKWVKFETKVAFR  185

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               +           + SG S   R+  VI GC+ +++R C EFE E++ LLE+L+ RPV+
Sbjct  186   -RFEAEWSDGASKSNESGFSDYYRIGKVIAGCEAILIRHCNEFEPEWLTLLEELHHRPVI  244

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GL+PP++  + +     N + W+    WL+ Q   SVV+V  GSE      Q+ ELA 
Sbjct  245   PLGLMPPKVQ-DHSTNNDANHTVWTGIKNWLNRQNKGSVVYVALGSEVTPSQDQVVELAH  303

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W+LRK        P  LP  F  R S +G V   WAPQ  IL H ++GG 
Sbjct  304   GLELSGVPFFWVLRKVSASE-SKPVELPNGFEERVSGRGMVWRSWAPQVEILKHASVGGF  362

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +I+E L +G+PLI LP + DQGLN++++VEK++G E+PR E DG+++R  VA+
Sbjct  363   LSHCGWSSIVEGLMYGNPLITLPFLVDQGLNSRVIVEKQLGVEIPRNEQDGTYTRKWVAD  422

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKIL  1463
             S++ VM   EG   + +A +M+ +FG+  LH  YID  I++ Q+  +
Sbjct  423   SVKLVMVGEEGRKFQERAQEMSLVFGDEELHRRYIDTAIQFLQNHTM  469



>emb|CDP04856.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 285/463 (62%), Gaps = 17/463 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
               HV++FPWLAFGH +P L+ +K +A +G +VSF+STPKN+ RLP IP  F   ++  +I
Sbjct  7     SLHVVMFPWLAFGHFIPFLDLSKFIAQRGHKVSFISTPKNVDRLPKIPLEFASSITYVKI  66

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP V GLPEN EATVDL   + V  LK AYD + P     +    P+ I+ DFA +W+P
Sbjct  67    PLPRVDGLPENVEATVDLGGLD-VAVLKKAYDGLEPELTRFLGYSAPDWIIYDFAPYWLP  125

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEE--LRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
              IA +  ++  F S+Y+A ++A+L  P E  +     R   E FTVPP W  F S VA +
Sbjct  126   PIAAKLNISKSFFSIYSAFSMAFLAPPFEALIAGADPRTKVEDFTVPPKWIPFESKVAFK  185

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                +  M+ + +  D SGVS   R+ SV++G D +++R C EFEG+++ L+E L  RP++
Sbjct  186   LHESRWMLESRNL-DGSGVSDLYRVGSVVKGADVILMRHCHEFEGQWLKLVEDLQARPLI  244

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GL+PP +  ++      N+ SW    +WLD Q   SVV+V  GSE  +   Q+ ELA 
Sbjct  245   PVGLMPPPVEKSSL----ENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELAL  300

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LE S +PF W LR         P+ LP  F +R   +G V   WAPQ NIL+H ++GG 
Sbjct  301   GLESSGVPFFWALRN--------PSGLPGGFEDRVKGRGIVWKNWAPQLNILSHDSVGGF  352

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GWG+ IE L FGHPLI+LP V D GL A++L EK +G E+PR + DGS++ D VAN
Sbjct  353   LTHCGWGSSIEGLMFGHPLIMLPFVIDTGLIARVLEEKLVGIEIPRNDVDGSYTSDSVAN  412

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             S+R VM   EG+  + KA ++  IFG+ +LH++Y+ + ++Y +
Sbjct  413   SVRLVMVENEGKVFKDKAKEIGAIFGDQDLHNSYLQKSVDYLE  455



>gb|KHN26937.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=452

 Score =   379 bits (974),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 283/462 (61%), Gaps = 18/462 (4%)
 Frame = +3

Query  87    IFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALPSV  266
             + PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++ +  +   E+ LPS+
Sbjct  1     MIPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSTLSHLVHFVELPLPSL  60

Query  267   PG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEIA  440
                 LPE  EATVD+  ++  ++LK A+D++    ++ V   LP+ I+ DF  HWV +IA
Sbjct  61    DNDILPEGAEATVDIPFEKH-EYLKAAFDKLQDAVKQFVANQLPDWIICDFNPHWVVDIA  119

Query  441   KRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYAP  620
             + + V  +  S+ +A    ++G P   R+G L  SPE  T PP W  F S VA R   A 
Sbjct  120   QEFQVKLILFSILSATGTTFIGPPGT-RAGHL--SPESLTAPPEWVTFPSSVAFRIHEAI  176

Query  621   TMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGLL  800
                      ++SGVS  +R+  + +    VI RSC E EGEY++  +KL+++P++ IGLL
Sbjct  177   HFCAGFDKVNSSGVSDFERVIKIHDASKAVIFRSCYEIEGEYLNAYQKLFEKPMIPIGLL  236

Query  801   PPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALELS  980
             P        ++ G    +    FEWLD Q  KSVVFVGFGSE K+   Q+ E+A  LE S
Sbjct  237   P--------VERGVVDGNSDNVFEWLDKQASKSVVFVGFGSELKLSKDQVFEIAYGLEES  288

Query  981   RMPFLWILRKPGID-NPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             ++PFLW LRKP  + N GY   LP  F+ RTSN+GRV  GW PQ  ILAH +IGG LFHS
Sbjct  289   QLPFLWALRKPSWESNDGYS--LPVGFIERTSNRGRVCKGWIPQLEILAHSSIGGSLFHS  346

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANSIRSV  1337
             GWG++IE+L FGH L++LP   DQ L A+ LVEK +  EV R EDGSF+R+ +A S+R  
Sbjct  347   GWGSVIENLQFGHTLVVLPFNIDQPLIARFLVEKGLAIEVKRNEDGSFTRNDIAASLRQA  406

Query  1338  MASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             M   EG+ IR    + A I GN  LH D+Y+  F+++ ++ I
Sbjct  407   MVLEEGKKIRNNTREAAAIVGNLKLHQDHYVAAFVQFLKNGI  448



>gb|KEH17945.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=470

 Score =   380 bits (975),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 204/475 (43%), Positives = 291/475 (61%), Gaps = 17/475 (4%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  +  HV++ PW AFGH++P  + +  LA  G  VS++STPKN+QRLP IP+S +  + 
Sbjct  1     MTEDTIHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSYISTPKNIQRLPKIPSSLSHLID  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
               EI LPS+    LPE  EAT+D+   +++Q+L+ AYD++  P ++LV   LP  I+ D+
Sbjct  61    FVEIPLPSLNEDLLPEGAEATMDIPF-DKIQYLEQAYDKLKNPVKQLVSNWLPNWIICDY  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
               HW+ +IA+ + +  ++ SV +AATLA+LG P  +     R SP+  T+PP W  F S 
Sbjct  120   NPHWIVDIAQEFHINLIYYSVVSAATLAFLGPPSNMNG---RFSPDSLTLPPKWMTFPSS  176

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+    A    +  H  +AS VS  +RL  VI+    +I  SC E EGEY++L +KL  
Sbjct  177   VAYNRTEAVAFSKYVHQNNASEVSGIERLVKVIDAAKSIICCSCYEIEGEYLNLYKKLVG  236

Query  774   RPVLAIGLLP---PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
             +PV+ IGLLP   P+  L   +  G+ +   +  F+WLD Q  KSVVFVGFGSE K+   
Sbjct  237   KPVIPIGLLPVEMPQRGLLDGL--GSVTGLRTAIFQWLDKQATKSVVFVGFGSECKLSKE  294

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGY--PALLPTDFVNRTSNQGRVILGWAPQQNI  1118
             Q+ E+A  LE S++ FLW LRK    N  Y     LP  F  R+ ++G V +GW P+Q I
Sbjct  295   QVFEIAYGLEDSKLSFLWGLRK---TNWAYNDEDFLPIGFSERSCDRGLVCMGWIPKQEI  351

Query  1119  LAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGS  1298
             LAH +IGG LFHSGWG+ IE+L F + L++LP   DQ LNA+LLV+K +  EV R EDG+
Sbjct  352   LAHSSIGGSLFHSGWGSTIEALQFENKLVVLPFNVDQPLNARLLVDKGLAIEVKRNEDGT  411

Query  1299  FSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             F+R  +A S+R  M   EG+ +R K  +   I GN  LH D+YI  F+++ +  I
Sbjct  412   FTRYEIAKSLRQAMVLEEGKELRTKTREAVGIVGNLKLHQDHYIAAFVQFLKDGI  466



>ref|XP_007047762.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX91919.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=535

 Score =   381 bits (979),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 282/470 (60%), Gaps = 10/470 (2%)
 Frame = +3

Query  54    ITMAAE-QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE  230
             IT+A E + H+ +FPWLAFGHM+P LEFAK +A KG ++SF STPKN+ RLP +P     
Sbjct  58    ITVAGESKLHIAMFPWLAFGHMIPFLEFAKLVAEKGHKISFSSTPKNIDRLPKLPPHLAS  117

Query  231   RLSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVD  410
              +   ++ LP +  LP+N EAT+D+   + V + K AYD +  P  +L++   P+ +L+D
Sbjct  118   LIYFIKLPLPQINHLPQNAEATIDV-PLDDVWYFKKAYDGLQQPMAQLLQSLSPDWLLLD  176

Query  411   FATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFH  587
             FA +W+P IA+   +   F S+ TAA L YLG P  L  G +    PE + V P W  F 
Sbjct  177   FAAYWLPSIARSLNIPNAFFSIVTAACLGYLGPPSFLMHGDEDHKKPEDYAVLPKWVTFP  236

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S V  +  Y    + N  T D +  S   R  + ++ CD V VRSC E E E++ LLE+L
Sbjct  237   STVRLKL-YEVLKIYNGITGDKTNTSDFYRFGATLKDCDMVAVRSCMELEPEWLKLLEQL  295

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
             Y++PV+ +G LP      T       +  W    EWLD Q   SVV++ FGSE K    +
Sbjct  296   YEKPVIPVGELP-----TTDYNNSEETEGWKSMKEWLDKQEKGSVVYIAFGSEAKPSQEE  350

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             ++E+A  LE S +PFLW+LRK        P  LP  F  RT  +G V+  WAPQ  ILAH
Sbjct  351   LNEIAQGLEFSGLPFLWVLRKSRGSTDAEPIKLPEGFEERTKERGVVLTTWAPQLKILAH  410

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFS  1304
              +IGG L H+GW +++E+  F  PLIL   +ADQG+NA+LL EK+IGY +PR+E DGSF+
Sbjct  411   DSIGGFLTHTGWSSVVEAPQFLRPLILFTFLADQGINARLLEEKKIGYSIPRKEQDGSFT  470

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R+ VA S+R V+   EG+  R KA +M  +FG+ +  + Y+D F+ Y ++
Sbjct  471   RNSVAESLRLVVVEDEGKIYRDKAKEMKRVFGDRDKQNWYLDNFLGYLEN  520



>gb|KEH17952.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=470

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/475 (43%), Positives = 290/475 (61%), Gaps = 17/475 (4%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  +  HV++ PW AFGH++P  + +  LA  G  VS++STPKN+QRLP IP+S +  + 
Sbjct  1     MTEDTIHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSYISTPKNIQRLPKIPSSLSHLID  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
               EI LPS+    LPE  EAT+D+   +++Q+L+ AYD++  P ++LV   LP  I+ D+
Sbjct  61    FVEIPLPSLNEDLLPEGAEATMDIPF-DKIQYLEQAYDKLKNPVKQLVSNWLPNWIICDY  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
               HW+ +IA+ + +  ++ SV +AATLA+LG P  +     R SP+  T+PP W  F S 
Sbjct  120   NPHWIVDIAQEFHINLIYYSVVSAATLAFLGPPSNMNG---RFSPDSLTLPPKWMTFPSS  176

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+    A    +  H  +AS VS  +RL  VI+    +I  SC E EGEY++L +KL  
Sbjct  177   VAYNRTEAVAFSKYVHQNNASEVSGIERLVKVIDAAKSIICCSCYEIEGEYLNLYKKLVG  236

Query  774   RPVLAIGLLP---PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
             +PV+ IGLLP   P+  L   +  G+ +   +  F+WLD Q  KSVVFVG GSE K+   
Sbjct  237   KPVIPIGLLPVEMPQRGLLDGL--GSVTGLRTAIFQWLDKQATKSVVFVGIGSECKLSKE  294

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGY--PALLPTDFVNRTSNQGRVILGWAPQQNI  1118
             Q+ E+A  LE S++ FLW LRK    N  Y     LP  F  R+ ++G V +GW PQQ I
Sbjct  295   QVFEIAYGLEDSKLSFLWGLRK---TNWAYNDEDFLPIGFSERSCDRGLVCMGWIPQQEI  351

Query  1119  LAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGS  1298
             LAH +IGG LFHSGWG+ IE+L F + L++LP   DQ LNA+LLV+K +  EV R EDG+
Sbjct  352   LAHSSIGGSLFHSGWGSTIEALQFENKLVVLPFNVDQPLNARLLVDKGLAIEVKRNEDGT  411

Query  1299  FSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             F+R  +A S+R  M   EG+ +R K  +   I GN  LH D+YI  F+++ +  I
Sbjct  412   FTRYEIAKSLRQAMVLEEGKELRTKTREAVGIVGNLKLHQDHYIAAFVQFLKDGI  466



>ref|XP_004306714.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=473

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 198/476 (42%), Positives = 287/476 (60%), Gaps = 22/476 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV++ PW AFGH++P  + +  LA     VSF+STP+N++RLP I       ++L  
Sbjct  6     KELHVVMLPWSAFGHLMPFFQLSIALAKAKVHVSFISTPRNIERLPKIAPDLQPFINLVP  65

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             I  P +    LPE  EA+VD+  Q Q   L+ A D +  P ++ +   +P+ I+ DF TH
Sbjct  66    IPFPPLEPDFLPEGAEASVDVPVQ-QYANLQVAVDLLQTPIKQFIADKMPDWIIADFFTH  124

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL----RSGKLRPSPEHFTVPPGWFNFHS  590
             WV +IAK Y V   + SV++AAT  + G PE L    R+G L P+ +  T PP W  F S
Sbjct  125   WVVDIAKEYDVPLAYFSVFSAATCVFFGPPEHLTAATRNGVL-PTIQSLTSPPEWITFPS  183

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
             L++ + DY           + +G+    RL+ ++     + +R+C E EG+Y+++ +K+ 
Sbjct  184   LLSLK-DYEAVKRLLAWEVNKTGMCFAWRLAKIVSASQVLAIRTCSEIEGDYLEVYKKIT  242

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNS----SSWSEAFEWLDNQRPKSVVFVGFGSEYKMP  938
              +PV+  G+LPP        QPG  +    +S +  F+WLD Q+P+SVVFVGFGSE ++ 
Sbjct  243   GKPVIPTGVLPPD-------QPGKRAEGEVNSDASMFDWLDKQKPRSVVFVGFGSECRLS  295

Query  939   IHQIHELASALELSRMPFLWILRKPG-IDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
               Q+HE+A  LELS  PF+W LRKP   ++      LP  F +RTS +G V  GW PQ  
Sbjct  296   KEQVHEMAHGLELSEQPFIWGLRKPNSTESDEVDDFLPLGFTDRTSEKGLVCFGWVPQME  355

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDG  1295
             IL HP+IGG LFHSGWG++IE+L FGH L++LP + DQ LNA+LLVEK +  EV R EDG
Sbjct  356   ILGHPSIGGSLFHSGWGSVIETLQFGHGLVVLPFMYDQPLNARLLVEKGLAAEVKRNEDG  415

Query  1296  SFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNL-HDNYIDQFIEYFQSKI  1460
             SFSR  +A S+R  M   EGE +R  A + A + G+H L HD+YI  F+ Y ++ +
Sbjct  416   SFSRGEIAKSLRLAMVEEEGEQLRSNARKAAAVIGDHKLQHDHYISAFVNYLKNNV  471



>ref|XP_006360400.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=471

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 287/465 (62%), Gaps = 13/465 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+++FPWLAFGH++P LE +K +A KG ++SF+STP+N+ RLP +P  ++  ++L +I
Sbjct  8     KLHIVMFPWLAFGHIIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPLEYSTSITLVKI  67

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP V GLPEN EAT+D+  ++ V +LK A D M       + +  P+ ++ DFA +W+ 
Sbjct  68    PLPHVDGLPENAEATMDIHTKDIV-YLKKALDGMELELTSFLEKTSPDWVIHDFAPYWLA  126

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR--PSPEHFTVPPGWFNFHSLVAHR  605
              I  R  ++  F  V  A  LA+ GS + + +G     P+PE F V P W  F + VA R
Sbjct  127   PITTRLRISRGFFRVVNAWFLAFGGSTDMMLTGSSNPPPTPEDFMVTPKWIPFETKVAFR  186

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                A  ++ +    + SGVS   R  + I+  D VI+R C EFE +++ LLE LY RP++
Sbjct  187   HHEAKWVV-DAMQKNVSGVSDIYRSGATIKDVDVVIIRHCCEFESQWLKLLEDLYHRPIV  245

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GL+PP L+         N+ +W+   EWLD Q   SVV+V  GSE  +   +I+ELA 
Sbjct  246   PVGLMPPSLD------NSDNNGTWTCIKEWLDEQTKGSVVYVALGSEVTIGPSEINELAY  299

Query  966   ALELSRMPFLWILRK-PGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              LELS + F W LRK P   N  Y   LP  F  R   +G V   W PQ  +L+H ++GG
Sbjct  300   GLELSGVAFFWALRKRPYSGNMDY-VELPDGFEERIHGRGIVWKSWVPQLKLLSHESVGG  358

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVA  1319
              L H GW +IIE L FGHPLI+LP + DQGLNA++L +KEIG E+PR  EDGS++RD V+
Sbjct  359   FLTHCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKEIGIEIPRNEEDGSYTRDSVS  418

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +S++ VM  ++G  IR KA ++++IFGN  LHD YI+  I++ + 
Sbjct  419   SSVKLVMVEKDGRKIREKAKEISSIFGNRRLHDKYIEDLIQFLED  463



>ref|XP_004240255.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=469

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/468 (42%), Positives = 288/468 (62%), Gaps = 15/468 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
               + H+++FPWLAFGH++P LE +K +A KG ++SF+STP+N+ RLP +P  ++  ++L 
Sbjct  2     TNKLHIVMFPWLAFGHIIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPLEYSTSITLV  61

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP V GLPEN EAT+D+  ++ V +LK A D M       + +  P+ I+ DFA +W
Sbjct  62    KIPLPHVDGLPENAEATMDIHTKDIV-YLKKALDGMELQLTSFLEKTSPDWIIHDFAPYW  120

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRP--SPEHFTVPPGWFNFHSLVA  599
             +  I  R  +A  F  V  A  LA+ GS + + +G   P  +PE   V P W  F +   
Sbjct  121   LAPITTRLRIARGFFRVINAWFLAFWGSTDMMLTGYTDPPPTPEDLMVMPKWIPFETKAV  180

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
              R   A  ++ +    + SGVS   R  + I+  D VI+R C EFEG+++ LLE L+ RP
Sbjct  181   FRHHEAKWVV-DAMQKNVSGVSDIYRAGATIKDVDVVIIRHCYEFEGQWLKLLEDLHHRP  239

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             ++ +GL+PP L+         N+ +W+    WLD Q   SVV+V  GSE  +   +I+EL
Sbjct  240   IVPVGLMPPSLD------NSDNNGTWTCIKGWLDEQTKGSVVYVALGSEVTIGPREINEL  293

Query  960   ASALELSRMPFLWILRKPGIDNPGYPAL--LPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             A  LELS +PF W+LRK  + N G+     LP  F  RT  +G V   W PQ  IL+H +
Sbjct  294   AYGLELSGVPFFWVLRK--LSNSGHMDYVELPDGFEERTHGRGIVWKSWVPQLKILSHKS  351

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRD  1310
             +GG L H GW +IIE L FGHPLI+LP + DQGLNA++L +KEIG E+PR  EDGS++RD
Sbjct  352   VGGFLTHCGWSSIIEGLMFGHPLIMLPFLVDQGLNARVLEDKEIGIEIPRNEEDGSYTRD  411

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              V++S++ VM  ++G  IR +A ++++I+GN  LHD YI+  I++ + 
Sbjct  412   SVSSSVKLVMVEKDGRRIREEAREISSIYGNKRLHDKYIEDLIQFLED  459



>gb|KHN26940.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=469

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 286/472 (61%), Gaps = 18/472 (4%)
 Frame = +3

Query  57    TMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERL  236
              MA     V + PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++ +  +
Sbjct  8     NMAENPIRVTMIPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSTLSHLV  67

Query  237   SLREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVD  410
                E+ LPS+    LPE  EATVD+  ++  ++LK A D++    ++ V   LP+ I+ D
Sbjct  68    HFVELPLPSLDNDILPEGAEATVDIPFEKH-EYLKAALDKLQDAVKQFVANQLPDWIICD  126

Query  411   FATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHS  590
             F  HWV +IA+ + V  +  S+ +A    ++G P   R+G L  SPE  T PP W  F S
Sbjct  127   FNPHWVVDIAQEFQVKLILFSILSATGTTFIGPPGT-RAGHL--SPESLTAPPEWVTFPS  183

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R   A          ++SGVS  +R+  +      V+ RSC E EGEY++  +KL+
Sbjct  184   SVAFRIHEAIHFCAGFDKVNSSGVSDFERIIKLHGASKAVLFRSCYEIEGEYLNAYQKLF  243

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++P++ IGLLP    +  A+  G + +     FEWLD Q  KSVVFVGFGSE K+   Q+
Sbjct  244   EKPMIPIGLLP----VERAVVDGCSDN----IFEWLDKQASKSVVFVGFGSELKLSKDQV  295

Query  951   HELASALELSRMPFLWILRKPGID-NPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
              E+A  LE S++PFLW LRKP  + N GY   LP  F+ RTSN+GRV  GW PQ  ILAH
Sbjct  296   FEIAYGLEESQLPFLWALRKPSWESNDGYS--LPVGFIERTSNRGRVCKGWIPQLEILAH  353

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
              +IGG LFHSGWG++IE+L FGH L++LP   DQ L A+ LVEK +  EV R EDGSF+R
Sbjct  354   SSIGGSLFHSGWGSVIENLQFGHTLVVLPFNIDQPLIARFLVEKGLAIEVKRNEDGSFTR  413

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             + +A S+R  M   EG+ IR    + A I GN  LH D+Y+  F+++ ++ I
Sbjct  414   NDIAASLRQAMVLEEGKKIRNNTREAAAIVGNLKLHQDHYVAAFVQFLKNGI  465



>ref|XP_008346533.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Malus 
domestica]
Length=476

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 207/468 (44%), Positives = 275/468 (59%), Gaps = 11/468 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +   V++ PW AFGHM+P  + +  LA     VSF+STPKN+QRLP I       + L  
Sbjct  5     DHLSVVMLPWSAFGHMMPFFQLSIALAKAKVHVSFISTPKNIQRLPKILPDLQPFVQLVX  64

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             I  P +    LPE  EA+VDL   E    LK AYD +  P ++ +   LP+ I+ DFA H
Sbjct  65    IPFPXLDPDLLPEGAEASVDL-PFENTDNLKIAYDLLQTPIKQFIGDRLPDWIITDFAAH  123

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGS---PEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             WV EI K YGV  V+ +V +AAT+    S   P    +    PSPE  T PP      S 
Sbjct  124   WVVEIGKEYGVPLVYFTVVSAATVVVFSSAENPSSXNTDXTLPSPESLTSPPDLVTSQST  183

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+R   A  M    +  + SG+S  +R + ++  C    +RSC EFEGEY++  +    
Sbjct  184   VAYREHEAVDMHEGLYGVNDSGISDAERHAKILSACRVFAIRSCYEFEGEYLEAYKNXSG  243

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             + V+  GLLPP +            SS    FEWLD Q+ +SVVFVGFGSE K+   Q+ 
Sbjct  244   KLVIPTGLLPPEIPXKGV---KGEISSDDGIFEWLDKQKTRSVVFVGFGSECKLSKEQVF  300

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PFLW LRKP   N    AL P  FV+R S +G V +GW PQ  ILAHP+
Sbjct  301   EIAHGLELSELPFLWALRKPNWANSEADAL-PLGFVDRVSEKGLVCIGWVPQMEILAHPS  359

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             +GG LFHSGWG+IIE+L FGH L++LP + DQ LNA+LL EK +  EV RR DGSFSRD 
Sbjct  360   VGGSLFHSGWGSIIETLQFGHVLVVLPFIIDQPLNARLLEEKGMAVEVKRRGDGSFSRDD  419

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQS  1454
             +A ++R  M   EGE +R  A + A +FG+H LH D+YI +F+ + ++
Sbjct  420   IAKTLRHAMVEEEGERLRSNARKAATVFGDHKLHQDHYIGKFVNFLKN  467



>emb|CDP01584.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/463 (42%), Positives = 286/463 (62%), Gaps = 7/463 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+++FPWLAFGHM+P LE +K +A KG +VSF+STP+N+ RLP  P + T  L   +I
Sbjct  6     KLHIVMFPWLAFGHMIPYLELSKLIAKKGHKVSFLSTPRNIDRLPKPPPNLTRHLKFVKI  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP +  LPEN EAT DL    +V++LK A D +  P  E +R+  P+ +L DFA +W+P
Sbjct  66    PLPHIENLPENAEATTDLPYN-KVKYLKLACDGLQQPISEFLRQTCPDWVLFDFAPYWIP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELR-SGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
              +A +  + T F S++TA  L + G  E ++ +G+ R +P+ FTV P W  F + VA + 
Sbjct  125   SVASKLNIRTAFFSIFTAPFLGFCGPVEVMKGNGEDRKTPQDFTVKPKWVPFETNVAFKL  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    + ++   D   +S   R  S IE CDF+ VRSC EFE E++ L+E++Y++PV+ 
Sbjct  185   -FEILRLVDSLIGDEEPISDIFRGGSSIENCDFLAVRSCSEFEPEWLQLMEEIYQKPVIP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LP   N +     G    +W    EWLD Q   SVV+V FGSE K    +++E++  
Sbjct  244   VGQLPTTGNNDAD---GGKDEAWRPIKEWLDKQERGSVVYVAFGSEAKPSQAEVNEISLG  300

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LELS +PF W+LR            LP  F +RT ++G V   WAPQ  IL+H ++GG L
Sbjct  301   LELSGLPFFWVLRTKRGGEDTEVIELPEGFEDRTKDRGVVCASWAPQLKILSHDSVGGFL  360

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              HSGW +++E++ F   LILL M+ADQG+NA++L EK++GY +PR + DGSF+RD VA S
Sbjct  361   THSGWSSVVEAIQFEKALILLTMLADQGINARVLGEKKMGYPIPRDDSDGSFTRDSVAES  420

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +R VM   EG+  R K+ +M  +F + +  D YI+  + + QS
Sbjct  421   LRLVMIEDEGKIYRDKSKEMRRLFCDESRQDGYIENLLNFLQS  463



>ref|XP_010277529.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nelumbo 
nucifera]
Length=474

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 288/470 (61%), Gaps = 14/470 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  H+++FPWLAFGHMLP LE +K LA +G R+SFV++P+N+QRLP IP S +  ++L  
Sbjct  6     DNLHIVMFPWLAFGHMLPFLELSKCLAQRGHRISFVTSPRNIQRLPQIPPSLSHLINLVN  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V  LPEN EAT+DL   +++Q+LK A+D +  P    +    P+ ++ DFA HW+
Sbjct  66    LPLPPVDNLPENTEATIDL-PYDKIQYLKKAFDGLEEPLTRFLEASSPDWVIYDFAPHWL  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHR  605
             P I  + G+     +++ AA   ++ SP  +   +  R   EHFTVPP W  F S +A R
Sbjct  125   PPITNKLGLLGACFNIFNAAAQVFIVSPSSMMGEEDPRSEAEHFTVPPKWIPFPSNLAFR  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLL-EKLYKRPV  782
               +    + +    + +GVS   R  S + G D + +RSC EFE +++ LL E++ ++P 
Sbjct  185   L-HEIRRIFDAVQENVAGVSDIFRFESTVRGSDIIAIRSCVEFEAQWLRLLNEEICRKPN  243

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP +     I+ G +  SW    EWLD Q+ +SVV++  GSE  +      ELA
Sbjct  244   VPVGLLPPSVQ---DIREGDDDESWIAIREWLDKQKSRSVVYIALGSEATLSHEDETELA  300

Query  963   SALELSRMPFLWILRKPGIDNPGYPAL--LPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
               LELSR+PF W+LR+P    PG  A   LPT F +RT ++G V  GWAPQ  ILAHP++
Sbjct  301   LGLELSRLPFFWVLRRP----PGSSAAEELPTGFEDRTRSRGVVCRGWAPQMKILAHPSV  356

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             G  L H GW + IE+LG+  PL+LLP+ + QGL A+ L   +IG E+PR E DGSF+R+ 
Sbjct  357   GVFLTHCGWSSAIEALGWEVPLVLLPLTSTQGLCARQLAWDKIGVEIPRNEGDGSFTRNS  416

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKIL  1463
             VA ++R V  S +G  +R +A +M  IF N  LHD Y+D F  + ++  L
Sbjct  417   VAETLRLVAVSEQGNALRTRAKEMRKIFCNSTLHDGYMDNFERHLKNHRL  466



>ref|XP_004289519.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=480

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 286/466 (61%), Gaps = 9/466 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLAFGHM+P LE AK +A +G +VSF+STP+N+QRL  IP + T  ++L +
Sbjct  10    QKLHIGLFPWLAFGHMIPFLEVAKHIARRGHKVSFISTPRNIQRLSKIPQNLTPLITLVQ  69

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP V  LPE  EAT+D+   + + +LK A+D +     E ++   P+ I+ DFA +W+
Sbjct  70    IPLPRVENLPEYAEATMDV-PIDVIPYLKIAHDGLENGISEFLQTHAPDWIIYDFAPYWL  128

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGS--PEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             P IA + G+       + A+T+ +LGS  PE       R  PE +TVPP WF F S +  
Sbjct  129   PPIAIKLGIKRAIFCTFNASTMCFLGSTAPEVTSRYAPRTKPEQYTVPPEWFPFPSKLCF  188

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +P  A  ++    TP+ASG++   R+ S  +GC    +RSC+E EGE++DLL+ L ++PV
Sbjct  189   KPFEAKRVVDGLMTPNASGMTDWFRVESTYQGCQVYFIRSCREIEGEWLDLLQDLNQKPV  248

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             +  GLLPP +  +   Q   + +SWS   EWLD Q+   VV+V FGSE  +   + +ELA
Sbjct  249   VPTGLLPPPVQTSDEDQ---HDNSWSRIAEWLDKQKKGEVVYVAFGSEINLSQEEFNELA  305

Query  963   SALELSRMPFLWILRKPG-IDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
               LEL  +PF W+LRKP      G    LP  F +RT+ +G V   WAPQQ ILAH ++G
Sbjct  306   LGLELCGLPFFWVLRKPSHRSGDGDTVKLPDGFEDRTNGRGLVWTTWAPQQKILAHESVG  365

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDMV  1316
             G L H GW ++IE+L +G PLI+LP + DQGL A+L   K+ G EV R E+ G F+RD +
Sbjct  366   GFLSHCGWSSLIEALQYGRPLIMLPFMYDQGLIARLW-NKKTGIEVSRDEESGWFTRDEL  424

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S+  V+   EG+  R  A +   +F +  LHD Y+D+ +EY +S
Sbjct  425   ARSVNLVVVHEEGKPYRDGAKEYRELFRDKELHDRYMDECVEYLES  470



>gb|KDO60536.1| hypothetical protein CISIN_1g011765mg [Citrus sinensis]
Length=478

 Score =   375 bits (964),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 194/464 (42%), Positives = 282/464 (61%), Gaps = 8/464 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             +  + +FPWLAFGHM+P LE AK +A KG ++ F+STP+N+ RLP +P +    +   +I
Sbjct  6     KLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQFVKI  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
             +LP V  L EN EAT+DL   E V++LK ++D +  P  +L++   P+ +L DFA +W+P
Sbjct  66    SLPHVDNLRENAEATIDLPYDE-VKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAYWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEEL--RSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
               A+  G+ + F S++TAATL Y G    L   SG    +PE +T  P W +F + +++R
Sbjct  125   ARARELGIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPNWVSFPTTISYR  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               +    + +    D S VS G R    ++GCD V VRSC EFE E++ LLE+L+++PV+
Sbjct  185   L-FEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKPVI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +G LP       +      + +W    EWLD Q   SVV+V FGSE K    ++ E+A 
Sbjct  244   PVGQLPTTTGDGDS---DAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS++PF W+L+K        P  LP  F  RT  +G V   WAPQ  ILAH ++GG 
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H+GW +++E+L FG PLI+L   ADQGLNAKLL EK+I   +PR E DG F+R+ VA 
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGFFTRNSVAE  420

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R V+   +G+  R KA +M  +FG+   HD Y+D F+ Y ++
Sbjct  421   SLRLVLVEEKGQIYRDKAKEMKGLFGDKGRHDRYVDNFLNYLKN  464



>emb|CDP01582.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   374 bits (961),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 197/463 (43%), Positives = 284/463 (61%), Gaps = 17/463 (4%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLAFGH +P LE +K +A +G +VSF+STPKN+ RLP IP  F   ++  +I L
Sbjct  9     HVVMFPWLAFGHFIPFLELSKFIAQRGHKVSFISTPKNIDRLPRIPPEFASSITFVKIPL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V GLPEN EATVDL   + V  LK AYD + P     +    P+ I+ DFA +W+P I
Sbjct  69    PPVDGLPENVEATVDLGGLD-VAVLKKAYDGLEPELTRFLEYSAPDWIIYDFAPYWIPPI  127

Query  438   AKRYGVATVFLSVYTAATLA-YLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRPD  611
             A +  ++  F  +++AA++A ++ S + + +G   R   E FTVPP W  F S +A +  
Sbjct  128   AAKLNISKSFFCIFSAASMAFFVRSVDAMIAGTDPRTKVEDFTVPPKWIPFESKLAFKL-  186

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             Y    +      + SGVS   R+ S I+  D  ++R C EFEG+++ LLE L KR V+ +
Sbjct  187   YESRWVVQGQNLEGSGVSDSYRVGSAIKDADVTLIRYCPEFEGQWLKLLEDLLKRHVIPL  246

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GL+PP +  +       N+ SW    +WLD Q   SVV+V  GSE  +   Q+ ELA  L
Sbjct  247   GLMPPPVEKSIV----ENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELALGL  302

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS +PF W LR         P+ LP  F +R   +G V   WAPQ N+L+H ++GG L 
Sbjct  303   ELSGVPFFWALRN--------PSGLPEGFEDRVKGRGIVWKNWAPQLNVLSHDSVGGFLT  354

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSI  1328
             H GW + IE L FGHPLI+LP VAD GL A++L EK++G E+PR + DGS++   VANS+
Sbjct  355   HCGWSSSIEGLMFGHPLIMLPFVADTGLIARMLEEKQVGIEIPRNDVDGSYTSHSVANSV  414

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             R +M   EG+  + KA +++ IFG+ +LHD+Y+ + ++Y ++K
Sbjct  415   RLIMVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYLENK  457



>emb|CDP21084.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/467 (42%), Positives = 286/467 (61%), Gaps = 17/467 (4%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +   HV++ PWLAFGH +P LE +K +A +G +VSFVSTPKN+ RLP IP +    +S  
Sbjct  5     SSSLHVVMLPWLAFGHFIPFLELSKFIARRGHKVSFVSTPKNIDRLPKIPPNLASSISFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP V GLPEN EATVDL   + V  LK AYD + P     +   +P+ I+ DFA +W
Sbjct  65    KIPLPPVDGLPENVEATVDLGGLD-VAVLKKAYDGLEPELTRFLESSVPDWIIYDFAPYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLG-SPEELRSGKL-RPSPEHFTVPPGWFNFHSLVA  599
             +P IA +  ++  F  +++AA+L +   S + + +G   R   E FTVPP W  F S +A
Sbjct  124   IPHIAAKLNISKSFFCIFSAASLVFSAPSLDAMVAGTDPRTKLEDFTVPPKWIPFKSKLA  183

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
              +   +  ++R+ +  D SGVS   R+ S I+G D  ++R C EFEG+++ LLE L +R 
Sbjct  184   FKLHESRFVVRSKNL-DGSGVSDMYRVGSAIKGADVTLIRYCPEFEGQWLKLLEDLLQRH  242

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             ++ +GL+PP +  +       N+ SW    +WLD Q   SVVFV  GSE  +   Q+ EL
Sbjct  243   IIPLGLMPPPMEKSIV----ENNESWIAIKDWLDGQGKGSVVFVALGSEVSLNQLQLSEL  298

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PF W LR         P+ LP  F +R    G V   WAPQ NIL+H ++G
Sbjct  299   ALGLELSGVPFFWALRN--------PSGLPEGFDDRVKGTGIVWKNWAPQLNILSHDSVG  350

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L H GW + IE L FGHPLI+LP + D GL A+++ EK++G E+PR + DGS++   V
Sbjct  351   GFLTHCGWSSSIEGLMFGHPLIMLPFIIDTGLIARIMEEKQVGIEIPRNDVDGSYTSHSV  410

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             ANS+R +M   EG+  + KA +++ IFG+ +LHD+Y+ + ++Y ++K
Sbjct  411   ANSVRLIMVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYLENK  457



>ref|XP_004288528.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   374 bits (961),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 195/463 (42%), Positives = 277/463 (60%), Gaps = 14/463 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGHMLP LE AK +A KG ++SF+STPKN+ RLPP+P   +  ++  +I
Sbjct  18    KLHIALFPWLAFGHMLPYLELAKLIAGKGHKISFISTPKNIDRLPPLPPKLSALITFVKI  77

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              L   P LPE  EAT DL  +EQV  LK AYD +  P  + ++   P+ +L DFA +WVP
Sbjct  78    PLQQYPNLPEGAEATADL-TEEQVFHLKIAYDSLREPITQFLKSSNPDWVLFDFAPYWVP  136

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             EIA+  G+ T F ++  A  +A+LG          R  PE +TVPP W +F + VA R  
Sbjct  137   EIARSLGIRTAFYTIVMAVVVAFLGPTSPEIPADDRKLPEDYTVPPKWVSFSTTVAWRLF  196

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
                 +++   T D + VS  QR    ++GCD + VRSC EFE E+++LLE ++ +PVL +
Sbjct  197   EVLRLLKQI-TGDDTNVSVVQRFMVGLQGCDLIAVRSCAEFEPEWLNLLEVMHGKPVLPV  255

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G+      L+T  +   +  +W    EWLD Q  K+VV+V FG+E      +  E+A  L
Sbjct  256   GV------LSTMPKTDDDDETWRSIKEWLDRQSKKTVVYVAFGTEAIPTQEEATEIALGL  309

Query  972   ELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             E S +PF W+LR K G D       LP  F  R   +G V   W PQ  ILAH + G  L
Sbjct  310   EKSGLPFFWVLRTKHGED----AVKLPEGFEERNEGRGVVCRSWVPQLKILAHDSFGVFL  365

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              HSGW +++E+L FG PL+L P+  DQGLNA+   EK++GYE+PR E DGSF+ + VA S
Sbjct  366   SHSGWSSVVEALTFGRPLVLFPLSNDQGLNARYFGEKKVGYELPRDEHDGSFTSEAVAES  425

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +R V+   EG   R  A ++  +FG+ +L + Y+D+F+EY  +
Sbjct  426   LRMVIEKEEGRVYRETAKELKTLFGDRDLQNVYLDKFLEYLTT  468



>emb|CDP21083.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 204/467 (44%), Positives = 287/467 (61%), Gaps = 19/467 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
               HV++FPWLAFGH +P LE +K +A KG +VSF+STPKN+ RLP +P +    ++  +I
Sbjct  7     SLHVVMFPWLAFGHFIPFLELSKFIAQKGHKVSFISTPKNIDRLPKLPPNLASSITFIKI  66

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP V GLPEN EATVDL   + V FLK AYD   P     +    P+ I+ DFA +W+P
Sbjct  67    PLPPVDGLPENVEATVDLGGLD-VAFLKKAYDGFEPDLTRFLEDSAPDWIIYDFAPYWLP  125

Query  432   EIAKRYGVATVFLSVYTAATLAYLG-SPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHR  605
              IA +  +A  F S+ +A+T+ + G S + + +G   R   E + VPP W  F S VA++
Sbjct  126   PIAAKLNIARSFFSIVSASTVVFFGPSFDAMINGTDPRSKVEDYIVPPKWIPFESKVAYK  185

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               Y    +      D SG S   R+ SVI+G D V+VR C+EFEG++++LLE L +RPV+
Sbjct  186   L-YESKWIVGASNLDGSGASDMYRVGSVIKGADVVLVRHCREFEGQWLNLLENLQRRPVM  244

Query  786   AIGLLPPRLNLNTAIQPGTNSS-SWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
              +GL+PP++      + G  S+ SW    +WLD Q   SVV+V FGSE  M   ++ ELA
Sbjct  245   PLGLMPPKVE-----KSGLESNESWIAIKKWLDGQGKGSVVYVAFGSEVSMSQLELGELA  299

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W LR         P+ LP  F +R   +G V   WAPQ NIL+H ++GG
Sbjct  300   LGLELSGVPFFWALRN--------PSGLPEGFEDRVEGRGIVWKNWAPQLNILSHDSVGG  351

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GW + IE L  GHPLI+LP V D GL A++L EK++G E+PR   DGS++RD VA
Sbjct  352   FLTHCGWSSSIEGLMLGHPLIMLPFVIDTGLVARILEEKQVGIEIPRNPVDGSYTRDSVA  411

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
              S+R +M   EG+  R KA +++ +FG+  LHD Y+ +F++Y +  +
Sbjct  412   KSVRLIMEEDEGKSYRDKAKEISAVFGDRELHDGYLQRFVDYLEKNV  458



>emb|CDP20375.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/478 (41%), Positives = 295/478 (62%), Gaps = 22/478 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  HV++ PWLAFGH++P  + +  LA  G   S VST KN+QRLP +P      + L  
Sbjct  5     ENIHVVLLPWLAFGHIMPSFQLSIALARAGVHASLVSTTKNIQRLPKLPPDLEGSIDLVG  64

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELV--RRDLPELILVDFA  416
             + LP++    LPE  EAT+D+    ++Q+LK AYD +  PF++ +  +   P+ I+ D  
Sbjct  65    LPLPAIDRNLLPEGAEATIDIPFH-KIQYLKIAYDLLKNPFKQFIADQAKSPDWIVADLL  123

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRS---GKLRPSPEHFTVPPGWFNFH  587
             THW  E+ ++  +  +    ++AAT  + G PE L      ++R +PE     P W +F 
Sbjct  124   THWAGEVGQQLNIPIICFYPFSAATAVFFGPPEYLAGEGQKRVRSTPESLMRKPEWVDFP  183

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S VA+R   A  +    +  +ASG+++GQR++ VI+ C  V +RSC EFE +Y  L EK+
Sbjct  184   STVAYRKREAIGVHAGFYHENASGIATGQRIAKVIQACKAVAIRSCPEFERDYFYLQEKI  243

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRP-KSVVFVGFGSEYKMPIH  944
               +P + +G LPP  + N          SW+  F+WLD Q+P KSVVFVGFGSE K+   
Sbjct  244   TGKPAIPLGFLPPETSNNL------RDESWNNIFQWLDEQKPIKSVVFVGFGSECKLRKD  297

Query  945   QIHELASALELSRMPFLWILRKPGI-DNPGYPALLPTDFVNRTSNQGRVILGWAPQQNIL  1121
             QIHE+A  LE+S +PF+W+L+KP   D+     +LP  F +R   +G   +GWAPQ+ IL
Sbjct  298   QIHEIAYGLEVSGLPFIWVLQKPSWGDSDNEDDILPLGFGSRVRGKGITQIGWAPQREIL  357

Query  1122  AHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSF  1301
             AHPA+GGCLFH+GWG++ E+L +GH L++LP + DQGLN++ LVEK +  EV R EDGSF
Sbjct  358   AHPAVGGCLFHAGWGSVTETLQYGHSLVVLPFIVDQGLNSRYLVEKGLAIEVERSEDGSF  417

Query  1302  SRDMVANSIRSVMA-SREGEG-----IRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              +D +A S+R  M  + E EG     +R +AA+ A +FG+  L+  YI++F+EY +++
Sbjct  418   CKDDIAQSLRRAMVPNVEDEGEALRLLRARAAEAAALFGDRELNGCYIERFVEYLKTE  475



>ref|XP_006466331.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Citrus sinensis]
Length=478

 Score =   374 bits (959),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 285/472 (60%), Gaps = 11/472 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             +  + +FPWLAFGHM+P LE AK +A KG ++ F+STP+N+ RLP +P +    +   +I
Sbjct  6     KLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQFVKI  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
             +LP V  L EN EAT+DL   E V++LK ++D +  P  +L++   P+ +L DFA +W+P
Sbjct  66    SLPHVDNLRENAEATIDLPYDE-VKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAYWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEEL--RSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
               A+  G+ + F S++TAATL Y G    L   SG    +PE +T  P W +F + +++R
Sbjct  125   ARARELGIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPNWVSFPTTISYR  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               +    + +    D S VS G R    ++GCD V VRSC EFE E++ LLE+L+++PV+
Sbjct  185   L-FEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKPVI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +G LP       +      + +W    EWLD Q   SVV+V FGSE K    ++ E+A 
Sbjct  244   PVGQLPTTTGDGDS---DAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS++PF W+L+K        P  LP  F  RT  +G V   WAPQ  ILAH ++GG 
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H+GW +++E+L FG PLI+L   ADQGLNAKLL EK+I   +PR E DGSF+R+ VA 
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGSFTRNSVAE  420

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKR  1478
             S+R V+   +G+  R K  +M  +FG+    D+Y+D F+ Y +   + +C R
Sbjct  421   SLRLVLVEEKGQIYRDKLKEMKELFGDRGRQDHYVDNFLNYLK---IHRCLR  469



>ref|XP_004306716.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=476

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 196/478 (41%), Positives = 289/478 (60%), Gaps = 23/478 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV+  P  AFGH++P  + +  LA     VSF+STP+N++RLP IP      ++L  
Sbjct  6     KELHVVTLPLSAFGHLMPFFQLSIALAKAKVHVSFISTPRNIERLPKIPPDLQPFINLVP  65

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQF--LKTAYDRMGPPFEELVRRDLPELILVDFA  416
             I  P +    LPE  EA+ D+ +Q++ Q+  L+ A D +  P ++ +   +P+ I+ DF 
Sbjct  66    IPFPPLEPDFLPEGAEASFDVPEQQEQQYANLQVAVDLLQTPIKQFIADKMPDWIIADFF  125

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL----RSGKLRPSPEHFTVPPGWFNF  584
             THWV +IAK Y V   + SV++AA   + G PE L    R+G L P+ +  T PP W  F
Sbjct  126   THWVVDIAKEYDVPLAYFSVFSAAACVFFGPPEHLTGATRNGVL-PTIQSLTSPPEWITF  184

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              SL+A + DY       +   + +G+S  +RL+ ++     + +R+C E EG+Y+++ +K
Sbjct  185   PSLLALK-DYEAVKRLLSWEVNKTGMSLNRRLAKIVSASQVLAIRTCSEIEGDYLEVYKK  243

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTNS----SSWSEAFEWLDNQRPKSVVFVGFGSEYK  932
             +  +PV+  G+LPP        QPG  +    +S +  F+WLD Q+P+SVVFVGFGSE  
Sbjct  244   ITGKPVIPTGVLPPD-------QPGKRAEGEVNSDASMFDWLDKQKPRSVVFVGFGSECM  296

Query  933   MPIHQIHELASALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQ  1109
             +   Q+HE+A  LELS +PF+W LRKP    +      LP  FV+RTS +G V  GW PQ
Sbjct  297   LSKEQVHEIAHGLELSELPFIWGLRKPHSTRSDEVDDFLPLGFVDRTSEKGLVCFGWVPQ  356

Query  1110  QNILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE  1289
               IL HP+I G LFHSGWG++IE+L FGH L++LP + DQ LNA+LLVEK +  EV R E
Sbjct  357   MEILGHPSIRGSLFHSGWGSVIETLQFGHCLVVLPFMYDQPLNARLLVEKGLAAEVKRNE  416

Query  1290  DGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNH-NLHDNYIDQFIEYFQSKI  1460
             DGSFSR+ +A S+R  M   EGE +R  A + A + G+    HD+YI  F+ Y ++ +
Sbjct  417   DGSFSREEIAKSLRLAMVEEEGEQLRSNARKAAAVIGDQKQQHDHYIGAFVNYLKNNV  474



>ref|XP_006426251.1| hypothetical protein CICLE_v10025508mg [Citrus clementina]
 gb|ESR39491.1| hypothetical protein CICLE_v10025508mg [Citrus clementina]
Length=478

 Score =   373 bits (958),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 281/464 (61%), Gaps = 8/464 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             +  + +FPWLAFGHM+P LE AK +A KG ++ F+STP+N+ RLP +P +    +   +I
Sbjct  6     KLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQFVKI  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
             +LP V  L EN EAT+DL   E V++LK ++D +  P  +L++   P+ +L DFA +W+P
Sbjct  66    SLPHVDNLRENAEATIDLPYDE-VKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAYWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEEL--RSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
               A+   + + F S++TAATL Y G    L   SG    +PE +T  P W +F + +++R
Sbjct  125   ARARELDIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPSWVSFPTTISYR  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               +    + +    D S VS G R    ++GCD V VRSC EFE E++ LLE+L+++PV+
Sbjct  185   L-FEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKPVI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +G LP       +      + +W    EWLD Q   SVV+V FGSE K    ++ E+A 
Sbjct  244   PVGQLPTTTGDGDS---DAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS++PF W+L+K        P  LP  F  RT  +G V   WAPQ  ILAH ++GG 
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H+GW +++E+L FG PLI+L   ADQGLNAKLL EK+I   +PR E DG F+R+ VA 
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGFFTRNSVAE  420

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R V+   +G+  R KA +M  +FG+   HD Y+D F+ Y ++
Sbjct  421   SLRLVLVEEKGQIYRDKAKEMKGLFGDKGRHDRYVDNFLNYLKN  464



>ref|XP_008352352.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Malus domestica]
Length=473

 Score =   372 bits (955),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 201/466 (43%), Positives = 272/466 (58%), Gaps = 10/466 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE--RLSL  242
             +   V++ PW AFGHM+P  + +  LA +   VSF+STPKN+QRLP I        +L  
Sbjct  5     DHLSVVMLPWSAFGHMMPFFQLSIALAKEKVHVSFISTPKNIQRLPKILPELQPFVQLVP  64

Query  243   REIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
                       LPE  EA+VDL   E    LK AYD +  P ++ +   LP+ I+ DFA H
Sbjct  65    XPFPPLDPDFLPEGAEASVDL-PFENTDNLKIAYDLLQKPIKQFIGDRLPDWIITDFAAH  123

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK---LRPSPEHFTVPPGWFNFHSL  593
             WV EI K YGV  V+ SV++AA++A   S E    GK   + P  E  T PP      S 
Sbjct  124   WVVEIGKEYGVPLVYFSVFSAASIALFRSVENFFIGKTNDVLPPLETLTSPPDXVTSRST  183

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+R   A       +  + SG+S G+R + ++  C  V +RSC EFEGEY +  +   +
Sbjct  184   VAYREHEAVHFHAALYGVNGSGISDGERYAKILSACRAVAIRSCNEFEGEYFEAYKNKTE  243

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             + V+  GLLPP +      +  +   +    FEWLD Q  +SVVFVGFGSE K+   ++ 
Sbjct  244   KLVIPTGLLPPEIPSKGVKREISTDDA---IFEWLDTQETRSVVFVGFGSECKLSKERVF  300

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PFLW LRKP   N    AL P  FV RTS +G V LGW PQ  ILAHP+
Sbjct  301   EIAHGLELSGLPFLWALRKPKWANSDADAL-PLGFVERTSEKGLVCLGWVPQMEILAHPS  359

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             +GG LFH+GWG++IE+L FGH L++LP + DQ LNA+LL EK +  E  RR DGSF+RD 
Sbjct  360   VGGSLFHAGWGSVIETLQFGHVLVVLPFIIDQPLNARLLEEKGVAVEGSRRGDGSFTRDD  419

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             +A ++R  M   +GE +R  A + A +FG+H LH +YI QF+   +
Sbjct  420   IAKTLRHAMVEEQGEKLRSNARKAAAVFGDHKLHQHYIGQFVNTLK  465



>gb|EYU30925.1| hypothetical protein MIMGU_mgv1a005472mg [Erythranthe guttata]
Length=482

 Score =   372 bits (955),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 284/464 (61%), Gaps = 7/464 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  H+++FPWLAFGH++P LE +K +A KG ++SFVSTP+N+ RLP +P   +  + L +
Sbjct  9     KSLHIVMFPWLAFGHIIPYLELSKLIALKGHKISFVSTPRNIDRLPKLPPHLSSSIELVK  68

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP +  LPEN EAT+D+    Q+ +LK A+D +       +    P+ I+ DFA HW+
Sbjct  69    IPLPKLDELPENAEATMDINGG-QMDYLKIAFDGLESGLTSFLEDSDPDWIICDFAPHWL  127

Query  429   PEIAKRYGVATVFLSVYTAATLAYLG-SPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             P IA R G++  F  ++ A  LA+ G   E++ SG   R   E + VPP W  F + VA+
Sbjct  128   PPIAARLGISRAFFLIFNAWFLAFFGPGAEDMISGSDYRTKREDYMVPPKWVEFETEVAY  187

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R   A  M+ +  T + SG S   R+  VI GC+ ++ R C EFE +++ LLE+L++RPV
Sbjct  188   RGFEANWMVGSGQT-NGSGYSDIYRVGKVIVGCEAILARHCHEFEPDWLTLLEELHRRPV  246

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
               +GL+PPRL  +   +  ++   W    +WLD Q   SVV+V  GSE      Q+ ELA
Sbjct  247   FPLGLMPPRLPQDGK-KDDSDEEIWVSIKKWLDVQNKGSVVYVALGSEVIPSQDQLSELA  305

Query  963   SALELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
               LELS +PF W+LRKP G+        LP  F  R + +G V   W PQ  IL+H ++G
Sbjct  306   HGLELSGVPFFWVLRKPSGLTESDDSVELPDGFEERVNGRGIVWRSWVPQLKILSHDSVG  365

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
             G L H GW +I+E L FGHPLI LP + DQGLN++++ EK++G E+PR  E+GS++ + V
Sbjct  366   GFLTHCGWSSIVEGLMFGHPLITLPFLVDQGLNSRVIAEKQVGVEIPRNEENGSYTSNSV  425

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             A+S++ VM   +G+  R +A ++  IFG+  LH  YID FI++ 
Sbjct  426   ADSVKLVMLENDGKRFRERAKEIGAIFGDTELHGRYIDNFIKFL  469



>gb|KDP29791.1| hypothetical protein JCGZ_18726 [Jatropha curcas]
Length=465

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/468 (42%), Positives = 280/468 (60%), Gaps = 13/468 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+++FPWLAFGH++P LE AK LA +G ++SF+STPKN+QRLP IP +    + L  
Sbjct  5     KKLHIVLFPWLAFGHIIPFLELAKLLAKRGHKISFISTPKNIQRLPKIPPNLANLVHLVT  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LPS   LP N EAT D+    +V +LK AYD +  P  + +    P+ I+ DFA  W+
Sbjct  65    LTLPSEDHLPPNSEATTDIPTH-KVPYLKKAYDNLQCPLLQFLETSTPDWIIYDFAPFWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAHR  605
             P I    G+++ F S+Y   +L + GS   + +G  LR  PE FTVPP W  F S VA R
Sbjct  124   PRITADLGISSAFFSIYGGWSLTFFGSSSAMINGDDLRTQPEDFTVPPKWVPFPSKVAFR  183

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                A   + +    D SG S   RL SV+ GCD + +RSC E EG+++ L+E+L+ +P L
Sbjct  184   LHEAKKALSHVQVND-SGCSDMFRLGSVMAGCDVIAIRSCFELEGDFLRLVEQLHGKPTL  242

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
               GLLPP    +     G    +W    +WL++Q   SVV++ FGSE ++   ++ ELA 
Sbjct  243   PTGLLPP----SDPDVNGEEDETWRIISQWLNSQNKGSVVYIAFGSEVEVSQQELTELAF  298

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W LR    DN      LP +F  R   +G V   W PQ  IL+H ++GG 
Sbjct  299   GLELSGLPFFWTLRIK--DN---SLGLPNEFEERVQGRGLVWKTWVPQLRILSHESVGGI  353

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H G+ +IIE+L FG  LI+LP+  DQGL A++  EK++G E+ R E DGSF+RD VA 
Sbjct  354   LTHCGYSSIIEALYFGRALIMLPIALDQGLIARVFEEKKVGVEITRDEQDGSFTRDSVAE  413

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILT  1466
             S+R VM  +EG+  R  A +M  +  + +LHD Y+D+F+E  Q   +T
Sbjct  414   SLRLVMVDKEGKEYRDAAKEMRELLADKDLHDRYVDRFVELLQHHRVT  461



>ref|XP_002315125.2| hypothetical protein POPTR_0010s18980g [Populus trichocarpa]
 gb|EEF01296.2| hypothetical protein POPTR_0010s18980g [Populus trichocarpa]
Length=477

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/465 (43%), Positives = 278/465 (60%), Gaps = 15/465 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGH++P LE AK +A +G ++SF+STP+N+QRLP IP + T R++L  +
Sbjct  6     ELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPTIPPNLTPRINLVSL  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
             ALP V  LP N EAT DL   +++ +LK AYDR+       +    P+ I+ DFA++W+P
Sbjct  66    ALPHVENLPNNAEATADLP-FDKIPYLKIAYDRLQDSLFHFLHSSSPDWIIFDFASYWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEE--LRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             EIA + G++ V  S++ A TL++ G      L     R  P+HFTVPP W  F S VA R
Sbjct  125   EIATKLGISGVLFSIFGAWTLSFAGPSYSAILNGDDPRTEPQHFTVPPKWVTFPSKVAFR  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                A   +      ++SGV+   R  SV+ GCD + VRSC E E +++ L+E L+ +PV+
Sbjct  185   IHEAKRFLVQIEA-NSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFLRLVEDLHCKPVI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLLPP    +     G     W    EWLD Q   SVV++ FGSE  +   +I ELA 
Sbjct  244   PVGLLPPPAQCSE----GGVDEKWVTISEWLDKQTQGSVVYIAFGSELTINQDEITELAL  299

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W LR     N      LP  F  R   +G V   WAPQ  I+AH ++GG 
Sbjct  300   GLELSGLPFFWALR-----NQDDSVRLPDGFDERVKGRGVVWTSWAPQLRIMAHESVGGF  354

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H G+ ++IE+L FG  LI+LP   DQGL A++   K++G EVPR E DGSF+R+ VA 
Sbjct  355   LTHCGYSSVIEALSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAE  414

Query  1323  SIRSVMASREGEGIRLKAA-QMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R V+  REG   R  A  QM  +FG+ ++ D  +DQF+ + +S
Sbjct  415   SLRLVIVDREGSAYRENAKQQMVTLFGDKSISDRCMDQFVAFLRS  459



>ref|XP_009767381.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=476

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 201/480 (42%), Positives = 298/480 (62%), Gaps = 25/480 (5%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  +  HV++ PWLAFGH+ P  + +  LA +   VSF+STPKN++RLP +P++    L+
Sbjct  1     MKKDNIHVVMVPWLAFGHLQPFFQLSIALATEKVHVSFISTPKNIKRLPKVPSNLAPLLN  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L E  LPSV G  LP + EA+VD+   +Q+ +L  A++ +  P +  +    P+ ++ DF
Sbjct  61    LVEFPLPSVNGSPLPADAEASVDV-SADQMLYLYQAFNLLQEPVKNFIADKKPDWVIADF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPE------ELRSGKLRPSPEHFTVPPGW  575
                WV +IA+   +  +  SV+TA++  + G P+      ++++G  +P  E  T PP W
Sbjct  120   VPDWVADIARELNIPLLKFSVFTASSRVFFGPPKPRPRPGQVKNGS-KPLHELLTSPPPW  178

Query  576   FNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEG-CDFVIVRSCKEFEGEYID  752
              +F S+VA R  Y    + +  + +     +     +VIEG C  V +R+C EFEG+Y+D
Sbjct  179   VDFPSMVAFR-KYEALDLISVLSAENESRETLLGHDAVIEGACRAVAIRTCIEFEGDYLD  237

Query  753   LLEKLYKRPVLAIGLLPPRLNLNTAIQPGTNSS-----SWSEAFEWLDNQRPKSVVFVGF  917
               +K+  +PV+ IGLLPP         PG   +     +W + F+WLD Q+P+SVVFVGF
Sbjct  238   TYKKVAGKPVIPIGLLPPEE------LPGNERTLSFHPNWQKIFKWLDEQKPRSVVFVGF  291

Query  918   GSEYKMPIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILG  1097
             GSE K+  +Q++E+A+ ++LS +PF WIL+KP        AL P+ F   T  +G V +G
Sbjct  292   GSECKLSKNQVYEIANGVKLSGLPFFWILQKPSWALNDIDAL-PSGFCASTEGRGLVHIG  350

Query  1098  WAPQQNILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEV  1277
             WAPQ+ ILAHP+IGG LFH GWG+ IE+L  GH L++LP V DQGLNA+LLVEK +  EV
Sbjct  351   WAPQKEILAHPSIGGSLFHGGWGSTIETLRSGHVLVVLPFVFDQGLNARLLVEKGVAIEV  410

Query  1278  PR-REDGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              R  EDGSFS + +A S+R  M S +GE +R +A + A IFG+ NLHD+Y+  F+EY +S
Sbjct  411   KRNEEDGSFSGNDIATSLREAMVSEDGEELRARAGKAAGIFGDQNLHDSYVKNFVEYMRS  470



>emb|CDP21820.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/460 (42%), Positives = 280/460 (61%), Gaps = 17/460 (4%)
 Frame = +3

Query  87    IFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALPSV  266
             + PWLAFGH +P LE +K +A KG +VSFVSTPKN+ RLP IP +    ++  +I LP V
Sbjct  1     MLPWLAFGHFIPFLELSKFMAQKGHKVSFVSTPKNIDRLPRIPPNLASSITFVKIPLPRV  60

Query  267   PGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEIAKR  446
              GLPEN EATVDL   + V  LK AYD + P     +    P+ I+ DFA +W+P IA +
Sbjct  61    DGLPENVEATVDLGDLD-VAVLKKAYDGLEPELTRFLEYSAPDWIIYDFAPYWIPPIAAK  119

Query  447   YGVATVFLSVYTAATLAY-LGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRPDYAP  620
               ++  F  +++AA++A+ + S + + +G   R   E FTVPP W  F S +A +  Y  
Sbjct  120   LNISKSFFCIFSAASMAFFVPSVDAMIAGTDPRTKVEDFTVPPKWIPFESKLAFKL-YES  178

Query  621   TMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGLL  800
               +      D SGVS   R+ S I+G D  ++R C EFEG+++ LLE L +R ++ +GL+
Sbjct  179   RWVVQGQNLDGSGVSDSYRVGSAIKGADVTLIRYCSEFEGKWLKLLEDLLQRHIIPLGLM  238

Query  801   PPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALELS  980
             PP +  +       N+ SW    +WLD Q   SVV+V  GSE  +   Q+ ELA  LELS
Sbjct  239   PPPVEKSIV----ENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELALGLELS  294

Query  981   RMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHSG  1160
              +PF W LR P        + LP  F +R    G V   WAPQ N+L+H ++GG L H G
Sbjct  295   GVPFFWALRNP--------SGLPEGFEDRVKGTGIVWKNWAPQLNVLSHDSVGGFLTHCG  346

Query  1161  WGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIRSV  1337
             W + IE L FGHPLI+LP VAD GL A++L EK++G E+PR + DGS++   VANS+R +
Sbjct  347   WSSSIEGLMFGHPLIMLPFVADTGLIARVLEEKQVGIEIPRNDVDGSYTSHSVANSVRLI  406

Query  1338  MASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             M   EG+  + KA +++ IFG+ +LHD+Y+ + ++Y ++K
Sbjct  407   MVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYLENK  446



>ref|XP_010535333.1| PREDICTED: UDP-glycosyltransferase 91C1 [Tarenaya hassleriana]
Length=461

 Score =   370 bits (950),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 195/470 (41%), Positives = 274/470 (58%), Gaps = 15/470 (3%)
 Frame = +3

Query  60    MAAEQC---HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE  230
             MA E+    HV++FPWLA GH+LP L  +K LA KG R+SFVSTP+N+ RLP +P   T 
Sbjct  1     MATEEIKTMHVVMFPWLAMGHLLPFLRLSKLLARKGHRISFVSTPRNISRLPKLPPDLTT  60

Query  231   RLSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVD  410
              ++     LP V GLP + E+++D+    Q Q LK A+D +  P  E +RR  PE ++ D
Sbjct  61    MITFVPFTLPPVSGLPLDAESSMDVPYNTQ-QRLKAAFDLLQIPVTEFLRRSSPEWVVYD  119

Query  411   FATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHS  590
             +A+HW+P+IA   GV+  + S++ AA++ + G PEEL +   R SPE FTV P W  F S
Sbjct  120   YASHWLPKIAAEIGVSKAYFSIFNAASMCFFGPPEELIADS-RTSPEDFTVVPTWVPFES  178

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              +A R       +  T   D +GVS   R    I   D V+VRSC EFE E+  LL  LY
Sbjct  179   DIAFRIHEITKYVEKTEE-DETGVSDAVRFGYSIGESDAVLVRSCPEFEPEWFGLLLDLY  237

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
              +PV+  G LP  +     ++     ++W    +WLD QR  SVV+V  G+E ++   ++
Sbjct  238   GKPVVPTGFLPLVMEEEVFVENNDEDTTWIGIKKWLDEQRVNSVVYVALGTEARVTRKEL  297

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  LE S +PF W+LR          + LP  ++ R   +G V  GW PQ  IL+H 
Sbjct  298   GEMALGLEKSALPFFWVLRN--------ESKLPDGYMERVKGRGLVHFGWVPQVKILSHD  349

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             ++GG + H GW ++IE LG G   IL P+V DQGLNA+LL  K +G E+PR E DGSFS 
Sbjct  350   SVGGFVTHCGWSSVIEGLGLGRVPILFPVVNDQGLNARLLQGKGLGVEIPRDERDGSFSC  409

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             D VA+SIRS MA    E +R K  +M ++FGN +    ++D+ + Y   K
Sbjct  410   DSVADSIRSAMADESDEPVRAKVKEMKSLFGNKDTDMRHVDELVRYLSDK  459



>emb|CDP01583.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   370 bits (950),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 195/467 (42%), Positives = 279/467 (60%), Gaps = 12/467 (3%)
 Frame = +3

Query  60    MAAE--QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTER  233
             MAAE  + HV++FPWLAFGHM+P LE AK +A KG RV++VSTP+N+ RLP IP++   +
Sbjct  1     MAAEAKKLHVVVFPWLAFGHMIPFLELAKSIAQKGHRVTYVSTPRNVDRLPKIPSTLISQ  60

Query  234   LSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L+  ++ LP +  LPEN EAT DL    +V  LK AYD +     + +   LP+ ++ DF
Sbjct  61    LNYLKLPLPQIANLPENAEATTDLPIT-KVHCLKKAYDGLQIEVAQFLETTLPDWLIYDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             A+H +P +  + G++  F S   A + A+ GS +   +   R  PE F VPP W  F S 
Sbjct  120   ASHSLPSMVGKLGISLAFFSSMNAWSAAFFGSAKTFHT---RTQPEDFLVPPKWVPFPSK  176

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA R  +    M   +  +ASGVS   R++  + GCD ++VRSC+E E +++DL EK+++
Sbjct  177   VAFR-RHELMRMDAGNVENASGVSDWDRVAEALIGCDAILVRSCRELESDWLDLTEKMHE  235

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +GL+PP    +   +      +W     WL+    +SV++V  G+E      ++ 
Sbjct  236   KPVITVGLMPP----SARDREDDGDDTWHTISGWLNRHGKESVIYVALGTEVAPSQEELT  291

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             ELA+ LELS +PF W LRK    +      LP  F  R   +G V   W PQ  +LAH +
Sbjct  292   ELATGLELSGLPFFWALRKKEGLSEFESLELPDGFEERVKERGIVWTSWTPQLRVLAHDS  351

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             +GG L H GW ++IE L  G PL++LP   DQGLNA+ L EK +G EVPR E DGS SRD
Sbjct  352   VGGFLTHCGWSSVIEGLQNGRPLVMLPFQLDQGLNARALEEKMVGIEVPRDEDDGSLSRD  411

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              VA S+R VMA ++G+  R KA +M  IFG+ +L + Y D  IEY +
Sbjct  412   SVAESLRLVMADQKGQVYRDKAKEMKLIFGDKDLQEKYEDNLIEYLE  458



>ref|XP_008346552.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Malus domestica]
Length=508

 Score =   371 bits (953),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 204/475 (43%), Positives = 274/475 (58%), Gaps = 11/475 (2%)
 Frame = +3

Query  51    NITMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE  230
              I    +   V++ PW AFGHM+P  + +  LA     VSF+STPKN+QRLP I      
Sbjct  31    TIMEKDDHLSVVMLPWSAFGHMMPFFQLSIALAKAKVHVSFISTPKNIQRLPKILPDLQP  90

Query  231   RLSLREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELIL  404
              + L  I  P +    LPE  EATVDL   E    LK AYD +  P ++ +   LP+ I+
Sbjct  91    FVQLVPIPFPPLDPDLLPEGAEATVDLPF-ENTDNLKIAYDXLQTPIKQFIGDRLPDWII  149

Query  405   VDFATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL---RSGKLRPSPEHFTVPPGW  575
              DF  HWV +I K YGV  V+ SV++AA+       E L    +  + PSPE  T PP  
Sbjct  150   TDFVAHWVADIGKEYGVPLVYFSVFSAASRIVYSPAENLYGCNTTDVLPSPESLTSPPDL  209

Query  576   FNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDL  755
                 S VA R   A  +    +  + SG+S  +R + ++  C    +RSC EFEGEY++ 
Sbjct  210   LTSQSTVAFREXEAVHIHAGFYGVNESGISDAERKAKILSACQVHAIRSCDEFEGEYLEA  269

Query  756   LEKLYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKM  935
              +   ++ V+  GLLPP +    A       SS    FEWLD Q+ +SVVFVGFGSE K+
Sbjct  270   YKNNCRKLVIPTGLLPPEI---PAKGVEREISSDDGIFEWLDKQKTRSVVFVGFGSECKL  326

Query  936   PIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
                Q+ E+A  LELS++PFLW LRKP        AL P  FV+R S++G V   W PQ  
Sbjct  327   SKAQVFEIAHGLELSQLPFLWALRKPNWATSEADAL-PLGFVDRISDKGLVCFLWVPQME  385

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDG  1295
             ILAHP++GG LFHSGWG+IIE+L FGH L++LP + DQ LNA+LL EK +  EV R  DG
Sbjct  386   ILAHPSVGGSLFHSGWGSIIETLQFGHVLVVLPFIIDQPLNARLLEEKGMAVEVKRLGDG  445

Query  1296  SFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSK  1457
             SFSRD +A ++R  M   EGE +R  A + A +F +H LH D+YI QF+ + ++ 
Sbjct  446   SFSRDDIAKTLRHAMVEEEGEPLRSNARKAATVFXDHKLHQDHYIGQFVNFLKNN  500



>ref|XP_008438010.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=492

 Score =   370 bits (951),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 209/480 (44%), Positives = 285/480 (59%), Gaps = 28/480 (6%)
 Frame = +3

Query  54    ITMAAEQ-CHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTE  230
             ITMA  +  HV++FPW AFGH++P  + +  LA  G  VSF+STPKNLQRLPPIP S + 
Sbjct  23    ITMAENKGLHVVVFPWSAFGHLIPHFQLSIALAKAGVHVSFISTPKNLQRLPPIPPSLSS  82

Query  231   RLSLREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDL--PEL  398
              ++   I LP +PG  LPE  EATVD+   E++ FLK A D   PPF + +      P+ 
Sbjct  83    FITPVPIPLPKLPGDPLPEGAEATVDI-PFEKIPFLKVALDLAEPPFRKFIADHPHPPDW  141

Query  399   ILVDFATHWVPEIAKRYGVATVFLSVYTAATLAY----LGS--PEELRSGKLRPSPEHFT  560
              +VDF   W+ +I++ + V  VF  V +   LA+    LG+  P       + P P    
Sbjct  142   FIVDFNVSWISDISREFRVPIVFFRVLSPGFLAFYAHVLGARLPLSEIGSLISPPPIE--  199

Query  561   VPPGWFNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEG  740
                      S VA+R   A  +       + SG+S  +R++ +I  C  + VR+C EF+ 
Sbjct  200   --------GSTVAYRRHEAVGIRAGFFEKNDSGMSDYERVTKIISACQAIAVRTCYEFDV  251

Query  741   EYIDLLEKLYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFG  920
             +Y+ L      + V+ +GLLPP     T  +    +S W   FEWLD Q PKSVVFVGFG
Sbjct  252   DYLKLYSNYCGKKVIPLGLLPPEKPPKTEFE---ANSPWKSTFEWLDQQNPKSVVFVGFG  308

Query  921   SEYKMPIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGW  1100
             SE K+   QIHE+A  +ELS +PFLW LRKP  D      +LP  F +RT+ +G V +GW
Sbjct  309   SECKLTKDQIHEIARGVELSELPFLWALRKP--DWAEDSDVLPAGFPDRTAGRGMVSMGW  366

Query  1101  APQQNILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVP  1280
             APQ  IL HPAIGG  FH GWG+ IE+L FG+ LILLP + DQ LNA+LLVEK +  EV 
Sbjct  367   APQMEILGHPAIGGSFFHGGWGSAIEALEFGNCLILLPFIVDQPLNARLLVEKGVAVEVE  426

Query  1281  RRE-DGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             R E DG FS + +A ++R  M S EGE IR +A ++A IFG+  LH  YI++F+E+ +++
Sbjct  427   RNEDDGCFSGEAIAKALREAMVSGEGEKIRKRAEEVAAIFGDTKLHQRYIEEFVEFLKNR  486



>ref|XP_007012761.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY30380.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=542

 Score =   372 bits (954),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/464 (43%), Positives = 282/464 (61%), Gaps = 15/464 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+ +FPWLA+GH++P LE +K LA KG R+S++STPKN+ RLP +PA  +  +S  E
Sbjct  79    EKLHIAMFPWLAYGHIMPFLEVSKFLAQKGHRISYISTPKNISRLPKLPAHLSSNISFIE  138

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I+LP V GLP   E+T ++  Q +V +LK A D++  P  E ++      I+ DF  HW+
Sbjct  139   ISLPQVHGLPPGVESTAEIPIQ-KVPYLKKACDKLEVPLTEFLKTSHVNWIIHDFMPHWL  197

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A  +G+  VF S++ A  LA+ G P  L  G  R  PE FTV P W ++   +A + 
Sbjct  198   PGVAIPFGINLVFFSIFNATLLAFFGPPSAL-IGDHRKRPEDFTVVPEWIDYPCNIAFK-  255

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                      +H      VS  QRL  VI+GC FVI+RSC EFE + I LL+KLY++PV+ 
Sbjct  256   ----LHEMVSHQECMDDVSDSQRLGQVIQGCQFVILRSCTEFESDQIQLLKKLYQKPVVP  311

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +GLLPP L  N       +  SW +  +WLD +  KSV +V  GSE  +    +HELA  
Sbjct  312   VGLLPPSLPSNEE----KSHESWEDIKKWLDRKGEKSVFYVALGSEVSLSQESMHELAFG  367

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             +  S +PF+W++R +P ++      ++P  F  R S++G V+  WAPQ  ILAH ++GG 
Sbjct  368   IYKSNLPFIWVVRNRPLVEGQMGQDIIPQGFEERVSDRGLVLKDWAPQLRILAHSSVGGF  427

Query  1146  LFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
             L H GW +IIE+L FG PLIL     +DQGLNA+LL  K++G E+ R E DGSF+ D+VA
Sbjct  428   LTHCGWSSIIEALKFGRPLILFSGASSDQGLNARLLHGKKVGLEIERNELDGSFTSDLVA  487

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              +IR VM   EGE +R  A  M +I  N  L +NY+D+F  + +
Sbjct  488   QTIRQVMVEPEGEPVRANAWAMRDI-CNEELSENYLDEFTRFIE  530



>ref|XP_009801322.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=463

 Score =   368 bits (944),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 192/469 (41%), Positives = 276/469 (59%), Gaps = 11/469 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ HV++FPWLAFGH++P  E AK++A KG +VS++ST +N+ RLP         +   
Sbjct  4     TKKLHVVLFPWLAFGHLIPFFELAKQIARKGHKVSYISTSRNIDRLPKFSQKLNYSIHFV  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              ++LP   GLPEN EAT D+   ++VQ+LK A+D +     + +   +P+ I+ DF  +W
Sbjct  64    NLSLPLTKGLPENAEATKDV-PLDKVQYLKKAFDGLESELTQFLEDSVPDWIIYDFTPYW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAH  602
             +P IA R G++  F S + A +  + G  +++  G + R  PE FTVPP W  F S +A 
Sbjct  123   LPPIAGRLGISRAFFSTFNAWSSVFFGPAKDVIDGNIQRTKPEDFTVPPKWIPFPSNIAF  182

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R  Y           + SGVS   R    + GCD  +VRSC E E E++DLL +L+++P+
Sbjct  183   RL-YEINRYFGHGQENVSGVSDWHRFGESVSGCDVFLVRSCNELEREWLDLLPELHQKPI  241

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP +        G  S +W     WL  QR KSVV+V  G+E      ++ ELA
Sbjct  242   VPVGLLPPSVQDTE----GDKSYAWGFINNWLAMQRKKSVVYVALGTEATPSQEELTELA  297

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W LRK    +      LP  F  RT  +G V + WAPQ  IL H ++G 
Sbjct  298   HGLELSGLPFFWALRK---QHDFLLLKLPEGFEERTKTRGIVWMSWAPQLRILEHDSVGC  354

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GWG+IIE L FG PL++LP + DQ LNA+ L EK +G E+PR E DGS +R+ VA
Sbjct  355   FLTHCGWGSIIEGLQFGKPLVMLPFLGDQALNARCLEEKMVGLEIPRNERDGSLTRNSVA  414

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILT  1466
              S++ VM   +G+    KA +M  IFGN +L DNYID FIE+ +++++ 
Sbjct  415   ESLKLVMNDEKGKIYWEKANEMRKIFGNRDLCDNYIDDFIEFVRTEVIV  463



>ref|XP_003635105.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Vitis vinifera]
Length=480

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 276/462 (60%), Gaps = 8/462 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             Q HV++FPWLAFGHM+P LE AK +A  G  VSFVSTP+N+ RLP +P +    ++  ++
Sbjct  14    QLHVVMFPWLAFGHMIPYLELAKLIAQSGNHVSFVSTPRNIDRLPKLPPNLAPFITFVKL  73

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP VP L EN EAT DL   ++VQFLK AYD +  P    +    P+ ++ DFA +W+ 
Sbjct  74    PLPHVPNLLENAEATADLP-NDKVQFLKVAYDLLQQPMARFLDAADPDWVIHDFAPYWLG  132

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
              IA + G++  F S++ A+ +++    ++L   + R  P+HFTVPP W  F S VA R  
Sbjct  133   PIATKLGISCAFFSIFNASCVSFFTPGDQL---EYRSEPDHFTVPPKWVPFQSKVAFRYF  189

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
                 ++    + DASG+S   RL+  IEGCD + VRSC E E E++ LLE+L ++PV+ +
Sbjct  190   EIKKIISEGLSGDASGISFKYRLTESIEGCDLLAVRSCFELEPEWLRLLEQLNRKPVIPV  249

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G L P L+            +W +  EWLD     SVV+V FGSE K    +I E+A  L
Sbjct  250   GQLAPELDDRG---DDGKDETWQQIKEWLDKLARGSVVYVAFGSEAKPNQTEITEIALGL  306

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             E S +PF W+L+     +      LP  F  RT  +G V   WAPQ  IL+H +IGG L 
Sbjct  307   EQSELPFFWVLKMSLGPSDTEMVKLPEGFEERTKGRGVVCTSWAPQLKILSHDSIGGFLS  366

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRDMVANSI  1328
             HSGW +++E+L    PLILL   ADQGLNA  L EK++GY +PR   DGSF+R+ VA S+
Sbjct  367   HSGWSSVVEALSLERPLILLTFFADQGLNASFLQEKKMGYLIPRNGGDGSFTREAVAQSL  426

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R VM    G+  R KA +M+ +F + +   +Y+D F+ Y ++
Sbjct  427   RLVMVEEGGKIYRDKAKEMSGLFRDRDKQKHYMDNFVSYLKA  468



>gb|KDP29778.1| hypothetical protein JCGZ_18713 [Jatropha curcas]
Length=466

 Score =   367 bits (942),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 285/462 (62%), Gaps = 10/462 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGH +P LE AK +A KG ++SF+STP+N+ RLP +P + +  ++  ++
Sbjct  7     KLHIALFPWLAFGHFIPYLELAKLIAQKGHKISFLSTPQNIHRLPKLPPNLSSSITFIKL  66

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LPSV GLPEN EAT D+   ++VQ+LK A+D +  P    ++   P+ ++ DFA +W+P
Sbjct  67    PLPSVDGLPENAEATADV-PLDKVQYLKKAFDGLKQPITSFLQISKPDWLIYDFAPYWLP  125

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
              +A    ++  F S++  A L  +  P+ + +   R  PE FTVPP W  F + VA R  
Sbjct  126   TVASNLCISHGFFSIFLGALLG-IAKPKSVINDD-RVKPEDFTVPPQWITFPTNVAFR-H  182

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             +    +  + T DAS VS   RL  V+ GC+ + VRSC +FE E+++LL+ ++++P + +
Sbjct  183   FEIVKIFESVTGDASEVSDMFRLEEVLNGCEMISVRSCSDFEPEWLNLLQDIHRKPCIPV  242

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G+LP      T  +    + +W    EWLD Q+   VV+V FGSE K    +I+E+A  L
Sbjct  243   GMLP-----TTQYENEDETDTWRTIKEWLDKQKKGYVVYVAFGSEAKPSQVEINEIALGL  297

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS +PF W+LRK           LP  F  RT ++G V   WAPQ  ILAH ++GG L 
Sbjct  298   ELSELPFFWVLRKRRGLTDTEVVELPDGFEERTKDRGLVCTSWAPQLKILAHDSVGGFLT  357

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSI  1328
             HSGW +++E+     PLILL  +ADQG+NA++L  K++GY +PR E DGSF+RD VA S+
Sbjct  358   HSGWSSVVEASQNERPLILLTFLADQGINARVLEGKKMGYPIPRNELDGSFTRDSVAESL  417

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R V+   EGE  R KA +M  +FG+ +  + Y+D+F+++  +
Sbjct  418   RLVIVKEEGEVYREKAKEMRILFGDRSKQERYLDKFLDFLHA  459



>emb|CDP00928.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/466 (41%), Positives = 284/466 (61%), Gaps = 11/466 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P L  +K LA KG ++SF+STP+NLQR+P +P      + +  I L
Sbjct  8     HVVMFPWLAMGHLIPFLRLSKCLAQKGHKISFISTPRNLQRIPKVPHDLASLIEMVSIPL  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLP--ELILVDFATHWVP  431
             P    LP+  E+++D+  +++ QFLK A+D +  P    +    P  + IL D+A+HW+P
Sbjct  68    PEGDNLPKQGESSMDVPHEKE-QFLKIAFDLLQSPIATFLENTTPKPDWILYDYASHWLP  126

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPE-ELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             EIA + G+A  + S++TAAT+AY+G P   L     R + E FT  P W  F   +A+R 
Sbjct  127   EIAAKNGIARAYFSLFTAATMAYIGPPSILLNEVDGRSTAEAFTRVPKWIPFPLNIAYRL  186

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   + ++ + + SG S   R ++ IEG D V+ R+C EFE E+ DL+ +LYK+PV++
Sbjct  187   HEVAKHIEDS-SGNESGTSDVIRFAAAIEGSDLVVFRTCVEFEPEWFDLVCELYKKPVIS  245

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G+LPP L+ +  +       +W    +WLD Q    VV+V  G+E  +   ++HELA  
Sbjct  246   LGVLPPSLDEDDEL---ETDETWLSIKDWLDKQSVSRVVYVALGTEVALGQTEVHELALG  302

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVIL--GWAPQQNILAHPAIGG  1142
             LE S +PF W+LRK          +LP  F  R +  GR ++   W PQ  IL+HPAIGG
Sbjct  303   LEQSELPFFWVLRKSPGSTKDVSQMLPEGFTERINANGRGVIYTEWVPQVKILSHPAIGG  362

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRDMVA  1319
              L H GW ++IE+LGFG  LIL P++ DQGLNA+LL  K++G E+PR  EDGSF+   VA
Sbjct  363   YLTHCGWNSVIEALGFGRVLILFPVMNDQGLNARLLEGKKVGVEIPREAEDGSFTSTAVA  422

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              ++R  + S +GE +R  A +M N+FG+ N + +Y+D F+   + K
Sbjct  423   ETLRLAVVSEDGESMRANALKMKNLFGDGNANQSYLDSFVRSLEEK  468



>gb|KDP29780.1| hypothetical protein JCGZ_18715 [Jatropha curcas]
Length=471

 Score =   366 bits (939),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 282/466 (61%), Gaps = 13/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV  FPWLAFGHM+P LE AK +A KG ++SF+STP+N++RLP IP + T  ++   
Sbjct  5     KKLHVAFFPWLAFGHMIPFLELAKHIAQKGHKISFISTPRNIRRLPIIPPNLTSNINFIS  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             ++LP V  LP + EAT+DL    QV +LK AYD +  P    ++   P  ++ DF  +W+
Sbjct  65    LSLPQVDNLPPDAEATIDLPFS-QVPYLKLAYDSLKDPLLHFLKTSTPNWVIYDFFPYWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSP-EELRSGK-LRPSPEHFTVPPGWFNFHSLVAH  602
             P I    G++  F S+    T+    SP   + +G+  R  PE FTVPP W  F S VA+
Sbjct  124   PSILADLGISGAFFSIAGGWTITSFASPLSAMINGRDSRTRPEDFTVPPKWIPFPSKVAY  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R   A   +R+ H  D SG S G RLS+V+ GCD V +RSC E E +++ L+ +L+ +PV
Sbjct  184   RLYEAKKTLRH-HEVDNSGTSDGFRLSTVMAGCDIVAIRSCFELEADFLRLVGELHGKPV  242

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
               +GLL P+L L+     G    +W +  +WLD Q+  SVV++ FGSE  +   +  ELA
Sbjct  243   FPVGLL-PQLTLDGN---GDEDDTWLKIRDWLDEQKKGSVVYIAFGSEVDLSQQEFTELA  298

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W +RK   DN      LP  F  R   +G V   W PQ  IL+H +IGG
Sbjct  299   LGLELSGLPFFWAIRKRD-DN---KVELPDGFEERVKGRGLVWTSWVPQPRILSHESIGG  354

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H G+ +II++L FG  LI+LP+  D GL A++  +K++G EV R E DGSF+RD+VA
Sbjct  355   FLTHCGYSSIIDALYFGCALIMLPIAFDHGLIARVFEDKKVGVEVTRHEDDGSFTRDLVA  414

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             +S+R VM   EG+  R  A +M+ +F +  L D YI++F+ + Q++
Sbjct  415   DSVRLVMVDEEGKLYRENAKEMSKLFADKELQDRYINKFVVFLQTQ  460



>ref|XP_007012764.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY30383.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=465

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 199/475 (42%), Positives = 284/475 (60%), Gaps = 31/475 (7%)
 Frame = +3

Query  63    AAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSL  242
               E+ H+ +FPWLA+GH++P LE +K LA KG R+S++STPKN+ RLP +PA  +  +S 
Sbjct  3     GKEKLHIAMFPWLAYGHIMPFLEVSKFLARKGHRISYISTPKNISRLPKLPAHLSSNISF  62

Query  243   REIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
              EI+LP V GLP   E+T ++  Q +V +LK A D++  P  E ++      I+ DF  H
Sbjct  63    IEISLPQVHGLPPGVESTAEIPIQ-KVPYLKKACDKLEVPLTEFLKTSHVNWIIHDFMPH  121

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNF------  584
             W+P +A  +G+  VF S+  A  LA+LG P  L  G  R  PE FTV P W ++      
Sbjct  122   WLPGVAIPFGINLVFFSICNATLLAFLGPPSAL-IGDHRKRPEDFTVVPKWIDYPCNIVL  180

Query  585   --HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLL  758
               H +V+H+       M +        VS  QR+  VI+GC FV +RSC EFE + I LL
Sbjct  181   KLHEMVSHQ-----ECMED--------VSDFQRIGQVIQGCQFVTLRSCVEFESDQIQLL  227

Query  759   EKLYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMP  938
             +KLY++PV+ +GLLPP L  N       +  SW +  +WLD +  KSV +V  GSE  + 
Sbjct  228   KKLYQKPVVPVGLLPPSLPSNEE----KSHESWEDIKKWLDRKGEKSVFYVALGSEVSLS  283

Query  939   IHQIHELASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
                +HELA  +  S +PF+W++R +P ++      ++P  F  R S++G V+  WAPQ  
Sbjct  284   QESMHELAFGIYKSNLPFIWVVRNRPLVEGQMGQDIIPQGFEERVSDRGLVLKDWAPQLR  343

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-  1289
             ILAH ++GG L H GW +IIE+L FG PLIL     +DQGLNA+LL  K++G E+ R E 
Sbjct  344   ILAHSSVGGFLTHCGWSSIIEALKFGRPLILFSGASSDQGLNARLLHGKKVGLEIERNEL  403

Query  1290  DGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             DGSF+ D+VA +IR VM   EGE +R  A  M +I  N  L +NY+D+F  + + 
Sbjct  404   DGSFTSDLVAQTIRQVMVEPEGEPVRANAWAMRDI-CNEELSNNYLDEFTRFIED  457



>ref|XP_011092852.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Sesamum indicum]
Length=479

 Score =   365 bits (938),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/471 (40%), Positives = 285/471 (61%), Gaps = 14/471 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLR  245
             +   V++ PWLAFGHM+P L+ +   A  G  V F+STP+N+QRL   IP +    +   
Sbjct  8     DDVRVVMLPWLAFGHMIPFLDLSIAFAKSGIHVYFLSTPRNIQRLHQRIPPNLPHLIEFV  67

Query  246   EIALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
                LP + G   LPE+ EATVD+   +++  LK A D +  P +  +   LP  I+VDF 
Sbjct  68    SFPLPKLDGSNLLPEDAEATVDIPA-DKMDCLKIACDLLQEPVKNFIAGKLPNWIIVDFF  126

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL-RSGK--LRPSPEHFTVPPGWFNFH  587
              HW  +IA    +  +   + +A+T  +  +PE +   GK   R SP+  T PP W +F 
Sbjct  127   PHWAVDIAHNLNIPIITYCICSASTAVFFWTPEFIVGEGKREARTSPQDLTAPPDWVDFP  186

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S VA R   A  +    +  +ASGV  G RL  +++    + +R+  EFEG+Y+     L
Sbjct  187   SQVACRNHEATVLYNVLYGKNASGVPDGARLMRLVQASQAIAIRTSLEFEGDYVKQHSNL  246

Query  768   YKRPVLAIGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
               +PV  +G LPP ++   + I+      SW + F+WLD Q P+SV+FVGFGSEYK+   
Sbjct  247   SGKPVFPVGFLPPEKVQGRSTIR----EESWCKIFDWLDQQSPRSVMFVGFGSEYKLKKE  302

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILA  1124
             +IHE+A  +ELS +PFLW LRKP          LP  F++RT+ +G V +GWAPQ+ ILA
Sbjct  303   EIHEIAHGVELSGLPFLWSLRKPDWATHDGIDALPPGFISRTAGRGVVQIGWAPQREILA  362

Query  1125  HPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFS  1304
             HP++GG LFH+GW +I+E++ +GH L+LLP +  Q L+ +LLVEK +  EV R +DGSF+
Sbjct  363   HPSVGGTLFHAGWASIVETIVYGHCLVLLPFIIAQPLDTRLLVEKGLAVEVERADDGSFT  422

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMAN-IFGNHNLHDNYIDQFIEYFQS  1454
             R+ +AN+++  M S+EGE +R +  + A+ IFGN  L+D+ + +FIEY ++
Sbjct  423   RNDIANALQKAMVSKEGEALRARTKEAADGIFGNQKLNDDCLKKFIEYLKN  473



>ref|XP_004287583.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Fragaria vesca 
subsp. vesca]
Length=532

 Score =   367 bits (942),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 285/471 (61%), Gaps = 30/471 (6%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLA+GH++P L+ +  LA KG R+SF+STPKNL RLP   +S +  ++L E+ L
Sbjct  74    HIVVFPWLAYGHLMPFLQVSNFLAQKGHRISFISTPKNLHRLPT--SSLSPLINLIELPL  131

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P+V GLP + E+T D+    +V +LK AYD++  P  E +       I+ DFA+HW+P +
Sbjct  132   PAVDGLPHSAESTADIPIN-KVPYLKKAYDKLELPLTEFLEHCDVNWIVHDFASHWLPRV  190

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNF---------HS  590
               R G+ +VF +++ A T+A+ G P E+ SG  R  PE FTV P W NF         H 
Sbjct  191   VTRLGINSVFFTIFNATTMAFAGPPSEILSGG-RQRPEDFTVVPKWINFPNYNVVFKLHE  249

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
             +V+H        M +        VS  QR ++ IEGCDFV+ R+C  F+ + + L+ KLY
Sbjct  250   MVSHW-----DCMEDE-------VSDFQRFAAAIEGCDFVVTRTCPVFDADSLSLVNKLY  297

Query  771   KRPVLAIGLLPPRL-NLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
              +PVL +G+LPP L + + +    +   +W    EWLD ++ KSVV++  G+E  +    
Sbjct  298   SKPVLPLGMLPPVLPDTDHSADDESEHGTWQSLREWLDGKKEKSVVYIALGTEVTLSRDS  357

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             IHELA  +E S + F+W+L        G P ++P  F  R  ++G V  GWAPQ  +LAH
Sbjct  358   IHELARGIEKSGLCFIWVLGHR--QEAGAPNMIPVGFEKRVEDRGLVWRGWAPQLRVLAH  415

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSF  1301
              A+GG L H GW ++IE+LGFG  L+L     ADQGL A+L+  K +G E+PR + DGSF
Sbjct  416   TAVGGFLTHCGWSSVIEALGFGRALVLFSGASADQGLIARLMHGKRVGLEIPRDDRDGSF  475

Query  1302  SRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S ++VA SIR VM   EGE +R  A  M  +FGN +L++ Y+++F E  +S
Sbjct  476   SSEVVAESIRRVMVEEEGEVLRENAWAMREVFGNLSLNNKYLEEFNEVLES  526



>ref|XP_002865752.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42011.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=515

 Score =   366 bits (940),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 192/471 (41%), Positives = 275/471 (58%), Gaps = 20/471 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  H+ +FPWLA GH+LP L  +K LA KG ++SF+STP+N+ RLP +P++ +  ++   
Sbjct  7     EVMHIAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNILRLPKLPSNLSSSITFVS  66

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LPS+ GLP + E+++D+   +Q Q LK A+D + PP  E +R   P+ I+ D+A+HW+
Sbjct  67    FPLPSISGLPPSSESSMDVPYNKQ-QSLKAAFDLLQPPLTEFLRLSSPDWIIYDYASHWL  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IAK  G++  F S++ AATL ++G    L   + R +PE FTV P W  F S +  R 
Sbjct  126   PSIAKELGISKAFFSLFNAATLCFMGPSSSLIE-ESRSTPEDFTVVPPWVPFKSTIVFRY  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I+G D V VRSC EFE E+  LL+ LY++PV  
Sbjct  185   HEVSRYVEKTDE-DVTGVSDSVRFGYTIDGSDAVFVRSCPEFEPEWFSLLQDLYRKPVFP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             IG LPP       I+   + ++W    EWLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  244   IGFLPP------VIEDDDDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREELTELALG  297

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE S  PF W+LR +P I         P  F  R   +G V +GW PQ  IL+H ++GG 
Sbjct  298   LEKSETPFFWVLRNEPQI---------PDGFEERVKGRGMVHVGWVPQVKILSHESVGGF  348

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E +GFG   I LP++ +QGLN +LL  K +G EV R E DGSF  D VA+
Sbjct  349   LTHCGWNSVVEGIGFGKVPIFLPVLNEQGLNTRLLQGKGLGVEVLRDERDGSFGSDSVAD  408

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
             S+R VM    GE IR K   M  +FGN + +  Y+D+ + + ++   +Q K
Sbjct  409   SVRLVMIDDAGEEIREKVKLMKGLFGNMDENIRYVDELVGFMRNDESSQLK  459



>ref|XP_004288529.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=476

 Score =   365 bits (936),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 270/461 (59%), Gaps = 13/461 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGHMLP LE AK +A KG ++SF+STP+N+ RLP +P + +  ++  E+
Sbjct  18    KLHIAMFPWLAFGHMLPYLELAKLIAGKGHKISFISTPRNIDRLPQLPPNLSTLITFVEV  77

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP    LPE  E+T DL  ++QV +LK AYD +  P  + + R  P+ +L DFA +WVP
Sbjct  78    PLPQNQNLPEGAESTADL-AEDQVPYLKIAYDSLQEPITQFLNRSKPDWLLFDFAPYWVP  136

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             EIA   G+ T F S+  AA L+ +G          R  PE + VPP W  F + VA R  
Sbjct  137   EIANTLGIPTAFFSIILAAALSIVGPTSPEIPADDRKLPEDYIVPPKWVPFPATVALRL-  195

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             +    +      D + V    R +  +  CD ++VRSC EFE E++ LLE L+ +PVL +
Sbjct  196   FEVRRLYTRVIGDETNVGDKYRFTETMWSCDMIVVRSCTEFEPEWLSLLEDLHGKPVLPV  255

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G+L P    +       +  +W    +WLD Q   +VV+V FGSE      +  E+A  L
Sbjct  256   GVLSPMPKAD-----DDDDETWRSIKDWLDRQSKNTVVYVAFGSEAMPSQEEATEIALGL  310

Query  972   ELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             E S +PF+W+LR K G D      +LP  F  R   +G V   W PQ  ILAH + G  L
Sbjct  311   EKSGLPFVWVLRTKHGEDA----VMLPEGFEERNEGRGVVCRSWVPQLKILAHDSFGVFL  366

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              HSGW +++E+L FG PL+LLPM  DQGLNA+  +EK++GYE+PR E DGSF+ + VA S
Sbjct  367   SHSGWSSVVEALTFGRPLVLLPMSNDQGLNARYFMEKKVGYELPRDEGDGSFTSEAVAES  426

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             +R V+   EG   R KA ++  +FG+    + Y+D+F+EY 
Sbjct  427   LRMVIEKEEGRVYRDKAKELKPLFGDRERQNMYVDKFLEYL  467



>ref|XP_009767882.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=465

 Score =   364 bits (934),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 201/475 (42%), Positives = 292/475 (61%), Gaps = 20/475 (4%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLA-AKGFRVSFVSTPKNLQRLPPIPASFTERL  236
             M     HV++ PW AFGH++P   F+  LA   G  VSF+STPKN++RLP +P + T  +
Sbjct  1     MRKNDVHVVMLPWSAFGHLIPFFNFSIALAKVGGVHVSFISTPKNIKRLPKVPTNLTHLV  60

Query  237   SLREIALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILV  407
              L E  LP++     LPE+ EA+VDL   E++Q+LK AYD +  P ++ +    P+ I+V
Sbjct  61    KLVEFPLPTLDDKSLLPEDAEASVDLPL-EKIQYLKAAYDLLQEPIKQFIADKKPDWIIV  119

Query  408   DFATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPG-WFNF  584
             DF  +W+ EIA+ Y +  + LS+++AA+ A+L +     SG   P PE  T P      F
Sbjct  120   DFFQYWIVEIAEAYDIPMIHLSIFSAASRAFLIAARA--SG---PIPECLTSPVSEKLEF  174

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              S +A+R   A  +  ++   DASG+S  QR + ++  C  + +RSCKEFEG+Y+D + K
Sbjct  175   SSTLAYRSYEALELFSSSFLEDASGLSYAQRSAKILSTCRAMAIRSCKEFEGDYLDAVHK  234

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTN---SSSWSEAFEWLDNQRPKSVVFVGFGSEYKM  935
             L  +P + +GLLPP     T+   G N     SW   F+WL+ Q+  SV+FVGFGSE K 
Sbjct  235   LISKPTIPVGLLPPE----TSSLGGENFNGDQSWQRIFKWLNQQKAGSVLFVGFGSECKP  290

Query  936   PIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
               +Q+ E+A  LEL  +PF+WIL+KP   +     L P  F   T+ +G V +GWAPQ+ 
Sbjct  291   SKYQVDEIAYGLELYGLPFIWILQKPSWSSDEVDPL-PAGFGLTTAEKGVVHIGWAPQKE  349

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-  1292
             ILAHP IGG L  +G  + +E+L  GH L++LP V DQGLNA+LLVEK +  EV R+E+ 
Sbjct  350   ILAHPCIGGTLTQAGLSSTVETLQHGHVLVVLPFVYDQGLNARLLVEKGMAIEVKRKEEN  409

Query  1293  GSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             GSF+R  +A ++   M S +GE +R +A + A IFG+  LHD+YI  F+EY ++K
Sbjct  410   GSFTRKEIAKALTYAMVSEDGEKLRARAREAAAIFGDRQLHDSYIASFVEYLKNK  464



>ref|XP_009623131.1| PREDICTED: UDP-glycosyltransferase 91C1 [Nicotiana tomentosiformis]
Length=476

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 282/462 (61%), Gaps = 10/462 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLA GH++P    +K LA +G RV+F+STP+NL+RL  +P+  T  L++  I L
Sbjct  9     HIVMFPWLAMGHIIPFFHLSKCLAQRGHRVTFISTPRNLERLGKVPSDLTPLLNIVSIPL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPP---FEELVRRDLPELILVDFATHWV  428
             P V  LP+  E+++D+  Q + QFLK A+D +  P   F E +    P+ I+ D+A+HW+
Sbjct  69    PKVENLPDQAESSMDIPYQ-KAQFLKIAFDLLETPLITFLENLSNPKPDWIVYDYASHWL  127

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P  A+  GV+  F S++TAAT+A+ G P  L + + R  PE +TV P W +F + V +R 
Sbjct  128   PHRARDLGVSCAFFSLFTAATMAFFGPPRALLNDE-RSIPEDYTVVPNWISFETDVKYR-  185

Query  609   DYAPTMMRNTHTP-DASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                  + +N   P + SG S G R    I+G DFV+ R+C EFE E+ +L+ +L+++PV+
Sbjct  186   --LHEIKKNFEAPANESGTSDGARFGGSIDGSDFVLFRTCVEFEPEWFNLVSELFQKPVI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +IG+LPP +  N  +   +N+++W    +WLD Q   SVV+V  G+E  +   +++ELA 
Sbjct  244   SIGVLPPSIEDNEDLGRSSNNTTWLSIKKWLDKQNQNSVVYVALGTESTLSQKELNELAL  303

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LE   +PF W++R     N     +LP  +  R  N+G +  GW PQ  IL+H +IGG 
Sbjct  304   GLEKCGLPFFWVIRNQPKLNQEESQILPDGYEERVKNRGVIYRGWVPQAKILSHLSIGGF  363

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW ++IE+L FG  LI+ P++ DQGLN +LL  K +G E+PR E DG F+ + VA 
Sbjct  364   LTHCGWNSVIEALCFGRVLIMFPVMNDQGLNTRLLQCKGVGVEIPRNENDGLFTSESVAE  423

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             +++  + S EG+ +R  A QM  +FG+ N +   ID  + Y 
Sbjct  424   TVKFAVVSEEGKTLRANARQMRGLFGDRNRNGELIDDCVGYL  465



>ref|NP_199780.1| UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
 sp|Q9LTA3.1|U91C1_ARATH RecName: Full=UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
 dbj|BAA98157.1| anthocyanidin-3-glucoside rhamnosyltransferase-like [Arabidopsis 
thaliana]
 dbj|BAC41828.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
 gb|AAO63454.1| At5g49690 [Arabidopsis thaliana]
 gb|AED95845.1| UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
Length=460

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 274/465 (59%), Gaps = 19/465 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  HV +FPWLA GH+LP L  +K LA KG ++SF+STP+N++RLP + ++    ++   
Sbjct  7     EVMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSITFVS  66

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GLP + E+++D+   +Q Q LK A+D + PP +E +RR  P+ I+ D+A+HW+
Sbjct  67    FPLPPISGLPPSSESSMDVPYNKQ-QSLKAAFDLLQPPLKEFLRRSSPDWIIYDYASHWL  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL ++G    L   ++R +PE FTV P W  F S +  R 
Sbjct  126   PSIAAELGISKAFFSLFNAATLCFMGPSSSLIE-EIRSTPEDFTVVPPWVPFKSNIVFRY  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I+  D V VRSC EFE E+  LL+ LY++PV  
Sbjct  185   HEVTRYVEKTEE-DVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVFP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             IG LPP +  + A+      ++W    +WLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  244   IGFLPPVIEDDDAVD-----TTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALG  298

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE S  PF W+LR +P I         P  F  R   +G V +GW PQ  IL+H ++GG 
Sbjct  299   LEKSETPFFWVLRNEPKI---------PDGFKTRVKGRGMVHVGWVPQVKILSHESVGGF  349

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E LGFG   I  P++ +QGLN +LL  K +G EV R E DGSF  D VA+
Sbjct  350   LTHCGWNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVAD  409

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             SIR VM    GE IR KA  M ++FGN + +  Y+D+ + + +SK
Sbjct  410   SIRLVMIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRSK  454



>ref|XP_009364807.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Pyrus 
x bretschneideri]
Length=476

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 274/464 (59%), Gaps = 10/464 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLAFGH++P LE AK +A +G +VSF+STP+N+QRLP IP + T  + L +I L
Sbjct  17    HIALFPWLAFGHIIPALEVAKHIAQRGHKVSFISTPRNIQRLPKIPPNLTPLIDLVQIPL  76

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT+D+   + + +LK A+D +       ++   P+ I+ DFA +W+P I
Sbjct  77    PRVENLPENAEATMDV-PYDLIPYLKLAHDGLEQGITSFLQTHTPDWIIYDFAPYWLPPI  135

Query  438   AKRYGVATVFLSVYTAATLAYLGS--PEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             A   G++      +   T    G   P+ L     R  PEHFTVPP W  F S +  R  
Sbjct  136   ASNLGISRAMFGGFNTYTGCAFGPTLPDVLSRYSPRTLPEHFTVPPEWIPFPSKLFFRLF  195

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
              A  +  +    +ASG+S   R+ S IEG    + RSC+E EG ++DL+ +LY++P + +
Sbjct  196   EAKKLF-DALEHNASGISDWFRMKSAIEGSQVCLFRSCREIEGAWLDLVPELYRKPAIPV  254

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GLLPP +            SSWS   +WLD Q   +VV+V  GSE      +  ELA  L
Sbjct  255   GLLPPSVQDTE----DKEDSSWSIVCQWLDKQERATVVYVALGSEINPTQEEFTELALGL  310

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS +PF W LR P    PG    LP +F +R+  +G V   WAPQ+ ILAH A+GG L 
Sbjct  311   ELSGLPFFWALRTPNGSTPGNSVKLPDEFEDRSKGRGLVWRTWAPQRQILAHKAVGGFLT  370

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRDMVANSI  1328
             H GW ++IE L  G PLI+ P + DQGLNA+L  ++++G EVPR  EDGSF+++ VA S+
Sbjct  371   HCGWSSLIEGLHCGIPLIMFPFLYDQGLNARLW-DRKVGIEVPRNDEDGSFTKNAVAESL  429

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
               VM   EG+  R    + + + G+ +LHD Y+D+ +EYF+  +
Sbjct  430   NLVMVDEEGKAYRDGTKEYSAVIGDKDLHDRYMDKCVEYFEKNV  473



>emb|CDP00929.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/470 (41%), Positives = 281/470 (60%), Gaps = 11/470 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P    +K LA KG ++SF+STP+NLQRLP IP     ++ L  I L
Sbjct  8     HVVMFPWLAMGHLIPFFRLSKLLAGKGHKISFISTPRNLQRLPKIPQELASQIELVSIPL  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVR--RDLPELILVDFATHWVP  431
             P V  LP+  E + D+   E+ QFLK A+D +  P    +   R  P+ I+ D+A+HW+P
Sbjct  68    PEVDNLPKQGETSTDIPH-EKDQFLKIAFDLLRSPIASFLENTRPKPDWIIHDYASHWLP  126

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRP  608
             EIA + GV+  F S++TAA L++LG P  L SG+  R + E FTV P W  F S  A+R 
Sbjct  127   EIAAQNGVSAAFFSLFTAAALSFLGRPSALLSGEDGRSTAEDFTVVPKWIPFPSNCAYRL  186

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   + +  + + SG S   R ++ I+  D VI R+  EFE E+ +L+ +LY++PV++
Sbjct  187   HEVRKNIEDA-SGNESGASDFVRFAASIDRSDLVIFRTSVEFEPEWFNLVRELYQKPVVS  245

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G+LPP L+ +  +        W +   WLD Q    VV+V  G+E  +   ++ +LA  
Sbjct  246   LGVLPPSLDDDDEL---ETDEKWQKIQNWLDKQTASKVVYVALGTEATISQKEVQDLAIG  302

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNR--TSNQGRVILGWAPQQNILAHPAIGG  1142
             LE S +PF W+LRKP         +LP  F  R   + QG V   W PQ  IL+HPAIGG
Sbjct  303   LEQSELPFFWVLRKPPGSKKDVTDMLPEGFRERINANGQGVVYTEWVPQVKILSHPAIGG  362

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVA  1319
              L H GW ++IE+LGFG  LIL P++ DQGLNA+LL  K++G E+PR  EDG F+   VA
Sbjct  363   YLTHCGWNSVIEALGFGRVLILFPVMNDQGLNARLLEGKKVGVEIPRAAEDGLFTSTAVA  422

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
              ++R  + S EGE +R  A QM ++FGN   + +YID F+   + + ++ 
Sbjct  423   ETLRYAVVSEEGEPMRANARQMTSLFGNGKRNQDYIDTFVRCLEERKISN  472



>ref|XP_009624393.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=471

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 291/470 (62%), Gaps = 20/470 (4%)
 Frame = +3

Query  75    CHVMIFPWLAFGHMLPMLEFAKKLA-AKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
              HV++ PW AFGH++P   F+  LA   G  VSF+STPKN++RLP +P + T  + L E 
Sbjct  12    VHVVMLPWSAFGHLIPFFNFSIALARVGGVHVSFISTPKNIKRLPKVPPNLTHLVKLVEF  71

Query  252   ALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
              LP++     LPE+ EA+VDL   E++Q+LK AYD +  P ++ +    P+ I+VDF  +
Sbjct  72    PLPTLDDKSLLPEDAEASVDLPL-EKIQYLKAAYDLLQEPIKQFIADKKPDWIIVDFFQY  130

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPG-WFNFHSLVA  599
             W+ EIA+ Y +  + LS+++AA+ A+L +     SG   P PE  T P      F S +A
Sbjct  131   WIVEIAEAYDIPMIHLSIFSAASRAFLIAARA--SG---PIPESLTSPASEMLEFSSTLA  185

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R   A  +  ++   DASG+S  QR + ++  C  + +RSCKEFEG+Y++ + KL  +P
Sbjct  186   YRSYEALELFSSSFVEDASGLSYAQRSAKILRTCRAMALRSCKEFEGDYLEAVHKLISKP  245

Query  780   VLAIGLLPPRLNLNTAIQPGTN---SSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
              + +GLLPP     T+   G N     SW   F+WL+ Q+  SV+FVGFGSE K    Q+
Sbjct  246   TIPVGLLPPE----TSSLGGENFNGDQSWQRIFKWLNQQKAGSVLFVGFGSECKPSKEQV  301

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  LELSR+PF+WIL+KP   +     L P  F   T+ +G V +GWAPQ+ ILAHP
Sbjct  302   DEIAYGLELSRLPFIWILQKPSWSSDEVDPL-PARFGLTTAEKGVVHIGWAPQKEILAHP  360

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSR  1307
              IGG L  +G  + +E+L  GH L+ LP V DQGLNA+LLVEK +  EV R+ED GSF+R
Sbjct  361   CIGGTLTQAGLSSTVETLQHGHVLVALPFVYDQGLNARLLVEKGMAIEVERKEDNGSFTR  420

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
               +A ++   M S +GE +R +A + A IFG+  LHD+YI  F+EY ++K
Sbjct  421   KEIAKALTYAMVSEDGEELRARAREAAAIFGDRQLHDSYIATFVEYLKNK  470



>ref|XP_011015214.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Populus euphratica]
Length=477

 Score =   363 bits (932),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 274/466 (59%), Gaps = 15/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLAFGH++P LE AK +A +G ++SF+STP+N+QRLP  P + T R++L  
Sbjct  5     DELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPSTPPNLTPRINLVS  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             +ALP V  LP N EAT DL   +++ +LK AYD +       +    P+ I+ DFA +W+
Sbjct  65    LALPHVENLPNNAEATADL-PFDKIPYLKLAYDGLQDSIFHFLHSSSPDWIIFDFAPYWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLG--SPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             PEIA + G++ V  S++ A T+++ G  S   L     R  P+HFTVPP W  F S VA 
Sbjct  124   PEIATKLGISGVLFSIFGAWTISFAGPSSSAMLNDDDPRTEPQHFTVPPKWVTFPSKVAF  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R   A   +      ++SGV+   R  SV+ GCD + VRSC E E ++I L+E L+ +PV
Sbjct  184   RIHEAKRFLDQIEL-NSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFIRLVEDLHCKPV  242

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP    +     G     W    EWLD Q   SVV++ FGSE  M    I ELA
Sbjct  243   IPVGLLPPSAEFSE----GGVDEKWVAISEWLDKQTQGSVVYIAFGSELTMNQKDITELA  298

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS + F W LR     N      LP  F  R   +G V   WAPQ  I+AH ++GG
Sbjct  299   LGLELSGLQFFWALR-----NRDDSVRLPDGFEERVKGRGVVWTSWAPQLRIMAHESVGG  353

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              + H G+ ++IE+L FG  LI+LP   DQGL A++   K++G EVPR E DGSF+R+ VA
Sbjct  354   FVTHCGYSSVIEALSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVA  413

Query  1320  NSIRSVMASREGEGIRLKAA-QMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+R V+  +EG   R  A  QM  +FG  ++ D  +DQF+ + +S
Sbjct  414   ESLRLVIVDKEGSAYRENAKQQMVTLFGEKSISDRGMDQFVGFLRS  459



>ref|XP_006451091.1| hypothetical protein CICLE_v10010307mg [Citrus clementina]
 gb|ESR64331.1| hypothetical protein CICLE_v10010307mg [Citrus clementina]
Length=467

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 194/465 (42%), Positives = 286/465 (62%), Gaps = 15/465 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++P  + A  LA KG  VS++STPKN+ RLP IP + + RLS  +
Sbjct  7     QKLHIAMFPWLAYGHIMPFFQVAMFLAEKGHHVSYISTPKNIDRLPQIPTNLSSRLSYIQ  66

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP + GLPE  E+T +L    +V +LK A+D +  P    ++      I+ DF +HW+
Sbjct  67    LPLPQLDGLPEGAESTAELPIH-KVPYLKKAHDLLQLPLTNFLQDSRVNWIIHDFISHWL  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +VF S+Y+AATL + G P ++ +G+ R  PE FTV P W +F S +A +P
Sbjct  126   PPVAAQLGVNSVFFSIYSAATLCFTGPPSDVIAGR-RQKPEDFTVVPEWIDFQSNLAFKP  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                 T++      D+  VS   R + V++ C  VI+RSC EFE + + LL K+ ++PVL 
Sbjct  185   --YETLINQDGMDDS--VSDYLRAAFVLQDCRVVILRSCAEFEPDALRLLGKMLQKPVLP  240

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +GLL P L      Q       W    +WLD++   SVV+  FG+E  +    +HELA  
Sbjct  241   VGLLAPSL------QDSAAGEHWPVLKDWLDSKENNSVVYAAFGTEMTLSQELLHELAYG  294

Query  969   LELSRMPFLWILR-KPGIDN-PGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
             LE S +PF+WI++ +P ++   G   LLP  F +R S  G V   WAPQ  ILAHP+IGG
Sbjct  295   LEKSGLPFIWIIKNRPLVEGESGLDHLLPPGFQDRVSGTGLVWTDWAPQLRILAHPSIGG  354

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L HSGW ++IE+LG G PLILLP  +D GL A+L+  + +G EV R E DGSF+RD VA
Sbjct  355   FLTHSGWSSVIEALGLGRPLILLPGSSDTGLVARLMHSRRLGLEVERNEQDGSFTRDSVA  414

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             + IR V+  +EGE +R  A  + +IFG+ +L   ++D+F  + ++
Sbjct  415   DCIRRVVVDQEGEPLRANARAVRDIFGSTHLSYKHLDEFTRFIEN  459



>gb|KHN26939.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=452

 Score =   362 bits (928),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 198/462 (43%), Positives = 278/462 (60%), Gaps = 18/462 (4%)
 Frame = +3

Query  87    IFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALPSV  266
             + PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++ +  +   E+ LPS+
Sbjct  1     MIPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSTLSHLVHFVELPLPSL  60

Query  267   PG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEIA  440
                 LPE  E T+D+  ++  ++LK AYD++    ++ V   LP+ I+ DF  HWV +IA
Sbjct  61    DNDILPEGAETTLDIPFEKH-EYLKAAYDKLQDAVKQFVANQLPDWIICDFNPHWVVDIA  119

Query  441   KRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYAP  620
             + + V  +   + +A    ++G P   R+G L  SPE  T PP W  F S VA R   A 
Sbjct  120   QEFQVKLILFVIISATGATFIGPPGT-RTGPL--SPESLTAPPEWVTFPSSVAFRKHEAI  176

Query  621   TMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGLL  800
                  ++   +SGVS  +R+  +      V+ RSC E EGEY++  +KL ++PV+ IGLL
Sbjct  177   HFCAGSYKVSSSGVSDFERIIKLHGASKAVLFRSCYEIEGEYLNAFQKLVEKPVIPIGLL  236

Query  801   PPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALELS  980
             P    +   +  G + +     FEWLD Q  KSVVFVGFGSE K+   Q+ E+A  LE S
Sbjct  237   P----VERQVVDGCSDT----IFEWLDKQASKSVVFVGFGSELKLSKDQVFEIAYGLEES  288

Query  981   RMPFLWILRKPGID-NPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             ++PFLW LRKP  + N  Y   LP  F+ RTSN+G V  GW PQ  ILAH +IGG LFHS
Sbjct  289   QLPFLWALRKPSWESNDEYS--LPVGFIERTSNRGSVCKGWIPQLEILAHSSIGGSLFHS  346

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANSIRSV  1337
             G G++IE+L FGH L++LP   DQ L A+ LVEK +  EV R EDGSF+R+ +A S+R  
Sbjct  347   GLGSVIENLQFGHTLVVLPFNIDQPLIARFLVEKGLAIEVKRNEDGSFTRNDIAASLRQA  406

Query  1338  MASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
             M   EG+ IR    + A I GN  LH D+Y+  F+++ ++ I
Sbjct  407   MVLEEGKKIRNNTREAAAIVGNLKLHQDHYVAAFVQFLKNGI  448



>ref|XP_011073572.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=468

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 277/464 (60%), Gaps = 14/464 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++FPWLAFGH++P  E +K +A KG +++F+STP+N+ RLP +P      + L +I
Sbjct  11    KLHVVMFPWLAFGHIIPFFELSKFIAQKGHKITFISTPRNIDRLPKLPPDLVSSIDLVKI  70

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP +  LPEN EAT+D+ + E V+ LK AYD M       +     ++I+ DFA +W+ 
Sbjct  71    PLPKLEELPENAEATMDV-RPEDVEHLKKAYDGMEDGVARFLENSDADIIIYDFAPYWLA  129

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAHRP  608
              IA R G++  F  ++ A  LA+LG+ + L +G + R   E F  PP W  F + VA+R 
Sbjct  130   PIATRLGISRFFFCIFNAWFLAFLGTTDALINGLEGRSRQEDFLAPPEWVTFDTKVAYRL  189

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              Y           +ASG S   R    I GC+ +I+R C EFE +++ LLE+L+++ V+ 
Sbjct  190   -YEAKWALGAAGTNASGFSDTYRAGKAIAGCNAMIIRHCNEFEPKWLKLLEELHQKEVIP  248

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +GL+PP++  NT     + + +W     WL     +SVV+V  GSE  +   QI ELA  
Sbjct  249   LGLMPPQVQDNT-----STNEAWVSIKNWLCTHPKESVVYVALGSEVVLSRDQISELAHG  303

Query  969   LELSRMPFLWILRKPGIDNPGYPAL-LPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LELS +PFLW LRKP     G   + LP  F  RT  +G V   WAPQ  IL H  +G  
Sbjct  304   LELSGVPFLWALRKPA----GSATIELPEGFEERTKGRGIVWKNWAPQLKILGHDGVGAF  359

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +I+E L FG PL++LP   DQGLNA++L +K++G EVPR E DG+++R+ VA 
Sbjct  360   LTHCGWSSIVEGLMFGRPLVMLPFQIDQGLNARVLGDKQVGMEVPRNEQDGTYTRNAVAE  419

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R+VM    G+ +R  A   + +FG+  LHD Y+  F+E+ ++
Sbjct  420   SVRTVMVDGVGQKLRDTAKATSAMFGDKELHDRYLHNFVEHLEN  463



>emb|CBI40428.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 269/462 (58%), Gaps = 55/462 (12%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++ PWLAFGHM+P L+ +  LA  G RVSFVSTP+N++RLP +P      +S +    
Sbjct  26    HVVMVPWLAFGHMIPFLQLSIALAKAGVRVSFVSTPRNIRRLPKLPPDLEPLISFK----  81

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
                                  +Q+LK AYD +  PF++ V    P+ I+ D   HWV E 
Sbjct  82    ---------------------IQYLKLAYDLLQHPFKKFVADQSPDWIISDTMAHWVVET  120

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A+ + + ++   ++++A   +                        W +F S VA R   A
Sbjct  121   AEEHRIPSMAFILFSSAAAVF------------------------WVSFPSSVAFRGYEA  156

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
              T        + SG++   R++ V   C  V VRSC EFEGEY+++ EK+  +PV+ +G 
Sbjct  157   RTCYAGFFGENVSGITDAHRVAKVCHACKAVAVRSCIEFEGEYLNIHEKIMGKPVIPVGF  216

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             LPP           T   SWSE F+WLD Q+PKSVVFVGFGSE K+   Q+HE+A  LEL
Sbjct  217   LPPEKQGGRE----TTEGSWSEIFKWLDEQKPKSVVFVGFGSECKLTKDQVHEIAYGLEL  272

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S +PFLW LRKP        AL P+ F +RTS +G V +GWAPQ  ILAHP+IGG LFHS
Sbjct  273   SELPFLWALRKPNWTMEDIDAL-PSCFSDRTSGKGIVWMGWAPQMEILAHPSIGGSLFHS  331

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANSIRSV  1337
             GWG++IE+L FGH L+LLP + DQGLNA+LLVEK +  E+ R EDGSFSR+ +A S+R  
Sbjct  332   GWGSVIETLQFGHCLVLLPFIVDQGLNARLLVEKGLAVEIERSEDGSFSREDIAKSLRVA  391

Query  1338  MASREGEGIRLKAAQMANIFGNHNL-HDNYIDQFIEYFQSKI  1460
             M S EGE +R +A + A IF +  L  ++YI   ++Y ++++
Sbjct  392   MVSEEGEKLRARAREAAAIFIDKRLQQEHYIGGLVKYLKAEV  433



>ref|XP_011015202.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Populus euphratica]
Length=465

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/466 (41%), Positives = 271/466 (58%), Gaps = 15/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLAFGH++P LE AK +A +G ++SF+STP+N+QRLP IP   T R++L  
Sbjct  5     DELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPSIPLDLTPRINLAS  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             +ALP V  LP N EAT DL   +++ +LK AYD +       +    P+ I+ DFA +W+
Sbjct  65    LALPRVENLPNNAEATADL-PFDKIPYLKLAYDGLQDSIFHFLHSSSPDWIIFDFAPYWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLG--SPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             PEIA + G+  V  S++ A T+++ G  S   L     R  P+HFTVPP W  F S VA 
Sbjct  124   PEIATKLGIYGVLFSIFGAWTISFAGPSSSAMLNDDDPRTEPQHFTVPPKWVTFPSKVAF  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R   A   +      ++SGV+   R  SV+ GCD + VRSC E E +++ L+E L+ +PV
Sbjct  184   RIHEAKRFLDQIEL-NSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFLRLVEDLHCKPV  242

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP    +     G     W    EWLD Q   SVV++ FGSE  M    I ELA
Sbjct  243   IPVGLLPP----SAEFSEGGVDEKWVAISEWLDKQTQGSVVYIAFGSELTMNQKDITELA  298

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS + F W LR     N      LP  F  R   +G V   WAPQ  I+AH ++GG
Sbjct  299   LGLELSGLQFFWALR-----NRDDSVRLPDGFEERVKGRGVVWTSWAPQLRIMAHESVGG  353

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              + H G+ ++IE+  FG  LI+LP   DQGL A++   K++G EVPR E DGSF+R+ VA
Sbjct  354   FVTHCGYSSVIEAFSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVA  413

Query  1320  NSIRSVMASREGEGIRLKAA-QMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+R V+  +EG   R  A  QM  +FG  ++ D  +D F+ + +S
Sbjct  414   ESLRLVIVDKEGSAYRENAKQQMVTLFGEKSISDRCMDHFVAFLRS  459



>ref|XP_004134320.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 ref|XP_004170635.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 gb|KGN56497.1| hypothetical protein Csa_3G121730 [Cucumis sativus]
Length=469

 Score =   359 bits (922),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 276/465 (59%), Gaps = 15/465 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPW AFGH++P  + +  LA  G  VSF+STPKNLQRLPPIP S +  ++L  I L
Sbjct  8     HVVVFPWSAFGHLIPHFQLSIALAKAGVHVSFISTPKNLQRLPPIPPSLSSFITLVPIPL  67

Query  258   PSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDL--PELILVDFATHW  425
             P +PG  LPE  EATVD+   +++ FLK A D   PPF + +      P+  +VDF   W
Sbjct  68    PKLPGDPLPEGAEATVDI-PFDKIPFLKVALDLTEPPFRKFIADHAHPPDWFIVDFNVSW  126

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             + +I++ + +  VF  V +   LA+      L   +L  +     + P      S VA+R
Sbjct  127   IGDISREFRIPIVFFRVLSPGFLAFYA---HLLGNRLPMTEIGSLISPPPIE-GSTVAYR  182

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                A  +       + SG+S  +R++ +   C  + VR+C EF+ +Y+ L      + V+
Sbjct  183   RHEAVGIHAGFFEKNDSGLSDYERVTKINTACRVIAVRTCYEFDVDYLKLYSNYCGKKVI  242

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +G LPP     T  +    +S W   FEWLD Q PKSVVFVGFGSE K+   QIHE+A 
Sbjct  243   PLGFLPPEKPPKTEFE---ANSPWKSTFEWLDQQNPKSVVFVGFGSECKLTKDQIHEIAR  299

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              +ELS +PF+W LR+P  D      +LP  F +RT+ +G V +GWAPQ  IL HPAIGG 
Sbjct  300   GVELSELPFMWALRQP--DWAEDSDVLPAGFRDRTAERGIVSMGWAPQMQILGHPAIGGS  357

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
              FH GWG+ IE+L FG+ LILLP + DQ LNA+LLVEK +  EV R E DG  S + +A 
Sbjct  358   FFHGGWGSAIEALEFGNCLILLPFIVDQPLNARLLVEKGVAIEVERNEDDGCSSGEAIAK  417

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             ++R  M S EGE IR +A ++A IFG+  LH  YI++F+E+ + +
Sbjct  418   ALREAMVSEEGEKIRKRAKEVAAIFGDTKLHQRYIEEFVEFLKHR  462



>ref|XP_010047533.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW79476.1| hypothetical protein EUGRSUZ_C00863 [Eucalyptus grandis]
Length=449

 Score =   358 bits (919),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 198/461 (43%), Positives = 277/461 (60%), Gaps = 24/461 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV IFPWLAFGH+LP LE A  LA KG RVSF+STPKNL++L   P      L+L E
Sbjct  6     KKLHVAIFPWLAFGHILPYLEVATFLAEKGHRVSFISTPKNLRKL---PTDLPPSLTLVE  62

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP+  E+T +L  + +V +LK AYD + P   E ++R   + I+ DFA HW+
Sbjct  63    LPLPRVDGLPDLAESTAELPIK-KVPYLKKAYDMLEPAITEFLQRSGVDWIIHDFAAHWL  121

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +  + G+ + F ++ +A + A+LG P  L  G + P PE  TV P W ++ S V    
Sbjct  122   PRVVSQIGINSAFFNITSATSPAFLGPPSLLIEGPV-PRPEDLTVVPKWIDYPSKVR---  177

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    M   H     GVS  QR+   I G  FV VRSC EFE + + LLEKLY +PV+ 
Sbjct  178   -FKLYEMLQNHDGMDPGVSDFQRIGESIRGSKFVAVRSCPEFEADPLRLLEKLYGKPVVP  236

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +GLLPPR   +      +    W E   WLD+++ KSV ++G G+E  +    I ELA  
Sbjct  237   VGLLPPRRKRS------SEDERWVELKRWLDDKKEKSVFYIGLGTEVNISPEMIVELAGG  290

Query  969   LELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             +E S +PF+W++ ++PG +N      +P  F ++ + +G + +GWAPQ  ILAHPAIGG 
Sbjct  291   IEKSGLPFVWVVGQRPGPEN------IPPGFESQVAGRGYMWMGWAPQAEILAHPAIGGI  344

Query  1146  LFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
             L H GW + IESLG G PLIL     +DQGL  +L  E+ +G+EVPR E DGSF+ D +A
Sbjct  345   LSHCGWSSAIESLGQGRPLILFSGANSDQGLMGRLFEERGVGFEVPRDEADGSFTSDSLA  404

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIE  1442
              +IR VM   EGE +R  A  M  IFGN+ L + Y+++  +
Sbjct  405   QTIRRVMVEPEGEQVRANAWAMREIFGNYELQNKYLEKLAQ  445



>ref|XP_008242170.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Prunus mume]
Length=469

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/469 (41%), Positives = 284/469 (61%), Gaps = 18/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++P LE +K LA KG RVSF+STPKN+QRLP   +S +  ++  E
Sbjct  7     QKLHIAMFPWLAYGHIMPFLEVSKFLAQKGHRVSFISTPKNIQRLP--KSSQSPLITFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP++ GLP+  E+T +L    +V +LK AYD + PP    ++      ++ DF  HW+
Sbjct  65    LPLPAIEGLPQCTESTSELPIH-KVPYLKKAYDLLQPPLAHFLQHSDVNWVIHDFICHWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + G+ +V+ ++++A TLA+LG P ELR G+ R  PE FTV P W +F S VA + 
Sbjct  124   PRVATQLGINSVYFNIFSATTLAFLGPPSELRGGQ-RQRPEDFTVVPKWVDFTSNVAFK-  181

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  M+ +    D + VS  QR +  I+ C+ V  RS  EFE + + LL KLY +PV+ 
Sbjct  182   --LHEMVSHWDCMD-NEVSDFQRFADAIQYCNLVTTRSTPEFESDSVSLLRKLYGKPVVP  238

Query  789   IGLLPPRLNLNTAIQPGTNSS----SWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             +GLLPP    +   Q G         W    EWLDN++ KSV+++  G+E  +    IHE
Sbjct  239   LGLLPPS---SVPCQHGGADDQVDEKWEVLREWLDNKKEKSVIYIALGTEVTLSQELIHE  295

Query  957   LASALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  +E S +PF+W++  +P ++      ++P  F  R  N+G V  GWAPQ  IL H +
Sbjct  296   LAYGIEKSGLPFIWVVNNRPLVEGMLGADIIPPGFETRVDNRGLVWRGWAPQLKILGHSS  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             IGG L H GW ++IE+LGFG  LIL     +DQGL A+LL  K +G E+PR E DGSF+ 
Sbjct  356   IGGFLTHCGWSSVIEALGFGRVLILFSGANSDQGLVARLLHGKRVGLEIPRDEQDGSFTS  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             D VA   R VM  +EGE +R  A  M +IFGN  L++  +D+F  + ++
Sbjct  416   DSVAELTRRVMVDKEGESLRSNAWAMKDIFGNKELNNKCLDEFTRFLET  464



>ref|XP_002270260.1| PREDICTED: UDP-glycosyltransferase 91A1 [Vitis vinifera]
Length=479

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/460 (43%), Positives = 267/460 (58%), Gaps = 11/460 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGHM+P LE AK +A +G  VSFVSTP+N+ RLP +P + T  +S  +I L
Sbjct  16    HIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFISFVKIPL  75

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P VP LPEN EAT DL +  +VQFLK AY+ +       +    P+ +L DF  +W+  I
Sbjct  76    PHVPNLPENAEATTDLPEN-KVQFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAYWLVPI  134

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHRPDY  614
             A + G+A  FLS++TA+ L +        SG+  R  PE FTV P W  F S VA R   
Sbjct  135   ATKLGIACGFLSIFTASVLCFFNP-----SGQDHRTEPEDFTVAPKWVPFPSRVAFRYFE  189

Query  615   APTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIG  794
                +  N    DASG S   R  + I GCD + VRSC E E E++ LLE+LY++PV+ +G
Sbjct  190   VVKIFNNAIAGDASGTSDMHRFEACIRGCDLLAVRSCTELEPEWLRLLEQLYQKPVVPVG  249

Query  795   LLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALE  974
              LPP L             +W E   WLD Q   SVV+V FGSE K    ++ E+A  LE
Sbjct  250   QLPPILPNGG---DDDEDETWLEIKCWLDKQAGGSVVYVAFGSEAKPNQTELTEIALGLE  306

Query  975   LSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFH  1154
              S +PF W L+            LP  F  RT  +G V   WAPQ  IL+HP+I G L H
Sbjct  307   QSELPFFWALKLKRGPCDTEVIQLPEGFKERTKGRGVVCTSWAPQLKILSHPSICGFLSH  366

Query  1155  SGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANSIR  1331
             SGW +++E+L    PLILL  +ADQGLNA  L EK++G  +PR  EDGSF+R+ VA S+R
Sbjct  367   SGWTSVVEALQLERPLILLTFLADQGLNASFLREKKMGCLIPRNEEDGSFTREAVAQSLR  426

Query  1332  SVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              V+    G+  R KA +M  +FG+ +  + Y+D  +   +
Sbjct  427   LVVVEEGGKIYRDKAKEMRGVFGDRDRQNQYVDTLVSCLK  466



>ref|XP_009774870.1| PREDICTED: UDP-glycosyltransferase 91C1 [Nicotiana sylvestris]
Length=472

 Score =   357 bits (916),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 281/462 (61%), Gaps = 13/462 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P    +K LA +G +V+F+STPKN++RL  +P+     L++  I L
Sbjct  9     HVVMFPWLAMGHIIPFFHLSKWLAQRGHKVTFISTPKNIERLDKVPSDIAHLLNIISIPL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPP---FEELVRRDLPELILVDFATHWV  428
             P V  LP++ E+++D+  Q + QFLK A+D +  P   F E      P+ I+ D+A+HW+
Sbjct  69    PKVENLPDHAESSMDIPYQ-KAQFLKIAFDLLETPLITFLENSSNPKPDWIVYDYASHWL  127

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P+ A+  GV+  F S++TAAT+A+ G P+ L + + R  PE +T+ P W  F + V +R 
Sbjct  128   PQRARDLGVSCAFFSLFTAATMAFFGPPQVLLNDE-RSIPEDYTIVPNWIPFETDVKYR-  185

Query  609   DYAPTMMRNTHTP-DASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                  + +N   P D SG S G R    I+G D V+ R+C EFE E+ +L+ +L+++PV+
Sbjct  186   --LHEIKKNFEAPADESGTSDGARFGGSIDGSDVVLFRTCVEFEPEWFNLVSELFQKPVI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +IG+LPP +     +  G+N ++W    +WLD Q   SVV+V  G+E  +   +++ELA 
Sbjct  244   SIGVLPPSIE---DLGRGSNDTTWLSIKKWLDMQNQNSVVYVALGTEATLSQKELNELAL  300

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LE   +PF W++R     N     +LP  +  R  N+G +  GW PQ  IL+H +IGG 
Sbjct  301   GLEKCGLPFFWVIRNQPRMNQEESQMLPNGYEERVKNRGVIYRGWVPQTKILSHSSIGGF  360

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW ++IE+L FG  LI+ P++ DQGLN +LL  K +G E+PR E DG F+ + VA 
Sbjct  361   LTHCGWNSVIEALCFGWVLIMFPVMNDQGLNTRLLQGKGVGVEIPRNENDGLFTSESVAE  420

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             +++  + S EGE +R  A QM  +FG+ N + + ID  I Y 
Sbjct  421   TVKFAVVSEEGETLRANARQMRGLFGDSNRNRSLIDDCIGYL  462



>ref|XP_002533518.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF28862.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/469 (39%), Positives = 277/469 (59%), Gaps = 10/469 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLAFGHM+P LE AK +A KG ++SF+STP+N+ RLP +P      ++  +
Sbjct  14    DELHIAMFPWLAFGHMIPFLELAKLIAQKGHKISFISTPRNIDRLPKLPPHLAPFINFVK  73

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP V  LP + EAT DL  ++ V  LK AYD +  P    ++  LP+ I+ DF ++WV
Sbjct  74    IPLPYVENLPRSAEATADLPAEDVVH-LKKAYDCLQEPLSNFLQSSLPDWIVFDFVSYWV  132

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P+IA ++ + +V+ S++ +A L YL S EE      R   E + V P W  F S VA+R 
Sbjct  133   PDIACKFNIPSVYFSIFISACLCYLSSGEE----DYRRVIEDYIVAPKWVPFPSKVAYRL  188

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  +     T D S +   +R    ++ CD +  R+C   E E++ L E+L+++PV  
Sbjct  189   FEVRKIFEAGITGDESNIYDIKRFQETMKNCDLIAARTCFGLEPEWLQLTEQLHQKPVFP  248

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G+LP   + ++         +W    +WLD Q  +SVV++ FGSE      ++ E+A  
Sbjct  249   VGVLPRETDQDSE---EDQEETWKPIKKWLDRQEKRSVVYIAFGSEALPSQEEVIEIAHG  305

Query  969   LELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LELS +PF W+LRK  G+        LP  F +R  ++G V   WAPQ  IL H +IG  
Sbjct  306   LELSGLPFFWVLRKSCGLSEEEEVVDLPNGFEDRVKDRGMVFTNWAPQLRILGHESIGAF  365

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVAN  1322
             L HSG  +++E+L  G PL+LLP  +DQGLNAKLL EK+IGY +PR  EDGSF+R+ VA 
Sbjct  366   LTHSGICSVVEALQHGRPLVLLPFNSDQGLNAKLLEEKKIGYLMPRNEEDGSFTRNSVAE  425

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
             S+R V+   EG+  R KA +M  +F + +    Y+D F++Y +++ L +
Sbjct  426   SLRLVIVEEEGKIYRDKAEEMRALFTDKDRQSRYVDAFLDYLKTQRLRE  474



>ref|XP_009623232.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=466

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/465 (41%), Positives = 269/465 (58%), Gaps = 11/465 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ HV++FPWLAFGH++P  E AK++A KG +VS++ST +N+ RLP +       +   
Sbjct  4     TKKLHVVLFPWLAFGHLIPFFELAKQIARKGHKVSYISTSRNIDRLPKLSQKLNYSIHFV  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              ++LP   GLPEN EAT D+   ++VQ+LK A+D +     + +   +P+ I+ DF  +W
Sbjct  64    NLSLPLTKGLPENAEATKDV-PLDKVQYLKKAFDGLESELTQFLVDSVPDWIIYDFTPYW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAH  602
             +P IA + G++  F S + A +  + G  +++  G + R  PE FTVPP W  F S +A 
Sbjct  123   LPPIAGKLGISCAFFSTFNAWSSVFFGPAKDIIDGNVQRTKPEDFTVPPKWIPFPSNIAF  182

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R  Y           + SGVS   R  + +  CD  +VRSC + E E++DLL +L+++PV
Sbjct  183   RL-YEINRFFGHGQENISGVSDWHRFRASVSDCDVFLVRSCNKLEREWLDLLPQLHQKPV  241

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP +        G    +W     WL  QR KSVV+V  G+E      ++ ELA
Sbjct  242   VPVGLLPPSVQDTE----GDKRDAWGFINNWLAMQREKSVVYVALGTEATPSQEELTELA  297

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W LRK    +      LP  F  RT N+G V   WAPQ  IL H ++G 
Sbjct  298   HGLELSGLPFFWALRK---QHDFLLLKLPEGFEERTKNRGIVWTSWAPQLRILEHDSVGV  354

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GWG+IIE L FG PL++LP + DQ LNA+ L EK +G E+ R E DGS +R+ VA
Sbjct  355   FLTHCGWGSIIEGLKFGKPLVMLPFLGDQALNARGLEEKMVGLEISRNEKDGSLTRNSVA  414

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S++ VM   +G+    KA +M  IFGN +L D YID FIEY   
Sbjct  415   ESLKLVMNDEKGKIYWEKANEMKKIFGNRDLSDIYIDDFIEYLHK  459



>ref|XP_009587012.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=476

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 194/474 (41%), Positives = 290/474 (61%), Gaps = 13/474 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  +  HV++ PWLAFGH+ P  + +  LA +   VSF+STP+N++RLP +P +    ++
Sbjct  1     MKKDSIHVVMVPWLAFGHLQPFFQLSVALAKEKVHVSFLSTPRNIKRLPKLPPNLAPLVN  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             L E  LPSV G  LP + EA+VD+   +Q+++L  A+D +  P +  +       ++ DF
Sbjct  61    LVEFPLPSVDGSPLPADAEASVDI-SADQMEYLYQAFDLLQEPVKNFIADKKTHWVIADF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPE------ELRSGKLRPSPEHFTVPPGW  575
                WV +IA+   +  +  SV+TA++  + G P+      ++++G  +P  E    PP W
Sbjct  120   VPDWVADIARELNIPLLKFSVFTASSRVFFGPPKPRTQPGQVKNGS-KPLHELLVSPPPW  178

Query  576   FNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDL  755
              +F S+VA R   A  ++      + S  +     + V   C  V +R+C EFEG+Y+D 
Sbjct  179   VDFPSMVAFRKYEALDLISILRAENESRETLLGHAAVVEGSCRAVAIRTCMEFEGDYLDT  238

Query  756   LEKLYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKM  935
               K+  +PV+ IGLLPP+  L    +      +W +  +WLD Q+P+SVVFVGFGSE K+
Sbjct  239   YNKVAGKPVIPIGLLPPK-ELPANERTLACHPNWQKISKWLDEQKPRSVVFVGFGSECKL  297

Query  936   PIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
               +Q++E+A+ ++LS +PFLWIL+KP        AL P+ F   T  +G V +GWAPQ+ 
Sbjct  298   TKNQVYEIANGVQLSGLPFLWILQKPSWALNDVDAL-PSGFGAATEGRGLVHIGWAPQKE  356

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-RED  1292
             ILAHP+IGG LFH GWG+ IE+L  GH L++LP V DQGLNA+LLVEK +  EV R  ED
Sbjct  357   ILAHPSIGGSLFHGGWGSAIETLQHGHVLVVLPFVFDQGLNARLLVEKGVAIEVRRNEED  416

Query  1293  GSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             GSFS + +A S+R  + S EGE +R +A + A IFG+  LHD+Y+  F+EY +S
Sbjct  417   GSFSGNDIATSLREAIVSEEGEELRARARKAAAIFGDQKLHDSYVKNFVEYMRS  470



>ref|XP_009623239.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 272/462 (59%), Gaps = 35/462 (8%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++FPWLAFGH++P LE +K +A KG ++SF+STP+N+ RLP +P  F+  ++  +I
Sbjct  11    KLHVVMFPWLAFGHIVPFLELSKFIAQKGHKISFISTPRNIDRLPKLPLEFSTSITFIKI  70

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
             +LP V GLPEN EAT+D+   E++ +LK A D M       + ++ P+ I+ DFA +W+ 
Sbjct  71    SLPKVDGLPENAEATMDI-TTEEIIYLKKAMDGMEKEVTNFLEKNSPDWIIQDFAQYWLA  129

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
              I              +A T AY G    L S K+               F +  A+R  
Sbjct  130   PI--------------SAKTTAYGGGF--LSSTKMD-------------TFETKAAYRRH  160

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
              A  ++ ++   + SGVS   R    + G D  I R C EFEG+++ LLE L+  P++  
Sbjct  161   EARWIVGSSQK-NVSGVSDLYRNGVTMIGADATIFRHCHEFEGQWLKLLEDLHNIPIIPS  219

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GL+PP +  N   +   N  SW    EWLD +   SVV+V  GSE  +  ++I+ELA  L
Sbjct  220   GLMPPMVENNNDEK---NYQSWISIKEWLDEKPKGSVVYVALGSEVTIGRNEINELALGL  276

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS  PF W+LRKP       P  LP  F  R   +G V   WAPQ NIL+H ++GG L 
Sbjct  277   ELSESPFFWVLRKPSGSGITDPIELPEGFEERIKGRGIVWKSWAPQLNILSHDSVGGFLT  336

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANSI  1328
             H GW +IIE L FGHPLI+LP + DQGLNA++L +K +G E+PR  EDGS++ D VANS+
Sbjct  337   HCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEIPRNEEDGSYTSDSVANSV  396

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
               VM   EG+ IR KA +M +IFGN NLHD YI+  IE+ ++
Sbjct  397   NLVMVENEGKIIREKAKEMISIFGNKNLHDKYIENLIEFLEN  438



>ref|XP_008242383.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Prunus mume]
Length=469

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/469 (41%), Positives = 282/469 (60%), Gaps = 18/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++P LE +K LA KG RVSF+STPKN+QRLP   +S +  ++  E
Sbjct  7     QKLHIAMFPWLAYGHIMPFLEVSKFLAQKGHRVSFISTPKNIQRLP--KSSLSPLITFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP++ GLP++ E+T +L    +V +LK AYD + PP    ++      ++ DF  HW+
Sbjct  65    LPLPAIEGLPQSTESTSELPIH-KVPYLKKAYDLLQPPLAHFLQHSDVNWVIHDFICHWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + G+ +V+ ++  A +LA+ G P ELR G+ R  PE FTV P W +F S VA + 
Sbjct  124   PRVATQLGINSVYFNISNATSLAFFGPPSELRGGQ-RQRPEEFTVVPKWVDFPSNVAFK-  181

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  M+ +    D   VS  QRL+  I+ CD V +RS  EFE + + LL KLY +PV+ 
Sbjct  182   --LHEMVSHWDCMDDE-VSDFQRLADAIQYCDLVTMRSSHEFESDSVSLLRKLYGKPVVP  238

Query  789   IGLLPPRLNLNTAIQPGTN----SSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             +GLL P    +   Q G         W    EWLDN++ KSV+++  G+E  +    +HE
Sbjct  239   LGLLSPS---SVPCQHGGAEDQVDEKWEVLREWLDNKKEKSVIYIALGTEVTLSQELMHE  295

Query  957   LASALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  +E S +PF+W++  +P ++      ++P  F  R  N+G V  GWAPQ  +L HP+
Sbjct  296   LAHGIEKSGLPFIWVINNRPLVEGMLGADIIPPGFETRVDNRGLVWRGWAPQLKMLGHPS  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             +GG L H GW ++IE+LGFG  LIL     +DQGL A+LL  K++G E+PR E DGSF+ 
Sbjct  356   VGGFLTHCGWSSVIEALGFGRVLILFSGANSDQGLIARLLHGKQVGLEIPRDEQDGSFTS  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             D VA   R VM   EGE +R  A  M  IFGN  L++  +D+F  + ++
Sbjct  416   DSVAELTRRVMVDEEGESLRSNAWAMKEIFGNKELNNKCLDEFTRFLET  464



>gb|EYU23564.1| hypothetical protein MIMGU_mgv1a026446mg [Erythranthe guttata]
Length=466

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/469 (43%), Positives = 284/469 (61%), Gaps = 20/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ HV++ PWLAFGHM+P L+ + +LA     VSF+STP+N+QRLP IP +    +    
Sbjct  7     EEVHVVMLPWLAFGHMIPFLDLSIELAKSNIHVSFLSTPRNIQRLPQIPPNLIPFIDFVP  66

Query  249   IALPSVPGL-PENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             + L    GL PE  EAT+D+   +++  LK A D +  P ++ +   LP+ I+VDF  +W
Sbjct  67    LPLEYSGGLLPEYAEATIDI-TVDRMNDLKIASDLLRQPIKDFMAEKLPDWIVVDFFPYW  125

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK----LRPSPEHFTVPPGWFNFHSL  593
             + +IA+   +  +   V+ AA  A+  SPE L SG+     RPSPE FT PP WF+F S 
Sbjct  126   IVDIARDLSIPIISHCVFAAAAAAFFWSPEFL-SGEGRRSARPSPEDFTAPPDWFDFLSE  184

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA     A  M    +  ++SG++ G RL+ +++    V +R+C +FE +Y+ L  KL  
Sbjct  185   VALSKHEAKAMHHVLYDVNSSGIADGDRLTRLLQASAAVSIRTCTDFEPDYLGLYSKLTG  244

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ IGLL                   +  F WLD Q+P+S VFVGFGSE K+    IH
Sbjct  245   KPVIPIGLL-----PPETPPDRPPPRQEAAIFNWLDRQKPRSAVFVGFGSETKLNREHIH  299

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PFLW +RKP  DN      LP  F+ RT+ QG V LGWAPQ+ IL HP+
Sbjct  300   EIAHGLELSGVPFLWAMRKP--DNEA----LPAGFLQRTAEQGVVHLGWAPQREILGHPS  353

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRD  1310
             IGG LFH GWG+IIE+L +GH L+LLP V DQ LN KL+VEK +G EV R  EDGSF+R+
Sbjct  354   IGGSLFHGGWGSIIETLQYGHALVLLPFVFDQPLNTKLMVEKGLGVEVERDGEDGSFTRN  413

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              VA++++  M S      R + A    IFGN +LH  Y+++F+ + + +
Sbjct  414   DVASALKKGMVSDVELRARCRKAGR-EIFGNQDLHRAYVEKFVRFLKGE  461



>ref|XP_008779257.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1, partial 
[Phoenix dactylifera]
Length=423

 Score =   353 bits (907),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 188/421 (45%), Positives = 263/421 (62%), Gaps = 9/421 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLAFGHMLP L+ +K LA +G R+SF++TP+N+QRLP IP      +    + L
Sbjct  8     HIAVFPWLAFGHMLPFLQLSKSLAMRGHRISFLATPRNIQRLPKIPPHLAPLIDFVSMPL  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDFATHWVP  431
             P V GLPEN EAT DL  ++QVQ+LK A+DR+G   E  +      P+ I++DFA HWVP
Sbjct  68    PKVEGLPENAEATPDL-PKDQVQYLKVAFDRLGGALESFLDEASPKPDWIILDFACHWVP  126

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             ++A  +GV   F SV+ A  LA+    E +  G      E  T PP   +F + VA R  
Sbjct  127   KLASMFGVPCAFFSVFAAPFLAFWRPSESISRGG-DNVLEELTAPPKGISFETSVAFRLH  185

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
              A  ++R  +  +ASGV    RL   +EGC  V  RSC E   +++  L++LY +PV+ +
Sbjct  186   EARRVIRG-YVNNASGVCDADRLLLTVEGCKVVAPRSCWELHSDWLCYLQELYGKPVIPV  244

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GLLPP  +   A    T+  S + A  WLD Q P SVV+  FGSE  +    +HELA  L
Sbjct  245   GLLPPATDDGGAGVDATSRES-NNALRWLDKQAPGSVVYAAFGSETVLSTEMLHELAFGL  303

Query  972   ELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             ELS++PFLW++RKP  I + G   +LP  F +RT ++G + +GW  Q  +LAH ++GGCL
Sbjct  304   ELSQVPFLWVIRKPVDIADEGR-EILPEGFEDRTRDRGVIAMGWIDQLEVLAHASVGGCL  362

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANS  1325
              HSGW ++IESL  GH LI+LP + DQG+ A+++ E+ IG EVPR  EDGSF+R+ +A +
Sbjct  363   THSGWSSVIESLQLGHLLIMLPFIVDQGIIARVMEERRIGIEVPRNEEDGSFNREELAKA  422

Query  1326  I  1328
             I
Sbjct  423   I  423



>gb|AAM12787.1| putative anthocyanidine rhamnosyl-transferase [Capsicum annuum]
Length=470

 Score =   355 bits (910),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 179/465 (38%), Positives = 276/465 (59%), Gaps = 7/465 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ H+ +FPWLAFGHM+P LE +K +A KG  VSF+STP+N+ RLP +P + ++ L   
Sbjct  5     GKKLHIAVFPWLAFGHMIPYLELSKLIARKGHTVSFISTPRNIDRLPKLPPNLSQFLKFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ +P V  LPEN EAT+D+   EQV++LK A D +     + +    P+ I  DF ++W
Sbjct  65    KLPMPHVEKLPENAEATIDV-PFEQVKYLKLAQDGLEESMAKFLEDSAPDFIFFDFTSYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP +A ++ + T + S++ AA L + G    L +  ++R +PE +TVPP W +F + VA 
Sbjct  124   VPSVASKFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKTPEEYTVPPKWVSFETTVAW  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   +   D   ++   R    +E CDF +VRSC EFE E++ +++ ++++PV
Sbjct  184   KLFEVSRIFEASMEGDEENIADITRFYKSVENCDFFLVRSCSEFEPEWLKVIQDIHRKPV  243

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
               +G LP      T     T  ++W E   WLD Q    V++V FGSE K   +++ EL+
Sbjct  244   FPVGQLP----TTTYEDETTKINAWREIKFWLDKQEKGRVIYVAFGSEAKPSQNELTELS  299

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+LR    ++      LP  F  RT  +G V   WAPQ  IL+H +IGG
Sbjct  300   LGLELSGLPFFWVLRTKRGESDDELICLPEGFEERTKGRGIVCTSWAPQLKILSHDSIGG  359

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L HSGW +++E++ F  PL+LL  +ADQG+NA+LL EK++ Y +PR + DGSF+RD VA
Sbjct  360   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSIPRNDRDGSFTRDSVA  419

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+  V+   EGE  R K  ++  +F +    DNY+   + Y Q+
Sbjct  420   ESVSMVLVKEEGEIYRKKVKEVKYLFCDKKRQDNYVKNLLSYLQN  464



>ref|XP_011017699.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=468

 Score =   355 bits (910),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 278/467 (60%), Gaps = 15/467 (3%)
 Frame = +3

Query  63    AAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSL  242
              + + H+ +FPWLAFGHM+P LE AK +A KG ++SF+STP+N  RLP +  S +  ++ 
Sbjct  3     GSSKLHIAMFPWLAFGHMIPYLELAKLVAQKGHKISFISTPRNTDRLPKLHPSISPLITF  62

Query  243   REIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRR-DLPELILVDFAT  419
               ++LP V  LP+  EAT D+   ++VQ+LK A D +  P  + ++  D  + IL DFA 
Sbjct  63    VRLSLPQVENLPKGAEATTDVP-YDKVQYLKQACDDLKEPLSKFLQTCDDLDCILFDFAP  121

Query  420   HWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +W+P+IA  +G+ +VF S++TAA L+Y+     +     R  PE FTVPP W  F + V 
Sbjct  122   YWLPDIAMSFGIPSVFFSIFTAAMLSYVKPASGIDD---RSKPEDFTVPPKWVPFPTNVV  178

Query  600   HRPDYAPTMMRNTHTPDASGVSSG-QRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
              R      ++R  +   A  V S   R    I+GCD + VRSC EFE E++ LLE+++ +
Sbjct  179   FR---LFEVLRIFYQSLAGNVVSDLYRTQEGIKGCDMIAVRSCMEFEPEWLQLLEEIHGK  235

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+ +G+L       T    G    +W    +WLD Q+  SVV++ FGSE K    ++ E
Sbjct  236   PVIPVGVLA-----TTVYDTGVEDEAWRSIKDWLDKQKQGSVVYIAFGSEAKPSQVELTE  290

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             +A  LELS +PF W+LRK           LP  F  RT  QG V   WAPQ  ILAH ++
Sbjct  291   IALGLELSGLPFFWVLRKHRGSADTELIKLPEGFEERTRAQGLVWTSWAPQLKILAHDSV  350

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG L HSGW +++E+L     LILL  +ADQG+NA++L +K++GY +PR E +G F+RD 
Sbjct  351   GGFLTHSGWSSVVEALQHARSLILLTFLADQGINARVLEDKKMGYSIPRNEKNGYFTRDS  410

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             VA S+R VM   EG+  R K  +M  +F + +  D Y+D+ +++ +S
Sbjct  411   VAESLRLVMEKEEGKIYRDKVKEMKPLFADKDRQDKYVDKLVDHLRS  457



>ref|XP_008338469.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Malus 
domestica]
Length=474

 Score =   355 bits (910),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 269/464 (58%), Gaps = 10/464 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLAFGH++P LE AK +A +G +VSF+STP+N+QRLP IP + T  + L +I L
Sbjct  15    HIALFPWLAFGHIIPALEVAKHIAQRGHKVSFISTPRNIQRLPKIPPNLTPLIDLVQIXL  74

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT+D+   + + +LK A+D +       ++   P+ I+ DFA +W+P I
Sbjct  75    PRVENLPENAEATMDV-PYDLIPYLKLAHDGLEQGITSFLQTHTPDWIIYDFAPYWLPPI  133

Query  438   AKRYGVATVFLSVYTAATLAYLGS--PEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             A   G++      +   T    G   P+ L     R  PEHFTVPP W  F S +  R  
Sbjct  134   ASNLGISRAMFGGFNTYTACAFGPTLPDVLSRYSPRTLPEHFTVPPEWVPFPSKLFFRLF  193

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
              A  +  +    +ASG+S   R+ S +EG    + RSC+E EG+++DL+ +LY +P + +
Sbjct  194   EAKKLF-DALEHNASGISDWFRMKSXVEGSQVCLFRSCREIEGDWLDLVPELYHKPAIPV  252

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GLLPP +             SWS   EWLD Q   +VV+V  GSE      +  ELA  L
Sbjct  253   GLLPPSVQDTE----DKEDXSWSIVCEWLDKQERATVVYVALGSEINPTQEEFTELALGL  308

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS +PF W LR P     G    LP +F +R   +G V   WAPQ+ ILAH A+GG   
Sbjct  309   ELSGLPFFWALRTPNGSAAGNSVKLPDEFEDRNKGRGLVWRTWAPQRQILAHKAVGGFWT  368

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRDMVANSI  1328
             H GW ++IE +  G PLI+ P + DQGLNA+L  ++++G EVPR  EDGSF++  VA S+
Sbjct  369   HCGWSSLIEGIHRGIPLIMFPFLYDQGLNARLW-DRKVGIEVPRNDEDGSFTKKEVAESL  427

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
               VM   EG+  R  A + + +  + +LHD Y+D+ +EYF+  +
Sbjct  428   NLVMVDEEGKAYRDGAKEYSAVIADKDLHDRYMDKCVEYFEKNV  471



>ref|XP_008236334.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Prunus 
mume]
Length=473

 Score =   354 bits (909),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 185/467 (40%), Positives = 277/467 (59%), Gaps = 12/467 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLAFGH++P  E AK +A +G +VSF+STP+N+QRLP IP   T  ++L +
Sbjct  14    KKLQIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTPLINLVQ  73

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             I LP V  LPEN EAT+D+     + +LK A+D +       +R   P+ I+ DFA +W+
Sbjct  74    IPLPCVENLPENAEATMDVPYH-IIPYLKIAHDGLEQGISNFLRTHKPDWIIHDFAPYWL  132

Query  429   PEIAKRYGVATVFLSVYTAATLAYLG--SPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             P IA   G++    SV+ A++L + G  SP+ L    +R  PE FTVP  W  F S +  
Sbjct  133   PPIASSLGISRAHFSVFNASSLCFYGPTSPQGLDRYGVRTLPEQFTVPAEWIPFPSNMVL  192

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +   A  +  ++   +AS VS   R+ S I+GC    +RSC+E EG ++DLL++L ++PV
Sbjct  193   KSFEAKNLF-DSMKQNASSVSDWFRVKSTIQGCQVYFIRSCRETEGAWLDLLQELQQKPV  251

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             +  GL+PP       +Q   +   WS   +WLD ++  +VV++  GSE  +      ELA
Sbjct  252   VPTGLMPP------VVQAREDKEDWSTIAQWLDKKQKATVVYIALGSELNLSQQDFTELA  305

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+LRKP     G    LP  F  RT  +G V   WAPQ  ILAH +IGG
Sbjct  306   LGLELSGLPFFWVLRKPSWSGNGGSGKLPDGFEERTKGRGLVWTTWAPQTQILAHDSIGG  365

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVA  1319
              L H G  +++E L +G PL++LP + DQGL A+   +K++G EVPR  EDGSFSR  +A
Sbjct  366   FLTHCGASSLVEGLQYGRPLLMLPCLYDQGLIARFW-DKKVGIEVPRNEEDGSFSRKSLA  424

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
              S+  ++    G+  R  A + + +F + +LHD Y+D+ +EY ++ +
Sbjct  425   ESLNLLVVDEAGKAYRDGAEEYSVLFQDKDLHDRYMDKCVEYMENHV  471



>gb|KDP29785.1| hypothetical protein JCGZ_18720 [Jatropha curcas]
Length=465

 Score =   354 bits (908),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 188/466 (40%), Positives = 279/466 (60%), Gaps = 14/466 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ HV +FPWLAFGH++P L+ AK +A KG ++SF+STP+N+QRLP IP + + ++   
Sbjct  4     TKKLHVALFPWLAFGHIIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSKIHFI  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              + LP V  LP + EAT+D+    +  +LK AYD +  P  + ++   P+ I+ DFA HW
Sbjct  64    SLPLPQVDNLPPHAEATMDIPTN-KTPYLKIAYDGLKDPLFQFLKISAPDWIIYDFAAHW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEE--LRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +P I    G+++ +LS+++A T+ +L S     +     R  PE FTVPP W  F S VA
Sbjct  123   LPPITSDLGISSAYLSIFSAWTITFLASSSSALINGDDERTRPEGFTVPPKWVPFPSKVA  182

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R   A     +    D SG+S   RL +V+   D + VRSC E E +++ L E+L+ +P
Sbjct  183   YRIHEAKRAFEHFEVND-SGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKP  241

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL IGLLPP  +L+     G +  +W +   WLD Q   SV+++ FGSE ++    ++EL
Sbjct  242   VLPIGLLPPS-DLDVT---GGDDETWLKICGWLDKQNKGSVIYIAFGSESEVNQKDLNEL  297

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PF W LRK G         LP  F  R   +G V   W PQ  IL H ++G
Sbjct  298   ALGLELSGLPFFWTLRKQGNSFE-----LPDGFEERVKGRGIVWTSWVPQLRILGHESVG  352

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRDMV  1316
             G L H G+ +IIE+L FG  LIL P+   QGLNA++L EK++G EV R  +DGSF+++ +
Sbjct  353   GFLTHCGFSSIIEALNFGLALILFPVSIAQGLNARVLEEKKLGVEVKRNAQDGSFTKESL  412

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S+  VM + +G+  R  A +M  +  N ++H+  IDQFIE+ Q+
Sbjct  413   AESLMLVMDNEKGKLYRESANEMRKLITNRDVHNGCIDQFIEFLQT  458



>ref|XP_006339794.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=479

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 287/476 (60%), Gaps = 25/476 (5%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAA-KGFRVSFVSTPKNLQRLPPIPASFTERLSL  242
             +E  HV++ PW AFGH++P    +  LA   G  VSF+STPKN+QRLP +  + T  + L
Sbjct  4     SENVHVVMLPWSAFGHLIPFSNLSLALAELGGIHVSFISTPKNIQRLPKVSPNLTHLVKL  63

Query  243   REIALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
              E  LPS+     LPE+ EA+VDL   E++Q+LK AYD +  P ++ +    P+ I+VDF
Sbjct  64    VEFPLPSLDDNTLLPEDAEASVDLPL-EKIQYLKVAYDLLREPIKKFIADQKPDWIIVDF  122

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPG-WFNFHS  590
               +W+ EIA+ Y +  +  SV++AA+ A+L +     SG   P PE  T+P     +F S
Sbjct  123   FQNWIVEIAEAYNIPIIHFSVFSAASRAFLIAARA--SG---PMPESLTLPVSEKLHFPS  177

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              +A+R   A  +   +   DASG S  QR + V+  C  V +RSC EFEG+Y+D + KL 
Sbjct  178   TLAYRSYEAAELFSLSFQEDASGESYAQRSAKVLRACRAVAIRSCNEFEGDYLDAMHKLI  237

Query  771   KRPVLAIGLLPP----RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMP  938
              +P++ IGLL P     LN+N          SW    +WL+ Q  +SV+FVG GSE K  
Sbjct  238   SKPIIPIGLLSPPSCVDLNIN-------RDQSWQRILKWLNQQNFQSVLFVGLGSECKPS  290

Query  939   IHQIHELASALELSRMPFLWILRKPGIDNPGYPAL--LPTDFVNRTSNQGRVILGWAPQQ  1112
               Q++E+A  +ELS++PFLWIL+KP   +     +  LP  F  R + +G V +GWA Q+
Sbjct  291   KDQVYEIAHGIELSKLPFLWILQKPKWSSTTSNDVDPLPEGFRARNAEKGVVHIGWARQK  350

Query  1113  NILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-RE  1289
              ILAH +IGG L   G G+I+E+L  GH L++LP V DQGLNA+L+VEK  G EV R  E
Sbjct  351   EILAHSSIGGALVQGGLGSIVETLQHGHVLVVLPFVHDQGLNARLIVEKGFGIEVERNEE  410

Query  1290  DGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             +GSF+R  +A ++   M S EG+ +R +A +  ++FG+  L  +YI  F+EY ++K
Sbjct  411   NGSFTRKDIAKALMYAMVSEEGKEMRERARKAIDVFGDIQLQTSYIVSFVEYLKNK  466



>ref|XP_010440988.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Camelina sativa]
Length=497

 Score =   354 bits (908),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/464 (41%), Positives = 264/464 (57%), Gaps = 20/464 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  H+ +FPWLA GH+LP L  +K LA KG ++SF+STP+NL+RLP +P++ +  ++   
Sbjct  43    EVMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITFVS  102

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GL    E+++D+   +Q Q LK A+D +  P +E + R  P+ I+ D+A+HW+
Sbjct  103   FPLPLISGLSPTSESSMDVPYNKQ-QSLKAAFDLLQAPLKEFLLRSSPDWIIYDYASHWL  161

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL +LG P      + R +PE FTV P W  F S VA R 
Sbjct  162   PSIAAELGISKAFFSLFNAATLCFLG-PSSSLIDEFRTTPEDFTVVPPWVPFKSNVAFRY  220

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I   D V VRSC EFE E+  LL+ LY++PV  
Sbjct  221   HEVTRYVEKTDE-DVTGVSDSVRFGYSIGESDAVFVRSCPEFESEWFGLLKDLYQKPVFP  279

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
              G LPP +          + ++W    EWLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  280   TGFLPPVIE--------DDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLCREEVTELALG  331

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LE S  PF W+LR           L P  F  R   +G V +GW PQ  IL H ++GG L
Sbjct  332   LEKSETPFFWVLRN--------EPLTPDGFEERVKGRGMVHVGWVPQVKILRHESVGGFL  383

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H GW +++E LGFG   I LP++ +QGLN +LL  K IG EV R E DGSF    VA+S
Sbjct  384   THCGWNSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADS  443

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             +R VM   EGE IR KA  M  +FGN + +  ++D+ + +  SK
Sbjct  444   VRLVMVDEEGESIRDKAKLMKGLFGNMDENIRHVDEIVSFMTSK  487



>ref|XP_010047531.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=459

 Score =   351 bits (901),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 281/465 (60%), Gaps = 21/465 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV +FPWLA+GH++P LE A  LA KG RVSF+STPKNLQ+L   PA+    ++L E
Sbjct  6     KKLHVAMFPWLAYGHLMPFLEVATFLARKGHRVSFISTPKNLQKL---PANLPPSITLVE  62

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP++ E+T +L     V +LK AYD + P   E + +   + ++ DF + W+
Sbjct  63    LPLPRVHGLPDSAESTSEL-LHNMVPYLKKAYDMLEPAVAEFLAKSDVDWVIQDFMSFWL  121

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRP-SPEHFTVPPGWFNFHSLVAHR  605
             P+ A+R GV + F S+++A TL + G P  L  G+ R  + E  TV P W  + + VA R
Sbjct  122   PQKARRLGVKSAFFSIFSATTLVFCGPPSILMDGQARAKAAEDLTVVPQWVTYPTKVAFR  181

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                   +         + +S  +RL  +I+GC+ V  R+C EFE E + LL+KLY R V+
Sbjct  182   --LHEVINEEDFVDSDANMSVFERLGRLIQGCEIVATRTCSEFEAEPLSLLKKLYGRAVV  239

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLLPP+   N +   G     WSE  +WLD++  KSV ++  G+E  +    +HELA 
Sbjct  240   PMGLLPPQ---NKSRHEGVG--RWSELKQWLDDREEKSVFYIALGTEVALSQEFMHELAC  294

Query  966   ALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++ RK G      P  +P+ F ++ S +G V +GWAPQ +ILAHP++GG
Sbjct  295   GIEKSSLPFVWVVGRKAG------PGSIPSSFESQVSGRGFVWVGWAPQLDILAHPSVGG  348

Query  1143  CLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW ++IE+LG G  LIL     +DQGL A+L+ E+ +G EVPR + DGSF+ D V
Sbjct  349   LLTHCGWSSVIEALGQGRALILFSGGSSDQGLVARLMDERRVGSEVPRNDRDGSFTGDSV  408

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             A +IR VM   EGE +R  A  M  IFGN  L   Y+++F +  +
Sbjct  409   AETIRRVMVEPEGEEVRANAWAMREIFGNVELQHKYLEEFAQVLE  453



>ref|XP_009623238.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=468

 Score =   352 bits (902),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/465 (37%), Positives = 271/465 (58%), Gaps = 7/465 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +++ H+ +FPWLAFGHM+P LE +K +A KG ++SF+STP+N+ RLP +P +    L+  
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLVPFLNFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +  +P +  LP+N EAT+D+   EQV++LK A D +     + +    P+ IL DF +HW
Sbjct  65    KFPMPKIEKLPKNAEATIDV-PYEQVKYLKLAQDELQQSMAKFLEDSAPDFILFDFTSHW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP +AK + + T + S++ AA L + G    L +  ++R +PE + VPP W  F + V  
Sbjct  124   VPSVAKNFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKTPEEYCVPPKWVPFETTVCW  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   +   D   V    RL   +E CD ++VRSC EFE E++ +LE ++++PV
Sbjct  184   KLFEVLRIFDASMEGDEENVPDIFRLYKTLEDCDILVVRSCSEFEPEWLKVLENIHQKPV  243

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
               +G LP      +     T   +W     WLD Q    VV+V FGSE K   +++ E++
Sbjct  244   FPVGQLP----TTSYEDDSTTMDAWRSIKLWLDMQEKGKVVYVAFGSEAKPSQNELTEIS  299

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LE S +PF W+LR    ++      LP  F  RT  +G V   WAPQ  IL++ ++GG
Sbjct  300   LGLEKSGLPFFWVLRTKRGESDDELIRLPEGFEERTKERGIVCTSWAPQLKILSNDSVGG  359

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L HSGW +++E++ F  PL+LL  +ADQG+NA+LL EK++ Y VPR + DGSF+R+ VA
Sbjct  360   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSVPRDDRDGSFTRESVA  419

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+  V+   EG+  R K  ++ N+F +    D Y++  + Y Q 
Sbjct  420   ESLSLVLVEEEGKIYREKVKEVKNLFCDKRRQDGYVENLLSYLQD  464



>ref|XP_009768273.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=468

 Score =   352 bits (902),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/466 (37%), Positives = 277/466 (59%), Gaps = 9/466 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +++ H+ +FPWLAFGHM+P LE +K +A KG +VSF+STP+N+ RLP +P +    L+  
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKVSFISTPRNIDRLPKLPPNLVPFLNFF  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +  +P +  LP+N EAT+D+   EQV++LK A D +     + +    P+ IL DF ++W
Sbjct  65    KFPVPKIEKLPKNAEATIDV-PYEQVKYLKLAQDGLQESMAKFLEDSAPDFILFDFTSYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP +AK++ + T + S++ AA L ++G    L +  ++R +PE +TVPP W    + V  
Sbjct  124   VPSVAKKFDIPTAYFSIFIAAFLGFVGPVPGLNNDYEIRTTPEEYTVPPAWVPIETTVCW  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   +   D   V    R+   +E CD + VRSC EFE E++ +LE ++++PV
Sbjct  184   KLFEVLRIFDASMEGDEENVPDIFRMYKTLEDCDILFVRSCSEFEPEWLKVLEDIHRKPV  243

Query  783   LAIGLLPPRLNLNTAIQPGTNS-SSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
               +G LP      T+ +  +++  +W     WLD Q    VV+V FGSE K   +++ E+
Sbjct  244   FPVGQLP-----TTSYEDDSSTIDAWKSIKLWLDMQEKGKVVYVAFGSEAKPSQNELTEI  298

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             +  LE S +PF W+LR    ++      LP  F  RT  +G V   WAPQ  IL+  ++G
Sbjct  299   SLGLEKSGLPFFWVLRTKRGESDDELIRLPEGFEERTKGRGIVCTSWAPQLKILSDDSVG  358

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L HSGW +++E++ F  PL+LL  +ADQG+NA+LL EK++ Y VPR + DGSF+RD V
Sbjct  359   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLAEKKMAYSVPRDDRDGSFTRDSV  418

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S+  V+   +G+  R K  +   +F +    D+Y++ F+ YFQ+
Sbjct  419   AESLSLVLVEEKGKIYREKVKEAKTLFCDKGRQDSYVENFLSYFQN  464



>ref|XP_010023432.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   352 bits (902),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 183/464 (39%), Positives = 267/464 (58%), Gaps = 12/464 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  H+++ PWLAFGHM+P L+ AK +A KG R+SF+S P+N+ R+P  P+     +S  +
Sbjct  6     DSLHIVMLPWLAFGHMMPYLKLAKLMAGKGHRISFLSAPRNIDRIPKPPSDLASLISFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V  LPE  EAT DL    ++Q+LK +YD +  P  + +    P+ I+ DFA +W 
Sbjct  66    LPLPAVEHLPEGAEATSDLPYN-KIQYLKKSYDMLQEPVAQFLESSDPDWIMYDFAPYWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
               IA R G+ +VF S+ T A L +LG    L+ G  R +PE FT  P W  F + VA R 
Sbjct  125   GSIASRLGIRSVFFSIMTGACLGFLGPVWALKGGDYRKTPEDFTKRPNWVPFPTRVAFR-  183

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    + +    +ASGV+   R  +  E CD + +RS  E E E++ LL  ++ +P+  
Sbjct  184   HFEIKKIFDAVIGNASGVTDLYRFGAGQESCDIIALRSSYEVEPEWLSLLRDIHTKPIFP  243

Query  789   IGLLPPRLNLNTAIQPGTNS--SSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             +GLLPPR        P T     SW    EWLD+Q+  +VV+V FGSE K    ++ E+A
Sbjct  244   VGLLPPR-------DPETRGEMDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIA  296

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+L+     +     +LP  F  R    G V   W PQ  ILAH ++GG
Sbjct  297   LGLELSGLPFFWVLKTRLGSSDTESVVLPNGFEERVKGHGVVWDSWVPQLKILAHDSVGG  356

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H+GW +++E+L F   LIL   +ADQGLNA+ L E++IGY +PR E DGS +R  VA
Sbjct  357   FLTHAGWSSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVA  416

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              S+R VM   +G   R KA +M  IFG+  + + Y++  + Y +
Sbjct  417   ESLRLVMVEEKGRVYREKAKEMRPIFGDKEIQERYVNNLLNYLK  460



>ref|XP_010646446.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Vitis vinifera]
Length=462

 Score =   351 bits (901),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 266/464 (57%), Gaps = 15/464 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+++FPWLAFGH+LP L+ +K +A KG R+SF+STP+N+ RLP +P      ++L +
Sbjct  5     EKLHIVMFPWLAFGHILPYLQLSKLIAQKGHRISFISTPRNIDRLPKLPPILQPLINLIK  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V  LPEN EAT DL   E+  +LK A+D +  P    +    P+ ++ DFA HW+
Sbjct  65    LPLPKVDNLPENAEATTDL-PYEKTPYLKKAFDGLQEPLTHFLINSHPDWVVHDFAPHWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPE-ELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             P +   +GV+  F S+Y A+TL + GS    L SG  R     F VPP W  F S +   
Sbjct  124   PPVLDEHGVSRSFFSIYGASTLCFAGSTSIMLGSGDPRKELHQFAVPPPWVPFPSNLG-L  182

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             P +    +     P+ SGVS   R+ SVI  CD V VRSC E E E++DLL +LY +PVL
Sbjct  183   PPFQMKRILGYDQPNLSGVSDSYRMGSVISACDVVAVRSCAELESEWLDLLRELYHKPVL  242

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP   ++          SW    EWLD Q   SVV+V  GSE      ++ ELA 
Sbjct  243   PIGLLPPLAPVS------GEDDSWIPILEWLDKQEKASVVYVALGSEATPREDELTELAL  296

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W LRK           LP  F +RT ++G V   WAPQ  IL H ++GG 
Sbjct  297   GLELSGLPFFWALRKRHDS-----VELPDGFEDRTKDRGVVWRTWAPQLRILGHESVGGF  351

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVAN  1322
             + H G  ++ E L FG  LI+ P+  DQG+ AK   E ++G E+PR  E+G FS   VA 
Sbjct  352   VTHCGLSSVXEGLYFGRALIMFPLWGDQGIIAKAFQEMKVGIEIPRDEEEGWFSSKSVAQ  411

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             ++  VM   EG   R KA +++ +FG+ +L   YI+ F+EY Q+
Sbjct  412   TLSLVMVEEEGRIYREKAKELSKLFGDKDLQQRYINDFVEYLQN  455



>gb|KDP29783.1| hypothetical protein JCGZ_18718 [Jatropha curcas]
Length=465

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 275/466 (59%), Gaps = 14/466 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ HV +FPWLAFGH++P L+ AK +A KG ++SF+STP+N+QRLP IP + +  +   
Sbjct  4     TKKLHVALFPWLAFGHIIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSNIHFI  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              + LP V  LP + EAT+D+    ++ +LK AYD +  P  + ++   P+ I+ DFA +W
Sbjct  64    SLPLPQVDNLPPDAEATMDIPTN-KIPYLKIAYDGLKEPLFQFLKTSAPDWIIYDFAAYW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEE--LRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +P I    G+++ F S+++A T+A+L S     +     R  PE FTVPP W  F S VA
Sbjct  123   LPPITSDLGISSAFFSIFSAWTMAFLASSSSAMINGDDERTRPEDFTVPPKWVPFPSKVA  182

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R   A     +    D SG+S   RL +V+   D + VRSC E E +++ L E+L+ +P
Sbjct  183   YRIHEAKRAFEHFEVND-SGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKP  241

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL IGLLPP  +L+     G +  +W +   WLD Q   SVV++ FGSE ++    +++L
Sbjct  242   VLPIGLLPPS-DLDVT---GGDDETWLKICGWLDKQNKGSVVYIAFGSELEVSQKDLNDL  297

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PF W LRK G         LP  F  R   +G V   W PQ  IL H ++G
Sbjct  298   ALGLELSGLPFFWTLRKQGNSFE-----LPDGFEERVKGRGIVWTSWVPQLRILGHESVG  352

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L H G  +++E+L FG  LIL P+  DQGLNA++  EK++G EV R E DGSF+++ +
Sbjct  353   GFLTHCGLSSVVEALNFGLALILFPVSIDQGLNARVFEEKKLGVEVKRNEQDGSFTKESL  412

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S+   M + +G+  R    +M  +  N  +H+  IDQF+E+ Q+
Sbjct  413   AESLMLAMDNEKGKLYRESTNEMRKLITNREVHNGCIDQFVEFLQT  458



>ref|XP_004233155.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Solanum lycopersicum]
Length=479

 Score =   351 bits (901),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/474 (37%), Positives = 286/474 (60%), Gaps = 13/474 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLR  245
             ++ HV++FPWLA GH++P    +K LA +G RV+F+STP+N++R+   +P+     L + 
Sbjct  6     DKLHVVMFPWLAMGHIIPFFHLSKCLARRGHRVTFISTPRNIERVVNKVPSDLAHLLHIV  65

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD---LPELILVDFA  416
                LP V  LP++ E+++D+  Q + QFLK A+D +  P    +       P+ I+ D+A
Sbjct  66    WFQLPKVENLPDDAESSMDIPYQ-KAQFLKIAFDSLEIPLTNYLESSSNPKPDWIVYDYA  124

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             +HW+P+IA + GV+  F S++TAAT+++ G P  L + + R   E +TV P W  F + V
Sbjct  125   SHWLPQIAGKLGVSRAFFSLFTAATMSFYGPPCALLNDE-RSIAEDYTVVPKWIPFETKV  183

Query  597   AHRPDYAPTMMRNTHTP-DASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
              +R      + +N   P D SG S G R  + I+  D ++ R+C EFE E+  L+ +LY+
Sbjct  184   VYR---LHEIKKNFEAPADESGTSDGARFGASIDASDVILFRNCVEFESEWFSLVSELYQ  240

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +P+++IG+LPP + ++   Q  +N +SWS    WLD     SVV+V  G+E  +   +++
Sbjct  241   KPIISIGVLPPSVVVDQE-QDDSNDASWSGIKSWLDKHNQDSVVYVALGTEATLNQQELN  299

Query  954   ELASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             ELA  LE   +PF+W+LR +P  +       LP  + +R  N+G +  GW PQ  IL+H 
Sbjct  300   ELALGLEKCGLPFVWVLRDQPKHNQQDSCIQLPDGYEDRVKNRGVIYKGWVPQTKILSHS  359

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             ++GG L H GW ++IE+L FG  L++ P++ DQGLN +LL EK +G E+PR E DG F+ 
Sbjct  360   SVGGFLTHCGWNSVIEALCFGRVLVMFPVLNDQGLNTRLLQEKGVGVEIPRNEKDGFFTS  419

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
             D VA +++  + S EGE +R  A QM+ +FG+   ++  ID  + YF    +++
Sbjct  420   DSVAEAVKFGVVSEEGELLRANARQMSCLFGDRKRNEQLIDDCVGYFMENRISK  473



>gb|AHL38585.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=920

 Score =   363 bits (933),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 274/465 (59%), Gaps = 19/465 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  HV +FPWLA GH+LP L  +K LA KG ++SF+STP+N++RLP + ++    ++   
Sbjct  7     EVMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSITFVS  66

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GLP + E+++D+   +Q Q LK A+D + PP +E +RR  P+ I+ D+A+HW+
Sbjct  67    FPLPPISGLPPSSESSMDVPYNKQ-QSLKAAFDLLQPPLKEFLRRSSPDWIIYDYASHWL  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL ++G    L   ++R +PE FTV P W  F S +  R 
Sbjct  126   PSIAAELGISKAFFSLFNAATLCFMGPSSSLIE-EIRSTPEDFTVVPPWVPFKSNIVFRY  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I+  D V VRSC EFE E+  LL+ LY++PV  
Sbjct  185   HEVTRYVEKTEE-DVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVFP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             IG LPP +  + A+      ++W    +WLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  244   IGFLPPVIEDDDAVD-----TTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALG  298

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE S  PF W+LR +P I         P  F  R   +G V +GW PQ  IL+H ++GG 
Sbjct  299   LEKSETPFFWVLRNEPKI---------PDGFKTRVKGRGMVHVGWVPQVKILSHESVGGF  349

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E LGFG   I  P++ +QGLN +LL  K +G EV R E DGSF  D VA+
Sbjct  350   LTHCGWNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVAD  409

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             SIR VM    GE IR KA  M ++FGN + +  Y+D+ + + +SK
Sbjct  410   SIRLVMIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRSK  454


 Score =   363 bits (933),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 274/465 (59%), Gaps = 19/465 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  HV +FPWLA GH+LP L  +K LA KG ++SF+STP+N++RLP + ++    ++   
Sbjct  467   EVMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSITFVS  526

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GLP + E+++D+   +Q Q LK A+D + PP +E +RR  P+ I+ D+A+HW+
Sbjct  527   FPLPPISGLPPSSESSMDVPYNKQ-QSLKAAFDLLQPPLKEFLRRSSPDWIIYDYASHWL  585

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL ++G    L   ++R +PE FTV P W  F S +  R 
Sbjct  586   PSIAAELGISKAFFSLFNAATLCFMGPSSSLIE-EIRSTPEDFTVVPPWVPFKSNIVFRY  644

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I+  D V VRSC EFE E+  LL+ LY++PV  
Sbjct  645   HEVTRYVEKTEE-DVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVFP  703

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             IG LPP +  + A+      ++W    +WLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  704   IGFLPPVIEDDDAVD-----TTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALG  758

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE S  PF W+LR +P I         P  F  R   +G V +GW PQ  IL+H ++GG 
Sbjct  759   LEKSETPFFWVLRNEPKI---------PDGFKTRVKGRGMVHVGWVPQVKILSHESVGGF  809

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E LGFG   I  P++ +QGLN +LL  K +G EV R E DGSF  D VA+
Sbjct  810   LTHCGWNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVAD  869

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             SIR VM    GE IR KA  M ++FGN + +  Y+D+ + + +SK
Sbjct  870   SIRLVMIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRSK  914



>ref|XP_007051735.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX95892.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=446

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/475 (40%), Positives = 271/475 (57%), Gaps = 40/475 (8%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             A   H+++ PW AFGH++P  + +  L   G +VSF+STP N+ R   +P+     + L 
Sbjct  2     ARDFHIVMLPWSAFGHLIPFFQLSVALGKAGVKVSFISTPGNIGRFK-VPSDLATLIDLV  60

Query  246   EIALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
                LP++     LPE  EATVD+   E++Q+LK AYD +  P ++ +    P+ I+VD  
Sbjct  61    AFQLPTLDNETLLPEGSEATVDIPS-EKIQYLKIAYDLLRHPVKQFISDQRPDWIIVDVI  119

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRS-GKLRPSPEHFTVPPGWFNFHSL  593
              HWV EI + Y +  +  SV + ++ ++  +P  L S G+ R                  
Sbjct  120   PHWVVEITQEYQIPLISFSVLSTSSYSFFANPRSLTSDGQKR------------------  161

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
                        +   +  +ASGVS  +RL+ +I+      +RSC E+E EY++++EK   
Sbjct  162   -----------IEGFYGENASGVSDAERLAKIIQASKAFAIRSCPEYEAEYLNVVEKTNG  210

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ IGLL P       I       SW E FEWLD Q+PKSVVFVGFGSEYK+  +QIH
Sbjct  211   KPVIPIGLLLPEKPEGRRI----TDKSWIEIFEWLDVQKPKSVVFVGFGSEYKLSKNQIH  266

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PFLW LRKP      + AL P  F +RTS +G V  GWA Q  IL HP 
Sbjct  267   EIAYGLELSGLPFLWALRKPDWALSDHDAL-PPGFSDRTSGRGVVSTGWAQQLEILEHPL  325

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDM  1313
             IGG LFH+GWG+IIE+L FGH L++LP + DQ LNA+ LVEK +  EV R +DGSFS   
Sbjct  326   IGGSLFHAGWGSIIETLQFGHCLVVLPFIIDQPLNARFLVEKGLAVEVERSDDGSFSGVD  385

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKR  1478
             +A ++   M S EG+ +R++  + A IF N +L ++  + F+EY +       +R
Sbjct  386   IAKALTLAMVSEEGQSLRVRIREAAQIFENRDLQNSNFNSFVEYLEKNGAANQRR  440



>ref|XP_009415710.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 274/467 (59%), Gaps = 14/467 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA    HV++FPWLAFGH++P LE +K LA +G  V F+STP+N+ RLP +P S    + 
Sbjct  1     MAESSLHVVLFPWLAFGHLIPFLELSKSLAKRGHHVFFLSTPRNISRLPKLPPSLAPSID  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPE--LILVDF  413
                I LP   GLP+  EAT DL  +E+V++L  A+D +     E + +  P+   I+ D+
Sbjct  61    FVPIPLPPCEGLPDGAEATSDL-PREKVKYLNKAFDGLEQSVAEFLVQTSPKPSWIIHDY  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             A +W+P IA R GV  +F + + A   A+   P     G  RP  E FT PP W  F + 
Sbjct  120   APYWLPLIATRVGVPCIFFNTFPAFVSAFFTGPG--GRGMQRPV-EAFTTPPEWIPFPTK  176

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             +A+R   A ++  +    D SGVS  +R+  V +GC+ + VR+C EFE E++ LL +  +
Sbjct  177   LAYRAYEARSLSDHVKRDDVSGVSLVRRIEMVGKGCELMAVRACTEFEREWLSLLREHNE  236

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +GLLPP +   +        ++  + F WL +Q P SV+ +  GSE  +    + 
Sbjct  237   KPVIPVGLLPPSIKDRSG--EANQGANTGDIFLWLRDQAPGSVLXIALGSEVALSAELLR  294

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             ELA  +E   +PFLW LR+P          LP  F  R   +G V  GW PQ  +LAH +
Sbjct  295   ELAFGVEQGGLPFLWALRRPDDMEA-----LPEGFEERLKGRGVVAFGWIPQLQVLAHES  349

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRD  1310
             +GG L H GWG++IE L FG PL+LLP+  DQGLNA+L+ EK +G E+ R  EDGSF+R+
Sbjct  350   VGGFLTHCGWGSLIEGLAFGRPLVLLPIAFDQGLNARLMEEKSLGVEIGRDEEDGSFTRE  409

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              VA++I  VM    G+ IR  A +M ++FG+   H+ Y+D+F++Y Q
Sbjct  410   AVAHAIGLVMVEEAGKTIRDAAKEMKDVFGDTECHEKYVDEFVQYLQ  456



>gb|KDP29779.1| hypothetical protein JCGZ_18714 [Jatropha curcas]
Length=465

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 274/466 (59%), Gaps = 14/466 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ HV +FPWLAFGH +P L+ AK +A KG ++SF+STP+N+QRLP IP + +  +   
Sbjct  4     TKKLHVALFPWLAFGHTIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSNIHFI  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              + LP V  LP + EAT+D+    ++ +LK AYD +  P  + ++   P+ I+ DFA +W
Sbjct  64    SLPLPQVDNLPPDAEATMDIPTN-KIPYLKIAYDGLKEPLFQFLKTSAPDWIIYDFAAYW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEE--LRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +P I    G+++ F S+++A T+A+L S     +     R  PE FTVPP W  F S VA
Sbjct  123   LPPITSDLGISSAFFSIFSAWTMAFLASSSSAMINGDDERTRPEDFTVPPKWVPFPSKVA  182

Query  600   HRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             +R   A     +    D SG+S   RL +V+   D + VRSC E E +++ L E+L+ +P
Sbjct  183   YRIHEAKRAFEHFEVND-SGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKP  241

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             VL IGLLPP  +L+     G +  +W +   WLD Q   SVV++ FGSE ++    +++L
Sbjct  242   VLPIGLLPPS-DLDVT---GGDDETWLKICGWLDKQNKGSVVYIAFGSELEVSQKDLNDL  297

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LELS +PF W LRK G         LP  F  R   +G V   W PQ  IL H ++G
Sbjct  298   ALGLELSGLPFFWTLRKQGNSFE-----LPDGFEERVKGRGIVWTSWVPQLRILGHESVG  352

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L H G  +++E+L FG  LIL P+  DQGLNA++  EK++G EV R E DGSF+++ +
Sbjct  353   GFLTHCGLSSVVEALNFGLALILFPVSIDQGLNARVFEEKKLGVEVKRNEQDGSFTKESL  412

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S+   M + +G+  R    +M  +  N  +H+  IDQF+E+ Q+
Sbjct  413   AESLMLAMDNEKGKLYRESTNEMRKLITNREVHNGCIDQFVEFLQT  458



>ref|XP_010942592.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=465

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 190/477 (40%), Positives = 281/477 (59%), Gaps = 21/477 (4%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M     H+++FPWLAFGH++P LE +K LA +G  + F+ST +N+ RLP IP      + 
Sbjct  1     MGEGPLHIVLFPWLAFGHLIPFLELSKSLAKRGHHIFFISTSRNIHRLPNIPLPLLPLID  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDF  413
             L  I LP    LP++ EAT DL    +V FLK A+D++  P  E + R    P+ I+ DF
Sbjct  61    LISIPLPPSHDLPDDAEATTDLPPH-KVPFLKKAFDKLDQPIAEFLERASPKPDWIICDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             A HW+P IA +  +   + + + +   A+            + SPE  TV P W  F + 
Sbjct  120   APHWLPPIASKLNIPCAYFNTFPSFFSAFAAG---------QRSPEQLTVTPEWIPFPTK  170

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VAHR   A ++ +     +ASGVS   R +SV++GC  + +R C EF+GE++ LL +LYK
Sbjct  171   VAHRLHEARSLAKLLSDVNASGVSDNYRFNSVVKGCHLMAMRGCMEFDGEWLTLLPELYK  230

Query  774   RPVLAIGLLPPRLNL--NTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
             +P++ +GLLPP  +   +     G  ++      +WL  Q P+S V+V  GSE  +    
Sbjct  231   KPIVPLGLLPPLADERPDGGNTNGMANTGHGNVVKWLTKQTPESTVYVSLGSEATLSNEL  290

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             +HELA  LELS +PFLW LR+ G +      LLP  F +R + +G V + W PQ  ILA 
Sbjct  291   VHELAFGLELSGLPFLWALRRKGEEV----ELLPKGFEDRIAARGMVAVDWMPQLEILAC  346

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFS  1304
              ++GG   HSGW ++IE L FGHPLILLP+  DQG+NA+++VEK++G EV R E+ GSF+
Sbjct  347   SSVGGFFTHSGWSSLIEGLAFGHPLILLPIFGDQGINARVMVEKKVGLEVERDEETGSFT  406

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
             R+ VA  +R VM   EG+ +R  A +M  +FGN ++H  Y+D F+ Y +  +  +C+
Sbjct  407   REAVAKVLRLVMVEEEGKKLRETAKRMREVFGNKDIHGRYMDAFVHYLKDHM--RCR  461



>ref|XP_009768930.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nicotiana sylvestris]
Length=469

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 195/474 (41%), Positives = 292/474 (62%), Gaps = 19/474 (4%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M  +  HV++ PWLAFGH+ P  + +  L+ +   VSF+STP+N++RLP +P +    ++
Sbjct  1     MKKDSIHVVMVPWLAFGHLQPFFQLSIALSKEKVHVSFLSTPRNIKRLPKLPPNLEPLVN  60

Query  240   LREIALPSVPG---LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVD  410
             L E  LPS+     LP++ EAT+D+   ++VQ+L  AYD +  P +  + R+ P+ I+VD
Sbjct  61    LVEFPLPSLDDKSLLPKDAEATLDI-PADKVQYLTVAYDLLQQPIKHFITREKPDWIIVD  119

Query  411   FATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEH--FTVPPGWFNF  584
             F+ +W+ EIA+   +  +  S++TAATL + G  +    G+  P P H     PP   +F
Sbjct  120   FSPYWIAEIARDLDIPMLQFSMFTAATLLFFGQLD--HEGQEEPKPLHELLLSPPPCGDF  177

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              S VA++      +       +ASG SS +R + + +    + +R+C EFE EY+ +  +
Sbjct  178   KSTVAYKKYEVAELFAAIAAENASGKSSMEREAIMGKASRAMALRTCAEFENEYL-VSPR  236

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTNSSS---WSEAFEWLDNQRPKSVVFVGFGSEYKM  935
              YK+P++ IGLL P       +  G N  +   W +  +WLD Q+P+SVVFVGFGSE + 
Sbjct  237   NYKKPLIPIGLLLP-----GELPVGENDLALPQWQKMSKWLDEQKPRSVVFVGFGSECRF  291

Query  936   PIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQN  1115
               +Q++E+A+ L+LS +PF WIL+KP        AL P+ F   T  +G V +GWAPQ+ 
Sbjct  292   TKNQVYEIANGLQLSELPFFWILQKPSWALNDVDAL-PSGFGAATEGRGFVHIGWAPQKE  350

Query  1116  ILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-RED  1292
             ILAHP+IGG LFH+GWG+ IE+L +GH L++LP V DQGLNA+LLVEK +  EV R  ED
Sbjct  351   ILAHPSIGGSLFHAGWGSAIETLRYGHVLVVLPFVFDQGLNARLLVEKGVAIEVKRNEED  410

Query  1293  GSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             GSFS   +A S+R  M   EGE +R +A + A IFG+  L D+Y+  F+EY +S
Sbjct  411   GSFSGKDIAMSLREAMVLEEGEELRARARKAAAIFGDRKLQDSYVRNFVEYLKS  464



>ref|XP_006353158.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=468

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/471 (38%), Positives = 285/471 (61%), Gaps = 11/471 (2%)
 Frame = +3

Query  54    ITMAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTER  233
             +T  +++ H+ +FPWLAFGHM+P LE +K +A KG ++SF+STPKN+ RLP +P +F   
Sbjct  1     MTENSKKLHIAVFPWLAFGHMIPYLELSKLIARKGHKISFISTPKNIDRLPKLPPNFAPF  60

Query  234   LSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             ++  +I LP V  LP+N EAT+DL   EQV++LK A D +  P  + +    P+ I+ DF
Sbjct  61    INFVKIPLPHVEKLPKNAEATIDL-PYEQVKYLKIAQDGLKEPIAKFLEDSAPDFIIFDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHS  590
             A++W+P IA ++ + T + S++ AA L + G    L +  ++R +PE +TVPP W  F +
Sbjct  120   ASYWIPSIASKFNIPTGYFSIFIAAVLGFTGPEPGLNNDYEIRKTPEEYTVPPKWVPFET  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA +      +   +   +   VS   R    +E CDF++VRSC EFE E++ ++  ++
Sbjct  180   TVAFKLFEVLRIFEASMKGEEENVSDIIRYYKSVENCDFLLVRSCSEFEPEWLKVVGDIH  239

Query  771   KRPVLAIGLLP--PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
             ++ V  +G LP  P  + +T I       +W E   WLD Q    V++V FGSE K   +
Sbjct  240   RKLVFPVGQLPTTPYEDDSTKI------DAWREIKLWLDEQEKGKVIYVAFGSEAKPSQN  293

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILA  1124
             ++ EL+  LELS +PF W+LR    ++      LP  F +RT  +G V   W PQ  IL+
Sbjct  294   ELTELSLGLELSGLPFFWVLRTKRGESDDELIQLPEGFKDRTKGRGIVCTSWVPQLKILS  353

Query  1125  HPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSF  1301
             H ++GG L HSGW +++E++ F  PL+LL  +ADQG+NA+LL EK++ Y +PR + DGSF
Sbjct  354   HHSVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSIPRDDRDGSF  413

Query  1302  SRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +RD VA S+  V+  ++GE  R K  +  N+F +    ++Y++  + Y Q+
Sbjct  414   TRDSVAESLNLVLIEKKGEIYRKKIKEAKNLFCDERRQNDYVESLLNYLQN  464



>ref|XP_002270294.1| PREDICTED: UDP-glycosyltransferase 91A1 [Vitis vinifera]
Length=479

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 266/462 (58%), Gaps = 11/462 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+++FPWLAFGHM+P LE AK +A +G  VSFVSTP+N+ RLP +P + T  +S  +I
Sbjct  14    KLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFISFVKI  73

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP VP LPEN EAT DL +  +V FLK AY+ +       +    P+ +L DF  +W+ 
Sbjct  74    PLPHVPNLPENAEATTDLPEN-KVPFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAYWLV  132

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHRP  608
              IA + G+A  FLS++TA+ L +        SG+  R  PE FTV P W  F S VA R 
Sbjct  133   PIATKLGIACGFLSIFTASALCFFNP-----SGQDHRTEPEDFTVAPKWVPFPSRVAFRY  187

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  +  N    DASG S   R  + + GCD + VRSC E E E++ LLE+LY++PV+ 
Sbjct  188   FEVVKIFNNAIAGDASGTSDMHRFEACLRGCDLLAVRSCTELEPEWLRLLEQLYQKPVVP  247

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP L             +W E   WLD Q   SVV+V FGSE K    ++ E+A  
Sbjct  248   VGQLPPILPHGGD---DDEDETWLEIKGWLDKQAGGSVVYVAFGSEAKPNQTELTEIALG  304

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LE S +PF W L+            LP  F  RT  +G V   WAPQ  IL+HP+I G L
Sbjct  305   LEQSELPFFWALKLKRGPCDIEVIQLPEGFEERTKGRGVVCTSWAPQLKILSHPSICGFL  364

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANS  1325
              HSGW +++E+L    PLILL  +ADQGLNA  L EK++G  +PR  EDGSF+R+ VA S
Sbjct  365   SHSGWTSVVEALQLERPLILLTFLADQGLNASFLREKKMGCLIPRNEEDGSFTREAVARS  424

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             +R V+     +  R KA +M  +FG+ +  + Y+D  +   +
Sbjct  425   LRLVVVEEGDKFYRDKAKEMRAVFGDRDRQNQYVDTLVSCLK  466



>ref|XP_009803298.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=483

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 187/481 (39%), Positives = 280/481 (58%), Gaps = 7/481 (1%)
 Frame = +3

Query  60    MAAE--QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTER  233
             MA E  + H+ + PWLAFGH+LP LE AK +A KG ++SF+STP+N+ RLP +P+  +  
Sbjct  1     MATENRKLHIAMLPWLAFGHILPYLELAKHIALKGHKISFISTPRNIDRLPKLPSHISPF  60

Query  234   LSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             +   +I L  V  LP++ EAT DL   ++VQ+LK AYD M       ++ + P+ I  DF
Sbjct  61    IRFVKIPLQPVENLPKDAEATTDL-PYDKVQYLKIAYDAMRDSIHHFLQTNKPDWIFFDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHS  590
             A +W   IA    +++ F S+  AA L +LG    L SG      PE  T  P W NF +
Sbjct  120   AAYWAGPIATELNISSAFFSIMIAAVLGFLGPAPVLISGYGTLDEPEVLTASPKWVNFPT  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R  Y    M+++ T + S  S   R  + I+ CD +++RSC EFE E++ L+E+++
Sbjct  180   TVAFRL-YEVLRMKDSFTGNMSEASDIYRFGAGIKSCDVLLIRSCSEFEPEWLHLVEEIH  238

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++ V  +G L P L ++        + +     +WLD+Q   SV++V FGSE K    ++
Sbjct  239   QKLVFPVGQLSP-LTIDNCDDESNGAWTGGSIKQWLDSQEKGSVIYVAFGSEAKPSQEEL  297

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  LELS +PF W+LRK   +       LP  F  RT ++G V +GWAPQ  IL+H 
Sbjct  298   TEIAHGLELSGLPFFWVLRKQRGEFDTDLNELPKGFEQRTKDRGVVCMGWAPQLKILSHD  357

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             ++GG L HSGW +++E++ +   LILLP +ADQGLNA+LL EK++ Y +PR E +G+F+R
Sbjct  358   SVGGFLTHSGWSSVVEAISYEKALILLPFLADQGLNARLLEEKKMAYSIPRDEREGTFTR  417

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKRG*N  1487
             D VANS+  VM    G+  R  A  M  +F +    + Y++  ++Y Q     Q + G  
Sbjct  418   DSVANSLSLVMLEEGGKVYRENAKNMRELFADKRKQEKYVENLMKYLQKHREIQKENGDT  477

Query  1488  T  1490
             T
Sbjct  478   T  478



>ref|XP_008362977.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X1 [Malus 
domestica]
Length=467

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 187/466 (40%), Positives = 275/466 (59%), Gaps = 12/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPAVDGLPESVESTSELPIN-KVPYLKKAYDLLKPSVMHFIQHSGVNWVVHDFICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A TLA+ G P EL   K R  PE FTV P W ++ S VA + 
Sbjct  124   PRVATQLGVNSVYFNITNATTLAFFGPPSELLGNKRR-GPEDFTVVPEWVDYPSNVAFKL  182

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                 T            VS  QRL   I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  183   HEMVTHWDCM----XDEVSDFQRLGRTIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  238

Query  789   IGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +GLLPP        +        W    EWL+N++P SVV++  G+E  +    +HELA 
Sbjct  239   LGLLPPVSAPQQHGVADDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELAH  298

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++  +P ++    P ++P  F  R  ++G V+ GWAPQ  IL HP++GG
Sbjct  299   GIEKSGLPFIWVVNNRPLVEGVFGPDVIPLGFQTRVEDRGLVLRGWAPQLKILGHPSVGG  358

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW +++E+LGFG  LIL     +DQGL A+L+ EK +G E+PR E DGSF+ D V
Sbjct  359   FLTHCGWSSVVEALGFGRVLILFSGANSDQGLIARLMHEKRVGLEIPRDERDGSFTSDSV  418

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A   R VM  REGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  419   AEVTRRVMVEREGESIRSNAWAMKEIFGNVELNNACLDEFTRVLET  464



>ref|XP_004306715.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=443

 Score =   348 bits (893),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 186/472 (39%), Positives = 270/472 (57%), Gaps = 44/472 (9%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV++ PW AFGH++P  + +  LA     VSF+STP+N++RLP I       ++L  
Sbjct  6     KELHVVMLPWSAFGHLMPFFQLSIALAKAKVHVSFISTPRNIERLPKIAPDLQPFINLVP  65

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             I  P +    LPE  EA+VD+  Q Q   L+ A D +  P ++ +   +P+ I+ DF TH
Sbjct  66    IPFPPLEPDFLPEGAEASVDVPVQ-QYANLQVAVDLLQTPIKQFIADKMPDWIIADFFTH  124

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             WV +IAK  GV                            P+ +  T PP W  F SL++ 
Sbjct  125   WVVDIAKENGVL---------------------------PTIQSLTSPPEWITFPSLLSL  157

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             + DY           + +G+    RL+ ++     + +R+C E EG+Y+++ +K+  +PV
Sbjct  158   K-DYEAVKRLLAWEVNKTGMCFAWRLAKIVSASQVLAIRTCSEIEGDYLEVYKKITGKPV  216

Query  783   LAIGLLPPRLNLNTAIQPGTNS----SSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             +  G+LPP        QPG  +    +S +  F+WLD Q+P+SVVFVGFGSE ++   Q+
Sbjct  217   IPTGVLPPD-------QPGKRAEGEVNSDASMFDWLDKQKPRSVVFVGFGSECRLSKEQV  269

Query  951   HELASALELSRMPFLWILRKPG-IDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             HE+A  LELS  PF+W LRKP   ++      LP  F +RTS +G V  GW PQ  IL H
Sbjct  270   HEMAHGLELSEQPFIWGLRKPNSTESDEVDDFLPLGFTDRTSEKGLVCFGWVPQMEILGH  329

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSR  1307
             P+IGG LFHSGWG++IE+L FGH L++LP + DQ LNA+LLVEK +  EV R EDGSFSR
Sbjct  330   PSIGGSLFHSGWGSVIETLQFGHGLVVLPFMYDQPLNARLLVEKGLAAEVKRNEDGSFSR  389

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNL-HDNYIDQFIEYFQSKI  1460
               +A S+R  M   EGE +R  A + A + G+H L HD+YI  F+ Y ++ +
Sbjct  390   GEIAKSLRLAMVEEEGEQLRSNARKAAAVIGDHKLQHDHYISAFVNYLKNNV  441



>ref|XP_008362978.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X2 [Malus 
domestica]
Length=467

 Score =   349 bits (895),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 279/469 (59%), Gaps = 18/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPAVDGLPESVESTSELPIN-KVPYLKKAYDLLKPSVMHFIQHSGVNWVVHDFICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A TLA+ G P EL   K R  PE FTV P W ++ S VA + 
Sbjct  124   PRVATQLGVNSVYFNITNATTLAFFGPPSELLGNKRR-GPEDFTVVPEWVDYPSNVAFKL  182

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                 T            VS  QRL   I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  183   HEMVTHWDCM----XDEVSDFQRLGRTIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  238

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFE----WLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             +GLLPP   ++   Q G       E +E    WL+N++P SVV++  G+E  +    +HE
Sbjct  239   LGLLPP---VSAPQQHGVADDRGDETWEVLRGWLENKKPNSVVYIALGTEVTLSQELMHE  295

Query  957   LASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  +E S +PF+W++  +P ++    P ++P  F  R  ++G V+ GWAPQ  IL HP+
Sbjct  296   LAHGIEKSGLPFIWVVNNRPLVEGVFGPDVIPLGFQTRVEDRGLVLRGWAPQLKILGHPS  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             +GG L H GW +++E+LGFG  LIL     +DQGL A+L+ EK +G E+PR E DGSF+ 
Sbjct  356   VGGFLTHCGWSSVVEALGFGRVLILFSGANSDQGLIARLMHEKRVGLEIPRDERDGSFTS  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             D VA   R VM  REGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  416   DSVAEVTRRVMVEREGESIRSNAWAMKEIFGNVELNNACLDEFTRVLET  464



>ref|XP_008789644.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=464

 Score =   349 bits (895),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 266/468 (57%), Gaps = 12/468 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             M     H+++FPWLAFGH+LP L  +K LA +G  +SF+STP+N+ RLP +P S    + 
Sbjct  1     MEEGSLHIVVFPWLAFGHLLPFLGLSKSLAKRGHHISFLSTPRNILRLPKLPPSLAPLIE  60

Query  240   LREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDF  413
                I LP    LP N EAT DL   + VQ+LK A+D +  P  + + +    P+ I+ DF
Sbjct  61    FIPIRLPPSDHLPNNAEATTDL-LPDDVQYLKKAFDGLDQPIAKFLEQASPKPDWIIQDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
               +W+P IA +  +     + + A   A++   +     ++R  PE  TV P W  F + 
Sbjct  120   TPYWLPPIAAKLHIPCAMFNTFPAYFSAFVWGED---GARMRGPPERLTVVPEWIPFPTT  176

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
                R  +           DASGVS+  R   V+  C  + +RSC E + + +  + +L+ 
Sbjct  177   AVLRL-FEARQFDYMLQVDASGVSAADRFEMVVRRCKLMALRSCMELDRQVLSTMSELFN  235

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
              PV+ +GLLPP ++        T+S +    F WLD Q P+SVV+V  GSE  +    +H
Sbjct  236   MPVVPVGLLPPSVDEGGEKIASTSSMN---IFRWLDKQTPRSVVYVSLGSEATLSSELVH  292

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             ELA  LELS  PFLW LR+P    P    LLP  F +R +  G V + WAPQ  ILAH +
Sbjct  293   ELAFGLELSGQPFLWALRRPA-GMPKEVELLPEGFEDRIAGNGMVTMDWAPQTEILAHES  351

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEV-PRREDGSFSRD  1310
             +GG L H GWG+++E LGFGHPL+ LP+  DQ +NA+++VEKEIG EV    EDGSF RD
Sbjct  352   VGGFLTHGGWGSLVEGLGFGHPLVFLPVFGDQPINARVMVEKEIGVEVRSDEEDGSFKRD  411

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              VA ++R VM   EG+ IR +A +M  IFGN  L +  ID+F+ Y + 
Sbjct  412   AVAQALRLVMVEEEGKKIRNEANKMKLIFGNKELQERCIDEFVRYLRD  459



>ref|XP_002533517.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF28861.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=415

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/419 (42%), Positives = 260/419 (62%), Gaps = 10/419 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGHM+P LE AK +A KG ++S++STP+N+ RLP +P + +  ++  +I
Sbjct  6     KLHIALFPWLAFGHMIPYLELAKLIAQKGHKISYISTPRNIDRLPELPPNLSSFINFVKI  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP    LP++ EAT D+    +VQ+LK +YDR+  P    +     + IL DFA +W+P
Sbjct  66    PLPRSDDLPQDAEATTDVPFN-KVQYLKKSYDRLKEPLTVFLENSDIDWILYDFAAYWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             ++A   G++  F  ++  AT+  +  P  L     R  PE FTVPP W NF + VA++  
Sbjct  125   DLANSLGISHAFFGIFLGATMGVIVKPASLTDD--RTKPEQFTVPPKWVNFPTKVAYKL-  181

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             +    +  +   DASGVS   R + V++GC+ + +RSC EFE E+++LLE+++ +P + +
Sbjct  182   FEILRIFESVEGDASGVSDLSRAAEVLKGCEIIAIRSCIEFEPEWLNLLEEIHGKPCIPV  241

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G+LP      T  + G  ++ W +  +WLD Q   SVV+V FGSE K    +++E+A  L
Sbjct  242   GMLP-----TTGYENGKETNEWRKIKQWLDKQDKASVVYVAFGSEGKPSQLELNEIALGL  296

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS +PF W+LRK           LP  F  RT  +G V  GWAPQ  ILAH +IGG L 
Sbjct  297   ELSGLPFFWVLRKRRGSTDAEVIELPDGFEERTKGRGVVSTGWAPQLKILAHDSIGGFLT  356

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
             HSGW +++E+  +  PLILL  +ADQG+NA++L EK++GY VPR E DGSF+ + VA S
Sbjct  357   HSGWSSVVEASQYERPLILLTFLADQGINARILEEKKMGYSVPRNEFDGSFTSESVAES  415



>dbj|BAJ84800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 270/472 (57%), Gaps = 24/472 (5%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++ PWLAFGH+LP  EFAK++A +G RV+ +S P+N +RL  IP      + +  +
Sbjct  8     KMHVVMLPWLAFGHVLPFTEFAKRVARQGHRVTLLSAPRNTRRLIDIPPGLAGLIRVVHV  67

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDL-----PELILVDFA  416
              LP V GLPE+ EAT+DL        L+ A+D     FE  + R L     P+ +LVD+A
Sbjct  68    PLPRVDGLPEHAEATIDLPSDHLRPCLRRAFD---AAFERELSRLLQEEAKPDWVLVDYA  124

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL----RSGKLRPSPEHFTVPPGWFNF  584
             ++W P  A R+GV   FLS++ AA L++ G+PE L    R  K  P+  H TV P +  F
Sbjct  125   SYWAPTAAARHGVPCAFLSLFGAAALSFFGTPETLLGIGRHAKTEPA--HLTVVPEYVPF  182

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              + VA+R   A  +      PD SGVS G R +  IEGC  V +RS  EFE E++ LL +
Sbjct  183   PTTVAYRGYEARELFEPGMVPDDSGVSEGYRFAKTIEGCQLVGIRSSSEFEPEWLRLLGE  242

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
             LY++PV+ +GL PP         P  + +       WLD Q P SVV+  FGSE K+   
Sbjct  243   LYRKPVIPVGLFPP--------APQDDVAGHEATLRWLDGQAPSSVVYAAFGSEVKLTGA  294

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGYPA-LLPTDFVNRTSNQGRVILGWAPQQNIL  1121
             Q+  +A  LE S +PF+W  R P     G  +  LP  F  R + +G V  GW PQ   L
Sbjct  295   QLQRIALGLEASGLPFIWAFRAPTSTETGAASGGLPEGFEERLAGRGVVCRGWVPQVKFL  354

Query  1122  AHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGS  1298
             AH ++GG L H+GW +I E L  G  L+LLP+V +QGLNA+ +V+K IG EV R E DGS
Sbjct  355   AHASVGGFLTHAGWNSIAEGLAHGVRLVLLPLVFEQGLNARNIVDKNIGVEVARDEQDGS  414

Query  1299  FSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             F+   +A ++R VM   EGEG   K  ++A +FG+  ++D  + +F+ +   
Sbjct  415   FAAGDIAAALRRVMVEDEGEGFGAKVKELAKVFGDDEVNDQCVREFLMHLSD  466



>ref|XP_002532392.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30004.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=471

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 280/462 (61%), Gaps = 10/462 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+++FPWLAFGHM+P LE AK +A KG +VSFVS+P+N+ RLP +P + +  +   ++
Sbjct  6     ELHIVMFPWLAFGHMIPYLELAKHIAQKGHKVSFVSSPRNIDRLPKLPPNLSPYIKFVKL  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP V GLP++ EAT D+   ++VQ+LK AYD +  P  + +    P  +L DFA +W+P
Sbjct  66    RLPHVAGLPQDAEATTDV-PYDKVQYLKKAYDGLKEPLTKFLETSDPHWLLYDFAPYWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             ++AK  G++  F S++ AA+L+++     +   + R  PE FTVPP W +F S V  R  
Sbjct  125   DVAKNLGISNAFFSIFLAASLSFVKPHSWI---EYRSKPEDFTVPPKWVSFPSKVTFRL-  180

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             +    + +  T D S VS   R+  V++GCD V+VRSC EFE E++ LLE+ + +P + +
Sbjct  181   HEILRIFDVVTGDESDVSDIYRMEEVVKGCDVVVVRSCVEFEPEWLHLLEENHGKPSIPV  240

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G+L      +   +P     +W    EWLD Q   SVV+V FGSE K    +++E+A  L
Sbjct  241   GMLATTEYNSEDEEP----EAWRSIKEWLDKQEKGSVVYVAFGSEAKPTQVELNEIAFGL  296

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             E S +PF W+L+K           LP  F  RT  +G V   WAPQ  ILAH +IGG L 
Sbjct  297   EFSGLPFFWVLKKRRGIADTEVIELPDGFEERTKERGMVCTSWAPQLKILAHGSIGGFLT  356

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSI  1328
             HSGW +++E++ +   LILL  +ADQ  NA+LL EK++GY +PR E DGSF+RD VA S+
Sbjct  357   HSGWSSVVEAIQYERALILLTFLADQSFNARLLEEKKMGYPIPRNEIDGSFNRDSVAESL  416

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R VM   EG   R K  +M  +F +     +Y+D F++Y  S
Sbjct  417   RLVMVKEEGNIYREKVKEMKGLFADREKQGSYVDNFLDYLHS  458



>ref|XP_010482257.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X1 [Camelina 
sativa]
 ref|XP_010482258.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X2 [Camelina 
sativa]
Length=461

 Score =   347 bits (891),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 192/466 (41%), Positives = 267/466 (57%), Gaps = 21/466 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  H+ +FPWLA GH+LP L  +K LA KG ++SF+STP+NL+RLP +P++ +  ++   
Sbjct  8     EVMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITFVS  67

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GL    E+++D+   +Q Q LK A+D +  P +E + R  P+ I+ D+A+HW+
Sbjct  68    FPLPLISGLSPTSESSMDVPYIKQ-QSLKAAFDLLQAPLKEFLGRSSPDWIIFDYASHWL  126

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL +LG P      +LR +PE FTV P W  F S VA R 
Sbjct  127   PSIAAELGISKAFFSLFNAATLCFLG-PSSSLIDELRTTPEDFTVVPPWVPFKSNVAFRY  185

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I   D V VRSC EFE E+  LL+ LY++PV  
Sbjct  186   HEVTRYVEKTDE-DVTGVSDSVRFGYSIGESDAVFVRSCPEFEPEWFGLLKDLYQKPVFP  244

Query  789   IGLLPPRLNLNTAIQPG-TNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              G LPP       I+ G  + ++W    EWLD QR  SVV+V  G+E  +   ++ ELA 
Sbjct  245   TGFLPP------VIEDGDDDDTTWVCIKEWLDKQRVNSVVYVSLGTEASLRREEVTELAL  298

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              LE S  PF W+LR +P I         P  F      +G V +GW PQ  IL H ++GG
Sbjct  299   GLEKSETPFFWVLRNEPHI---------PDGFEKTVKGRGMVHVGWVPQVKILRHESVGG  349

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GW +++E LGFG   I LP++ +QGLN +LL  K IG EV R E DGSF    VA
Sbjct  350   FLTHCGWNSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVA  409

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             +S+R VM   EGE IR  A  M  +FGN + +  ++D+ + +  SK
Sbjct  410   DSVRLVMMDEEGESIRDTAKLMKGLFGNMDENIRHVDEIVSFMTSK  455



>ref|XP_007156463.1| hypothetical protein PHAVU_003G288100g [Phaseolus vulgaris]
 gb|ESW28457.1| hypothetical protein PHAVU_003G288100g [Phaseolus vulgaris]
Length=469

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 270/468 (58%), Gaps = 15/468 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGHM+P LE AK +A KG RVSFVSTP+N+ RLP +  +    ++  ++ L
Sbjct  10    HIVMFPWLAFGHMIPNLELAKLIAEKGHRVSFVSTPRNIDRLPKLSPTL---INFVKLPL  66

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P +  LPEN EAT D+   + VQ+LK AYD +  PF   +     + +  DF   W   +
Sbjct  67    PKLQNLPENAEATTDV-PYDAVQYLKKAYDALEQPFTRFLESSKADWLFYDFVPFWAASV  125

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRPDY  614
             A + G+ T F S++TA+ L ++G P  L +    R  PE + V P W  F + VA+R   
Sbjct  126   ASKLGIKTAFYSIFTASVLGFIGPPSYLTANDSPRQKPEEYIVVPPWVTFPTTVAYRYYE  185

Query  615   APTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIG  794
                ++ +    + +GVS   R  + I+ CD  +VR C EFE E+  LLE +Y +PVL  G
Sbjct  186   IMRIVDSLSAQNNTGVSDTYRFGASIQNCDIAVVRGCTEFEPEWFHLLENIYGKPVLPAG  245

Query  795   LLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALE  974
              LP     +TA     ++ +W    EWLD Q    VV+V FGSE K    ++ E+A  LE
Sbjct  246   QLP-----STAPVGSEDNETWRWMKEWLDKQARGRVVYVAFGSEAKPTQEEVTEIALGLE  300

Query  975   LSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
              S +PFLW+LR + G  +P     LP  F  RT  +G V   WAPQ  IL H A+GG L 
Sbjct  301   KSELPFLWVLRVQRGPSDPDV-LRLPEGFEERTKARGVVCRSWAPQLKILEHVAVGGFLT  359

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANSI  1328
             HSGW +++E +     L+LL  ++DQG+NA++L EK++GY VPR  EDGSFS D VA S+
Sbjct  360   HSGWTSVVEGIQNEKALVLLTFLSDQGINARVLEEKKMGYSVPRDEEDGSFSSDSVAESL  419

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQC  1472
             + V+   EG+  R +  +M ++F N +  + YID  I     K  ++C
Sbjct  420   KLVVVEEEGKIYRERIKEMKDLFVNEDRQNRYIDNLIHNL--KTFSKC  465



>ref|XP_007222833.1| hypothetical protein PRUPE_ppa005106mg [Prunus persica]
 gb|EMJ24032.1| hypothetical protein PRUPE_ppa005106mg [Prunus persica]
Length=477

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 187/471 (40%), Positives = 277/471 (59%), Gaps = 22/471 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P    +K +A KG  VSF+STP+N+ RLP IP+  +  ++L  + L
Sbjct  11    HVVVFPWLAMGHLIPFFHLSKLIAQKGHSVSFISTPRNILRLPKIPSHLSSLINLVSLPL  70

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELV--RRDLPELILVDFATHWVP  431
             P +  LP + E++ D+   +Q Q LK A+D +  P  + +      P+ ++ D+A+HW+P
Sbjct  71    PRLDNLPNDAESSTDVPYNKQ-QLLKRAFDLLELPLTDFLGSSESKPDWVIYDYASHWLP  129

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHR-  605
              +A R+ ++  F S ++AA LAY+G P  L +G+  R + E FT+ P W  F S +A+R 
Sbjct  130   PVAARFDISRAFFSCFSAACLAYIGPPAPLINGQDFRTNAEDFTLVPEWVPFESDMAYRL  189

Query  606   PDYAPTMMRNTH----TPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
              + A  + R++     TPD        R    I   + V +RS  EFE E+ +LL +LY 
Sbjct  190   HEIAKYLQRSSENESVTPDTV------RFGFAINESEVVFIRSSDEFEPEWFNLLRELYG  243

Query  774   R--PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
             +  PV+ IG LPP +N     Q     ++W    EWLD QR  SV+++  G+E  +   +
Sbjct  244   KGKPVVPIGFLPPLINE----QVDEFDTNWVGINEWLDKQRVNSVIYIAVGTEATLSREE  299

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             + ELA  LELS +PF W+LR P         +LP  FV R   +G V LGWAPQ  IL+H
Sbjct  300   LTELALGLELSGVPFFWVLRNPPESTQSVFEMLPHGFVERVEGRGVVHLGWAPQVRILSH  359

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFS  1304
              ++GG L H GW ++IE LGFG  LIL PMV DQGLNA+L   K +G E+PR  +DGSF+
Sbjct  360   DSVGGFLTHCGWNSMIEGLGFGRVLILFPMVNDQGLNARLGNNKGLGVEIPRIAQDGSFT  419

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             RD VA  +R  M    GE +R++A +M  +FG+ N ++   D+FI + +  
Sbjct  420   RDSVAKLVRLAMVEDSGESLRIRAKEMKGLFGDRNRNNQIADEFICFLEEN  470



>ref|NP_565540.4| UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 sp|Q940V3.1|U91A1_ARATH RecName: Full=UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 gb|AAK96560.1| At2g22590/T9I22.3 [Arabidopsis thaliana]
 gb|AAL36076.1| At2g22590/T9I22.3 [Arabidopsis thaliana]
 gb|AEC07325.1| UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 gb|AHL38846.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=470

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/465 (40%), Positives = 280/465 (60%), Gaps = 17/465 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV++FPWLAFGHM+P LE +K +A KG +VSF+STP+N+ RL P +P + +  ++  +
Sbjct  13    KLHVVMFPWLAFGHMVPYLELSKLIAQKGHKVSFISTPRNIDRLLPRLPENLSSVINFVK  72

Query  249   IALPSVPG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++LP     LPE+ EAT D+   E + +LK AYD +  P  E +    P+ +L DFA  W
Sbjct  73    LSLPVGDNKLPEDGEATTDV-PFELIPYLKIAYDGLKVPVTEFLESSKPDWVLQDFAGFW  131

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +P I++R G+ T F S +  ATL  L  P  EE R+     SP  F  PP W  F + VA
Sbjct  132   LPPISRRLGIKTGFFSAFNGATLGILKPPGFEEYRT-----SPADFMKPPKWVPFETSVA  186

Query  600   HRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
              +      + +        G V    R+  VI+GCD + VRSC E+E E++ L ++L+++
Sbjct  187   FKLFECRFIFKGFMAETTEGNVPDIHRVGGVIDGCDVIFVRSCYEYEAEWLGLTQELHRK  246

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+ +G+LPP+ +     +   ++ +W    +WLD+++ KS+V+V FGSE K    +++E
Sbjct  247   PVIPVGVLPPKPD-----EKFEDTDTWLSVKKWLDSRKSKSIVYVAFGSEAKPSQTELNE  301

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             +A  LELS +PF W+L+         P  LP  F  RT+++G V  GW  Q   L+H +I
Sbjct  302   IALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHDSI  361

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             G  L H GWGTIIE++ F  P+ +L  V DQGLNA+++ EK+IGY +PR E +G F+++ 
Sbjct  362   GLVLTHPGWGTIIEAIRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFTKES  421

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             VANS+R VM   EG+  R    +M  +FG+ +  D Y+D F+EY 
Sbjct  422   VANSLRLVMVEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLEYL  466



>dbj|BAJ99561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   347 bits (891),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 269/472 (57%), Gaps = 24/472 (5%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++ PWLAFGH+LP  EFAK++A +G RV+ +S P+N +RL  IP      + +  +
Sbjct  8     KMHVVMLPWLAFGHVLPFTEFAKRVARQGHRVTLLSAPRNTRRLIDIPPGLAGLIRVVHV  67

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDL-----PELILVDFA  416
              LP V GLPE+ EAT+DL        L+ A+D     FE  + R L     P+ +LVD+A
Sbjct  68    PLPRVDGLPEHAEATIDLPSDHLRPCLRRAFD---AAFERELSRLLQEEAKPDWVLVDYA  124

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEEL----RSGKLRPSPEHFTVPPGWFNF  584
             ++W P  A R+GV   FLS++ AA L++ G+PE L    R  K  P+  H TV P +  F
Sbjct  125   SYWAPTAAARHGVPCAFLSLFGAAALSFFGTPETLLGIGRHAKTEPA--HLTVVPEYVPF  182

Query  585   HSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEK  764
              + VA+R   A  +      PD SGVS G R +  IEGC  V +RS  EFE E++ LL +
Sbjct  183   PTTVAYRGYEARELFEPGMVPDDSGVSEGYRFAKTIEGCQLVGIRSSSEFEPEWLRLLGE  242

Query  765   LYKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIH  944
             LY++PV+ +GL PP         P  + +       WLD Q P SVV+  FGSE K+   
Sbjct  243   LYRKPVIPVGLFPP--------APQDDVAGHEATLRWLDGQAPSSVVYAAFGSEVKLTGA  294

Query  945   QIHELASALELSRMPFLWILRKPGIDNPGYPA-LLPTDFVNRTSNQGRVILGWAPQQNIL  1121
             Q+  +A  LE S +PF+W  R P     G  +  LP  F  R + +G V  GW PQ   L
Sbjct  295   QLQRIALGLEASGLPFIWAFRAPTSTETGAASGGLPEGFEERLAGRGVVCRGWVPQVKFL  354

Query  1122  AHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGS  1298
             AH ++GG L H+GW +I E L  G  L+LLP+V +QGLNA+ +V+K IG EV R E DGS
Sbjct  355   AHASVGGFLTHAGWNSIAEGLAHGVRLVLLPLVFEQGLNARNIVDKNIGVEVARDEQDGS  414

Query  1299  FSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             F+   +A ++R VM   EGEG   K  ++A +FG+  ++D  + +F  +   
Sbjct  415   FAAGDIAAALRRVMVEDEGEGFGAKVKELAKVFGDDEVNDQCVREFFMHLSD  466



>ref|XP_010023433.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   347 bits (891),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 263/464 (57%), Gaps = 12/464 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  H+ + PWLAFGHM+P LE AK +A KG R+SF+S P N+ RLP  P      +S   
Sbjct  6     ENLHMAMLPWLAFGHMMPYLELAKLMAGKGHRISFLSVPGNIDRLPKPPPDLAPLISFVN  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V  LPE   AT DL   +++QFLK AYD +  P    +    P+ I+ DFA +W 
Sbjct  66    LPLPTVEHLPEGAGATSDL-PYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
               IA R G+ +VF S+ TAA+L + G    L+ G  R +PE FT  P W  F + VA R 
Sbjct  125   GPIASRLGIRSVFFSITTAASLGFFGPIWALKGGDYRKTPEDFTKRPNWVPFPTKVAFR-  183

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    + +    +ASGV+   R  +  E CD +  RS  E E E++ LL+ ++ +P+  
Sbjct  184   HFEIKKIFDAVIGNASGVTDLYRFGAGQESCDIIAARSSYEVEPEWLSLLKDIHTKPIFP  243

Query  789   IGLLPPRLNLNTAIQPGTNS--SSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             +G LPPR        P T     SW    EWLD+Q+  +VV+V FGSE K    ++ E+A
Sbjct  244   VGQLPPR-------DPETRGEIDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIA  296

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+L+     +     +LP  F  R   +G V   W PQ  IL H ++GG
Sbjct  297   LGLELSGLPFFWVLKTRLGSSDTESVVLPNGFEERVKGRGVVWDSWVPQLKILEHDSVGG  356

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H+GW +++E+L F   LIL   +ADQGLNA+ L E++IGY +PR E DGS +R  VA
Sbjct  357   FLTHAGWSSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVA  416

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              S+R VM   +G   R KA +M  IFG+ N+ + Y++  + Y +
Sbjct  417   ESLRLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLK  460



>gb|AAD15567.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
Length=470

 Score =   347 bits (890),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 185/465 (40%), Positives = 280/465 (60%), Gaps = 17/465 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPP-IPASFTERLSLRE  248
             + HV++FPWLAFGHM+P LE +K +A KG +VSF+STP+N+ RL P +P + +  ++  +
Sbjct  13    KLHVVMFPWLAFGHMVPYLELSKLIAQKGHKVSFISTPRNIDRLLPWLPENLSSVINFVK  72

Query  249   IALPSVPG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++LP     LPE+ EAT D+   E + +LK AYD +  P  E +    P+ +L DFA  W
Sbjct  73    LSLPVGDNKLPEDGEATTDV-PFELIPYLKIAYDGLKVPVTEFLESSKPDWVLQDFAGFW  131

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +P I++R G+ T F S +  ATL  L  P  EE R+     SP  F  PP W  F + VA
Sbjct  132   LPPISRRLGIKTGFFSAFNGATLGILKPPGFEEYRT-----SPADFMKPPKWVPFETSVA  186

Query  600   HRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
              +      + +        G V    R+  VI+GCD + VRSC E+E E++ L ++L+++
Sbjct  187   FKLFECRFIFKGFMAETTEGNVPDIHRVGGVIDGCDVIFVRSCYEYEAEWLGLTQELHRK  246

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+ +G+LPP+ +     +   ++ +W    +WLD+++ KS+V+V FGSE K    +++E
Sbjct  247   PVIPVGVLPPKPD-----EKFEDTDTWLSVKKWLDSRKSKSIVYVAFGSEAKPSQTELNE  301

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             +A  LELS +PF W+L+         P  LP  F  RT+++G V  GW  Q   L+H +I
Sbjct  302   IALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHDSI  361

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             G  L H GWGTIIE++ F  P+ +L  V DQGLNA+++ EK+IGY +PR E +G F+++ 
Sbjct  362   GLVLTHPGWGTIIEAIRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFTKES  421

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             VANS+R VM   EG+  R    +M  +FG+ +  D Y+D F+EY 
Sbjct  422   VANSLRLVMVEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLEYL  466



>ref|XP_009623233.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=484

 Score =   347 bits (891),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 186/468 (40%), Positives = 274/468 (59%), Gaps = 6/468 (1%)
 Frame = +3

Query  60    MAAE--QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTER  233
             MA E  + H+ + PWLAFGHMLP LE AK +A KG ++SF+STP+N+ RLP +P + +  
Sbjct  1     MATENKKLHIAMVPWLAFGHMLPYLELAKHIALKGHKISFISTPRNIDRLPKLPPNISPF  60

Query  234   LSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
             +   +I L  V  LP++ EAT DL   E+VQ+LK AYD +       ++ + P+ I  DF
Sbjct  61    IRFVKIPLQPVENLPKDAEATTDL-PYEKVQYLKIAYDALRDSIRHFLQTNKPDWIFFDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHS  590
             A +W   IA    +++ F S+  AA L +LG    L SG       +  T  P W NF +
Sbjct  120   AAYWAGPIATELNISSAFFSIMIAAVLGFLGPAPVLMSGYGTLDELKVLTASPKWVNFPT  179

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              VA R  Y    M+++ T + S  S   R  + I+ CD ++ RSC EFE E++ L+E+++
Sbjct  180   TVAFRL-YEVLRMKDSFTGNMSEASDIYRFGAGIKSCDVLLNRSCSEFEPEWLHLVEQIH  238

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++PV  +G L P    N   +     +  S   +WLD+Q   SV++V FGSE K    ++
Sbjct  239   RKPVFPVGQLSPLTIDNCDDESNGVWTGGSTIKQWLDSQEKGSVIYVAFGSEAKPSQEEL  298

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  LELS +PF W+LRK   +       LP  F  RT+++G V  GWAPQ  IL+H 
Sbjct  299   TEIAHGLELSGLPFFWVLRKQRGEFDTDLIELPEGFEERTNDRGMVCTGWAPQLKILSHD  358

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             ++GG L HSGW +++E+L +   LILLP ++DQGLNA+LL EK++ Y +PR E +G+F+R
Sbjct  359   SVGGFLTHSGWSSVVEALSYEKALILLPFLSDQGLNARLLEEKKMAYSIPRDEREGTFTR  418

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             D VANS+  VM    G+  R  A  M  +F +    + Y+D  ++Y Q
Sbjct  419   DSVANSLSLVMLEEGGKVYRENAKNMRELFADKGKQEKYVDNLMKYLQ  466



>ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF35043.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=470

 Score =   347 bits (889),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 177/470 (38%), Positives = 267/470 (57%), Gaps = 10/470 (2%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV +FPWLA GH++P L F+  LA KG  VSF+STP NL RLP IP   +  +SL  +
Sbjct  6     KLHVAVFPWLAMGHLIPFLRFSNLLAQKGHLVSFISTPGNLHRLPKIPPQLSSHISLISL  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LPSVPGLP N E T D+   +Q Q LK A+D +  P    +    P+ ++ D+A+HW+P
Sbjct  66    PLPSVPGLPSNAETTTDVPYTKQ-QLLKKAFDLLESPLATFLETKKPDWVIYDYASHWLP  124

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPE-ELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
              IA + G+++ F S++TAATL+++G P   +  G LR + E FT+ P W  F S + +  
Sbjct  125   SIASKVGISSAFFSLFTAATLSFIGPPSLTMNGGDLRLTAEDFTIVPRWVPFESNIKYCI  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +G +   R +    G D VI+RS  EFE E+ DL  K+ ++P++ 
Sbjct  185   HEVTKYIEKTEE-DETGPNDTVRFAFASGGADVVIIRSSPEFEPEWFDLYSKMSEKPIIP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP            +   W++  EWLD +  +SVV+V  G+E  +   ++ ELA  
Sbjct  244   LGFLPPLEVEEEDDD--IDVKGWADIIEWLDKKEAESVVYVALGTEAALTRQEVRELALG  301

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LE SR PF+W+L+ P         +L   +  R  ++G +  GW PQ  IL+H ++GG L
Sbjct  302   LEKSRSPFIWVLKNPPGTTQNALEMLQDGYEERVKDRGMIYCGWVPQVKILSHESVGGFL  361

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H GW +++E L FG  LIL P++ DQGLNA+LL  K+IG EVPR E DG+F+ D VA  
Sbjct  362   THCGWNSVVEGLSFGRVLILFPVLNDQGLNARLLHGKKIGLEVPRNESDGAFTSDSVAEL  421

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
             +R        +     A +M N+FG+ + ++   +  + Y +   +++ K
Sbjct  422   VRKAKVDDPAD----LAKEMRNLFGDRDRNNRLAEGVVHYLEENRISRLK  467



>ref|XP_007018258.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY15483.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=466

 Score =   347 bits (889),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 178/462 (39%), Positives = 268/462 (58%), Gaps = 9/462 (2%)
 Frame = +3

Query  75    CHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIA  254
              H+++FPWLA GH +P    +K LA +G R+SFVSTP+NL +LP IP++ + +++L    
Sbjct  7     LHIVMFPWLAMGHFIPFFRLSKLLAQRGHRISFVSTPRNLSKLPKIPSNLSSQITLVSFP  66

Query  255   LPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPE  434
             LP VP LP   E+++D+   +Q Q LK A+D + P     +    P+ I+ D+A+HW+P 
Sbjct  67    LPEVPNLPSLAESSMDITHNQQ-QPLKHAFDLLQPLLTSFLESSKPDWIIYDYASHWLPS  125

Query  435   IAKRYGVATVFLSVYTAATLAYLGSPEELRSGK--LRPSPEHFTVPPGWFNFHSLVAHRP  608
             +A + GV+  F +V+TAA L++LG P  L +G    R + + FT  P W  F S +A+R 
Sbjct  126   VAAQLGVSRAFFAVFTAACLSFLGPPSALINGGDGARSTADDFTKVPKWVPFESNLAYRL  185

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D  G     R    I+  D V++RS  EFE ++ +LL +L+++PV  
Sbjct  186   HEITKYVERTDE-DTFGPPDTVRFGVTIQESDVVVIRSSDEFEPDWFNLLRQLFEKPVTP  244

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP L     IQ       W    EWLD QR  SVV+V  G+E  +   ++ +LA  
Sbjct  245   VGFLPPILE-EDEIQ---KDEKWVVVKEWLDKQRVNSVVYVALGTEVHLSKEELSDLAMG  300

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LE S +PF W+L+K    +     +LP     R   +G V LGW PQ  IL+H +IGG L
Sbjct  301   LEKSGLPFFWVLKKSPGSSQSELDMLPDGLEERVKGRGFVHLGWVPQVKILSHESIGGFL  360

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H GW ++IE+LG G  LI+ P++ DQGLNA+LL E+++G E+PR E DGSF+ D VA S
Sbjct  361   THCGWNSVIEALGLGRVLIMFPVLNDQGLNARLLHERKVGVEIPRNEIDGSFTSDEVAES  420

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             +R  +    G+ +R     + + FG+   +D Y+D+F+   +
Sbjct  421   VRLAVVEESGQSLRETVQAIKSYFGDKGRNDGYVDKFVRQLE  462



>ref|XP_006415140.1| hypothetical protein EUTSA_v10007607mg [Eutrema salsugineum]
 gb|ESQ33493.1| hypothetical protein EUTSA_v10007607mg [Eutrema salsugineum]
Length=452

 Score =   346 bits (887),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 180/461 (39%), Positives = 266/461 (58%), Gaps = 19/461 (4%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV +FPWLA GH+LP L  +K LA KG +V F+STP+N++RLP +P++ +  ++     L
Sbjct  9     HVAMFPWLAMGHLLPFLRLSKLLAQKGHKVLFISTPRNIKRLPKLPSNLSSSITFVSFPL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P+ PG     E ++D+   +Q Q LK+++D +  P  + +R   P+ ++ D+A+HW+P++
Sbjct  69    PAFPGSTPGSECSMDVSFNKQ-QSLKSSFDLLQLPLTKFLRDSSPDWVVYDYASHWLPQV  127

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A   G++  F S++ AA+L +LG P  L     R  PE FTV P W  FHS +A+R  + 
Sbjct  128   AAELGISKAFFSLFNAASLCFLGPPS-LLIDNFRSKPEDFTVVPPWIPFHSNIAYRY-HE  185

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
              T++ +    D +GVS   R    I  CD V V S  EFE E++ LL++LY++PV   G 
Sbjct  186   ITLVGDKKEKDTTGVSDPVRFGYSISNCDAVFVHSSPEFEPEWLGLLQELYQKPVFPTGF  245

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             LP    +          ++W    +WLD QR  SVV+V  G+E  +   ++ ELA  LE 
Sbjct  246   LPTDAEVE-------GDTTWIAIKKWLDMQRVNSVVYVALGTEAILCPEELTELAHGLEK  298

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S +PF W+LR          + +P  F  R   +G V  GWAPQ NIL+H ++GG L H 
Sbjct  299   SDVPFFWVLRNE--------SQVPDGFEERVEGRGMVHFGWAPQVNILSHDSVGGFLTHC  350

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIRS  1334
             GW +++E LG G   I  P++ +QGLN +LL  K +G E+PR E DG+F  D VA S+R 
Sbjct  351   GWNSLVEGLGLGRVPIFFPVLNEQGLNTRLLEGKGLGVEIPRDEKDGAFDSDSVAYSVRL  410

Query  1335  VMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              M    GE IR KA  M  +FGN + +  Y+D+ + Y  SK
Sbjct  411   AMIDDAGESIRAKAKLMKGLFGNIDENSRYVDELLGYMTSK  451



>ref|XP_006353004.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Solanum tuberosum]
Length=474

 Score =   346 bits (888),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/476 (38%), Positives = 283/476 (59%), Gaps = 14/476 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLR  245
             E+ HV++FPWLA GH++P    +K LA +G RV+F+STP+N++R+   +P+     L + 
Sbjct  6     ERLHVVMFPWLAMGHIIPFFHLSKCLAQRGHRVTFISTPRNIERVVNKVPSDLAPLLHIL  65

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPP---FEELVRRDLPELILVDFA  416
                LP V  LP + E+++D+  Q + QFLK A+D +  P   F E      P+ I+ D+A
Sbjct  66    SFPLPKVENLPNDAESSMDIPYQ-KAQFLKIAFDLLEIPLTNFLESSSNPKPDWIVYDYA  124

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             +HW+P+IA + GV+  F S++TAAT+++ G P  L +   R  PE +TV P W    + V
Sbjct  125   SHWLPQIAGKLGVSRAFFSLFTAATMSFYGPPWALLNDD-RSIPEDYTVIPKWIPLETKV  183

Query  597   AHRPDYAPTMMRNTHTP-DASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
              +R      + +N   P D SG S G R  + I+G D ++ R+C EFE E+  L+ +LY+
Sbjct  184   VYR---LHEIKKNFEAPADESGTSDGVRFGASIDGSDVILFRNCVEFEPEWFSLVCELYQ  240

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV++IG+LPP +  N      +N ++W     WLD Q   SVV+V  G+E  +   +++
Sbjct  241   KPVISIGVLPPSVVENEKFD--SNDTTWLGIKNWLDKQNQDSVVYVALGTEATLNQEELN  298

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPAL-LPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             ELA  LE   +PF+W+LR   I N     + LP  + +R  N+G +  GW PQ  IL+H 
Sbjct  299   ELALGLEKCGLPFIWVLRDQPIHNQEDSRIQLPDGYEDRVKNRGVIYKGWVPQTKILSHL  358

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             ++GG L H GW ++IE+L FG  LI+ P++ DQGLN +LL EK +G E+PR E DG F+ 
Sbjct  359   SVGGFLTHCGWNSVIEALCFGRVLIMFPVLNDQGLNTRLLQEKGVGVEIPRNEKDGFFTS  418

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
             D VA +++  + S EGE +R  A QM+ +FG+   ++  ID  + Y     ++  K
Sbjct  419   DSVAEAVKFGVVSEEGELLRDNARQMSGLFGDRKRNEELIDDCVGYLMENRISISK  474



>ref|XP_006396998.1| hypothetical protein EUTSA_v10028640mg [Eutrema salsugineum]
 gb|ESQ38451.1| hypothetical protein EUTSA_v10028640mg [Eutrema salsugineum]
Length=466

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/461 (40%), Positives = 266/461 (58%), Gaps = 14/461 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV +FPWLA GH+LP L  +K LA KG ++SF+STP+N++RLP +P++ +  ++     L
Sbjct  15    HVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLPSNLSSSITFVSFPL  74

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P  P LP + E+++D+    Q Q LK+A+D +  P  E +RR  P+ I+ D+A+HW+P I
Sbjct  75    PPFPNLPPSSESSMDVPYINQ-QSLKSAFDLLKLPVTEFLRRSSPDWIIYDYASHWLPSI  133

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A   G++  F S++ A+ L ++G P  L     R +PE FTV P W  F S +  R    
Sbjct  134   AMELGISKAFFSLFNASALCFMGPPSSLIE-DFRSTPEDFTVVPLWIPFESKIVFRYHEV  192

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
                +  T   D +GVS   R    I   D V VRSC EFE E+  LL+ LY++P+   G 
Sbjct  193   TRYVEKTEE-DVTGVSDSVRFGYSISESDAVFVRSCPEFEPEWFGLLQDLYQKPIFPTGF  251

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             LPP   ++  +      ++W    EWLD QR  SVV+V  G+E  +P  ++ ELA  LE 
Sbjct  252   LPP---VSEDVDGEEEDATWVCIKEWLDKQRVNSVVYVSLGTEASLPQEELVELALGLEK  308

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S++PF W+LR           L+   F  R   +G V +GW PQ  IL+H ++GG L H 
Sbjct  309   SKVPFFWVLRNE-------ETLILDGFEERVKGRGMVQVGWVPQVKILSHESVGGFLTHC  361

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIRS  1334
             GW +++E LGFG   I LP++ +QGLN +LL  K IG EVPR E DGSF  D VA+S+R 
Sbjct  362   GWNSVVEGLGFGRVPIFLPVLNEQGLNTRLLEGKGIGVEVPRNERDGSFDSDSVADSVRL  421

Query  1335  VMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              M    GE  R  A  M  +FGN + +  Y+D+ + Y +SK
Sbjct  422   AMVDGGGESKRANAKMMKGLFGNKDENIRYVDELVGYMRSK  462



>gb|KCW79472.1| hypothetical protein EUGRSUZ_C00857, partial [Eucalyptus grandis]
Length=453

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 192/460 (42%), Positives = 275/460 (60%), Gaps = 21/460 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ HV +FPWLA+GH++P LE A  LA KG R+SF+STPKNLQ+LP   A+    ++L E
Sbjct  5     EKLHVAMFPWLAYGHLMPFLEVATFLARKGHRISFISTPKNLQKLP---ANLPSSITLVE  61

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP++ E+T +L  Q  V +LK AYD + P   E +       ++ DF + W+
Sbjct  62    LPLPRVHGLPDSAESTSEL-LQNMVPYLKKAYDMLEPAVAEFLVNSDVNWVIQDFMSFWL  120

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRP-SPEHFTVPPGWFNFHSLVAHR  605
             P+ A++ GV +VF S++ A+ LA++G P  L   + R  + E  TV P W  + + +A R
Sbjct  121   PQKARQLGVKSVFFSIFNASILAFIGPPSLLIDNQARAKTAEDLTVVPQWVTYPTKIAFR  180

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                   +         S +S  +R    I+GCD V +R+C EFE E + LL+K Y RPV+
Sbjct  181   --LHEVLNEEDFVDPKSNMSVFERFGRSIQGCDIVAIRTCSEFEAEPLSLLKKFYARPVV  238

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLL P+   N +   G     WSE  +WLD +  KSV +V  G+E  +    +HELA 
Sbjct  239   PMGLLSPQ---NKSRHEG--DGRWSELKQWLDGKEGKSVFYVALGTEVALSQELMHELAR  293

Query  966   ALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++ RK G      P+ +P+ F +R S +G V +GWAPQ +ILAHP+IGG
Sbjct  294   GIEKSGLPFVWVISRKAG------PSSIPSGFESRVSGRGLVWVGWAPQLDILAHPSIGG  347

Query  1143  CLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
              L H GW ++IE+LG G  LIL     +DQGL A+L+ E+ +G EVPR   DGSF+ D V
Sbjct  348   FLTHCGWSSVIEALGQGRALILFSGGSSDQGLMARLMDERRVGSEVPRDSRDGSFTSDSV  407

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQF  1436
             A +I+ VM   EGE +R  A  M  IFGN      Y+++F
Sbjct  408   AETIKWVMVEPEGEEVRANAWAMREIFGNVESQLKYLEEF  447



>ref|XP_010050451.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=563

 Score =   347 bits (890),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 197/474 (42%), Positives = 281/474 (59%), Gaps = 24/474 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPP-IPASFTERLSLR  245
             E+ HV +FPWLA+GH++P LE A  LA KG R+SF+STPKNLQ+LP  +P+S T    L 
Sbjct  5     EKLHVAMFPWLAYGHLMPFLEVATFLARKGHRISFISTPKNLQKLPANLPSSIT----LV  60

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             E+ LP V GLP++ E+T +L  Q  V +LK AYD + P   E +       ++ DF + W
Sbjct  61    ELPLPRVHGLPDSAESTSEL-LQNMVPYLKKAYDMLEPAVAEFLVNSDVNWVIQDFMSFW  119

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR-PSPEHFTVPPGWFNFHSLVAH  602
             +P+ A++ GV +VF S++ A+ LA++G P  L   + R  + E  TV P W  + + +A 
Sbjct  120   LPQKARQLGVKSVFFSIFNASILAFIGPPSLLIDNQARAKTAEDLTVVPQWVTYPTKIAF  179

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R      +         S +S  +R    I+GCD V +R+C EFE E + LL+K Y RPV
Sbjct  180   R--LHEVLNEEDFVDPKSNMSVFERFGRSIQGCDIVAIRTCSEFEAEPLSLLKKFYARPV  237

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLL P+   N +   G     WSE  +WLD +  KSV +V  G+E  +    +HELA
Sbjct  238   VPMGLLSPQ---NKSRHEG--DGRWSELKQWLDGKEGKSVFYVALGTEVALSQELMHELA  292

Query  963   SALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
               +E S +PF+W++ RK G      P+ +P+ F +R S +G V +GWAPQ +ILAHP+IG
Sbjct  293   RGIEKSGLPFVWVISRKAG------PSSIPSGFESRVSGRGLVWVGWAPQLDILAHPSIG  346

Query  1140  GCLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDM  1313
             G L H GW ++IE+LG G  LIL     +DQGL A+L+ E+ +G EVPR   DGSF+ D 
Sbjct  347   GFLTHCGWSSVIEALGQGRALILFSGGSSDQGLMARLMDERRVGSEVPRDSRDGSFTSDS  406

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
             VA +I+ VM   EGE +R  A  M  IFGN      Y+++F    + K+ T  K
Sbjct  407   VAETIKWVMVEPEGEEVRANAWAMREIFGNVESQLKYLEEFARALE-KVTTNEK  459



>ref|XP_008378603.1| PREDICTED: UDP-glycosyltransferase 91C1 [Malus domestica]
Length=487

 Score =   344 bits (883),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 187/471 (40%), Positives = 265/471 (56%), Gaps = 12/471 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P    +  +A +G  VSFVSTP+NL RLP IP+  +  ++L    L
Sbjct  21    HVVVFPWLAMGHLIPFFHLSTLIAQRGHTVSFVSTPRNLSRLPKIPSHLSSLVNLVSFPL  80

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P +P LP + E++ D+   +Q Q LKTA+D +  P    +    P+ ++ D+A HW+P I
Sbjct  81    PRLPNLPNDAESSTDVPFHKQ-QLLKTAFDMLQTPLTAFLESSRPDWVIYDYAPHWLPAI  139

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRPDY  614
             A R GVA  F     AA LAYLG P  L SG+  R   E FTV P W  F S +A+R   
Sbjct  140   AARLGVAHAFFFCVNAACLAYLGPPSVLISGQDGRTKAEDFTVVPKWVPFESDMAYRLHE  199

Query  615   APTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI-  791
                 ++ + + + SG     R    IE  D V VRS  EFE E+++L+ +LY+   +   
Sbjct  200   VAKWVQAS-SGNESGTPDTVRFGVAIEESDVVFVRSSDEFEPEWLNLVRELYREVKVKPV  258

Query  792   ---GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
                G LPP    N   +      +W     WLD QR  SVV++  G+E  +   ++ ELA
Sbjct  259   VPVGFLPP----NIEEEASEFDETWGGIKGWLDKQRVNSVVYIALGTEATLSQEELTELA  314

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+LR P         +LP  F+ R   +G V LGWAPQ  IL+H + GG
Sbjct  315   LGLELSGVPFFWVLRNPPESTQSVSEMLPPGFLERVKGRGVVDLGWAPQVRILSHDSXGG  374

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GW ++IE L FG  L+  PMV DQGLNA+L   K +G E+PR E DGSF+RD VA
Sbjct  375   FLTHCGWNSMIEGLMFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFTRDSVA  434

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQC  1472
               +R  M    GE +R++A +M ++FG+ N ++  + +FI + +     +C
Sbjct  435   EFVRLAMVDDSGESMRIRAKEMKDLFGDRNKNNRIVGEFICFLEENRPPRC  485



>ref|XP_008388229.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=465

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 277/469 (59%), Gaps = 20/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ D   +W+
Sbjct  65    LPLPAVDGLPESVESTSELPIN-KVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDIICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V  ++Y A TLA+ G P EL   +    PE FTV P W ++ S VA   
Sbjct  124   PRVATQLGVNSVCFNIYNATTLAFFGPPSELLXCR---RPEDFTVVPDWVDYPSNVA---  177

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    M +        VS  +RL+  I+ C+FV +RSC EFE   + LL K+Y +PV+ 
Sbjct  178   -FKLHEMVSHWDCMNDEVSDFKRLAGSIQDCNFVTMRSCTEFESVAVSLLRKIYGKPVVP  236

Query  789   IGLLPPRLNLNTAIQPGT----NSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             +GLLPP    +T  Q G         W    EWL+N++P SVV++  G+E  +    +HE
Sbjct  237   LGLLPPG---STPYQHGVANDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHE  293

Query  957   LASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  +E S +PF+W++  +P ++    P ++P  F  R  ++G V+ GWAPQ  IL HP+
Sbjct  294   LAHGIEKSGLPFIWVVNNRPLVEGVFGPDVIPLGFQTRVEDRGLVLRGWAPQLKILGHPS  353

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             +GG L H GW +++E+LGFG  LIL     +DQGL A+L+ EK +G E+PR E DGSF+ 
Sbjct  354   VGGFLTHCGWSSVVEALGFGRVLILFSGANSDQGLIARLMHEKRVGLEIPRDERDGSFTS  413

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             D VA   R VM  REGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  414   DSVAEVTRRVMVEREGESIRSNAWAMKEIFGNVELNNACLDEFTRVLET  462



>ref|XP_009361645.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Pyrus x bretschneideri]
Length=469

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/466 (40%), Positives = 278/466 (60%), Gaps = 12/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ R+    +SF+  +   E
Sbjct  7     KKLHIAMFPWLAYGHLVPFLEVSKFLAQKGHQISFISTPKNINRIR--SSSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPAVDGLPESAESTSELPIN-KVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A TLA+ G P EL S K R  PE FTV P W N+ S  A + 
Sbjct  124   PRVATQLGVNSVYFNITNATTLAFFGPPSELLSDK-RWRPEDFTVVPEWVNYPSNGAFK-  181

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  M+ +    D   VS   R++  I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  182   --LHEMVSHWDCMDDE-VSDFHRVAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  238

Query  789   IGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +GLLPP  +     +       +W     WL+N++P SVV++ FG+E       +HELA 
Sbjct  239   LGLLPPGSVPQQQGVADDRGDETWGVLRGWLENKKPNSVVYIAFGTEVTPSQELMHELAD  298

Query  966   ALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++  +P ++      ++P  F  R  ++G V  GWAPQ  IL H ++GG
Sbjct  299   GIEKSGLPFIWVVNNRPLVEGVLGADIIPPGFQTRVEDRGLVWRGWAPQLKILGHISVGG  358

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW +++E+LG G  LIL     ADQGLNA+L+ +K +G E+PR E DGSF+ D V
Sbjct  359   FLTHCGWSSVVEALGHGRALILFSGANADQGLNARLMQDKRVGLEIPRDERDGSFTSDSV  418

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A  IR VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  419   AELIRRVMVEKEGESIRSNAWAMKEIFGNVELNNRCLDEFTRTLET  464



>ref|XP_008342850.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=468

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/466 (39%), Positives = 274/466 (59%), Gaps = 13/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPAVDGLPESVESTSELPIN-KVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A TLA+ G P EL   K R   E FTV P W ++ S VA + 
Sbjct  124   PRVATQLGVNSVYFNITNATTLAFFGPPSELLGDK-RKRXEDFTVVPEWVDYPSNVAFKL  182

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                 +     H      VS  QRLS  I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  183   HEMVS-----HWDCMDEVSDFQRLSGAIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  237

Query  789   IGLLP-PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +GLLP         +        W    EWL+N++P SVV++  G+E  +    +HELA 
Sbjct  238   LGLLPLGSAXHQHGVADDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELAR  297

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++  +P ++      ++P  F  +  ++G V+ GWAPQ  IL HP++GG
Sbjct  298   GIEKSGLPFIWVVNNRPLVEGVLGSDIIPFGFQTQVEDRGLVLRGWAPQLKILGHPSVGG  357

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW +++E+LGFG  LIL     ADQGL ++L+ EK +G E+PR E DGSF+ D V
Sbjct  358   FLTHCGWSSVVEALGFGRALILFSGANADQGLISRLMHEKRVGLEIPRDEQDGSFTSDSV  417

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A   R VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  418   AEVTRRVMVEKEGESIRSNAWAMKEIFGNLELNNTCLDEFTRVLET  463



>ref|XP_010047532.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW79475.1| hypothetical protein EUGRSUZ_C00861 [Eucalyptus grandis]
Length=458

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 189/465 (41%), Positives = 277/465 (60%), Gaps = 21/465 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ HV +FPWLA+GH++P LE A  LA KG R+SF+STPKNLQ+L   PA+    ++L E
Sbjct  5     EKLHVAMFPWLAYGHLMPFLEVATFLAQKGHRISFISTPKNLQKL---PANLPPSITLVE  61

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP++ E+T +L     V +LK AYD + P   E +     + ++ DF + W+
Sbjct  62    LPLPRVHGLPDSAESTSEL-LHNMVPYLKKAYDMLEPAVAEFLANSDVDWVIQDFMSFWL  120

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRP-SPEHFTVPPGWFNFHSLVAHR  605
             P+ A+R GV + F S+++A TL + G P  L   + R  + E  TV P W  + + VA R
Sbjct  121   PQKARRLGVKSAFFSIFSATTLVFCGPPSLLIDSRARAKAAEDLTVVPPWVTYPTKVAFR  180

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                   +         + +S  QR+  +I+GC+ V  R+C EFE E + LL+KLY R V+
Sbjct  181   --LHEVINEEDMVDSDANMSVLQRVGRLIQGCEIVATRTCSEFEAEPLSLLKKLYGRAVV  238

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLLPP+   N +   G     WSE  +WLD++  KSV ++  G+E  +    +H+LA 
Sbjct  239   PMGLLPPQ---NKSRHEG--DGRWSELKQWLDDREEKSVFYIALGTEVALSQELMHQLAC  293

Query  966   ALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++ RK G      P  +P+ F +R   +G V +GWAPQ +ILAHP++GG
Sbjct  294   GIEKSGLPFVWVVGRKAG------PGSIPSGFESRVLGRGFVWVGWAPQLDILAHPSVGG  347

Query  1143  CLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW ++IE+LG G  LI+     +DQGL A+L+ E+ +G EVPR + DGSF  D V
Sbjct  348   FLTHCGWSSVIEALGQGRALIVFSGGSSDQGLVARLMDERRVGSEVPRNDRDGSFMGDSV  407

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             A +IR VM   EGE +R  A  M  IFGN  L   Y+++F +  +
Sbjct  408   AKTIRRVMVEPEGEEVRANAWAMREIFGNVELQHKYLEEFAQVLE  452



>ref|XP_010431575.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=471

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 276/466 (59%), Gaps = 18/466 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV +FP+LAFGHM+P LE +K +A KG  VSF+STP+N+ RL P +P + +  ++  +
Sbjct  13    KLHVAMFPFLAFGHMVPYLELSKLIAQKGHTVSFISTPRNIDRLLPRLPENLSSAINFVK  72

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             + LP V    LPE+ EAT DL   E + +LK AYD +  P  E +    P+ +L DFA +
Sbjct  73    LPLPVVGDNKLPEDGEATTDL-PVELISYLKIAYDGLKSPVTEFLESSKPDWVLQDFAAY  131

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             W+P I++R G+ T FLS Y  ATL  L  P  EE R+      P  F  PP W  F + V
Sbjct  132   WLPPISRRLGIKTGFLSAYNGATLGILKPPGFEEYRT-----CPADFMKPPKWVPFETPV  186

Query  597   AHRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             A +      +          G V    R+  VI+GCD + VRSC E+E E++ +++ L++
Sbjct  187   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  246

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +G+LPP+L      +   ++ +W    +WLD+++ KSVV+V FGSE K    +++
Sbjct  247   KPVIPVGVLPPKLE-----EKFEDTDTWLTVKKWLDSRKAKSVVYVAFGSEAKPSQTELN  301

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PF W+LR         P  LP  F  RT+++G V  GW  Q   L+H +
Sbjct  302   EIALGLELSGLPFFWVLRTRRGSGDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHES  361

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             IG  L H GWGTIIE++ F  P+ +L  + DQGLNA+++ +K+IGY +PR E +G F+++
Sbjct  362   IGLALTHPGWGTIIEAIRFSKPMAVLVFLNDQGLNARVIEQKKIGYMIPRDETEGFFTKE  421

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
              VA S++ VM   EG+  R     M  +FG+ +  D Y+D F++Y 
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYL  467



>ref|XP_003564684.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Brachypodium 
distachyon]
Length=476

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 264/467 (57%), Gaps = 23/467 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++ PWLAFGH+LP  EFAK++A +G RV+  STP+N +RL  IP     R+ + +I L
Sbjct  9     HVVMLPWLAFGHILPFTEFAKRVARQGHRVTLFSTPRNTRRLIDIPEGLAARIRVVDITL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDL-------PELILVDFA  416
             P V  LPE+ EA+ DL   +    L+ AYD     F+  + R L       P+ +L+D+A
Sbjct  69    PRVERLPEHAEASFDLPSDDLRPCLRRAYD---AAFQRELSRLLHEDQTPRPDWVLIDYA  125

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG--KLRPSPEHFTVPPGWFNFHS  590
              +W PE+A R+GV   FLS++ AA L + G+P+ L       +  P HFTV P +  F +
Sbjct  126   AYWAPEVAARHGVPCAFLSLFGAAALGFFGTPDALTGTGEHAKTEPAHFTVVPEYVPFPT  185

Query  591   LVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLY  770
              V +R   A  M      PD SGVS G R +  IEG   V +RS  E E E++ LL +LY
Sbjct  186   TVCYRGYEAREMFEPGMVPDDSGVSEGYRFAKSIEGSQLVGIRSSVEIEPEWLQLLGQLY  245

Query  771   KRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             ++PV+ +GL PP         P  N S   E   WLD   P +VV+  FGSE K+   Q+
Sbjct  246   QKPVIPVGLFPP--------PPQQNISGHEETLRWLDGHAPSTVVYAAFGSEAKLTSAQL  297

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
               +A  LE S +PF+W  R+P     G    LP  F  R   +G V  GW PQ   LAH 
Sbjct  298   RRIALGLEQSGLPFVWAFREPADGADG--CCLPEGFEERVEGRGLVCRGWVPQVRFLAHG  355

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             ++GG L H+GW +I E L  G  L+LLP++ +QGLNA+ LV+K++G EV R E DGSF+ 
Sbjct  356   SVGGFLTHAGWNSIAEGLARGVRLVLLPLIFEQGLNARHLVDKKVGVEVARDEQDGSFAA  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
               +A ++R VM   EGE    K  ++A +FG+  ++D  +  F+ + 
Sbjct  416   QDIAAALRKVMVDDEGEVSGAKVRELAQVFGDDEVNDQCVRDFLSHL  462



>ref|XP_010442438.1| PREDICTED: UDP-glycosyltransferase 91C1 [Camelina sativa]
Length=465

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/461 (41%), Positives = 265/461 (57%), Gaps = 19/461 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  H+ +FPWLA GH+LP L  +K LA KG ++SF+STP+NL+RLP +P++ +  ++   
Sbjct  8     EVMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITFVS  67

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GL    E+++D+   +Q Q LK A+D +  P +E + R  P+ I+ D+A+HW+
Sbjct  68    FPLPLISGLSPTSESSMDVPYNKQ-QSLKAAFDLLQAPLKEFLGRSSPDWIIFDYASHWL  126

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL +LG P      +LR +PE FTV P W  F S +A R 
Sbjct  127   PSIAAELGISKAFFSLFNAATLCFLG-PSSSLIDELRTTPEDFTVVPPWVPFKSNIAFRY  185

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    I   D V VRSC EFE E+  LL+ LY++PV  
Sbjct  186   HEVTRYVEKTDE-DVTGVSDSVRFGYSIGESDAVFVRSCPEFEPEWFGLLKDLYQKPVFP  244

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
              G LPP +  +       + ++W    EWLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  245   SGFLPPVIEEDDD-----DDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALG  299

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE S  PF W+LR +P I         P  F      +G V +GW PQ  IL H ++GG 
Sbjct  300   LEKSETPFFWVLRNEPHI---------PDGFEETVKGRGMVHVGWVPQVKILRHESVGGF  350

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E LGFG   I LP++ +QGLN +LL  K IG EV R E DGSF    VA+
Sbjct  351   LTHCGWNSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVAD  410

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEY  1445
             S+R VM   EGE IR KA  M  +FGN + +  ++D+ + +
Sbjct  411   SVRLVMVDEEGESIRDKAKLMKGLFGNMDENIRHVDEIVSF  451



>gb|KCW59683.1| hypothetical protein EUGRSUZ_H02441 [Eucalyptus grandis]
Length=475

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/465 (39%), Positives = 266/465 (57%), Gaps = 12/465 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  H+++ PWLAFGHM P LE AK +A KG R+SF+S P+N+ RLP      T  +S  +
Sbjct  6     DNLHIVMLPWLAFGHMTPYLELAKLMAGKGHRISFLSAPRNIDRLPKPTPDLTPLISFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP++  LPE  EAT DL   +++Q+LK AYD +  P    +    P+ I+ DFA +W 
Sbjct  66    LPLPAIEHLPEGAEATSDL-PYDKIQYLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
               IA R G+ +VF ++   A L ++G  ++ + G  R +PE FT PP W  F + VA   
Sbjct  125   GSIASRLGIRSVFFTILIGAGLGFIGPSQDSKGGDYRKTPEDFTRPPKWVPFPTKVAFH-  183

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    + ++ T +ASGV+   RL +  E CD + +RS  E E E++ LL+ +Y +PV  
Sbjct  184   HFEIKKIFDSVTGNASGVTDLYRLKASQENCDIIALRSSYEVEPEWLTLLKDVYAKPVFP  243

Query  789   IGLLPPRLNLNTAIQPGT--NSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             +G LPP         P +   + +W    EWLD Q+  +VV+V FGSE K    ++ E+A
Sbjct  244   VGQLPPG-------DPDSRGETETWRLIKEWLDAQKNGTVVYVAFGSESKPTQTELTEIA  296

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+L+           +LP  F  R   +G V   W PQ  ILAH ++GG
Sbjct  297   LGLELSGLPFFWVLKTRLGSADSELIMLPDGFEERVKGRGVVWDSWVPQLKILAHNSVGG  356

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GW + +E+L F   LIL   +ADQGLNA+LL E++IGY +PR E DGS +R  VA
Sbjct  357   FLTHGGWNSAVEALSFERALILFTFLADQGLNARLLEERQIGYSIPRNESDGSVTRQSVA  416

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+R VM   +G   R KA +M  IF + ++ + Y++  + Y + 
Sbjct  417   ESLRMVMVEEKGRVYREKAKEMRPIFEDKDIQERYVNNLLNYLKD  461



>ref|XP_010023429.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=494

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/487 (38%), Positives = 277/487 (57%), Gaps = 14/487 (3%)
 Frame = +3

Query  9     NKQIGIKLESLWF*NITMAA--EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVST  182
             ++ I ++L + +F    MA   +  H+++ PWLAFGHM P LE AK +A KG R+SF+S 
Sbjct  3     SRAIQLELPTDFFFYSAMADTHDNLHIVMLPWLAFGHMTPYLELAKLMAGKGHRISFLSA  62

Query  183   PKNLQRLPPIPASFTERLSLREIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPP  362
             P+N+ RLP      T  +S  ++ LP++  LPE  EAT DL   +++Q+LK AYD +  P
Sbjct  63    PRNIDRLPKPTPDLTPLISFVKLPLPAIEHLPEGAEATSDL-PYDKIQYLKKAYDMLQEP  121

Query  363   FEELVRRDLPELILVDFATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRP  542
                 +    P+ I+ DFA +W   IA R G+ +VF ++   A L ++G  ++ + G  R 
Sbjct  122   VARFLESSDPDWIMYDFAPYWAGSIASRLGIRSVFFTILIGAGLGFIGPSQDSKGGDYRK  181

Query  543   SPEHFTVPPGWFNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRS  722
             +PE FT PP W  F + VA    +    + ++ T +ASGV+   RL +  E CD + +RS
Sbjct  182   TPEDFTRPPKWVPFPTKVAFH-HFEIKKIFDSVTGNASGVTDLYRLKASQENCDIIALRS  240

Query  723   CKEFEGEYIDLLEKLYKRPVLAIGLLPPRLNLNTAIQPGT--NSSSWSEAFEWLDNQRPK  896
               E E E++ LL+ +Y +PV  +G LPP         P +   + +W    EWLD Q+  
Sbjct  241   SYEVEPEWLTLLKDVYAKPVFPVGQLPPG-------DPDSRGETETWRLIKEWLDAQKNG  293

Query  897   SVVFVGFGSEYKMPIHQIHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSN  1076
             +VV+V FGSE K    ++ E+A  LELS +PF W+L+           +LP  F  R   
Sbjct  294   TVVYVAFGSESKPTQTELTEIALGLELSGLPFFWVLKTRLGSADSELIMLPDGFEERVKG  353

Query  1077  QGRVILGWAPQQNILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVE  1256
             +G V   W PQ  ILAH ++GG L H GW + +E+L F   LIL   +ADQGLNA+LL E
Sbjct  354   RGVVWDSWVPQLKILAHNSVGGFLTHGGWNSAVEALSFERALILFTFLADQGLNARLLEE  413

Query  1257  KEIGYEVPRRE-DGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQ  1433
             ++IGY +PR E DGS +R  VA S+R VM   +G   R KA +M  IF + ++ + Y++ 
Sbjct  414   RQIGYSIPRNESDGSVTRQSVAESLRMVMVEEKGRVYREKAKEMRPIFEDKDIQERYVNN  473

Query  1434  FIEYFQS  1454
              + Y + 
Sbjct  474   LLNYLKD  480



>ref|XP_009795659.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=472

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 185/464 (40%), Positives = 270/464 (58%), Gaps = 14/464 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H  +FPWLAFGHM+P LE AK LA KG ++SF STPKN+QRLP +P +   ++    + L
Sbjct  8     HFFMFPWLAFGHMIPYLELAKLLAKKGHKISFFSTPKNIQRLPKLPPNLKPKIEFITLQL  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT+DL    +V++LK A+D++     +L+    P+ ++ DFA++W+  I
Sbjct  68    PHVENLPENAEATIDLPYN-KVRYLKIAFDKLQESMPKLIETLSPDFVIQDFASYWLVPI  126

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAHRPD-  611
              K+    T++ S++ A  L+  G P  +  G   R  PE FTV P W  F + V  RP  
Sbjct  127   TKKSQTPTIYFSIFPATGLSMGGDPSSIIIGDDDRVKPEDFTVKPKWVPFETNV--RPSF  184

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             Y    M N    D   VS   RL+  ++G D V +RSC EFEGE++ ++E LY++ ++ I
Sbjct  185   YQIQRMFNDLVIDGGNVSDIYRLAVTVKGVDVVAIRSCYEFEGEWLQVIENLYEKEIIPI  244

Query  792   GLLPPRLNLNTAIQPG--TNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             GLLP      T+   G   N+ +W E   WLD Q+  SVV++ FGSE K    ++  +A 
Sbjct  245   GLLP-----TTSYDDGEDDNNETWLEMKAWLDMQQKGSVVYIAFGSETKPSQDELTIIAL  299

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W+ R+           LP  F  RT+ +G +   WAPQ  IL H +IGG 
Sbjct  300   GLELSNLPFFWVFRQQRGCADSEVIELPEQFEERTNGRGFICTSWAPQLKILNHESIGGF  359

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L HSGW ++IE++ F  PLILLP +ADQG+    L EK++GY + R E DGSF+++ VA 
Sbjct  360   LTHSGWSSVIEAVQFEKPLILLPFLADQGMICSHLTEKKLGYPIFRNELDGSFTKECVAE  419

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R V+   +G+  R    +M     + ++   ++D  ++Y QS
Sbjct  420   SLRLVIVEEKGKIYRQNVKEMKES-CSKDVQQRFVDNLLDYLQS  462



>ref|XP_002270331.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=481

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 183/466 (39%), Positives = 265/466 (57%), Gaps = 19/466 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+++FPWLAFGH+LP LE +K +A +G R+SF+STP+N++RLP +P +    + L +
Sbjct  21    EKLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPNLQPLIDLVK  80

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP+   LPEN EAT DL     + +LK A+D +  P    +    P+ ++ DFA HW+
Sbjct  81    FPLPNDDNLPENAEATTDLPYG-NIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFAPHWL  139

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPE-ELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             P IA ++GV+  F  +++A  L + GS    +  G  R     F  PP W  F + VA  
Sbjct  140   PPIAAKHGVSRAFFCIFSATALCFGGSTSIMMEGGDPRTELHQFAAPPPWVTFPTKVA-L  198

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             P +      +    + SGVS   R+ S I GCD + +RSC E E E++DLL KL+++P+ 
Sbjct  199   PLFLLRRSLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLF  258

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP   +N       +  SW    EWLD Q  + VV+V  G+E      ++ ELA 
Sbjct  259   PIGLLPPSAPVN------GDDDSWPPIKEWLDKQEKECVVYVALGTEVTPTEDELTELAF  312

Query  966   ALELSRMPFLWILRK--PGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
              LELS +PF W LRK    +D       LP  F  RT  +G V   WAPQ  IL H ++G
Sbjct  313   GLELSGLPFFWALRKRHDAVD-------LPDRFEERTKGRGMVWRSWAPQLRILDHDSVG  365

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
             G + H GW ++IE L FG  LI+LP+  DQG+NA+   E ++G E+PR +E+   SR  V
Sbjct  366   GFVTHCGWSSVIEGLHFGQALIMLPLWGDQGVNARTFEEMKVGVEIPRDQEEERLSRKSV  425

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A ++  VM    G+  R KA +M+ + G+ + H  Y+  F+EY Q 
Sbjct  426   AETLSLVMVEETGKIYRNKAKEMSKLLGDKHRHHRYVSDFVEYLQK  471



>ref|XP_006282295.1| hypothetical protein CARUB_v10028581mg [Capsella rubella]
 gb|EOA15193.1| hypothetical protein CARUB_v10028581mg [Capsella rubella]
Length=458

 Score =   342 bits (876),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 185/464 (40%), Positives = 267/464 (58%), Gaps = 14/464 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  H+ +FPWLA GH+LP L  +K LA KG ++SF+STP+N+QRLP +P + +  ++   
Sbjct  7     EGMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNIQRLPKLPPNLSSSITFVS  66

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP + GL    E+++D+   +Q Q LK A+D + PP +E +    P+ I+ D+A+HW+
Sbjct  67    FPLPLISGLSPTSESSMDVPYNKQ-QSLKAAFDLLQPPLKEFLLVSSPDWIVYDYASHWL  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA   G++  F S++ AATL + G P      ++R +P+ FTV P W  F S +  R 
Sbjct  126   PSIAAELGISKAFFSLFNAATLCFQG-PSSSLIDEVRTTPDDFTVVPPWVPFKSNIVFRY  184

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +GVS   R    IEG D V VRSC +FE E+  LL+ LY++PV  
Sbjct  185   HEVARYVEKTDK-DVTGVSDSFRFGYSIEGSDAVFVRSCPKFEPEWFGLLKVLYQKPVFP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
              G LPP + ++       + ++W    EWLD QR  SVV+V  G+E  +   ++ ELA  
Sbjct  244   TGFLPPVI-VDEDEDEDEDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALG  302

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LE S  PF W+LR    + P +    P  F  R   +G V +GW PQ  IL H ++GG L
Sbjct  303   LEKSETPFFWVLR----NKPKF----PDGFEERVKGRGMVHVGWVPQVKILRHESVGGFL  354

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H GW +++E LGFG   I LP++ +QGLN +LL  K +G EV R E DGSF    VA S
Sbjct  355   THCGWNSVVEGLGFGKVPIYLPVLNEQGLNTRLLHGKGLGVEVLRDERDGSFDSYSVAES  414

Query  1326  IRSVMASRE-GEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             +R VM   E GE IR KA  M  +FGN + +  Y+D+ + + ++
Sbjct  415   VRLVMVDDEKGESIRDKAKVMKGLFGNMDENSGYVDEIVGFMRT  458



>ref|XP_008236324.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Prunus mume]
Length=463

 Score =   342 bits (876),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 267/475 (56%), Gaps = 19/475 (4%)
 Frame = +3

Query  63    AAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERL-S  239
             + ++ H+ +FPWLAFGHM+P LE AK +A +G ++SF+STP+N++RLP +P   +  L +
Sbjct  4     SDQKLHIAMFPWLAFGHMIPYLELAKLIAQEGHQISFISTPRNIERLPQLPPILSSSLIT  63

Query  240   LREIALPSVPG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
               ++ LP V    PE  EAT D+ Q  +V  LK  YD +  P    +    P+ +L DFA
Sbjct  64    FVKLPLPRVDDDFPEAAEATTDVSQN-KVMKLKKVYDALQQPLTHFLESSNPDWLLFDFA  122

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLV  596
              +W P  A+  G+   F S++  A LA++G      S   R +PE +TVPP W  F S V
Sbjct  123   AYWAPTTARNLGIPCAFFSIFIGACLAFVGPTSPEISPDDRKNPEDYTVPPKWVPFPSNV  182

Query  597   AHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
             A        +  +T T D S VS   R    + GCD + +R C EF+ E++ LL+ ++++
Sbjct  183   AFHLFEVHRVYLDTITGDESNVSDIYRFMEGMRGCDVIAIRDCMEFDPEWLRLLQDIHRK  242

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PVL +G LP   +          +  W    EWLD Q   SVV+V FGSE      +I  
Sbjct  243   PVLPVGQLPTTNH--------EENDRWGSMSEWLDRQPKASVVYVAFGSEAMPSQEEITT  294

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             +A  LELS +PF+W+LR   +        LP  F  R   +G V   WAPQ  IL H ++
Sbjct  295   IALGLELSELPFIWVLRTNVVK-------LPQGFEERIGGRGLVCRSWAPQLKILGHDSV  347

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDM  1313
             G  L HSGW +++E+L FG  L+LL M  DQGLNA+LL E++IGY +PR  EDGSF+ D 
Sbjct  348   GVFLSHSGWSSVVEALSFGRALVLLTMSNDQGLNARLLEERKIGYCIPRDEEDGSFTSDS  407

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKR  1478
             VA S++ V+   EG+  R KA ++  +FG+    D Y+  F+EY ++      K+
Sbjct  408   VAESLKLVIEMEEGKIYRDKAKELKPLFGDRKKQDTYVHNFLEYLKAHARNASKK  462



>ref|XP_006353156.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=470

 Score =   342 bits (876),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 174/465 (37%), Positives = 276/465 (59%), Gaps = 7/465 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +++ H+ +FPWLAFGHM+P LE +K +A KG ++SF+STP+N+ RLP +P + T  L+  
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLTPFLNFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ +P V  LPEN EAT+DL   EQV++LK A+D +     + +     + IL DFA++W
Sbjct  65    KLPMPHVEKLPENAEATIDL-PYEQVKYLKLAHDALKESMAKFLEDSDIDFILFDFASYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAH  602
             +P IA ++ + T + S++ AA L + G    L +   +R + E  TV P W  F + VA 
Sbjct  124   IPSIASKFNIPTGYFSIFIAAYLGFTGPVPGLNNNYGIRMTMEELTVSPKWVPFETAVAF  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +       +   +    R+    E CDF++VRSC EFE E++ ++E ++ +PV
Sbjct  184   KEFELLRIYEGCKDGEEENIYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHLKPV  243

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +G LP      +     TN  +W E  +WLD Q    V++V FGSE K+  +++ EL+
Sbjct  244   IPVGQLPT----TSYEDDDTNIDAWREIKQWLDKQEKGKVIYVAFGSETKLSQNELTELS  299

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+LR    ++      LP  F  RT  +G V   W PQ  IL+H ++GG
Sbjct  300   LGLELSGLPFFWVLRTKRGESDDELIQLPEGFEERTKGRGIVYTSWVPQLKILSHDSVGG  359

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H+GW +++E++ F  PLILL  +ADQG++A+LL EK++ Y +PR + DGSF+RD V 
Sbjct  360   FLNHAGWSSVVEAIQFEKPLILLTFLADQGIDARLLEEKKVAYLIPRNDLDGSFTRDAVV  419

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+  V+  +EGE  R K  ++ N+  +    DNY++  + + Q+
Sbjct  420   ESLSLVLVEKEGEIYRQKIKEVKNLCCDKKRQDNYVENLLRFLQN  464



>ref|XP_009108218.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Brassica rapa]
Length=473

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 188/465 (40%), Positives = 271/465 (58%), Gaps = 12/465 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E  HV +FPWLA GH+LP L  +K LA KG +VSF+STP+N++RLP +P + +  ++   
Sbjct  13    ETLHVAMFPWLAMGHLLPFLNISKLLAQKGHKVSFISTPRNIERLPKLPPNLSSSITFVS  72

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP +P LP + E+++D+    Q Q LK+A+D +  P  E +RR  P+ I+ D+ +HW+
Sbjct  73    LPLPPIPNLPPSSESSMDVPYINQ-QSLKSAFDLLQLPVTEFLRRSSPDWIIYDYTSHWL  131

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A   G+   F S++ A+ L ++G P  L     R +P+ FTV P W  F S V  R 
Sbjct  132   PPVATELGIKKAFFSLFNASALCFMGPPSSLIEDA-RTTPDDFTVVPPWIPFESDVVFRY  190

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  T   D +G+S   R    I   D V VRSC EFE E+  LL  LY++PV  
Sbjct  191   HEVARYVEKTEE-DVTGISDSVRFGYSIGESDAVFVRSCPEFEPEWFVLLRDLYQKPVFP  249

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
              G LPP ++ +         ++W+   EWLD QR  SVV+V  G+E  +P  ++ ELA  
Sbjct  250   TGFLPPPVSED---HEDDGDATWARIKEWLDKQRVNSVVYVSLGTEASLPREELAELALG  306

Query  969   LELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE S++PFLW LR +P    P    L+P  F  R   +G V +GW PQ  IL+H ++GG 
Sbjct  307   LEKSKVPFLWALRNEPTRSEP----LIPDGFEERVGGRGMVHVGWVPQVKILSHESVGGF  362

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E LGFG   I LP++ +QGLN +LL  K+IG E+PR E DG F  D VA+
Sbjct  363   LTHCGWNSVVEGLGFGRVPIFLPVLNEQGLNTRLLRGKDIGVEIPRNERDGRFWSDSVAD  422

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             ++R  M    GE  R K   M  +FGN + +  Y+D+ I+Y +SK
Sbjct  423   TVRLAMIDDAGELKRTKVKMMKGLFGNRDENILYVDELIDYMKSK  467



>ref|XP_004289539.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/461 (40%), Positives = 265/461 (57%), Gaps = 15/461 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGHM+P LE AK +A KG ++SF+STP+N+ RLPP+P   +  ++  ++
Sbjct  17    KLHIGMFPWLAFGHMIPYLELAKLIARKGHQISFISTPRNIDRLPPLPPKLSTLITFVKL  76

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP  P LPE  EAT DL  ++QV+ LK AYD +  P  + ++    + +L DFA +W+P
Sbjct  77    PLPENPNLPEGAEATSDL-PEDQVEHLKIAYDSLKEPITQFLKSSNLDWLLYDFAPYWLP  135

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             EI +   + T F S++ A+   +LG          R  PE + V P W  F + VA R  
Sbjct  136   EITRNLEIPTAFFSIFLASCSVFLGPTSPEVPSDYRKLPEDYLVSPKWVPFRATVALRL-  194

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             +    +    T D + VS   R      GCD + VRSC EFE  ++ LL  ++ +PV+ +
Sbjct  195   FEVLRLYKRITGDETNVSDVYRFKETTRGCDVIAVRSCVEFEPGWLSLLGVIHGKPVIPV  254

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GL      L+T      N S WS   +WLD Q   +VV+V FG+E      ++ E+A  L
Sbjct  255   GL------LSTTPNDDENDSWWSIK-DWLDKQSKNTVVYVAFGTEAMPSQEEVTEIALGL  307

Query  972   ELSRMPFLWILRKPGIDNPGYPAL-LPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             E S +PF W+LR       G  A+ LP  F  R   +G V   W PQ  ILAH + G  L
Sbjct  308   EKSGLPFFWVLRT----KHGEEAVKLPEGFEERNEGRGVVYRSWVPQLKILAHDSFGVFL  363

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANS  1325
              H+GW +++E+L F  PL+LLPM+ DQGLNA+L  EK++GYE+PR  E GSF+ + VA S
Sbjct  364   SHAGWSSVVEALTFARPLVLLPMLNDQGLNARLFGEKKVGYELPRDNETGSFTSEAVAES  423

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             +R V+   EG   R KA ++  +FG+    + Y+D+F+EY 
Sbjct  424   LRMVIEKEEGRVYRDKAKELKPLFGDRERQNVYVDKFLEYL  464



>ref|XP_008362434.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=468

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/466 (39%), Positives = 272/466 (58%), Gaps = 13/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLQIAMFPWLAYGHLMPFLEVSKFLAXKGHQISFISTPKNINRLRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPXVDGLPESVESTSELPIN-KVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A TLA+ G P EL   K R   E FTV P W ++ S VA + 
Sbjct  124   PRVATQLGVNSVYFNITNATTLAFFGPPSELLXDK-RKRXEDFTVVPEWVDYPSNVAFKL  182

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                 +     H      VS  QRLS  I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  183   HEMVS-----HWDCMDEVSDFQRLSGAIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  237

Query  789   IGLLP-PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +GLLP         +        W    EWL+N++P SVV++  G+E  +    +HELA 
Sbjct  238   LGLLPLGSAXHQHGVADDRGDEKWXVLREWLENKKPNSVVYIALGTEVTLSQELMHELAR  297

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++  +P ++      ++P  F  +  ++G V+ GWAPQ  IL HP++GG
Sbjct  298   GIEKSGLPFIWVVNNRPLVEGVLGSDIIPFGFQTQVEDRGLVLRGWAPQLKILGHPSVGG  357

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW +++E+LGFG  LIL     ADQGL ++L+ EK +G E PR E DGSF+ D V
Sbjct  358   FLTHCGWSSVVEALGFGRALILFSGANADQGLISRLMHEKRVGLEXPRDEQDGSFTSDSV  417

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A   R VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  418   AEVTRRVMVEKEGESIRSNAWAMKEIFGNLELNNTCLDEFTRVLET  463



>gb|KFK29804.1| hypothetical protein AALP_AA7G181400 [Arabis alpina]
Length=457

 Score =   341 bits (874),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 180/464 (39%), Positives = 264/464 (57%), Gaps = 20/464 (4%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLA GH+LP L  +K LA KG ++S++STP+N+QRLP +P++ +  ++     L
Sbjct  10    HIAMFPWLAMGHLLPFLNLSKSLAQKGHKISYISTPRNIQRLPKLPSTLSSSITFISFPL  69

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P  PGL  + E+++D+   +Q Q LK+A+D +  P +  + R  P+ I+ D+A+HW+P I
Sbjct  70    PPFPGLSPSFESSMDIPYNKQ-QSLKSAFDLLQTPIKNFLLRSSPDWIIYDYASHWLPSI  128

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A   G++  F S++ AA+L ++G P  L   + R  PE FTV P W  F S +  R    
Sbjct  129   ATELGISKAFFSLFNAASLCFMGPPSSLIQ-ETRSKPEDFTVVPSWVPFESNIVFRYHEV  187

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
                +  T   D +GVS   R    I   D VIVRSC EFE E+  LL  LY++PV   G 
Sbjct  188   ARYVEKTEE-DVTGVSDSVRFGYSIGESDVVIVRSCVEFEPEWFRLLLDLYQKPVFPTGF  246

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             LPP      +   G + ++W    EWLD QR  SVV+V  G+E  +P  ++ EL   LE+
Sbjct  247   LPP-----VSEGEGDDDATWVCIKEWLDKQRVNSVVYVALGTEASLPKEELAELGLGLEI  301

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S + F W+LR            +P  F  R   +G V +GW PQ  IL+H ++GG L H 
Sbjct  302   SNVSFFWVLRN--------ELEIPDGFEERVEERGMVHVGWVPQVKILSHESVGGFLTHC  353

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIRS  1334
             GW +++E LG G   ILLP++ +QGLNA+LL  K +G E+ R E DG+F  D VA+S+R 
Sbjct  354   GWNSVVEGLGLGRVPILLPVLNEQGLNARLLQGKGLGVEIVRDERDGTFDSDSVASSVRL  413

Query  1335  VMASRE---GEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              M   +    E  + K   M ++FGN +    Y+D+ + Y  SK
Sbjct  414   AMMDDDVDAYESRKGKVKLMKDLFGNKDKSICYVDELVRYLTSK  457



>gb|KHN06911.1| UDP-glycosyltransferase 91A1 [Glycine soja]
Length=468

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 189/474 (40%), Positives = 276/474 (58%), Gaps = 17/474 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+++FPWLAFGH++P LE AK +A KG  +SFVSTP+N++RLP +  +    +   +
Sbjct  6     EKLHIVMFPWLAFGHLIPNLELAKLIAQKGHNISFVSTPRNIERLPKLSPNLASFIKFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V  LPEN EAT D+   + VQ+LK AYD +  P    +     + +  D    W 
Sbjct  66    LPLPKVDKLPENAEATTDV-PYDVVQYLKKAYDDLEEPLTRFLESSKVDWLFYDLIPFWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHR  605
               +A + G+ + F S+ T   + +LG P  L      R   + FTV P W +F + VA+R
Sbjct  125   GTVASKLGIKSAFYSICTPPCMGFLGPPSVLMGEDPYRTKLKDFTVTPPWISFPTTVAYR  184

Query  606   PDYAPTMMRNTH--TPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
                   MMRN+   + + SG+S   R  +VI+ CD V++R C EFE E+  +LE +Y++P
Sbjct  185   ---YFEMMRNSDAVSDNDSGISDMYRFGAVIKNCDIVVIRGCTEFEPEWFQVLENIYQKP  241

Query  780   VLAIGLLPPRLNLNTAIQPG-TNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             VL +G L     +N   +    N ++W    +WLD Q   SVV+V FGSE K    ++ +
Sbjct  242   VLPVGQL-----INREFEGDEDNITTWQWMKDWLDKQPCGSVVYVAFGSEAKPSQDEVTQ  296

Query  957   LASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             +A  LE S++ F W+LR + G  +P     LP  F  RT  +G V   WAPQ  IL+H A
Sbjct  297   IALGLEESKIRFFWVLRVQRGPWDPDV-LRLPEGFEERTKGRGIVCTSWAPQLKILSHVA  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             +GG L HSGW +++E++    PLILL  +ADQGLNA++L EK++GY VPR E DGS + D
Sbjct  356   VGGFLTHSGWTSVVEAVQNEKPLILLAFLADQGLNARVLEEKKMGYSVPRDERDGSITSD  415

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQC  1472
              +ANSIR VM   EG   R K  ++ ++F N    + YID+ + Y  S+ L+ C
Sbjct  416   AIANSIRLVMVEDEGRVYREKIKEVKDLFVNTVRQEKYIDELLHYL-SRNLSNC  468



>ref|XP_009351087.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Pyrus x bretschneideri]
Length=469

 Score =   341 bits (875),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 272/466 (58%), Gaps = 12/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++  + +FPWLA+GH++P LE +K LA KG ++SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPAVDGLPESAESTSELPIN-KVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A TLA+ G P EL S K R  PE  TV P W ++ S VA   
Sbjct  124   PRVATQLGVNSVYFNITNATTLAFFGPPSELLSDK-RWRPEDLTVVPEWVDYPSNVA---  179

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              Y    M +        V   QRL   IE C+ V +RSC EFE + + LL K+Y +PV+ 
Sbjct  180   -YKLHEMVSPWDGMDDEVLDFQRLGRTIEDCNVVTMRSCTEFESDAVSLLRKIYGKPVVP  238

Query  789   IGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +GLLPP        +        W    EWL+N++P SVV++  G+E  +    +HELA 
Sbjct  239   LGLLPPVSAPQQHGVADDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELAH  298

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++  +P ++      ++P  F  R  ++G V+ GWAPQ  IL H ++GG
Sbjct  299   GIEKSGLPFIWVVNNRPLVEGVLGSDIIPFGFETRVEDRGLVLRGWAPQLKILGHISVGG  358

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW +++E+LG+G  LIL     ADQGLNA+L+ +K +G E+PR E DGSF  D V
Sbjct  359   FLTHCGWSSVVEALGYGRALILFSGANADQGLNARLMQDKRVGLEIPRDERDGSFMSDSV  418

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A   R VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  419   AEVTRRVMVEKEGESIRSNAWAMKEIFGNVELNNKCLDEFTRVLET  464



>ref|XP_009615005.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=472

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/464 (39%), Positives = 267/464 (58%), Gaps = 14/464 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H  +FPWLAFGHM+P +E AK LA KG ++SF STPKN+QRLP +P +    +    + L
Sbjct  8     HFFMFPWLAFGHMIPYVELAKLLAEKGHKISFFSTPKNIQRLPKLPPNLKPHIEFITLQL  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT DL    +V++LK A+DR+     +L+    P+ ++ DFA++W+  I
Sbjct  68    PHVENLPENAEATSDLPYN-KVRYLKIAFDRLQESMPKLIESIYPDFVIQDFASYWLVPI  126

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAHRPD-  611
              ++  + T++ S++ A  L+  G P  + +G   R  PE FTV P W  F + V  RP  
Sbjct  127   TEKLQIPTIYFSIFPATCLSLGGIPSSIINGDNDRVKPEDFTVKPKWVTFETNV--RPSF  184

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             Y    M N    D   VS   RL+  ++G D V +RSC EFEGE++ ++E +Y++P++ I
Sbjct  185   YQIQRMFNDLVIDGGNVSDIYRLAVTVKGVDVVAIRSCYEFEGEWLQVIENIYEKPIIPI  244

Query  792   GLLPPRLNLNTAIQPG--TNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             GLLP      T+   G   N+ +W E   WLD Q+  SVV++ FGSE K    ++  +A 
Sbjct  245   GLLP-----TTSYDDGEEDNNETWLEMKAWLDMQQKGSVVYIAFGSETKPSQDELTIIAL  299

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W+ RK           LP  F  RT  +G +   WAPQ  +L H +IGG 
Sbjct  300   GLELSNLPFFWVFRKQRGCADSKVIELPEQFEERTKGRGFICTSWAPQLKLLNHESIGGF  359

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L HSGW ++IE++ F  PLILLP + DQG+    L EK++GY + R E DGSF+++ VA 
Sbjct  360   LTHSGWSSVIEAVQFEKPLILLPFLGDQGMICSHLTEKKLGYPIFRNELDGSFTKECVAK  419

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R VM   +G+       +M     + ++   ++D  + Y QS
Sbjct  420   SLRLVMVEEKGKIYSQNVKEMKES-CSKDVQQRFVDNLLAYLQS  462



>ref|XP_002297733.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE82538.1| glycosyltransferase family protein [Populus trichocarpa]
Length=475

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/464 (40%), Positives = 269/464 (58%), Gaps = 12/464 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGHM+P LE AK +A KG +++F+STP+N+ RLP +P   +  ++  ++
Sbjct  6     KLHIAMFPWLAFGHMIPYLELAKLIAQKGHKITFISTPRNIDRLPKLPPYLSPLINFVKL  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELV--RRDLPELILVDFATHW  425
              LP    L E  EAT D+    +VQ+LK A+D +  P    +    D+ + +L DFA +W
Sbjct  66    PLPHAAHLLEGDEATTDVPYN-KVQYLKVAFDGLKEPMTRFLATSHDI-DYLLYDFAPYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             +PEIA   G+   F S++  A + +L     +     R  PEHFTVPP    F + V  +
Sbjct  124   LPEIATGLGIPNAFFSIFLGAAVCFLKPASLIED---RTEPEHFTVPPKSIPFPTTVRFK  180

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               +    +  + T DAS VS   RL  V+  C  V +RSC EFE E++ L ++L  +PV+
Sbjct  181   L-FEILRIFESVTGDASDVSDIYRLQEVLRCCQMVAIRSCMEFEPEWLHLFQELIGKPVI  239

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLL P    + A++    S  W    +WLD Q   SVV+V FGSE K    ++ E+A 
Sbjct  240   PVGLLAP--TEDDAVR-DEGSGMWKSMKDWLDKQEKGSVVYVAFGSEAKPSQVELTEIAL  296

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LELS +PF W+LR            LP  F +RT  +G V   W PQ  ILAH ++GG 
Sbjct  297   GLELSGLPFFWVLRTRRGLTDNEVIKLPEGFEDRTRGRGLVFTSWVPQLKILAHDSVGGF  356

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L HSGW +++E+L     LILL  +A+QGLN+++  EK+IGY +PR E DGSF+RD VA 
Sbjct  357   LTHSGWSSVVEALQHERALILLSFLAEQGLNSRVFEEKKIGYPIPRDESDGSFTRDSVAE  416

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             S+R VM   EG+  R KA +M  +FGN ++ D Y+  F+ Y  S
Sbjct  417   SLRLVMVKEEGKIYREKAKEMKGLFGNKDIQDQYVVNFLRYIMS  460



>ref|XP_011084237.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Sesamum indicum]
Length=465

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/462 (39%), Positives = 277/462 (60%), Gaps = 18/462 (4%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLA GH+ P L  +  LA KG R+SF+STP+NL R   +P   +  +++    L
Sbjct  9     HIVMFPWLAIGHLRPFLRLSICLAQKGHRISFISTPRNLHRAVKVPQDLSHLINVIAFPL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVR--RDLPELILVDFATHWVP  431
             P V  LP + E+++D+   +Q Q LK A+D + P   + +   R  P+ I+ D+A+HW+P
Sbjct  69    PEVEHLPPHAESSMDVPHVKQ-QLLKVAFDLLRPLVSDFLDNVRPKPDWIVYDYASHWLP  127

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHR-  605
             ++A+  G++  F S++TAA +A+LGSP  L   K  R +   FT+ P W  F S +A R 
Sbjct  128   KLAEEMGISRAFFSLFTAAFMAFLGSPSALMDQKYSRSTAADFTIVPEWIPFPSDMAFRL  187

Query  606   PDYAPTMMRNTHTPD-ASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
              + +  M ++    +  SG S   R    I+G + VI RSC EFE E+ DL+ +LY++PV
Sbjct  188   HEMSKNMEKDADGNEYDSGTSDSIRFGLSIDGSEIVIFRSCVEFEPEWFDLVRQLYQKPV  247

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +G+LP         +   N+  W +  +WLD Q+  S+V+V  G+E  +   +  ELA
Sbjct  248   IPVGILP------VEDEEHDNNEEWLKIKQWLDAQKDDSLVYVALGTEAALSQTEAQELA  301

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LE   +PF W+L +  +     P +LP  F +R +N+G V   WAPQ  IL+HPA+G 
Sbjct  302   LGLEQCGLPFFWVLNRNYL-----PEMLPDGFQDRVANRGMVYTEWAPQIKILSHPAVGA  356

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H GW +  E+LGFG  LIL P++ DQGLNA+LL EK++G E+PR E DGSF+RD V+
Sbjct  357   FLTHCGWNSATEALGFGRVLILFPVMNDQGLNARLLQEKKVGVEIPRNEKDGSFTRDSVS  416

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEY  1445
              ++R V+ S EG  +R  A +M  +FG+ +   +Y+D  +++
Sbjct  417   ETVRLVLVSEEGRKVRENARKMKELFGDKSRSSSYVDSLVQH  458



>emb|CAN80742.1| hypothetical protein VITISV_015059 [Vitis vinifera]
Length=481

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/466 (39%), Positives = 264/466 (57%), Gaps = 19/466 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+++FPWLAFGH+LP LE +K +A +G R+SF+STP+N++RLP +P +    + L +
Sbjct  21    EKLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPNLQPLIDLVK  80

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP+   LPEN EAT DL     + +LK A+D +  P    +    P+ ++ DFA HW+
Sbjct  81    FPLPNDDNLPENAEATTDLPYG-NIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFAPHWL  139

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPE-ELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             P IA ++GV+  F  +++A  L + GS    +  G  R     F  PP W  F + VA  
Sbjct  140   PPIAAKHGVSRAFFCIFSATALCFGGSTSIMMEGGDPRTELHQFAAPPPWVTFPTKVA-L  198

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             P +      +    + SGVS   R+ S I GCD + +RSC E E E++DLL KL+++P+ 
Sbjct  199   PLFLLRRSLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLF  258

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP   +N       +  SW    EWLD Q  + VV+V  G+E      ++ ELA 
Sbjct  259   PIGLLPPSAPVN------GDDDSWPPIKEWLDKQEKECVVYVALGTEVTPTEDELTELAF  312

Query  966   ALELSRMPFLWILRK--PGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
              LELS +PF W LRK    +D       LP  F  RT  +G V   WAPQ  IL H ++G
Sbjct  313   GLELSGLPFFWALRKRHDAVD-------LPDRFEERTKGRGMVWRSWAPQLRILDHDSVG  365

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
             G + H GW ++IE L FG  LI+LP+  DQG NA+   E ++G E+PR +E+   SR  V
Sbjct  366   GFVTHCGWSSVIEGLHFGQALIMLPLWGDQGXNARTFEEMKVGVEIPRDQEEERLSRKSV  425

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A ++  VM    G+  R KA +M+ + G+ + H  Y+  F+EY Q 
Sbjct  426   AETLSLVMVEETGKIYRNKAKEMSKLLGDXHRHHXYVSDFVEYLQK  471



>ref|XP_003551309.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Glycine max]
Length=468

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 189/474 (40%), Positives = 276/474 (58%), Gaps = 17/474 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+++FPWLAFGH++P LE AK +A KG  +SFVSTP+N++RLP +  +    +   +
Sbjct  6     EKLHIVMFPWLAFGHLIPNLELAKLIAQKGHNISFVSTPRNIERLPKLSPNLASFIKFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V  LPEN EAT D+   + VQ+LK AYD +  P    +     + +  D    W 
Sbjct  66    LPLPKVDKLPENAEATTDV-PYDVVQYLKKAYDDLEEPLTRFLESSKVDWLFYDLIPFWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHR  605
               +A + G+ + F S+ T   + +LG P  L     +R   + FTV P W +F + VA+R
Sbjct  125   GTVASKLGIKSAFYSICTPPCMGFLGPPSVLMGEDPVRTKLKGFTVTPPWISFPTTVAYR  184

Query  606   PDYAPTMMRNTH--TPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
                   MMRN+   + + SG+S   R  +VI+ CD V++R C EFE E+  +LE +Y++P
Sbjct  185   ---YFEMMRNSDAVSDNDSGISDMYRFGAVIKNCDIVVIRGCTEFEPEWFQVLENIYQKP  241

Query  780   VLAIGLLPPRLNLNTAIQPG-TNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             VL +G L     +N   +    N ++W    +WLD Q   SVV+V FGSE K    ++ +
Sbjct  242   VLPVGQL-----INREFEGDEDNITTWQWMKDWLDKQPCGSVVYVAFGSEAKPSQDEVTQ  296

Query  957   LASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             +A  LE S+  F W+LR + G  +P     LP  F  RT  +G V   WAPQ  IL+H A
Sbjct  297   IALGLEESKTRFFWVLRVQRGPWDPDV-LRLPEGFEERTKGRGIVCTSWAPQLKILSHVA  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             +GG L HSGW +++E++    PLILL  +ADQGLNA++L EK++GY VPR E DGS + D
Sbjct  356   VGGFLTHSGWTSVVEAVQNEKPLILLAFLADQGLNARVLEEKKMGYSVPRDERDGSITSD  415

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQC  1472
              +ANSIR VM   EG   R K  ++ ++F N    + YID+ + Y  S+ L+ C
Sbjct  416   AIANSIRLVMVEDEGRVYREKIKEVKDLFVNTVRQEKYIDELLHYL-SRNLSNC  468



>gb|KDP41496.1| hypothetical protein JCGZ_15903 [Jatropha curcas]
Length=481

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/471 (39%), Positives = 264/471 (56%), Gaps = 12/471 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +Q HV++FPWLA GH++P   F+  LA KG +VSFVSTP+NL  LP IP   +  +SL  
Sbjct  6     KQLHVVVFPWLAMGHLIPYHRFSILLAQKGHKVSFVSTPRNLLNLPKIPPKLSSNISLIS  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LPS+P LP N E T D+   +Q Q LK A+D +  P    +++  P+ ++ D+A+HW+
Sbjct  66    LPLPSIPALPPNAETTTDIPYVKQ-QLLKKAFDFLRSPLIAFLQKVKPDWVIYDYASHWL  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEEL-RSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             P I    G++T F S++ AATL+++G P  L   G LR + E FTV P W  F S +A+R
Sbjct  125   PSIVAELGISTAFFSLFNAATLSFIGPPSMLMNGGDLRLTAEDFTVVPKWVPFESNIAYR  184

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                    +  T   D +G++   R    I   D VIVRS  E E E+ DL  KL +RP +
Sbjct  185   VHEVTKYVEKTEE-DETGLTDSVRFGFAIGNADLVIVRSSPELEPEWFDLFGKLSQRPNI  243

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IG LPP   L        +   W++  EWLD    KSVV+V  G+E  +   ++ EL  
Sbjct  244   PIGFLPP---LVEEENNNADVGGWADIKEWLDKHEAKSVVYVALGTESALTKKEVRELGL  300

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              LE S  PF W+LR           +LP  F  R  ++G V   WAPQ NIL+H ++G  
Sbjct  301   GLEKSSSPFFWVLRNSPESTQNVLEMLPDGFQERVKDRGIVYTRWAPQVNILSHESVGTF  360

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E L FG  LIL PM+ DQGLNA+LL  K++G E+PR E DG+F+ D VA 
Sbjct  361   LTHCGWNSVVEGLSFGKVLILFPMLNDQGLNARLLHGKKLGLEIPRNELDGAFTSDSVAE  420

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
              +R     +   G    A  +  +FG+   +D  ++  + Y ++  +++ +
Sbjct  421   LVR-----KSKVGSADLADPIRGLFGDRGRNDRLLEGVVHYLENDTMSRLR  466



>ref|XP_008811282.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=466

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/472 (39%), Positives = 281/472 (60%), Gaps = 22/472 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGH++P LE +K LA +G  + F+STP+N+ RLP IP      +    I L
Sbjct  7     HIVLFPWLAFGHLIPFLELSKSLAKRGHHIFFISTPRNIHRLPNIPLPLLPLIDFISIPL  66

Query  258   PSVPGLPE-NCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRD--LPELILVDFATHWV  428
             P    LP+ + EAT DL    +V  LK A+D++  P  E + +    P+ I+ DFA +W+
Sbjct  67    PPSDDLPDHDAEATADLPPH-KVPHLKKAFDKLDQPVAEFLEQASPKPDWIICDFAPYWL  125

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P IA +      + + + + + A+        S   + SPE  T  P W  F + VA+R 
Sbjct  126   PPIASKLNTPCAYFNTFPSFSSAF--------SAAWQRSPEQLTATPEWIPFPTKVAYRL  177

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
               A +  +  H   ASGVS   R +SV+  CD + VR C EF+GE++++L +LY++P++ 
Sbjct  178   HEARSFAKLVHD-SASGVSDEYRFNSVVRCCDLMAVRGCMEFDGEWLNVLPELYEKPIVP  236

Query  789   IGLLPPRLNL--NTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             +GLLPP  +   +     G  ++      +WL+ Q P+SVV+V  GSE  +    +HELA
Sbjct  237   LGLLPPSADDRPDGENTNGMANTGHGNVVKWLNKQTPESVVYVSLGSEATLSNELVHELA  296

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PFLW LR+   +      LLP  F +R + +G + +GW PQ  ILA  ++GG
Sbjct  297   FGLELSGLPFLWALRRKREEV----ELLPKGFEDRIAGRGVIAMGWMPQLEILACSSVGG  352

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDMVA  1319
                H GW +++E L FGHPLILLP+  DQG+NA+++VEK++G EV R E+ GSF+R+ VA
Sbjct  353   FFTHCGWSSVVEGLAFGHPLILLPVFGDQGINARVMVEKKLGLEVERDEETGSFTREAVA  412

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
             N +RSVM   EG+ +R  A +M  +F N+++H  Y+D F+ Y +  +  +C+
Sbjct  413   NVVRSVMVEDEGKKLRETAKRMREVFSNNDIHGRYVDAFVHYLRDHV--RCR  462



>gb|KCW59684.1| hypothetical protein EUGRSUZ_H02443, partial [Eucalyptus grandis]
Length=464

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 268/462 (58%), Gaps = 8/462 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  HV++ PWLAFGHM+P LE AK +A KG R+SF+ +P N+ RLP  P+     +S  +
Sbjct  6     DSLHVVMLPWLAFGHMMPYLELAKLMAGKGHRISFLLSPGNIDRLPKPPSDLASLISFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V  LPE   AT DL   +++QFLK AYD +  P    +    P+ I+ DFA +W 
Sbjct  66    LPLPAVEQLPEGAGATSDL-PYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
               I+ R G+ +VF S+ TAA+L +LG     + G  R +PE FT  P W  F + VA+R 
Sbjct  125   GPISSRLGIRSVFFSITTAASLGFLGPTWASKGGDYRKTPEDFTKRPNWVPFPTSVAYR-  183

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    + +  + +ASGV+   R  +  E CD + VRS  E E E++ LL+ +  +P+  
Sbjct  184   HFEIEKIFDAVSRNASGVTDLYRWGAGRECCDIIAVRSSYEVEPEWLSLLKDILAKPIFP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP    N  ++  T+S  W    EWLD Q+  +VV+V FGSE K    ++ ++A  
Sbjct  244   VGQLPPS---NPEMRGETDS--WRSIKEWLDVQKKCTVVYVAFGSEAKPSQTELTDIALG  298

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LELS +PF W+L+           +LP  F  R   +  V   W PQ  ILAH ++G  L
Sbjct  299   LELSGLPFFWVLKTQLGSADTESVVLPDGFEERVRGRVMVWDSWVPQLKILAHDSVGWFL  358

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H+GW +++E+L FG  LIL   +ADQGLNA+LL E++IGY +PR E DGS +R  V+ S
Sbjct  359   THAGWSSVVEALSFGRALILFTFLADQGLNARLLEERQIGYPIPRNESDGSVTRQSVSES  418

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             +  VM   +G   R KA +M  IFG+ N+ + Y++  + Y +
Sbjct  419   LSLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLK  460



>ref|XP_008388212.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=467

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/466 (39%), Positives = 279/466 (60%), Gaps = 12/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++P  E +K LA  G ++SF+STPKN+ RL    +SF+  ++  E
Sbjct  7     KKLHIAMFPWLAYGHLMPFXEVSKFLAQXGHQISFISTPKNINRLRS--SSFSPLINFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK AYD + P     ++      ++ D   +W+
Sbjct  65    LPLPAVDGLPESVESTSELPIN-KVPYLKKAYDLLKPSVXHFIQHSSVNWVVHDIICYWM  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V+ ++  A+TLA+LG P EL   K R  PE FTV P W ++ S VA + 
Sbjct  124   PRVATQLGVNSVYFNITNASTLAFLGPPXELLGDKRR-RPEDFTVVPEWVDYPSNVAFKQ  182

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  M+ +    D   VS  QRL+  I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  183   H---EMVSHWDCMDDE-VSDFQRLAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  238

Query  789   IGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             +GLLPP        +        W    +WL+N++P SVV++  G+E  +    +HELA 
Sbjct  239   LGLLPPGSAPHQHGVANDRGDDKWEVLRKWLENKKPNSVVYIALGTEVTLSQELMHELAH  298

Query  966   ALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++  +P ++      ++P  F  R  ++G V+ GWAPQ  IL H +IGG
Sbjct  299   GIEKSGLPFIWVVNNRPLVEGVLGSDIIPLGFETRVEDRGLVLRGWAPQLKILGHISIGG  358

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW +++E+LG+G  LIL     +DQGL A+L+ +K++G E+PR E DGSF+ D V
Sbjct  359   FLTHCGWSSVVEALGYGRALILFSGANSDQGLIARLMHDKQVGLEIPRDEQDGSFTSDSV  418

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A  I  VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  419   AELIGRVMVEKEGESIRSNARAMKEIFGNVELNNKCLDEFTRVLET  464



>ref|XP_010023430.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 268/462 (58%), Gaps = 8/462 (2%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             +  HV++ PWLAFGHM+P LE AK +A KG R+SF+ +P N+ RLP  P+     +S  +
Sbjct  6     DSLHVVMLPWLAFGHMMPYLELAKLMAGKGHRISFLLSPGNIDRLPKPPSDLASLISFVK  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V  LPE   AT DL   +++QFLK AYD +  P    +    P+ I+ DFA +W 
Sbjct  66    LPLPAVEQLPEGAGATSDL-PYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWA  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
               I+ R G+ +VF S+ TAA+L +LG     + G  R +PE FT  P W  F + VA+R 
Sbjct  125   GPISSRLGIRSVFFSITTAASLGFLGPTWASKGGDYRKTPEDFTKRPNWVPFPTSVAYR-  183

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +    + +  + +ASGV+   R  +  E CD + VRS  E E E++ LL+ +  +P+  
Sbjct  184   HFEIEKIFDAVSRNASGVTDLYRWGAGRECCDIIAVRSSYEVEPEWLSLLKDILAKPIFP  243

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +G LPP    N  ++  T+S  W    EWLD Q+  +VV+V FGSE K    ++ ++A  
Sbjct  244   VGQLPPS---NPEMRGETDS--WRSIKEWLDVQKKCTVVYVAFGSEAKPSQTELTDIALG  298

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LELS +PF W+L+           +LP  F  R   +  V   W PQ  ILAH ++G  L
Sbjct  299   LELSGLPFFWVLKTQLGSADTESVVLPDGFEERVRGRVMVWDSWVPQLKILAHDSVGWFL  358

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H+GW +++E+L FG  LIL   +ADQGLNA+LL E++IGY +PR E DGS +R  V+ S
Sbjct  359   THAGWSSVVEALSFGRALILFTFLADQGLNARLLEERQIGYPIPRNESDGSVTRQSVSES  418

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             +  VM   +G   R KA +M  IFG+ N+ + Y++  + Y +
Sbjct  419   LSLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLK  460



>dbj|BAO45905.1| UDP-glycosyltransferase [Acacia mangium]
Length=468

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 273/473 (58%), Gaps = 16/473 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+++FPWLAFGH++P LE AK +A KG  VSFVS P+N+ RLP +P   +  + L +
Sbjct  5     KKLHIVMFPWLAFGHIIPYLELAKLIAEKGHHVSFVSAPRNIDRLPKLPPHLSPLIKLVK  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V  LP + EATVD+     VQ LK AYD    P    +    P+ IL DFA +W+
Sbjct  65    LPLPKVHDLPHDAEATVDVPYN-VVQHLKKAYDEFQQPMTLFLESSKPDWILYDFAPYWI  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEEL--RSGKLRPSPEHFTVPPGWFNFHSLVAH  602
               IA + G+ T F  ++ A ++ ++GS   L       R + + + VPP W  F + VA 
Sbjct  124   GSIASKLGIKTAFFCIFMAMSMGFMGSSLTLMGTDDNSRKTLQDYLVPPPWVPFPTTVAF  183

Query  603   RPDYAPTM-MRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRP  779
             R  Y   M + ++ + + SGVS   RL+  I+ CD V+VRSC EFE E+I LLE LYK+P
Sbjct  184   R--YFEIMKISDSFSNNNSGVSDTYRLALSIQNCDIVLVRSCFEFEAEWIQLLEHLYKKP  241

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             V+ +GLLP     +T    G  + +W    EWLD QR  +VV+V FGSE K    ++ E+
Sbjct  242   VVPVGLLP-----STTYDDGKENETWRWMNEWLDRQRKGTVVYVAFGSEAKPSQEEVREI  296

Query  960   ASALELSRMPFLWILRKPGIDNPGYPAL--LPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             A  LE S +PFLW LR      P  P +  LP  F  RT  +G V   W PQ  IL H +
Sbjct  297   ALGLEKSELPFLWALRVQ--RGPTDPEILQLPEGFEERTRGRGVVCSYWVPQLKILGHES  354

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             +GG L HSG  +++E++    PL+ L ++ADQGL +++L EK+IGY +PR + DGSF+ +
Sbjct  355   VGGFLSHSGCSSVVEAIQNEKPLVFLALLADQGLISRVLEEKKIGYSIPRDDRDGSFTSE  414

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQ  1469
              VA+++R V+    G   R K  ++  IF N    + Y+ + +   +    +Q
Sbjct  415   SVADALRMVVVEERGRIFREKMKEIKGIFVNRERQEEYVRKLLSCLRDHKKSQ  467



>ref|XP_002303861.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE78840.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=473

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/475 (39%), Positives = 269/475 (57%), Gaps = 11/475 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
               +  V++FPWLA GH++P L+ +K LA KG ++ FVSTP+NL RLP IP   +  + L 
Sbjct  4     GNRLQVVMFPWLATGHLIPFLQLSKLLAEKGHKIFFVSTPRNLNRLPKIPKQLSSEIILV  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
                 P VP LP   E++ D+   +Q Q LK  +D + PP    +    P+ I  D+A+HW
Sbjct  64    SFPFPHVPNLPSCAESSTDVPYTKQ-QLLKKGFDLLEPPLTTFLESSKPDWIFYDYASHW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRS-GKLRPSPEHFTVPPGWFNFHSLVAH  602
             +P +A R G++  F S++TAA L+Y+G P  L + G  R   E FTV P W  F S +  
Sbjct  123   LPSVAARLGISCAFFSLFTAACLSYIGPPSALMTIGDPRSKAEDFTVVPKWIPFESDLVF  182

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLL-EKLYKRP  779
             R       +  T   D +G S   R      G D VI+RS  EFE E+ +LL ++LYK+P
Sbjct  183   RLHEVTKYVEKTEE-DETGPSDLIRFGFAAGGSDVVIIRSSPEFEPEWFNLLHDQLYKKP  241

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             ++ +G LPP +  N       +   WS   EWLD Q+  SVV+V  G+E  +   ++ EL
Sbjct  242   IIPVGFLPPIVEHNEE-DDNIDGHEWSNIKEWLDKQKVHSVVYVAIGTEASLSGEELKEL  300

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LE S +PF W+L K          +LP  F  R  N+G +  GWAPQ  IL+H ++G
Sbjct  301   ALGLENSTLPFFWVLNKIPGSTKNALDMLPDGFQERVKNRGIIHGGWAPQVKILSHDSVG  360

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G + H GW +IIE L FG  LILLP++ +QGLN++LL  K++G E+PR+E DGSF+   V
Sbjct  361   GFMTHCGWNSIIEGLTFGRVLILLPILNEQGLNSRLLHGKKLGLEIPRKEQDGSFTWASV  420

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKRG  1481
             A S+R+ M    G   R +A ++  +FG+ + ++ ++   + Y     LT+ K+ 
Sbjct  421   AESMRTAMVDDSGVSWRNRAREIRYLFGDVDRNNCFVASLVNY-----LTENKKA  470



>ref|XP_008219240.1| PREDICTED: UDP-glycosyltransferase 91C1 [Prunus mume]
Length=477

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 185/471 (39%), Positives = 275/471 (58%), Gaps = 22/471 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P    +K +A KG  VSF+STP+N+ RLP IP+  +  ++L  + L
Sbjct  11    HVVVFPWLAMGHLIPFFRLSKLIAQKGHTVSFISTPRNILRLPKIPSHLSSLINLVSLPL  70

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELV--RRDLPELILVDFATHWVP  431
             P +  LP + E++ D+    Q Q LK A+D +  P  + +      P+ ++ D+A+HW+P
Sbjct  71    PRLDNLPNDAESSTDVPYNGQ-QLLKRAFDLLELPLTDFLGSSESKPDWVIYDYASHWLP  129

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHR-  605
              +A R+ ++  F S ++AA LAY+G P  L +G+  R + E FT+ P W  F S +A+R 
Sbjct  130   PVAARFDISRAFFSCFSAACLAYIGPPAPLVNGQDFRTNAEDFTLVPEWVPFESDMAYRL  189

Query  606   PDYAPTMMRNTH----TPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
              + A  + R++     TPD        R    I   + V +RS  EFE E+ +LL ++Y 
Sbjct  190   HEIAKYLQRSSENESVTPDTV------RFGFAINESEVVFIRSSDEFEPEWFNLLREIYG  243

Query  774   R--PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
             +  PV+ IG LPP ++     Q     ++W    EWLD QR  SV+++  G+E  +   +
Sbjct  244   KGKPVVPIGFLPPPIDE----QVDEFDTNWVGIKEWLDKQRVNSVIYIAVGTEAILSQEE  299

Query  948   IHELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAH  1127
             + ELA  LELS +PF W+LR P         +LP  FV R   +G V LGWAPQ  IL+H
Sbjct  300   LTELALGLELSGVPFFWVLRNPPESTQYVFEMLPHGFVERVEGRGVVHLGWAPQVRILSH  359

Query  1128  PAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFS  1304
              ++GG L H GW ++IE LGFG  LIL PMV DQGLNA+L   K +G E+PR  +DGSF+
Sbjct  360   DSVGGFLTHCGWNSMIEGLGFGRVLILFPMVNDQGLNARLGNNKGLGVEIPRIAQDGSFT  419

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             RD VA  +R  M    GE +R +A +M  +FG+ N ++   D+FI + +  
Sbjct  420   RDSVAKLVRFAMVEDSGESLRNRAKEMKGLFGDRNRNNQIADEFICFLEEN  470



>ref|XP_004253507.2| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=483

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/467 (39%), Positives = 276/467 (59%), Gaps = 11/467 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             ++  H+ +FPWLAFGHM+P LE +K +A KG ++SF+STP+N+ RLP +  + T  L+  
Sbjct  18    SKMLHIGVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLSPNLTPFLNFV  77

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ +P V  LPEN EAT D+   EQV++LK A D +     + +     + IL DF ++W
Sbjct  78    KLPMPYVENLPENAEATTDV-TYEQVKYLKLAQDGLEESMAKFLEDSDLDFILFDFTSYW  136

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP IA ++ + +   S+Y AA L + G    L +  ++R +PE +TVPP W  F + VA 
Sbjct  137   VPSIASKFNIRSGHFSIYIAAFLGFTGPVPGLNNDYEIRTTPEEYTVPPKWVPFETTVAF  196

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   T   +   ++   R    +E CDF+ VRSC E E E++ +L  ++++PV
Sbjct  197   KLFEVLRIFEATMKGEEENIADITRYYKSVENCDFLFVRSCSELEPEWLKVLGDIHRKPV  256

Query  783   LAIGLLP--PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             L +G LP  P  + +T I       +W E   WLD +    V++V FGSE K   +++ E
Sbjct  257   LPVGQLPTTPYEDDSTKI------DAWIEIKLWLDKREKGKVIYVAFGSEAKSSQNELIE  310

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             L+  LELS + FLW+LR    ++      LP  F +R   +G V   WAPQ  IL+H ++
Sbjct  311   LSLGLELSGLSFLWVLRTKRGESDDELVQLPEGFEDRMKGRGIVCTSWAPQLKILSHDSV  370

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG L HSGW +++E++ +  PL+LL   ADQG+NA+LL EK+I Y +PR + DGSF+RD 
Sbjct  371   GGFLTHSGWSSVVEAIQYEKPLVLLTFSADQGINARLLEEKKIAYSIPRDDCDGSFTRDS  430

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             VA S+  V+  +EGE  R K  QM ++F +    DNY+D  + Y Q+
Sbjct  431   VAKSLNLVLIEKEGEIYREKVKQMKSLFCDKERQDNYVDNLLCYLQN  477



>ref|XP_006353157.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=483

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/467 (38%), Positives = 280/467 (60%), Gaps = 11/467 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ H+ +FPWLAFGHM+P LE +K +A KG ++SF+STP+N+ RLP +P++ T   +  
Sbjct  18    GKKLHIALFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPSNLTPFFNFV  77

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ +P V  LPEN EAT+DL   EQV++LK A D +     + +     + IL DF ++W
Sbjct  78    KLPMPHVEKLPENAEATIDL-PYEQVKYLKLAQDALEESMAKFLEDSDIDFILFDFTSYW  136

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP IA ++ + + + S++ AA L + G    L +  ++R +PE +TV P W  F + VA 
Sbjct  137   VPSIASKFNIPSGYFSIFIAAFLGFTGPVPGLNNDYEIRMTPEEYTVTPKWVPFETTVAF  196

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   +   +   ++   R    +E CDF++VRSC EFE E++ ++  ++++PV
Sbjct  197   KFFEVSRIFEASMKGEEENIADIIRYYKSVENCDFLLVRSCSEFEPEWLKVVGDIHRKPV  256

Query  783   LAIGLLP--PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             + +G LP  P  + +T I       +W E   WLD Q    V++V FGSE K   +++ E
Sbjct  257   IPVGQLPTTPYEDDSTKI------DAWREIKLWLDKQEKGKVIYVAFGSEAKPSQNELTE  310

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             L+  LELS +PF W+LR    ++      LP  F  RT  +G V   WAPQ  IL+H ++
Sbjct  311   LSLGLELSGLPFFWVLRTKRGESDDELIQLPEGFEERTKGRGIVCTSWAPQLKILSHDSV  370

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG L HSGW +++E++ F   L+LL  +ADQG+NA+LL EKE+ Y +PR + DGSF+RD 
Sbjct  371   GGFLTHSGWSSVVEAIQFEKSLVLLTFLADQGINARLLEEKEMAYSIPRNDQDGSFTRDS  430

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             VA S+  V+  +EG   R K  +M ++F +    +NY++ F+ + Q+
Sbjct  431   VAESLNLVLVKKEGFIYREKIKEMKDLFCDKERQNNYVENFLSFLQN  477



>ref|XP_006353155.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=470

 Score =   339 bits (869),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 175/465 (38%), Positives = 275/465 (59%), Gaps = 7/465 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +++ H+ +FPWLAFGHM+P LE +K +A KG R+SF+STP+N+ RLP +P +    L+  
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHRISFISTPRNIDRLPKLPPNLIPFLNFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ +P V  LPEN EAT+D+   EQV++LK A D +     + +     + IL DF ++W
Sbjct  65    KLPMPHVERLPENAEATIDV-PYEQVKYLKLAQDGLEESMAKFLEDSDLDFILFDFTSYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP IA ++ + +   S++ AA L + G    L +  ++R +PE +TVPP W  F + VA 
Sbjct  124   VPSIASKFNIPSGHFSIFIAAFLGFTGPVPGLNNDYEIRTTPEEYTVPPKWVPFETTVAF  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   T   +   ++   R    +E CDF++VRSC E E E++ ++  ++++PV
Sbjct  184   KLFEVLRIFEATMKGEEDNIADITRYCKSVENCDFLLVRSCSELEPEWLKVVGDIHRKPV  243

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
               +G LP     + +    T   +W E   WLD Q    V++V FGSE K   +++ EL+
Sbjct  244   FPVGQLPTTPYEDDS----TEMDAWKEIKLWLDKQEKGKVIYVAFGSETKPSQNELTELS  299

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+LR    ++      LP  F +RT  +G V   WAPQ  IL+H ++GG
Sbjct  300   LGLELSGLPFFWVLRTKRGESDDELTQLPEGFEDRTKGRGIVCTSWAPQLKILSHDSVGG  359

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L HSGW +++E++ F   L+LL   ADQG+NA+LL EK+I Y +PR + DGSF+ + +A
Sbjct  360   FLTHSGWSSVVEAIQFEKSLVLLTFSADQGINARLLEEKKIAYSIPRDDCDGSFTHESIA  419

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+  V+  REGE  R K  +M ++F +    DNY++  + Y Q+
Sbjct  420   ESLNLVLVKREGEIYREKVKEMKSLFCDKERQDNYVENLLRYLQN  464



>ref|XP_003615305.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES98263.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=446

 Score =   338 bits (866),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 190/468 (41%), Positives = 274/468 (59%), Gaps = 36/468 (8%)
 Frame = +3

Query  87    IFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALPSV  266
             + PW AFGH++P  + +  LA  G  VS++STPK +QRL  IP+S +  +   EI LPS+
Sbjct  1     MLPWSAFGHLIPFFKLSIALAKAGVHVSYISTPKKIQRLRKIPSSLSHLIDFVEIPLPSL  60

Query  267   PG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEIA  440
                 LPE  EAT+D+   +++Q+L+ AYD++    ++LV   LP  I+ D+  HW+ +IA
Sbjct  61    NKDLLPEGAEATMDIPL-DKIQYLEQAYDKLKNSVKQLVSNWLPNWIICDYNPHWIVDIA  119

Query  441   KRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYAP  620
             + + +  ++  V +AATLA+LG P                      N + L  +R + A 
Sbjct  120   QEFHINLIYYYVVSAATLAFLGPPS---------------------NMNGLAYNRTE-AV  157

Query  621   TMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGLL  800
                +  H  + S VS  +R   VI+    +I  SC E EGEY++L +KL  +PV+ IGLL
Sbjct  158   AFSKYVHQNNGSEVSGIERFVKVIDAAKSIICCSCYEIEGEYLNLYKKLVGKPVIPIGLL  217

Query  801   P---PRLNLNTAIQPGTNSSSW--SEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
             P   P+  L   +   T S +   +  F+WLD Q  KSVVFVGFGSE K+   Q+ E+A 
Sbjct  218   PVEMPQRGLLDGLGSVTGSGTGLRTAIFQWLDRQTTKSVVFVGFGSECKLSKEQVFEIAY  277

Query  966   ALELSRMPFLWILRKPGIDNPGY--PALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
              LE S++ FLW LRKP   N  Y     LP  F  R+ ++G V +GW P+Q ILAH +IG
Sbjct  278   GLEDSKLSFLWGLRKP---NWAYNDEDFLPIGFSERSCDRGLVCMGWIPKQEILAHSSIG  334

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVA  1319
             G LFHSG G+ IE+L FG+ L++LP   DQ LNA+LLV+K +  EV R EDG+F+R  +A
Sbjct  335   GSLFHSGLGSTIEALQFGNKLVVLPFNVDQPLNARLLVDKGLAIEVKRNEDGTFTRYEIA  394

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQSKI  1460
              S+R  M   EG+ +R+K  + A I GN  LH D+YI  F+++ +  I
Sbjct  395   KSLRQAMVLEEGKELRIKTREDAGIVGNLKLHQDHYIAAFVQFLKDGI  442



>ref|XP_011020572.1| PREDICTED: UDP-glycosyltransferase 91C1 [Populus euphratica]
Length=473

 Score =   339 bits (869),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 180/464 (39%), Positives = 262/464 (56%), Gaps = 6/464 (1%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
               +  V++FPWLA GH++P L  +K LA KG ++ FVSTP+NL RLP IP   +  + L 
Sbjct  4     GNRLQVVMFPWLATGHLIPFLRLSKLLAEKGHKIYFVSTPRNLNRLPKIPKQLSSEIILV  63

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
                 P VP LP   E++ D+   +Q Q LK  +D + PP    +    P+ I  D+A+HW
Sbjct  64    SFPFPHVPNLPSCAESSTDVPYTKQ-QLLKKGFDLLEPPLTTFLESSKPDWIFYDYASHW  122

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRS-GKLRPSPEHFTVPPGWFNFHSLVAH  602
             +  +A R G++  F S++TAA L+Y+G P  L + G  R   E FTV P W  F S +  
Sbjct  123   LSSVAARLGISCAFFSLFTAACLSYIGPPSTLMNIGDSRSKAEDFTVVPKWIPFESDIVF  182

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLL-EKLYKRP  779
             R       +  T   D +G S   R      G D VI+RS  EFE E+ +LL ++LYK+P
Sbjct  183   RLHEVTKYVEKTEE-DETGPSDSIRFGFAAGGSDVVIIRSSPEFEPEWFNLLHDQLYKKP  241

Query  780   VLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHEL  959
             ++ +G LPP +  N       +   W    EWLD Q+  SVV+V  G+E  +   ++ EL
Sbjct  242   IIPVGFLPPIVEHNEE-DDTKDGLKWGNIKEWLDKQKANSVVYVALGTEASLSGEELKEL  300

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A  LE S +PF W+L K          +LP  F  R  N+G V  GWAPQ  IL+H ++G
Sbjct  301   ALGLENSTLPFFWVLNKIPGSTKNALDMLPDGFQERVKNRGIVHGGWAPQVKILSHDSVG  360

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G + H GW +IIE L FG  LILLP++ DQGLN++LL  K++G E+PR+E DGSF+   V
Sbjct  361   GFMTHCGWNSIIEGLTFGRVLILLPILNDQGLNSRLLHGKKLGLEIPRKEQDGSFTWASV  420

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             A S+R+ M    G   R +A ++  +FG+ + ++ ++ + + Y 
Sbjct  421   AESMRTAMVDDSGVPWRNRAREIRCLFGDVDRNNCFVARLVNYL  464



>gb|KEH20103.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   338 bits (868),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 181/465 (39%), Positives = 268/465 (58%), Gaps = 12/465 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGHM+P LE AK +A KG +VS+VSTP+N+QRLP +P +    +    + +
Sbjct  8     HIVMFPWLAFGHMIPYLEVAKLIAQKGHQVSYVSTPRNIQRLPQLPPNVAPLIKFVSLPM  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT D+   +  Q+LK A+D++  P    +     + IL DFA  W+  +
Sbjct  68    PKVDNLPENAEATTDV-SWDVFQYLKDAFDKLEQPLTNFLESSDADWILHDFAPFWLGPV  126

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKL---RPSPEHFTVPPGWFNFHSLVAHRP  608
             A + G+  VF ++ T   LA+LG P  + +GK    R   E +T PP W  F++ VA++ 
Sbjct  127   ATKIGIKCVFFNITTPPNLAFLG-PISVLTGKEKDPRTKLEDYTAPPPWIPFNTTVAYKY  185

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
              +         +   SGVS   R+SS ++ CD +++R C EFE E+ +LL+ L ++PVL 
Sbjct  186   -FEIKKNAEVFSKKDSGVSEMHRVSSCVQNCDTILIRGCTEFEPEWFELLQNLLQKPVLP  244

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
              G LP     +T       + +W    +WLDNQ   SVV+V FGSE      +++E+A  
Sbjct  245   AGQLP-----STGFNFVDENDTWQGIKKWLDNQPHGSVVYVAFGSEATPSQEEVNEIALG  299

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LE S +PF W+LR            LP  F +RT  +G V   WAPQ  IL H AIG   
Sbjct  300   LEKSNLPFFWVLRAQHGRKDKAVLQLPEGFEDRTKGRGVVCTDWAPQMKILGHMAIGVFF  359

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANS  1325
              H+GW +++E++    PL+L+  + DQG+NAK+L EK++ Y VPR E DGSF+ D VA +
Sbjct  360   SHAGWTSVVEAVQNEKPLVLMTFLVDQGINAKVLEEKKMAYTVPRDEQDGSFTSDSVART  419

Query  1326  IRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
             IR VM   EG   R    ++ ++F N    D YID  +++ +S++
Sbjct  420   IRLVMLEEEGRIYRENIKEVKDLFVNIERQDRYIDNLLDHLKSRL  464



>ref|XP_011000621.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=472

 Score =   338 bits (868),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 190/466 (41%), Positives = 272/466 (58%), Gaps = 16/466 (3%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGHM+P LE AK +A KG +++F+STP+N+ RLP +P   +  ++  ++
Sbjct  6     KLHIAMFPWLAFGHMIPYLELAKLIAQKGHKITFISTPRNIDRLPKLPPYLSPLINFVKL  65

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELV--RRDLPELILVDFATHW  425
              LP    L E  EAT D+    +VQ LK A+D +  P    +    D+ + +L DFA +W
Sbjct  66    PLPHAAHLLEGDEATTDVPYN-KVQHLKVAFDGLKEPMTRFLATSHDI-DYLLYDFAPYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             +PEIA   G+   F S++  A + +L     +     R  PEHFTVPP    F + V  +
Sbjct  124   LPEIATGLGIPNAFFSIFLGAAVCFLKPASLIED---RTEPEHFTVPPKSIPFPTTVRFK  180

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
               +    +  + T DAS VS   RL  V+  C  V +RSC EFE E++ L ++L  +PV+
Sbjct  181   L-FEILRIFESITGDASDVSDSYRLQEVLRCCQMVAIRSCMEFEPEWLHLFQELIGKPVI  239

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLL P    + A++    S  W    +WLD Q   SVV+V FGSE K    ++ E+A 
Sbjct  240   PVGLLAP--TEDDAVR-DEGSGMWKSMKDWLDKQEKGSVVYVAFGSEAKPSQVELTEIAL  296

Query  966   ALELSRMPFLWILR-KPGI-DNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
              LELS +PF W LR + G+ DN      LP  F +RT  +G V   W PQ  ILAH ++G
Sbjct  297   GLELSGLPFFWALRTRRGLTDNEAIK--LPEGFEDRTRGRGLVFTSWVPQLKILAHDSVG  354

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L HSGW +++E+L     LILL  +A+QGLN+++  EK+IGY +PR E DGSF+RD V
Sbjct  355   GFLTHSGWSSVVEALQHERALILLSFLAEQGLNSRVFEEKKIGYPIPRDEFDGSFTRDSV  414

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S+R VM   EG+  R KA +M  +FGN ++ D Y+  F+ Y  S
Sbjct  415   AESLRLVMVKEEGKIYREKAKEMKGLFGNKDIQDQYVVNFLRYIMS  460



>ref|XP_009361641.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Pyrus x bretschneideri]
Length=469

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/470 (40%), Positives = 278/470 (59%), Gaps = 20/470 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++  LE +K LA KG ++SF+STPKN+ R     +SF+  +   E
Sbjct  7     KKLHIAMFPWLAYGHLMSFLEVSKFLAQKGHQISFISTPKNINRHRS--SSFSPLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE  E+T +L    +V +LK AYD + P     ++      ++ DF  +W+
Sbjct  65    LPLPAVDGLPETAESTSELPIN-KVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +A + GV +V  SV  A T+A+ G P EL S KLR  PE FTV P W ++ S VA + 
Sbjct  124   PRVANQLGVNSVLFSVTNATTMAFFGPPSELLSDKLR-RPEDFTVVPEWVDYPSNVAFK-  181

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  M+ +    D + VS  QR +  I+ C+FV +RSC EFE + + LL K+Y +P++ 
Sbjct  182   --LHEMVSHWDCMD-NEVSDFQRAAGAIQDCNFVTMRSCTEFESDAVSLLRKMYGKPIVP  238

Query  789   IGLLPPRLNLNTA-----IQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +GLLPP    N+A     +        W    EWL++++P SVV++ FG+E       +H
Sbjct  239   LGLLPP----NSAPHQHGVADDRRDEKWEFLREWLESKKPNSVVYIAFGTEVTPSQELMH  294

Query  954   ELASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
             ELA  +E S +PF+W++  +P ++      ++P  F  R  ++G V  GWAPQ  IL H 
Sbjct  295   ELAHGMEKSGLPFIWVVNDRPLVEGVLGADIVPLGFQTRVKDRGLVWRGWAPQLKILGHA  354

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFS  1304
             ++GG L H GW +++E+L FG  LIL     +DQ LNA+L+ +K +G E+PR E DGSF+
Sbjct  355   SVGGFLTHCGWSSVVEALRFGRVLILFSGAYSDQPLNARLMHDKRVGLEIPRDERDGSFT  414

Query  1305  RDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              D VA  IR VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  415   SDSVAELIRRVMVEKEGESIRSNAWAMKEIFGNVELNNMCLDEFTRVLET  464



>ref|XP_004489091.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Cicer arietinum]
Length=456

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/458 (38%), Positives = 264/458 (58%), Gaps = 20/458 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + H+ +FPWLAFGH+LP    +K LA KG ++SF+STP+N++RLP +P +    L + E+
Sbjct  7     KLHIAVFPWLAFGHILPYFHLSKLLAQKGHKISFISTPRNIKRLPKLPTNLQTSLEMIEL  66

Query  252   ALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVP  431
              LP +  LP++ EAT+D+ +     +L+ A+D +  P  + +    P+ I+ DF  +W+P
Sbjct  67    QLPRIDHLPDHAEATLDIPRH-ITPYLRKAFDGLKEPLTKFLETSTPDCIIYDFTPYWLP  125

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPD  611
             +I+ + G+  V  S++   +L +  +   ++SG+      HF            VA +P 
Sbjct  126   QISSKLGIFQVHFSIFCGLSLYFFANLFVMKSGE-----RHFDKSKL-----KAVALKPF  175

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
                 +       + SGVS   R    + G D ++VRSC E EGE + LLE LYK+PV+ +
Sbjct  176   EEKYLCDKHLENNESGVSDAFRFQQTLFGADLLVVRSCMEIEGESLTLLENLYKKPVIPV  235

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             GLLPP L+ +  I    +  +W +  +WLD     SV++V FGS+  +      EL   L
Sbjct  236   GLLPPSLDFSEDI--SNDDDNWCKISKWLDKHEKNSVIYVAFGSQVVISDEDFTELTMGL  293

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             ELS  PFL++L+K   D+  +      D+  + SN G V   W PQ  ILAH ++GG L 
Sbjct  294   ELSGFPFLFVLKKKNSDDNRH------DWFKKRSNNGLVWTNWVPQLRILAHESVGGFLT  347

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSI  1328
             H GW ++IESL  G PLI+LP+  +QGLNA ++ EK +G +V R + DG F+RD VA ++
Sbjct  348   HCGWSSVIESLEVGCPLIMLPLENEQGLNAIVMEEKMVGVKVARNDHDGKFNRDSVAKAL  407

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIE  1442
             RSVM   EG+  R K  +M+ IFG+  L D YID F++
Sbjct  408   RSVMDKEEGKVYRSKVEEMSKIFGDMELQDKYIDGFVD  445



>gb|KCW82044.1| hypothetical protein EUGRSUZ_C03414, partial [Eucalyptus grandis]
Length=451

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 267/459 (58%), Gaps = 29/459 (6%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL----PPIPASFTERLSLR  245
             H+ +FPWLA GH+ P LE +K L+ +G  +SF+STP N+ RL    P +P S    + L 
Sbjct  10    HIAMFPWLAHGHITPFLELSKFLSLRGHAISFLSTPNNIARLARSHPELPPS----VRLV  65

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
                LP VP LP + E+T DL+  + V +LK AYD + P     +     + ++ DFA+HW
Sbjct  66    SFPLPRVPNLPSSAESTSDLD-IDLVPYLKKAYDLLEPALTRFLSGSRVDWVIHDFASHW  124

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             +P  A R GV +VF S + A +LA+LG P EL SG+ +  PE  T  P W  + S    R
Sbjct  125   LPGAAARLGVTSVFFSTFNATSLAFLGPPSELISGRCQ-KPEDLTCVPAWIPYESTACLR  183

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                   ++++    D   VS   R    I+GCDFVIVRSC+EFE E + LL+++Y++P +
Sbjct  184   ---LHEILKHQRCMDEE-VSDLCRFGHTIDGCDFVIVRSCREFESEPLSLLQQIYQKPAI  239

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLL P +  +     G +   W     WL  +R KSV+++  G+E  +     +ELA+
Sbjct  240   PVGLLTPAVRQDE----GDDDEKWKALKSWLHTKREKSVLYIALGTEVILSHELTNELAA  295

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              +E S +PF+W++R  G+  PG        F  R S +G +  GWAPQ  ILAH AIGG 
Sbjct  296   GIEKSGLPFVWVVRN-GLVAPG--------FEQRVSGRGFIWAGWAPQTRILAHEAIGGF  346

Query  1146  LFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
             L H GW + IE+LG G PL+L     +DQGL A+ L EK++G+EVPR E DG F+ D+VA
Sbjct  347   LTHCGWNSTIEALGRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGLFTGDVVA  406

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQF  1436
              SIR VM   EGE IR  A  M  +FGN  L + Y+++F
Sbjct  407   ESIRRVMVEHEGEPIRATARAMKEVFGNIELQNEYLEEF  445



>ref|XP_010419269.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=471

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/466 (39%), Positives = 274/466 (59%), Gaps = 18/466 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV +FP+LAFGHM+P LE +K +A KG  VSF+STP+N+ RL P +P + +  ++  +
Sbjct  13    KLHVAMFPFLAFGHMVPYLELSKLIAEKGHTVSFISTPRNIDRLLPRLPENLSSAINFVK  72

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             + LP V    LPE+ EAT DL   E + +LK AYD +  P  + +    P+ +L DFA +
Sbjct  73    LPLPVVGDNKLPEDGEATTDL-PVELISYLKIAYDGLKSPVTKFLESAKPDWVLQDFAAY  131

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             W+P I++  G+ T FLS Y  ATL  L  P  EE R+      P  F  PP W  F + V
Sbjct  132   WLPPISRSLGIKTGFLSAYNGATLGILKPPGFEEYRT-----CPADFMKPPKWVPFETPV  186

Query  597   AHRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             A +      +          G V    R+  VI+GCD + VRSC E+E E++ +++ L++
Sbjct  187   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  246

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +G+LPP++      +   ++ +W    +WLD+++ KSVV+V FGSE K    +++
Sbjct  247   KPVIPVGVLPPKME-----EKFEDTDTWLTVKKWLDSRKTKSVVYVAFGSEAKPSQTELN  301

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             E+A  LELS +PF W+LR         P  LP  F  RT+ +G V  GW  Q   L+H +
Sbjct  302   EIALGLELSGLPFFWVLRTRRGSGDTEPVELPEGFEERTAGRGMVWRGWVEQLRTLSHDS  361

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             IG  L H GWGTIIE++ F  P+ +L  + DQGLNA+++ +K+IGY +PR E +G F+++
Sbjct  362   IGLALTHPGWGTIIEAIRFSKPMAVLVFLNDQGLNARVIEQKKIGYMIPRDETEGFFTKE  421

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
              VA S++ VM   EG+  R     M  +FG+ +  D Y+D F++Y 
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYL  467



>gb|ACU24590.1| unknown [Glycine max]
Length=458

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 185/423 (44%), Positives = 255/423 (60%), Gaps = 16/423 (4%)
 Frame = +3

Query  210   IPASFTERLSLREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRR  383
             IP++    + L +  LPS+    LPE  EATVD+   E++++LK AYD++    ++ V  
Sbjct  39    IPSNLAHLVDLVQFPLPSLDKEHLPEGAEATVDIPS-EKIEYLKLAYDKLQHAVKQFVAN  97

Query  384   DLPELILVDFATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTV  563
              LP  I+ DF+ HW+ +I   + V  +F +V +A  L   G P    + K   SPE  T 
Sbjct  98    QLPNWIICDFSPHWIVDIVHEFQVKLIFYNVLSAPALTVWGPP---GTRKTPLSPESLTA  154

Query  564   PPGWFNFHSLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGE  743
             PP W  F S VA+R   A  +    +  +ASGVS  +RL  V    + VI RSC E EGE
Sbjct  155   PPEWVTFPSSVAYRIHEAIALCAGANPVNASGVSDFERLHKVFNASEAVIFRSCYEIEGE  214

Query  744   YIDLLEKLYKRPVLAIGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFG  920
             Y++  +KL  +PV+ IGLLP         I  G  S    + FEWLD Q  KSVVFVGFG
Sbjct  215   YLNAYQKLVGKPVIPIGLLPADSEERGREIIDGRTSG---KIFEWLDEQASKSVVFVGFG  271

Query  921   SEYKMPIHQIHELASALELSRMPFLWILRKP--GIDNPGYPALLPTDFVNRTSNQGRVIL  1094
             SE K+   Q+ E+A  +E   +PF+W LRKP   I++  +   LP  F+ RTSN+G V +
Sbjct  272   SELKLNKDQVFEIAYGIEEYELPFIWALRKPSWAINDEDF---LPFGFIERTSNRGVVCM  328

Query  1095  GWAPQQNILAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYE  1274
             GW PQQ ILAHP+IGG LFHSGWG++IE+L FGH L++LP + DQ LNA+ LVEK +  E
Sbjct  329   GWIPQQEILAHPSIGGSLFHSGWGSVIETLQFGHILVVLPFIIDQPLNARFLVEKGLAIE  388

Query  1275  VPRREDGSFSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLH-DNYIDQFIEYFQ  1451
             V R EDGSF+R+ +A S+R  M   EG+ IR+   + A I GN  LH D+YI +F+++ +
Sbjct  389   VKRNEDGSFTRNDIATSLRQAMVLEEGKKIRINTGEAAAIVGNMKLHQDHYIAEFVQFLK  448

Query  1452  SKI  1460
             + I
Sbjct  449   NGI  451



>gb|AFJ53032.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=458

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 272/462 (59%), Gaps = 23/462 (5%)
 Frame = +3

Query  87    IFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIALPS-  263
             +FPWLAFGH+LP L+ AK +A +G  +SF+STP+N+ RLP +P + +  ++  ++ LPS 
Sbjct  1     MFPWLAFGHILPFLQLAKLIAQRGHLISFISTPRNIDRLPKLPPALSSLITFVKLPLPSS  60

Query  264   -VPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEIA  440
              V GLP   EAT DLE +  V +LK AYD +       ++   P+ I+ D+A  W+P IA
Sbjct  61    DVQGLPHAAEATSDLEAR-HVGYLKRAYDLLQHQLSTFLQSSNPDFIICDYAPFWLPPIA  119

Query  441   KRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYAP  620
             +R G+ TVF S++ A+ LA+   P +      R + E  T  P W  F +   +   Y P
Sbjct  120   RRLGIPTVFFSIFIASVLAFTSPPADDEDEDYRKTVEDLTEKPRWVPFETTSGY---YRP  176

Query  621   TMMRNTHTPDASGVSSGQ------RLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
                + +      G   GQ      R   ++ GCDFV VR+C E E +++ LLE+++K+PV
Sbjct  177   FEAKVSFEMAVVG-GGGQEFPELHRFRQMLRGCDFVAVRTCPELEHDWLKLLEQIHKKPV  235

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPK-SVVFVGFGSEYKMPIHQIHEL  959
               IG+LP   N         +  +W    EWLD+ + K SVV+V FGSE      ++ E+
Sbjct  236   FPIGVLP---NPIKEEDEEGDEDTWKSIKEWLDDGKEKGSVVYVAFGSEAIPSQEELTEI  292

Query  960   ASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
             A+ LELS +PF W+LR    D+P     LP  F  RT+ +G V  GWAPQ  IL H ++G
Sbjct  293   ATGLELSGLPFFWVLRSS--DDPRRE--LPEGFEERTAGRGLVWKGWAPQVKILGHESVG  348

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRR-EDGSFSRDMV  1316
                 HSGW +++E+L FG PL+LL   ADQGLN+KLL EK +GY VPR  +DG F R+ V
Sbjct  349   CMFCHSGWSSVVEALQFGRPLVLLTFYADQGLNSKLLQEKGLGYLVPRNDDDGRFRRESV  408

Query  1317  ANSIRSVMASREGE-GIRLKAAQMANIFGNHNLHDNYIDQFI  1439
             A S+R+VM + EG+ G R KAA+M  +F +   H++Y+  F+
Sbjct  409   AESLRTVMLAEEGQSGHREKAAEMQTLFADTEKHESYVHDFL  450



>ref|XP_010051441.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=461

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 190/472 (40%), Positives = 270/472 (57%), Gaps = 29/472 (6%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL----PPIPASFTERLSLR  245
             H+ +FPWLA GH+ P LE +K L+ +G  +SF+STP N+ RL    P +P S    + L 
Sbjct  10    HIAMFPWLAHGHITPFLELSKFLSLRGHAISFLSTPNNIARLARSHPELPPS----VRLV  65

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
                LP VP LP + E+T DL+  + V +LK AYD + P     +     + ++ DFA+HW
Sbjct  66    SFPLPRVPNLPSSAESTSDLD-IDLVPYLKKAYDLLEPALTRFLSGSRVDWVIHDFASHW  124

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             +P  A R GV +VF S + A +LA+LG P EL SG+ +  PE  T  P W  + S    R
Sbjct  125   LPGAAARLGVTSVFFSTFNATSLAFLGPPSELISGRCQ-KPEDLTCVPAWIPYESTACLR  183

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                   ++++    D   VS   R    I+GCDFVIVRSC+EFE E + LL+++Y++P +
Sbjct  184   ---LHEILKHQRCMDEE-VSDLCRFGHTIDGCDFVIVRSCREFESEPLSLLQQIYQKPAI  239

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLL P +  +     G +   W     WL  +R KSV+++  G+E  +     +ELA+
Sbjct  240   PVGLLTPAVRQDE----GDDDEKWKALKSWLHTKREKSVLYIALGTEVILSHELTNELAA  295

Query  966   ALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
              +E S +PF+W++R  G+  PG        F  R S +G +  GWAPQ  ILAH AIGG 
Sbjct  296   GIEKSGLPFVWVVRN-GLVAPG--------FEQRVSGRGFIWAGWAPQTRILAHEAIGGF  346

Query  1146  LFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
             L H GW + IE+LG G PL+L     +DQGL A+ L EK++G+EVPR E DG F+ D+VA
Sbjct  347   LTHCGWNSTIEALGRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGLFTGDVVA  406

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCK  1475
              SIR VM   EGE IR  A  M  +FGN  L + Y+++F    +  +    K
Sbjct  407   ESIRRVMVEHEGEPIRATARAMKEVFGNIELQNEYLEEFAGILEKGVTKDQK  458



>gb|KFK32801.1| hypothetical protein AALP_AA6G289900 [Arabis alpina]
Length=471

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 182/466 (39%), Positives = 275/466 (59%), Gaps = 17/466 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLR  245
             ++ +V +FP+LAFGHM+P LE +K +A KG  VSF+STP+N+ RL P +P + +  ++  
Sbjct  13    KKLYVAMFPFLAFGHMVPYLELSKLMAQKGHTVSFISTPRNIDRLLPRLPENLSSAINFI  72

Query  246   EIALPSV-PGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             ++ L +V   LPE  EAT DL   E + +LK AYD +  P  E +    P+ +L DFA +
Sbjct  73    KLPLSTVGDKLPEGGEATTDL-PFELISYLKIAYDGLRVPVTEFLESSKPDWVLQDFAPY  131

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             W+P I++  G+ T F S +  ATL  L  P  EE R+ +       F  PP W  F + V
Sbjct  132   WLPPISRHLGIKTAFFSAFNGATLGLLKPPGFEEYRTCQ-----ADFLTPPKWVPFETPV  186

Query  597   AHRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             A +      + +        G V    R++ VI+GCD + VRSC E+E E++ L++ L++
Sbjct  187   AFKLFECKDIFKGFMVETTEGNVPDVHRVAGVIDGCDVIAVRSCYEYEAEWLGLIQDLHR  246

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +G+LPP+       +   ++ +W     WLD+++ KSVV V FGSE K    ++ 
Sbjct  247   KPVIPVGVLPPKPE-----EKFEDTDTWVTIKAWLDSRKSKSVVHVAFGSEAKPSHTEVD  301

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
              +A  LELS +PF W+L+         P  LP  F  RT+++G V  GW  Q   L+H +
Sbjct  302   AIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWKGWVEQLRTLSHDS  361

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             IG  L H GWGTIIE++ FG P+++L  V DQGLNA+++ EK+IGY +PR E +G F+++
Sbjct  362   IGLVLTHPGWGTIIEAVRFGKPMVMLVFVCDQGLNARVIEEKKIGYMIPREEKEGLFTKE  421

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
              VA S+R VM   EG+  R    +M N+FG+ +  D Y+D F+EY 
Sbjct  422   SVAKSLRLVMEEEEGKVYRENVKEMKNVFGDMDRQDRYVDDFMEYL  467



>ref|XP_008354446.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=469

 Score =   337 bits (863),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 279/469 (59%), Gaps = 18/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++   E +K LA KG R+SF+STPKN+ RL    +SF+  +   E
Sbjct  7     KKLHIAMFPWLAYGHLMSYXEVSKFLAQKGHRISFISTPKNITRLRS--SSFSPLIDXVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T +L    +V +LK A D + P     +       I+ DF  +WV
Sbjct  65    LPLPTVDGLPESAESTSELPIN-KVPYLKKANDLLKPSVTHFIEHSGVNWIVHDFNCYWV  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P++A + GV +V+ SV  A +LA+ G P EL   K R  PE FTV P W ++ S VA + 
Sbjct  124   PQVATQLGVNSVYFSVTNANSLAFGGPPSELLGNK-RRRPEDFTVVPEWVDYPSNVAFK-  181

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  ++ +    D   VS   RL+  I+ C+FV +RSC EFE + + LL K+Y +PV+ 
Sbjct  182   --LHEVVSHWDCMDDE-VSDFXRLAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVP  238

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFE----WLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             +GLLPP   ++   Q G       E +E    WL+N++P SVV++  G+E  +    +HE
Sbjct  239   LGLLPP---VSAPHQHGVADDRGDETWEVLRGWLENKKPNSVVYIALGTEVTLSQELMHE  295

Query  957   LASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  +E S +PF+W++  +P ++      ++P  F  R  N+G V+ GWAPQ NIL H +
Sbjct  296   LAHGIEKSGLPFIWVVNNRPLVEGLLGSDIIPLGFETRVENRGLVLRGWAPQLNILGHIS  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             +GG L H GW +++E+LG+G  LIL     +DQGL ++L+ EK +G E+PR E DGSF+ 
Sbjct  356   VGGFLTHCGWSSVVEALGYGRALILFSGANSDQGLISRLMHEKRVGLEIPRDEQDGSFTS  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             D VA   R VM  +EGE IR  A  M  IFGN  L++  +D+F    ++
Sbjct  416   DSVAELTRRVMVEKEGESIRSNAWAMKEIFGNVELNNKCLDEFTGVLET  464



>ref|XP_010047534.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=460

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 188/460 (41%), Positives = 269/460 (58%), Gaps = 21/460 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV +FPWLA+GH++P LE A  LA KG RVSF+STPKNLQ+ P   A     ++L E
Sbjct  6     KKLHVAMFPWLAYGHLMPFLEVATFLAQKGHRVSFISTPKNLQKFP---ADLPPSMTLVE  62

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP++ E+T +L     V +LK AYD + P   E +     + ++ DF + W+
Sbjct  63    LPLPRVHGLPDSAESTSELPHN-MVPYLKKAYDMLEPAVAEFLANSDVDWVIQDFVSFWL  121

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR-PSPEHFTVPPGWFNFHSLVAHR  605
             P+ A+R GV + F  ++ A  L + G P  L   + R  + E  TV P W  + + VA+R
Sbjct  122   PQKARRVGVKSAFFCIFNATALVFAGPPSLLIDSQARVKTAEDLTVVPEWVTYPTKVAYR  181

Query  606   PDYAPTMMRNTHTPDASGVSSG-QRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
                   ++      D+   +SG +RL   I GCD V VR+C EFE E + LL+KL+  PV
Sbjct  182   ---LHEVINEEDIVDSDSNTSGLERLGRSILGCDIVAVRACSEFEAEPLSLLKKLHASPV  238

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP+   N     G     WSE  +WLD+++ KSV +V  G+E  +    +HELA
Sbjct  239   VPMGLLPPQ---NKRRHEG--DGRWSELKQWLDDRKEKSVFYVALGTEVALSQESMHELA  293

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               +E S +PF+W+     +     P  +P+ F +R   +G V +GWAPQ +ILAHP++GG
Sbjct  294   CGIEKSDLPFVWV-----VGPKASPGTIPSGFESRVLGRGFVWVGWAPQLDILAHPSVGG  348

Query  1143  CLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
              L H GW +IIE+LG G  LIL     +DQGL A+L+ E+ +G+EV R   DGSF+ D V
Sbjct  349   FLTHCGWSSIIEALGHGRALILFSGGFSDQGLMARLMDERRVGWEVLRDSRDGSFTSDSV  408

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQF  1436
             A +IR VM   EG+ +R  A  M  IFGN  L   Y++ F
Sbjct  409   AETIRRVMVEPEGKEVRANAWAMREIFGNVELGRKYLEGF  448



>ref|XP_007156464.1| hypothetical protein PHAVU_003G288200g [Phaseolus vulgaris]
 gb|ESW28458.1| hypothetical protein PHAVU_003G288200g [Phaseolus vulgaris]
Length=465

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 185/462 (40%), Positives = 263/462 (57%), Gaps = 13/462 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGHM+P LE AK +A KG RVSFVSTP+N+ RLP +  +    ++  ++ L
Sbjct  10    HIVMFPWLAFGHMIPNLELAKLIAEKGHRVSFVSTPRNIDRLPKLSPTL---INFVKLPL  66

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P+V  LPEN EAT D+   + VQ+LK AYD +  P    +     + +  DF   W   +
Sbjct  67    PNVQNLPENAEATTDV-PYDAVQYLKKAYDALEQPLTRFLESSKADWLFYDFVPFWAASV  125

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRPDY  614
             A + G+ T F S++T   L ++G P  L      R  PE + V P W  F + VA R   
Sbjct  126   ASKLGIKTAFYSIFTPPFLGFIGPPSYLTDNNSPRHKPEEYIVVPPWVTFPTTVAFRYYE  185

Query  615   APTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIG  794
                ++      + SG S   R  + I+ CD V+VR C EF+ E+  LLE +Y +PVL  G
Sbjct  186   IMRIVDILSDQNNSGFSDTYRHGAGIQNCDIVVVRGCTEFDAEWFPLLENIYGKPVLPAG  245

Query  795   LLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALE  974
              LP     +TA     ++ +W    EWLD Q    VV+V FGSE K    ++ E+A  LE
Sbjct  246   QLP-----STAPVGSEDNETWRWMKEWLDKQARGRVVYVAFGSEAKPTQEEVTEIALGLE  300

Query  975   LSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
              S +PFLW+LR + G  +P     LP  F  RT  +G V   WAPQ  IL H A+GG L 
Sbjct  301   KSELPFLWVLRVQRGPSDPDV-LRLPEGFEERTKARGVVCRSWAPQLKILEHVAVGGFLT  359

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVANSI  1328
             HSGW +++E +     L+LL  ++DQG+NA++L EK++GY VPR  EDGSFS D VA S+
Sbjct  360   HSGWTSVVEGIQNEKALVLLTFLSDQGINARVLEEKKMGYSVPRDEEDGSFSSDSVAESL  419

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             + V+   EG+  R +  +M ++F N +  + YID  I   ++
Sbjct  420   KLVVVEEEGKIYRERIKEMKDLFVNEDRQNRYIDNLIHNLKT  461



>ref|XP_006294142.1| hypothetical protein CARUB_v10023135mg [Capsella rubella]
 gb|EOA27040.1| hypothetical protein CARUB_v10023135mg [Capsella rubella]
Length=471

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/465 (39%), Positives = 274/465 (59%), Gaps = 17/465 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV +FPWLAFGHM+P  E +K +A KG  VSF+STP+N+ RL P +P + +  ++  +
Sbjct  14    KLHVAMFPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPQNLSSAINFVK  73

Query  249   IALPSVPG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             + LP     LPE+ EAT D+   E V +LK A+D +  P  E +    P+ +L DFA +W
Sbjct  74    LPLPVGDNKLPEDGEATTDV-PFELVSYLKIAFDGLKSPVTEFLESSKPDWVLQDFAAYW  132

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLVA  599
             +P +++R G+ T FLS +  ATL  L  P  EE R+      P  F  PP W  F + VA
Sbjct  133   LPPVSRRLGIKTGFLSAFNGATLGILKPPGFEEYRT-----CPADFMKPPKWVPFETPVA  187

Query  600   HRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
              +      +          G V    R+  VI+GCD + VRSC E+E E++ +++ L+++
Sbjct  188   FKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHRK  247

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+ +G+LPP+       +   ++ +W    +WLD+++ KSVV+V FGSE K    +++E
Sbjct  248   PVIPVGVLPPKPE-----EKFEDTDTWLTVKKWLDSRKAKSVVYVAFGSEAKPSQTELNE  302

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             +A  LELS +PF W+L+         P  LP  F  RT+++G V  GW  Q   L+H +I
Sbjct  303   IALGLELSGLPFFWVLKTRRGSWDTEPTELPEGFEERTADRGMVWRGWVEQLRTLSHESI  362

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             G  L H GWGTIIE++ F  P+ +L  V DQGLNA+++ EK+IGY +PR E +G F+++ 
Sbjct  363   GLVLTHPGWGTIIEAIRFAKPMAMLVFVFDQGLNARVIEEKKIGYMIPRDETEGFFTKES  422

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             VA S++ VM   EG+  R    +M  +FG+ +  D Y+D F++Y 
Sbjct  423   VAKSLKLVMEEEEGKVYRENVKEMKGVFGDMDRQDLYVDSFLDYL  467



>ref|XP_007205156.1| hypothetical protein PRUPE_ppa005394mg [Prunus persica]
 gb|EMJ06355.1| hypothetical protein PRUPE_ppa005394mg [Prunus persica]
Length=463

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 181/473 (38%), Positives = 268/473 (57%), Gaps = 19/473 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERL-SLR  245
             ++ H+ +FPWLAFGHM+P LE AK +A KG ++SF+STP+N++RLP +P + +  L +  
Sbjct  6     QKLHIAMFPWLAFGHMIPYLELAKLIAQKGHQISFISTPRNIERLPQLPPNLSSSLITFV  65

Query  246   EIALPSVPG-LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             ++ LP V    PE  EAT D+ Q  +V  LK  YD +  P    +    P+ +L DFA +
Sbjct  66    KLPLPRVDDDFPEGAEATTDVSQN-KVMKLKKVYDALQQPLTHFLESSNPDWLLFDFAAY  124

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             W P  A+  G+   F S++  A LA+LG      S   R +PE +TV P W  F S VA 
Sbjct  125   WAPTTARNLGIPCAFFSIFIGACLAFLGPTSPEISPDDRKNPEDYTVQPKWVPFPSNVAF  184

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
                    +  ++ T D S VS   R    ++GCD + +R C EF+ +++ LL+ ++++P+
Sbjct  185   HLFEVHRVYLDSTTGDESNVSDVYRFMGGMKGCDVIAIRGCMEFDLKWLRLLQDIHRKPI  244

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             L +G LP      T  +    +  W    EWLD Q   SVV+V FGSE      +I  +A
Sbjct  245   LPVGQLP-----TTNYE---ENDRWGSMREWLDRQLKASVVYVAFGSEAMPSQEEITTIA  296

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS++PF+W+LR   +        LP  F  R   +G V   WAPQ  IL H ++G 
Sbjct  297   LGLELSKLPFIWVLRTNVVK-------LPEGFEKRMGGRGLVCRSWAPQLKILGHDSVGV  349

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMVA  1319
              L HSGW +++E+L FG  L+LL M  DQGLNA+ L E++I Y +PR  EDGSF+ D VA
Sbjct  350   FLSHSGWSSVVEALTFGRALVLLTMSNDQGLNARFLEERKIVYCIPRDEEDGSFTSDSVA  409

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKILTQCKR  1478
              S++ V+   EG+  R KA ++  +FG+    D Y+  F+EY ++ +    K+
Sbjct  410   ESLKLVIEMEEGKIYRDKAEELKPLFGDRKKQDAYVHNFLEYLKAHVGNASKK  462



>ref|XP_002270369.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=464

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 183/466 (39%), Positives = 259/466 (56%), Gaps = 20/466 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             E+ H+++FPWLAFGH+LP LE +K +A +G  +SF+STP+N+ RLP +P +    + L +
Sbjct  5     EKLHIVMFPWLAFGHILPYLELSKLIAREGHLISFISTPRNIDRLPKLPLNLQPLIDLVK  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
               LP++  LPEN EAT DL   E++ +LK A+D +  P    +    P+ ++ DF  HW+
Sbjct  65    FPLPNIDNLPENAEATTDL-PYEKIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFTPHWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLG-SPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHR  605
             P IA ++GV+  F    +A TL + G +   +  G  R         P W  F + VA  
Sbjct  124   PPIAAKHGVSRAFFCTSSATTLCFCGPTSIMMEGGDPRTELHQLATAPPWVTFPTKVA-S  182

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
             P +    +   H  D SGVS   R+ S I GCD + +RSC E E E++DLL KL+++P+ 
Sbjct  183   PLFLLRRILGIHQADVSGVSDKFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLF  242

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              IGLLPP   +N       +  SW    EWLD Q  + VV+V  G+E      ++ ELA 
Sbjct  243   PIGLLPPSAPVN------GDDDSWPPIREWLDKQEKECVVYVALGTEVTPTEDELTELAF  296

Query  966   ALELSRMPFLWILRK--PGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
              LELS +PF W LRK    +D       LP  F  RT  +G V   WAPQ  IL H ++G
Sbjct  297   GLELSGLPFFWALRKRHDSVD-------LPDGFEERTKGRGMVWRTWAPQLRILDHESVG  349

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
             G + H GW ++IE L FG  L +LP+  DQGLNA+   E ++G E+PR +E+G  SR  V
Sbjct  350   GFVIHCGWSSVIEGLHFGQALTMLPLWGDQGLNARTFEEMKVGVEIPRDQEEGWLSRKSV  409

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A ++  VM    G+  R KA +M  +   H  H  Y+  F EY Q 
Sbjct  410   AETLSLVMVEEAGKIYRNKAKEMRKLLDKHR-HHRYVTDFAEYLQK  454



>gb|KDP29789.1| hypothetical protein JCGZ_18724 [Jatropha curcas]
Length=473

 Score =   336 bits (862),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 183/468 (39%), Positives = 272/468 (58%), Gaps = 16/468 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV  FPWLAFGHM+P LE AK++A KG ++SF+STP+N+QRLP IP + +  ++   
Sbjct  5     KRLHVAFFPWLAFGHMIPFLELAKRIAQKGHKISFLSTPRNIQRLPKIPPNLSSNINFIS  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V  LP + EAT+DL   +++++L+ AYD +  P  + +    P  ++ D   +W+
Sbjct  65    LPLPQVDNLPPDAEATIDL-PFDKIRYLRMAYDSLKDPLVQFLETSTPNWVIYDCFPYWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPE--ELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             P I    G+++ F S++   TL +  SP    +     R  PE FTVPP W  F S VA+
Sbjct  124   PPILADLGISSAFFSIFGGWTLTFWASPSLAMIDGDDSRFHPEDFTVPPKWIPFPSKVAY  183

Query  603   RPDYAPTMMRNTHTPDASGVSSG---QRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             R   A  +       D SG+        +SSV+   D + +RSC E E +++ L+ +L+ 
Sbjct  184   RLHEAKRIPHRFEV-DKSGIPKHIFRSSVSSVMASSDIIAIRSCFELEADFLRLVRELHG  242

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV  +GLLPP L L+     G    +W +  +WLD Q   SVV++ FGSE  +  ++  
Sbjct  243   KPVFPVGLLPP-LTLDGN---GDEDDTWLKIRDWLDKQEKGSVVYIAFGSEVDLSQNEFT  298

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             ELA  LELS +PF W  RK       Y A LP  F  R   +G     W PQ  IL+H +
Sbjct  299   ELALGLELSGLPFFWASRK----RNDYSAELPDGFEERVEGRGMFWTSWVPQPRILSHES  354

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPR-REDGSFSRD  1310
             +GG L H G+ +II++L  G  LI+LP+  D GL A++  +K++G E+ R  EDGS++RD
Sbjct  355   VGGFLTHCGFSSIIDALYSGRALIMLPITFDHGLIARVFEDKKVGVEITRDEEDGSYTRD  414

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              VA+S++ VM   EG+  R  A +M+ +F N  LHD YIDQF+E  Q+
Sbjct  415   SVADSVKLVMVEEEGKLYRENAKEMSKLFANKELHDRYIDQFVELLQT  462



>ref|XP_009151459.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Brassica rapa]
Length=453

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/461 (38%), Positives = 260/461 (56%), Gaps = 17/461 (4%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV +FPWLA GH+LP    +K LA KG +VSF+STP+N++RLP +P+S +  ++     L
Sbjct  9     HVAMFPWLAMGHLLPFFRMSKLLAQKGHKVSFISTPRNIERLPNLPSSLSSFITFVSFPL  68

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
                PG     E ++D+   +Q   LK+A+D +  P  E ++ + P+ ++ D+A HW+P +
Sbjct  69    VPFPGSTPGSECSMDVTYSKQPS-LKSAFDLLQKPLTEFLQEESPDWVIYDYAAHWLPPV  127

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A   G++  F S++ AA+L +LG P  L  G +R +PE FTV P W  F S +A+R  + 
Sbjct  128   AAELGISKAFFSIFNAASLCFLGPPSLLLEG-VRSTPEDFTVVPPWIPFQSNMAYR-YHE  185

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
              T++ +    D +GVS   R    I   D V V +   FE E++ LL+ LY++PV   G 
Sbjct  186   VTLVGDKRGKDTNGVSDSARFGYSISESDAVFVHTSTGFEPEWLGLLKDLYRKPVFPTGF  245

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             LP                +W    +WLD Q   SVV+V  G+E  +P  +  ELA  LE 
Sbjct  246   LPTDTEDEVE-----GDKTWVGIKKWLDKQSINSVVYVALGTEASLPPAEFTELAHGLEK  300

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S +PF W++R       GY        V R + +G V +GW PQ  IL+H ++GG L H 
Sbjct  301   SEVPFFWVIRNESQILDGY--------VERVAGRGMVNVGWVPQVKILSHSSVGGFLTHC  352

Query  1158  GWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRED-GSFSRDMVANSIRS  1334
             GW +++E LGFG   IL P++ +QGLN +LL  K +G E+PR E+ GSF  D VA+S+R 
Sbjct  353   GWNSLVEGLGFGRVPILFPVLNEQGLNTRLLEGKGLGVEIPRDEEKGSFDSDSVAHSVRL  412

Query  1335  VMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
              M    GE IR K   M  +FGN + +  Y+D+ I Y +SK
Sbjct  413   AMVDDAGESIRAKTKLMMGLFGNMDENSRYVDELIGYMRSK  453



>gb|KCW79477.1| hypothetical protein EUGRSUZ_C00864, partial [Eucalyptus grandis]
Length=446

 Score =   334 bits (857),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/458 (41%), Positives = 268/458 (59%), Gaps = 21/458 (5%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV +FPWLA+GH++P LE A  LA KG RVSF+STPKNLQ+ P   A     ++L E
Sbjct  6     KKLHVAMFPWLAYGHLMPFLEVATFLAQKGHRVSFISTPKNLQKFP---ADLPPSMTLVE  62

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP++ E+T +L     V +LK AYD + P   E +     + ++ DF + W+
Sbjct  63    LPLPRVHGLPDSAESTSELPHN-MVPYLKKAYDMLEPAVAEFLANSDVDWVIQDFVSFWL  121

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLR-PSPEHFTVPPGWFNFHSLVAHR  605
             P+ A+R GV + F  ++ A  L + G P  L   + R  + E  TV P W  + + VA+R
Sbjct  122   PQKARRVGVKSAFFCIFNATALVFAGPPSLLIDSQARVKTAEDLTVVPEWVTYPTKVAYR  181

Query  606   PDYAPTMMRNTHTPDASGVSSG-QRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
                   ++      D+   +SG +RL   I GCD V VR+C EFE E + LL+KL+  PV
Sbjct  182   ---LHEVINEEDIVDSDSNTSGLERLGRSILGCDIVAVRACSEFEAEPLSLLKKLHASPV  238

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +GLLPP+   N     G     WSE  +WLD+++ KSV +V  G+E  +    +HELA
Sbjct  239   VPMGLLPPQ---NKRRHEG--DGRWSELKQWLDDRKEKSVFYVALGTEVALSQESMHELA  293

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               +E S +PF+W+     +     P  +P+ F +R   +G V +GWAPQ +ILAHP++GG
Sbjct  294   CGIEKSDLPFVWV-----VGPKASPGTIPSGFESRVLGRGFVWVGWAPQLDILAHPSVGG  348

Query  1143  CLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPR-REDGSFSRDMV  1316
              L H GW +IIE+LG G  LIL     +DQGL A+L+ E+ +G+EV R   DGSF+ D V
Sbjct  349   FLTHCGWSSIIEALGHGRALILFSGGFSDQGLMARLMDERRVGWEVLRDSRDGSFTSDSV  408

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYID  1430
             A +IR VM   EG+ +R  A  M  IFGN  L   Y++
Sbjct  409   AETIRRVMVEPEGKEVRANAWAMREIFGNVELGRKYLE  446



>ref|XP_010271397.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=473

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 185/473 (39%), Positives = 271/473 (57%), Gaps = 26/473 (5%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREI  251
             + HV++ P+LAFGHM+P    +  LA  G RVSFVSTP+N+ RLP  P + +  L     
Sbjct  4     EVHVVMLPYLAFGHMIPFFHLSIALAKSGIRVSFVSTPRNIDRLPKPPVNLSALLEFVPF  63

Query  252   ALPSVPG-----LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
              LP VP      LP N EATVD+   ++V  L  AY+ +  PF++ +    P  I+ DF 
Sbjct  64    PLPIVPNTNGETLPPNAEATVDV-PADKVPLLDAAYNLLRDPFKQFLFDKSPHWIIQDFL  122

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG---KLRPSPEHFTVPPGWFNFH  587
               W  +IAK + +  +  SV+ A T A++G P+ +       +RP+ E    PP W  F 
Sbjct  123   ADWTIDIAKEFCIPIIGFSVFAAITNAFIGPPDFMVGDARKSVRPTAESLMSPPPWIRFE  182

Query  588   SLVAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKL  767
             S +      A +        D       +++++V+     V +R+C +FE  Y D+LE +
Sbjct  183   SSLGLPSYEAVSFFHGFFGKDGPA----EKIATVLRESKAVAIRTCPDFECGYFDVLETM  238

Query  768   YKRPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQ  947
             Y++ V+ +GLL P     T    G +   W +   WLD Q+PKSV+FVGFGSE ++   Q
Sbjct  239   YEKEVIPVGLLSP-----TPSDHGGDEE-WIKILHWLDQQKPKSVLFVGFGSECRLSKEQ  292

Query  948   IHELASALELSRMPFLWILRK---PGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNI  1118
             I E+A  +ELS   F+W LRK    G D+     +LP  F +RTS +G V +GWAPQ  I
Sbjct  293   IEEIARGVELSNFSFIWALRKSHWAGNDD----EVLPQGFSSRTSGRGIVGMGWAPQLKI  348

Query  1119  LAHPAIGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGS  1298
             LAHP+I G LFHSGWG++IE+L + H L+LLP++ DQG+NAKLLVEK +  EV   EDGS
Sbjct  349   LAHPSIRGSLFHSGWGSVIETLQYVHRLVLLPLIIDQGINAKLLVEKNLAIEVEINEDGS  408

Query  1299  FSRDMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSK  1457
             FS + +A +++  MAS EG+ +  +A + A I  N      Y+++F++Y  + 
Sbjct  409   FSGESIAKALKRAMASEEGDEMSQRAKETAAIICNRLREAEYMNKFVKYLTNN  461



>ref|XP_008337731.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
 ref|XP_008352374.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=469

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 278/469 (59%), Gaps = 18/469 (4%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLA+GH++P LE +K LA KG ++SF+STP+N+ RL    +S +  +   E
Sbjct  7     KKLHIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPQNINRL--RSSSLSLLIDFVE  64

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP+V GLPE+ E+T  L    +V +LK AY  + P     V+      ++ D   +W+
Sbjct  65    LPLPAVDGLPESVESTSQLPIN-KVPYLKKAYXLLKPAVTHFVQHSGVNWVVHDVICYWL  123

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P++A + GV +VF S+  A +LA+ G P EL   K R  PE FTV P WF++ S VA++ 
Sbjct  124   PZVATQLGVNSVFFSIINATSLAFGGPPSELLGDK-RRRPEDFTVVPEWFDYPSTVAYK-  181

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                  M+ +    D   VS  QRL+  ++ C+FV +RSC E E + + LL  LY +PV+ 
Sbjct  182   --LHEMVSHWDCMD-DNVSDFQRLAVTVQDCNFVTIRSCTEVESDAVSLLRNLYGKPVVP  238

Query  789   IGLLPPRLNLNTAIQP-GTNSSS---WSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             +GLLP     +   QP G N  +   W    EWL+N++P SVV++  G+E  +    +HE
Sbjct  239   LGLLPTS---SAPHQPXGXNDGADEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHE  295

Query  957   LASALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
             LA  +E S +PF+W++  +P ++      +LP  F  R    G V  GWAPQ+ IL H +
Sbjct  296   LAHGIEKSGLPFIWVVNNRPLVEXALGSNILPLGFETRXDGXGFVWRGWAPQRKILGHIS  355

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMV-ADQGLNAKLLVEKEIGYEVPRRE-DGSFSR  1307
             +GG L H GW +IIE+LGFG  LIL     +DQGLN +L+ EK++G E+PR E DGSF+ 
Sbjct  356   VGGFLTHCGWSSIIEALGFGRVLILFSGANSDQGLNXRLMHEKQVGLEIPRDERDGSFTS  415

Query  1308  DMVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             D VA  IR VM  +EGE +R  A  M  IFGN  L+   +D+F    ++
Sbjct  416   DSVAELIRXVMVEKEGELVRANAXAMKEIFGNVELNKKCLDEFTRVLET  464



>gb|AIE12480.1| UGT3 [Panax ginseng]
Length=471

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 185/462 (40%), Positives = 271/462 (59%), Gaps = 13/462 (3%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             HV++FPWLA GH++P L+ +K LA KG RVSF+STP+N++RLP IP   +  ++L     
Sbjct  8     HVVMFPWLAIGHLIPFLQLSKILALKGHRVSFISTPRNIERLPKIPPDLSPMINLVTFPF  67

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVR--RDLPELILVDFATHWVP  431
             P V  LP+   +++D+    + QFLK A+D +  P  + ++  R  P+ I+ D+A+HW+P
Sbjct  68    PKVHNLPDEAGSSMDIPHH-KAQFLKIAFDLLKSPLVDFLKNTRLKPDWIVYDYASHWLP  126

Query  432   EIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKL-RPSPEHFTVPPGWFNFHSLVAHRP  608
              IA   G++  + S+++AA +A+LG P  L SG+  R   E FT+ P W  F S V +R 
Sbjct  127   SIAGELGISRGYFSLFSAACMAFLGPPSLLVSGEDGRLKGEDFTIVPKWIPFQSDVVYRL  186

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
                   +  +   + SG S   R  + I G D V+ R+  EFE E+ +L+ +LY++PV+ 
Sbjct  187   HEVIKYVDGS-AGNESGASDSVRFGASIGGSDLVLFRTSVEFEPEWFNLVCQLYRKPVVP  245

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
                      L        N   W    EWLD Q   SVV+V  GSE  +   ++ ELA  
Sbjct  246   ------VGVLPPDNDDFGNEEKWVFIKEWLDKQMVDSVVYVALGSEAILSRDELSELALG  299

Query  969   LELSRMPFLWILRKP-GIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGC  1145
             LE   +PF W+LR P G        LLP  FV R  ++G V  GW PQ  IL+H A+GG 
Sbjct  300   LEQCGLPFFWVLRMPPGSTQDESQLLLPDGFVERVKSRGVVHQGWVPQVKILSHSAVGGF  359

Query  1146  LFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVAN  1322
             L H GW +++E+LG+G  LIL P++ DQGLNA+LL  K++G E+PR E DG+F+ D VA+
Sbjct  360   LTHCGWNSVVEALGYGRVLILFPVMNDQGLNARLLKGKKVGVEIPRNERDGAFTSDSVAD  419

Query  1323  SIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
             S+R  M S+EGE +R  A +M  +FG+   +DN ID F+ + 
Sbjct  420   SVRIAMVSQEGESVRATAREMRGLFGHGIRNDNCIDNFVSHL  461



>ref|XP_004250158.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/467 (37%), Positives = 276/467 (59%), Gaps = 11/467 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
              ++ H+ +FPWLAFGHM+P LE +K +A KG ++SF+STP+N+ RLP +P + T  L+  
Sbjct  5     GKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLTPFLNFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ +P V  LPEN EAT+DL   EQV++LK A D +     + +     + IL DF ++W
Sbjct  65    KLPMPHVEKLPENAEATIDL-PYEQVKYLKLAQDALQESMSKFIEDSDIDFILFDFTSYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             VP IA ++ + + + S++ AA L + G    L +  ++R +PE +TV P W  F + VA 
Sbjct  124   VPSIASKFNIPSGYFSIFIAAFLGFTGPVPGLNNDYEIRMTPEEYTVTPKWVPFETTVAF  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +   +   +   ++   R    +E CDF++VRSC EFE E++ ++  ++++PV
Sbjct  184   KLFEVSRIFEASMKGEEENIADIVRYYRSVENCDFLLVRSCSEFEPEWLKVVGDIHRKPV  243

Query  783   LAIGLLP--PRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
               +G LP  P  + +T I       +W E   WLD Q    V++V FGSE K   +++ E
Sbjct  244   FPVGQLPTTPYEDDSTKI------DAWREIKLWLDKQEKGKVIYVAFGSEAKPSQNELTE  297

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             L+  LELS +PF W+LR    ++      LP  F  RT  +G V   WAPQ  IL+H ++
Sbjct  298   LSLGLELSGLPFFWVLRIKRGESDDELIQLPEGFEERTKGRGIVCTSWAPQLKILSHDSV  357

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG L HSGW +++E++ F   L+LL  +ADQG+NA+LL EK++ Y +PR + DGSF+RD 
Sbjct  358   GGFLTHSGWSSVVEAIQFEKSLVLLTFLADQGINARLLEEKKMAYSIPRNDQDGSFTRDS  417

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             VA S+  V+   EG   R K  +M ++F +    +NY++  + + Q 
Sbjct  418   VAESLNLVLVKEEGFIYREKIKEMKDLFCDKKRQNNYVENLLSFLQD  464



>ref|XP_010547586.1| PREDICTED: UDP-glycosyltransferase 91B1 [Tarenaya hassleriana]
Length=466

 Score =   334 bits (856),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 186/466 (40%), Positives = 260/466 (56%), Gaps = 15/466 (3%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +++ HV++FPWLAFGHM+P LE + ++A KG  VSF+STP+N+ RL  IP+  +  ++  
Sbjct  6     SKKLHVVVFPWLAFGHMIPFLELSNRIAMKGHTVSFISTPRNICRLSQIPSLSSTPVTFV  65

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              + LP V  LPEN EAT DL +   V FLK A+D M   F E +    P+ ++ DF  HW
Sbjct  66    ALPLPPVDHLPENAEATTDLPET-HVGFLKKAFDGMSEAFSEFLEASRPDWVIFDFVQHW  124

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSP-EELRSGKL-RPSPEHFTVPPGWFNFHSLVA  599
             VP IA++ GV+  F S + AAT+  +G P  ++  G+  R +    TVPP W  F + V 
Sbjct  125   VPPIAEKLGVSRAFFSTFNAATICIIGGPSSDMIDGRDPRKTAMDLTVPPPWVPFETHVL  184

Query  600   HRPDYAPTMMRN-THTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR  776
              R   A  +M   T     S ++   R      G D + +R+C E E E+I LL KL+ +
Sbjct  185   FRLFEARKIMEYPTAGVTGSDLNDNYRAGLACTGSDVIAIRTCMELEPEWIQLLGKLHDK  244

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PV+  GL      L+       +  +W +   WLD Q+  SVV+V  G+E  +   +I  
Sbjct  245   PVILTGL------LSAGPVDNPDDRTWQDISGWLDKQQRNSVVYVALGTEVTVTPEEIQG  298

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             LA  LELS +PFLW LRK          LLP  F  R + QG V  GW PQ  IL+H +I
Sbjct  299   LAHGLELSGLPFLWALRK---RTEASGQLLPHGFEERVNGQGIVWTGWVPQTKILSHGSI  355

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG + H GWG+ +E L FG PLI+ P   DQ L A+ L    +G E+PR E DGSF+   
Sbjct  356   GGFVTHCGWGSAVEGLSFGRPLIMFPCNLDQPLVARFLAGMNVGVEIPRDEKDGSFTIGS  415

Query  1314  VANSIRSVMASREGEGIRLKAA-QMANIFGNHNLHDNYIDQFIEYF  1448
             VA +IR V+   +G+  R  AA Q   +FGN  L D Y++ F+E+ 
Sbjct  416   VAETIRKVVTEEDGKIYRENAASQQKRVFGNKTLQDQYVNTFVEFL  461



>ref|XP_010051440.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=461

 Score =   333 bits (855),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 183/455 (40%), Positives = 259/455 (57%), Gaps = 21/455 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLA GH+ P LE +K L+ +G  VSF++TP N+ RL          L L  + L
Sbjct  10    HIAMFPWLAHGHITPFLELSKFLSLRGHAVSFLTTPGNVARLAGAHPELPPSLRLVSLPL  69

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             PSVP LP + E+T DL+  + V +LK AYD++ P     +     + ++ DFA+HW+P  
Sbjct  70    PSVPNLPTSAESTSDLD-IDSVPYLKKAYDQLEPALARFLSDGRVDWVIHDFASHWLPRA  128

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A R GV +VF S   A +LA+LG P EL  G+    PE  T  P W  + S    R    
Sbjct  129   AARLGVRSVFFSTINATSLAFLGPPSELLGGRCH-KPEDLTCVPAWIPYESTACFR---L  184

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
               ++++    D   VS   R    I+GCDFVIVRSC EFE E + LL ++Y++P + IGL
Sbjct  185   YEVLKHQRCMDEE-VSDFSRFGHTIDGCDFVIVRSCHEFESEPLSLLPEIYQKPAIPIGL  243

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             + P +        G +   W     WL  +R KSV+++  G+E  +     +ELA+ +E 
Sbjct  244   VTPAIRDEV----GADDEKWKALESWLSAKREKSVLYIALGTEVILSSELTNELAAGIEK  299

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S +PF+W++R           L+P  F  R S++G V  GWAPQ  ILAH A GG L H 
Sbjct  300   SGLPFVWVVRN---------CLVPAGFEERVSDRGFVWAGWAPQTRILAHRATGGFLTHC  350

Query  1158  GWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIR  1331
             GW + IE+L  G PL+L     ADQG+ A+ L +K +G+EVPR E DGSF+ D+VA SIR
Sbjct  351   GWNSTIEALSRGLPLVLFSGGSADQGVMARFLHQKRVGFEVPRDEADGSFTGDVVAKSIR  410

Query  1332  SVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQF  1436
              VM   EG+ IR  A+ M  +FG+  L + Y+++F
Sbjct  411   QVMVEPEGKPIRANASAMKEVFGDMELQNKYMEEF  445



>gb|KCW82042.1| hypothetical protein EUGRSUZ_C03411, partial [Eucalyptus grandis]
Length=451

 Score =   333 bits (854),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 183/455 (40%), Positives = 259/455 (57%), Gaps = 21/455 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLA GH+ P LE +K L+ +G  VSF++TP N+ RL          L L  + L
Sbjct  10    HIAMFPWLAHGHITPFLELSKFLSLRGHAVSFLTTPGNVARLAGAHPELPPSLRLVSLPL  69

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             PSVP LP + E+T DL+  + V +LK AYD++ P     +     + ++ DFA+HW+P  
Sbjct  70    PSVPNLPTSAESTSDLD-IDSVPYLKKAYDQLEPALARFLSDGRVDWVIHDFASHWLPRA  128

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A R GV +VF S   A +LA+LG P EL  G+    PE  T  P W  + S    R    
Sbjct  129   AARLGVRSVFFSTINATSLAFLGPPSELLGGRCH-KPEDLTCVPAWIPYESTACFR---L  184

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
               ++++    D   VS   R    I+GCDFVIVRSC EFE E + LL ++Y++P + IGL
Sbjct  185   YEVLKHQRCMDEE-VSDFSRFGHTIDGCDFVIVRSCHEFESEPLSLLPEIYQKPAIPIGL  243

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             + P +        G +   W     WL  +R KSV+++  G+E  +     +ELA+ +E 
Sbjct  244   VTPAIRDEV----GADDEKWKALESWLSAKREKSVLYIALGTEVILSSELTNELAAGIEK  299

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S +PF+W++R           L+P  F  R S++G V  GWAPQ  ILAH A GG L H 
Sbjct  300   SGLPFVWVVRN---------CLVPAGFEERVSDRGFVWAGWAPQTRILAHRATGGFLTHC  350

Query  1158  GWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIR  1331
             GW + IE+L  G PL+L     ADQG+ A+ L +K +G+EVPR E DGSF+ D+VA SIR
Sbjct  351   GWNSTIEALSRGLPLVLFSGGSADQGVMARFLHQKRVGFEVPRDEADGSFTGDVVAKSIR  410

Query  1332  SVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQF  1436
              VM   EG+ IR  A+ M  +FG+  L + Y+++F
Sbjct  411   QVMVEPEGKPIRANASAMKEVFGDMELQNKYMEEF  445



>ref|XP_003552084.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Glycine max]
 gb|KHN27633.1| UDP-glycosyltransferase 91A1 [Glycine soja]
Length=465

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 186/468 (40%), Positives = 265/468 (57%), Gaps = 14/468 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLP-PIPASFTERLSLR  245
             E+  +++FPWLAFGHM+P LE AK +A KG +VSFVSTP+N+QRLP P P +    ++  
Sbjct  6     EKLTIVMFPWLAFGHMIPNLELAKLIARKGHQVSFVSTPRNIQRLPKPSPNTL---INFV  62

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             ++ LP +  LPEN EAT D+   + V+ LK AYD +  P +  +    P+ +  DF   W
Sbjct  63    KLPLPKIQNLPENAEATTDI-PYDVVEHLKVAYDALQEPLKRFLESSKPDWLFYDFVPFW  121

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELR-SGKLRPSPEHFTVPPGWFNFHSLVAH  602
                IA + G+ + F S+ T     +LG P  L     LR  PE F V P W  F + VA 
Sbjct  122   AGSIASKLGIKSAFYSICTPPFSGFLGPPSSLMGKDSLRQKPEDFIVSPPWVPFPTTVAF  181

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R      ++ +    + +GVS   R  +  E CD V++R C EF+ E+  +LE +Y++PV
Sbjct  182   RYFEIMRIVDSLSAENNTGVSDAYRYGASAENCDIVVIRGCTEFQPEWFQVLENIYRKPV  241

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             L IG LP     +T    G ++ +W    +WLD     SVV+V FGSE K    ++ E+A
Sbjct  242   LPIGQLP-----STDPVGGEDTDTWRWVKDWLDKHARGSVVYVAFGSEAKPRQDEVTEIA  296

Query  963   SALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
               LE S++PF W LR + G  +P     LP  F  RT   G V   WAPQ  IL H A+G
Sbjct  297   LGLEKSKLPFFWALRLQRGPWDPDV-LRLPEGFEERTKALGVVCTTWAPQLKILGHMAVG  355

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L HSGW +++E++    PL+LL  ++DQG+NA++L EK++GY VPR E DG F+ D V
Sbjct  356   GFLTHSGWTSVVEAILNEKPLVLLTFLSDQGINARVLEEKKMGYSVPRNERDGLFTSDSV  415

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
             A S+R VM   EG   R +  +M ++F N    + YID  +    S +
Sbjct  416   AESLRLVMVEEEGRIYRERIKEMKDLFVNRERQNMYIDNLLRTLTSSL  463



>ref|XP_010417017.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=472

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/466 (38%), Positives = 272/466 (58%), Gaps = 18/466 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV + PWLAFGHM+P  E +K +A KG  VSF+STP+N+ RL P +P + +  ++   
Sbjct  14    KLHVAMLPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPKNLSSAINFVR  73

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             + LP V    LPE+ EAT D+   E + +LK A+D +  P  E +    P+ +L DFA +
Sbjct  74    LPLPVVGDNKLPEDGEATTDV-PFELISYLKIAFDGLKSPVTEFLESSKPDWVLQDFAAY  132

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             W+P I++R G+ T FLS +  ATL  L  P  EE R+      P  F  PP W  F + V
Sbjct  133   WLPPISRRLGIKTGFLSAFNGATLGILKPPGFEEYRT-----CPADFMKPPKWVPFETPV  187

Query  597   AHRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             A +      +          G V    R+  VI+GCD + VRSC E+E E++ +++ L++
Sbjct  188   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  247

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +G+LPP++      +   ++ +W    +WLD+++ KSVV++ FGSE K    +++
Sbjct  248   KPVIPVGVLPPKME-----EKFEDTDTWLTVKKWLDSRKAKSVVYIAFGSEAKPSQTELN  302

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
              +A  LELS +PF W+L+         P  LP  F  RT+++G V  GW  Q   L+H +
Sbjct  303   AIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHES  362

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             IG  L H GWGT+IE++ F  P+ +L  V DQGLNA+++ +K+IGY +PR E +G F+++
Sbjct  363   IGVVLTHPGWGTVIEAIRFSKPMAMLVFVYDQGLNARVIEQKKIGYMIPRDETEGFFTKE  422

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
              VA S++ VM   EG+  R     M  +FG+ +  D Y+D F++Y 
Sbjct  423   SVAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYL  468



>gb|KCW79469.1| hypothetical protein EUGRSUZ_C00854 [Eucalyptus grandis]
Length=448

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/465 (40%), Positives = 273/465 (59%), Gaps = 32/465 (7%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ HV +FPWLA+GH++P LE A  LA KG RVSF+STPKNLQ+L   PA+    ++L E
Sbjct  6     KKLHVAMFPWLAYGHLMPFLEVATFLARKGHRVSFISTPKNLQKL---PANLPPSITLVE  62

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             + LP V GLP++ E+T +L     V +LK AYD + P   E + +   + ++ DF + W+
Sbjct  63    LPLPRVHGLPDSAESTSEL-LHNMVPYLKKAYDMLEPAVAEFLAKSDVDWVIQDFMSFWL  121

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRP-SPEHFTVPPGWFNFHSLVAHR  605
             P+ A+R GV + F S+++A TL + G P  L  G+ R  + E  TV P W  + + VA R
Sbjct  122   PQKARRLGVKSAFFSIFSATTLVFCGPPSILMDGQARAKAAEDLTVVPQWVTYPTKVAFR  181

Query  606   PDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVL  785
                   +         + +S  +RL  +I+GC+ V  R+C EFE E + LL+KLY R V+
Sbjct  182   --LHEVINEEDFVDSDANMSVFERLGRLIQGCEIVATRTCSEFEAEPLSLLKKLYGRAVV  239

Query  786   AIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELAS  965
              +GLLPP+   N +   G               +  KSV ++  G+E  +    +HELA 
Sbjct  240   PMGLLPPQ---NKSRHEGV-------------GREEKSVFYIALGTEVALSQEFMHELAC  283

Query  966   ALELSRMPFLWIL-RKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
              +E S +PF+W++ RK G      P  +P+ F ++ S +G V +GWAPQ +ILAHP++GG
Sbjct  284   GIEKSSLPFVWVVGRKAG------PGSIPSSFESQVSGRGFVWVGWAPQLDILAHPSVGG  337

Query  1143  CLFHSGWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
              L H GW ++IE+LG G  LIL     +DQGL A+L+ E+ +G EVPR + DGSF+ D V
Sbjct  338   LLTHCGWSSVIEALGQGRALILFSGGSSDQGLVARLMDERRVGSEVPRNDRDGSFTGDSV  397

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             A +IR VM   EGE +R  A  M  IFGN  L   Y+++F +  +
Sbjct  398   AETIRRVMVEPEGEEVRANAWAMREIFGNVELQHKYLEEFAQVLE  442



>gb|KGN48689.1| hypothetical protein Csa_6G497390 [Cucumis sativus]
Length=468

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 271/466 (58%), Gaps = 16/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPP-IPASFTERLSLR  245
             ++ H+++FPWLAFGHM+P LE +K +A KG RVSFVSTPKN+ RLP  +P   +  LS  
Sbjct  5     KKLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP +  LP + EAT DL   ++VQFLK A+D +  P  + ++    + IL DFA +W
Sbjct  65    KIPLPQLHTLPPDAEATSDL-PYDKVQFLKEAFDALKQPLSDFLQTSDADWILYDFAPYW  123

Query  426   V-PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             V  EI     + T F S++   +LA++G      SG  R   E FTVPP W  F + VA 
Sbjct  124   VGQEIGPNLRIKTAFFSIFILQSLAFVGP----MSGDSRMKLEDFTVPPDWIPFPTTVAF  179

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R  +    + +    +A+GV+   R        D V+VR+  EFE E+I LLE ++ + V
Sbjct  180   R-HFEIKKIFDFVAGNATGVTDIDRFKMSAHYSDLVVVRAFPEFEPEWIQLLEDIHHKTV  238

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             L +G LP      +      ++ +W    EWLD Q   SVV+V FGSE K   H++ E+A
Sbjct  239   LPVGQLP-----TSEYDLKEDNPTWQSIKEWLDKQAKGSVVYVAFGSEAKPNQHELTEIA  293

Query  963   SALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
               LE SR  F W+LR + G+ +P  P  LP  F  RT  +G V   WAPQ  IL H ++G
Sbjct  294   LGLEQSRFSFFWVLRTRLGLSDPE-PIELPEGFEERTKGRGVVCTTWAPQLKILGHESVG  352

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L HSGW +++E++     L+LL  VADQG+ A++L EK++GY VPR E DGSF+RD V
Sbjct  353   GFLTHSGWSSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYCVPRSELDGSFTRDSV  412

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S++ VM   EG+  R +  +M ++F N    +  ID F+ Y + 
Sbjct  413   AESLKLVMVEEEGKVYRERIREMKDLFVNKERDEKLIDGFLSYLKK  458



>ref|XP_010049450.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW82043.1| hypothetical protein EUGRSUZ_C03413 [Eucalyptus grandis]
Length=459

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 189/455 (42%), Positives = 259/455 (57%), Gaps = 23/455 (5%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+ +FPWLA GH+ P LE +K L+ +G  VSF+STP N+ RL          + L  + L
Sbjct  10    HIAMFPWLAHGHITPFLELSKFLSLRGHAVSFLSTPNNVARLARAHPELPPSIRLVSLPL  69

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P VP LP + E+T DL+  + V +LK AYD + P     +     + ++ DFA+HW+P  
Sbjct  70    PCVPNLPSSAESTSDLD-IDSVPYLKKAYDLLEPALTRFLSGSRVDWVIHDFASHWLPGA  128

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRPDYA  617
             A + GV +VF S + A  L  LG P EL  G+ +  PE  T  P W    S V  R    
Sbjct  129   AAQLGVGSVFFSTFNATALTLLGPPSELIGGRFQ-KPEDLTTVPAWIP--STVCLR---L  182

Query  618   PTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIGL  797
               ++R+    D   VS   R   VI+GCDFVIVRSC+EFE E + LL++LY++P + IGL
Sbjct  183   HEVLRHQRCMDDE-VSDFCRFGHVIDGCDFVIVRSCREFELEPLSLLQELYQKPAIPIGL  241

Query  798   LPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALEL  977
             L P +        G +   W     WLD +R KSV++V  G+E  +     +ELA+ +E 
Sbjct  242   LTPAIREEV----GDDDEKWKALKSWLDTKREKSVLYVALGTEVILSHELTNELAAGIEK  297

Query  978   SRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFHS  1157
             S +PF+W++R           L+P  F  R S +G +  GWAPQ  ILAH AI G L H 
Sbjct  298   SGLPFVWVVRN---------RLVPAGFEERVSGRGFIWAGWAPQTRILAHEAIVGFLTHC  348

Query  1158  GWGTIIESLGFGHPLILLP-MVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIR  1331
             GW + IE+L  G PL+L     +DQGL A+ L EK++G+EVPR E DGSF+ D+VA SIR
Sbjct  349   GWNSTIEALSRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGSFTGDVVAESIR  408

Query  1332  SVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQF  1436
              VM   EGE IR  A  M  +FGN  L + Y+++F
Sbjct  409   RVMVEHEGEPIRATARAMKEVFGNMELQNKYLEEF  443



>gb|KEH20104.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=468

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/460 (38%), Positives = 263/460 (57%), Gaps = 8/460 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGHM+P LE AK +A KG +VS+VSTP+N+QRLP +P +    +    + L
Sbjct  12    HIVMFPWLAFGHMIPYLELAKLIAQKGHQVSYVSTPRNIQRLPKLPPNVAPLIKFVSLPL  71

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT D+   + V  LK A+D++  P    ++    + IL DF   W+  +
Sbjct  72    PKVDNLPENAEATTDI-PYDVVPHLKNAFDKLEQPLTHFLQSSNADWILHDFVPFWLGSV  130

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAHRPDY  614
             A + G+  VF S++T   + ++G    L     +R  PE F V P W  F + VA+R   
Sbjct  131   APQLGIKCVFFSIFTPPFMGFMGPGSVLLGNDPVRTKPEDFLVSPSWVPFKTTVAYRYFE  190

Query  615   APTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAIG  794
                +M      + SG S   R  S I+  +F+++R C EFE E+  +++ ++ + VL  G
Sbjct  191   IIKIMDILSDNNDSGFSDAYRFCSSIKNSEFILIRGCTEFEPEWFQVIQNIHNKLVLPAG  250

Query  795   LLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASALE  974
              L     L+T  + G  +++W    EWLD +   +VV+V FGSE K    +++E+A  LE
Sbjct  251   QL-----LSTEFEGGDENNTWWWMKEWLDKKPNGTVVYVAFGSEAKPSQEEVNEIALGLE  305

Query  975   LSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLFH  1154
              S +PF W+LR            LP  F  RT  +G V   WAPQ  IL+H A+GG L H
Sbjct  306   KSNLPFFWVLRVRRGPTDKVVLQLPEGFEERTKVRGVVCTEWAPQMKILSHVAVGGFLTH  365

Query  1155  SGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSIR  1331
             +GW +++E++    PL+LL  +ADQG+NA++L EK++GY VPR E DGSF+ DMVA+SIR
Sbjct  366   AGWTSVVEAVQHEKPLVLLTCLADQGINARMLEEKKMGYSVPRDERDGSFTSDMVAHSIR  425

Query  1332  SVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
              VM   EG   R     M ++F N    D Y+   +++ +
Sbjct  426   LVMVEEEGRIYRDNIKNMKDLFVNPERQDRYVTSLLDHLR  465



>ref|XP_004287416.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/466 (39%), Positives = 269/466 (58%), Gaps = 22/466 (5%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIP--ASFTERLSLR  245
             + H+++FPWLA GH++P    +K +A KG +VSF+STP+NLQRLP IP  +S +  ++L 
Sbjct  12    RLHLVVFPWLAMGHLIPFFHLSKLIAQKGHKVSFISTPRNLQRLPKIPPHSSLSSLITLV  71

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
              + LP V  LP++ E++ D+   +Q Q LK A+D +  P  + +    P+ ++ D+A+HW
Sbjct  72    PLPLPHVENLPDDAESSNDVPYNKQ-QLLKKAFDLLESPMADFLESSAPDWVVYDYASHW  130

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGK-LRPSPEHFTVPPGWFNFHSLVAH  602
             +P +A + GV+  +  ++TAA +A +G P  L  G+  R   E FTV   W  F S +A 
Sbjct  131   LPPLAAKLGVSRAYFCLFTAACMAVIGPPSLLIDGQDKRTKTEDFTVVSPWIPFKSDMAF  190

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKR--  776
             R      + +  H  + SG     R    +   D V++RS +EFE E+ +LL +LY R  
Sbjct  191   R---YHEVAKYVHE-NESGTPDTVRFGIAVRDSDVVLMRSSEEFEPEWFELLRELYGRSI  246

Query  777   PVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHE  956
             PVL +G LPP +               +   +WLD QR  SVV+V  G+E  +   ++ E
Sbjct  247   PVLPVGFLPPLVEEKP-----------TRVKDWLDEQRVNSVVYVALGTEATLSQGELTE  295

Query  957   LASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAI  1136
             LA  LE S +PF W+LR P         +LP  F+ R  ++G V  GWAPQ  IL+H ++
Sbjct  296   LALGLERSGLPFFWVLRDPPESTRAVSEMLPDGFLERVRDRGMVHFGWAPQVWILSHDSV  355

Query  1137  GGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDM  1313
             GG L H GW ++IE LGFG  LIL PM+ DQGLNA+L   K +G E+PR E DGSF+RD 
Sbjct  356   GGFLTHCGWNSMIEGLGFGKVLILFPMLNDQGLNARLANGKGLGVEIPRNELDGSFTRDA  415

Query  1314  VANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQ  1451
             VA  +R  M   EGE +R +  ++  IFG+ N +    ++FI + +
Sbjct  416   VAEFVRLAMVEEEGEMVRRRVKEIKGIFGDRNRNSRLENEFICFLE  461



>ref|XP_004143439.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 gb|KGN48691.1| hypothetical protein Csa_6G497900 [Cucumis sativus]
Length=468

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 190/466 (41%), Positives = 270/466 (58%), Gaps = 16/466 (3%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPP-IPASFTERLSLR  245
             +  H+++FPWLAFGHM+P LE +K +A KG RVSFVSTPKN+ RLP  +P   +  LS  
Sbjct  5     KNLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP +  LP + EAT DL   ++VQFLK A+D +  P  + ++    + IL DFA +W
Sbjct  65    KIPLPQLHNLPPDAEATSDL-PYDKVQFLKKAFDALKQPLSDFLQTSDADWILYDFAPYW  123

Query  426   V-PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAH  602
             V  EI     + T F +++   +LA++G      SG  R   E FTVPP W  F + VA 
Sbjct  124   VGQEIGPNLRIKTAFFTIFILQSLAFVGP----MSGDSRMKLEDFTVPPDWIPFPTTVAF  179

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             R  +    + +    + +GV+   RL       D V+VR+  EFE E+I LLE ++ + V
Sbjct  180   R-HFEIKKLFDFVAGNTTGVTDIDRLKMSAHYSDLVVVRAFPEFEPEWIQLLEDIHHKTV  238

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             L +G LP      +      ++ +W    EWLD Q   SVV+V FGSE K   H++ E+A
Sbjct  239   LPVGQLP-----TSEYDLKEDNPTWQSIKEWLDKQAKGSVVYVAFGSEAKPNQHELTEIA  293

Query  963   SALELSRMPFLWILR-KPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIG  1139
               LE SR  F W+LR + G+ +P  P  LP  F  RT  +G V   WAPQ  IL H ++G
Sbjct  294   LGLEQSRFSFFWVLRTRLGLSDPE-PIELPEGFEERTKGRGVVCTTWAPQLKILGHESVG  352

Query  1140  GCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMV  1316
             G L HSGW +++E++     L+LL  VADQG+ A++L EK++GY VPR E DGSF+RD V
Sbjct  353   GFLTHSGWSSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYCVPRSELDGSFTRDSV  412

Query  1317  ANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             A S++ VM   EG+  R +  +M ++F N    +  ID F+ Y + 
Sbjct  413   AESLKLVMVEEEGKVYRERIREMKDLFVNKERDEKLIDGFLSYLKK  458



>gb|AFK35814.1| unknown [Medicago truncatula]
 gb|KEH20105.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=469

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/462 (39%), Positives = 259/462 (56%), Gaps = 11/462 (2%)
 Frame = +3

Query  78    HVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLREIAL  257
             H+++FPWLAFGHM+P LE AK +A KG +VS+VSTP+N+QRLP +P +    +    + L
Sbjct  12    HIVMFPWLAFGHMIPYLELAKLIAQKGHKVSYVSTPRNIQRLPKLPPNVAPLIKFVNLPL  71

Query  258   PSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWVPEI  437
             P V  LPEN EAT D+   + V +LK A+D++  PF   +       I  DFA  W+   
Sbjct  72    PKVDNLPENAEATTDI-PYDVVPYLKNAFDKLEKPFTHFLETSNAGWIFHDFANFWIAPT  130

Query  438   AKRYGVATVFLSVYTAATLAYLGSPEELRSGKL--RPSPEHFTVPPGWFNFHSLVAHRPD  611
             A + G+   F S++TA T+ +LG P  +  G    R  PE FTV P W  F + VA+R  
Sbjct  131   ASQLGIKCAFFSIFTAPTMGFLG-PVSVILGDEPGRTKPEDFTVAPPWVPFQTTVAYR-Y  188

Query  612   YAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLAI  791
             +      +  +    G S   R    I+  DF+++R C EFE E+  +++ ++++ VL  
Sbjct  189   FEIIKTADILSDKILGTSDLHRYGLSIQNSDFILIRGCTEFEPEWFQVIQNIHQKTVLPA  248

Query  792   GLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASAL  971
             G LP     NT    G  + SW    EWLD Q   +VV+V FGSE K    +++E+A  L
Sbjct  249   GQLP-----NTEFDSGHENDSWPRIKEWLDKQPHGTVVYVAFGSEAKPSQEEVNEIALGL  303

Query  972   ELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCLF  1151
             E S +PF W+L+            LP  F  RT  +G V   W PQ  IL H A+GG L 
Sbjct  304   EKSNLPFFWVLKVRRGPTDKVVLQLPEGFEERTKGRGVVCTDWVPQMKILGHMAVGGFLT  363

Query  1152  HSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVANSI  1328
             H+GW +++E++    PL+LL  ++DQG+NA++L EK++GY VPR E DGSF+ D VA+SI
Sbjct  364   HAGWTSVVEAVQHEKPLVLLTYLSDQGINARVLEEKKMGYSVPRDERDGSFTSDSVAHSI  423

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
             R ++   EG   R     M ++F N    D Y++  + +  S
Sbjct  424   RLIVVEEEGMIYRENIKNMKDLFVNIERQDKYVNNLLSHLTS  465



>ref|XP_006404721.1| hypothetical protein EUTSA_v10000154mg [Eutrema salsugineum]
 gb|ESQ46174.1| hypothetical protein EUTSA_v10000154mg [Eutrema salsugineum]
Length=472

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 181/466 (39%), Positives = 270/466 (58%), Gaps = 18/466 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV +FPWLAFGHM+P LE +K +A KG  VSF+STP+N+ RL P +P +     +++ 
Sbjct  14    KLHVAMFPWLAFGHMVPYLELSKLIAQKGHTVSFISTPRNIDRLLPRLPENLHS--AIKF  71

Query  249   IALPSVPG----LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFA  416
             + LP   G    LPE+ EAT D+   + + +LK A+D +  P  E +    P+ IL DFA
Sbjct  72    VKLPLSGGVDKKLPEDGEATTDV-PFDLIPYLKIAFDGLRIPVTEFLESSKPDWILQDFA  130

Query  417   THWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLV  596
              +W+P I++R G+ T F S +  ATL  L  P      + R SP  F  PP W  F + V
Sbjct  131   AYWLPPISRRLGIKTGFFSAFNGATLGILKPPG---FDEYRTSPADFMTPPKWVPFETPV  187

Query  597   AHRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             A +      + +        G V    R++ VI+GCD + VRSC E+E E++ L++ L++
Sbjct  188   AFKLFECRYIFKGFMAETTEGNVPDVHRVAGVIDGCDVIAVRSCYEYEAEWLGLIQDLHR  247

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +G+LPP+       +   ++ +W     WLD+++ KSVV+V FGSE K    +++
Sbjct  248   KPVIPVGVLPPKTE-----EKYDDTDTWLSIKAWLDSRKSKSVVYVAFGSEAKPNQTELN  302

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
              +A  LELS +PF W+L+         P  LP  F  RT  +G V  GW  Q   L+H +
Sbjct  303   AIAFGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTKERGMVWRGWVEQLRTLSHDS  362

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             IG  L H GWGTIIE++ F  P+ +L  V DQGLNA+++ EK+IGY +PR E +G F+++
Sbjct  363   IGLVLTHPGWGTIIEAVRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFTKE  422

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
              VA S+R VM   EG+  R    +M  +FG+ +  D Y+D F+ Y 
Sbjct  423   SVAKSLRLVMEEEEGKVYRENVKEMKRVFGDMDRQDRYVDSFLNYL  468



>gb|ACU23401.1| unknown [Glycine max]
Length=381

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/390 (44%), Positives = 241/390 (62%), Gaps = 12/390 (3%)
 Frame = +3

Query  60    MAAEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLS  239
             MA  + HV++ PW AFGH++P  + +  LA  G  VSF+STPKN+QRLP IP++    + 
Sbjct  1     MAENEIHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSNLAHLVH  60

Query  240   LREIALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDF  413
               ++ LPS+    LPE  EATVD+  +E ++FLK AYD++  P ++ V   LP  I+ DF
Sbjct  61    FVQLPLPSLDKEHLPEGAEATVDIPSEE-IEFLKLAYDKLQHPVKQFVANQLPNWIICDF  119

Query  414   ATHWVPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSL  593
             + HW+ +IA+ + V  +F SV++AA++          + K   +PE  TVPP W  F S 
Sbjct  120   SPHWIVDIAQEFQVKLIFYSVFSAASMNIFAP----STRKFPVTPESLTVPPEWVTFPSS  175

Query  594   VAHRPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             VA+R   A       +  +ASGV   +R+++V      VI RSC E EGEY++  +KL  
Sbjct  176   VAYRIHEAIPFCAGANDVNASGVRDYERMATVCCASKAVIFRSCYEVEGEYLNAFQKLVG  235

Query  774   RPVLAIGLLPP-RLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQI  950
             +PV+ IG+LP    +    I  G+ S    + FEWLD Q  KSVVFVGFGSE K+   Q+
Sbjct  236   KPVIPIGILPADSADREREIIDGSTSG---KIFEWLDEQASKSVVFVGFGSELKLNKDQV  292

Query  951   HELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHP  1130
              E+A  +E S++PFLW LRKP          LP  F+ RTSN+G V +GW PQQ ILAHP
Sbjct  293   FEIAYGIEESQLPFLWGLRKPSWAT-NDEDFLPVGFIERTSNRGVVCMGWIPQQEILAHP  351

Query  1131  AIGGCLFHSGWGTIIESLGFGHPLILLPMV  1220
             +IGG LFHSGWG++IE+L FGH L++LP +
Sbjct  352   SIGGSLFHSGWGSVIETLQFGHNLVVLPFI  381



>ref|XP_010472246.1| PREDICTED: UDP-glycosyltransferase 91A1 [Camelina sativa]
Length=471

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 177/466 (38%), Positives = 272/466 (58%), Gaps = 18/466 (4%)
 Frame = +3

Query  72    QCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRL-PPIPASFTERLSLRE  248
             + HV + PWLAFGHM+P  E +K +A KG  VSF+STP+N+ RL P +P + +  ++   
Sbjct  13    KLHVAMLPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPKNLSSAINFVR  72

Query  249   IALPSVPG--LPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATH  422
             + LP V    LPE+ EAT D+   E + +LK A+D +  P  E +    P+ +L DFA +
Sbjct  73    LPLPVVGDNKLPEDGEATTDV-PFELISYLKIAFDGLKSPVTEFLESSKPDWVLQDFAAY  131

Query  423   WVPEIAKRYGVATVFLSVYTAATLAYLGSP--EELRSGKLRPSPEHFTVPPGWFNFHSLV  596
             W+P I++R G+ T FLS +  ATL  L  P  EE R+      P  F  PP W  F + V
Sbjct  132   WLPPISRRLGIKTGFLSAFNGATLGILKPPGFEEYRT-----CPAGFMKPPKWVPFETPV  186

Query  597   AHRPDYAPTMMRNTHTPDASG-VSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYK  773
             A +      +          G V    R+  VI+GCD + VRSC E+E E++ +++ L++
Sbjct  187   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  246

Query  774   RPVLAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIH  953
             +PV+ +G+LPP+       +   ++ +W    +WLD+++ KSVV+V FGSE K    +++
Sbjct  247   KPVIPVGVLPPKPE-----EKFEDTDTWLTVKKWLDSRKTKSVVYVAFGSEAKPSQTELN  301

Query  954   ELASALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPA  1133
              +A  LELS +PF W+L+         P  LP  F  RT+++G V  GW  Q   L+H +
Sbjct  302   AIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHAS  361

Query  1134  IGGCLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRD  1310
             IG  L H GWGT+IE++ F  P+ +L  V DQGLNA+++ +K+IGY +PR E +G F+++
Sbjct  362   IGLVLTHPGWGTVIEAIRFAKPMAMLVFVYDQGLNARVIEQKKIGYMIPRDETEGFFTKE  421

Query  1311  MVANSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYF  1448
              VA S++ VM   EG+  R    +M  +FG+ +  D Y+D F++Y 
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLDYL  467



>ref|XP_004250160.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 172/465 (37%), Positives = 271/465 (58%), Gaps = 7/465 (2%)
 Frame = +3

Query  66    AEQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLR  245
             +++ H+ +FPWLAFGHM+P LE +K +A KG ++SF+STP+N+ RLP +P S    L+  
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPSLAPFLNFV  64

Query  246   EIALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHW  425
             +I LP V  LP+N EAT DL   EQV++LK A+D +  P  + +    P+ IL DF ++W
Sbjct  65    KIPLPYVEKLPKNAEATTDL-PYEQVKYLKLAHDALKEPMAKFLEDSAPDFILFDFTSYW  123

Query  426   VPEIAKRYGVATVFLSVYTAATLAYLGSPEELRSG-KLRPSPEHFTVPPGWFNFHSLVAH  602
             +P IA ++ + T + S++ AA L + G    L +  + R + E  TV P W  F + VA 
Sbjct  124   LPSIASKFNIPTGYFSIFVAAYLGFTGPVPGLNNNYENRMTLEELTVSPKWVPFETAVAF  183

Query  603   RPDYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPV  782
             +      +       +        R+    E CDF++VRSC EFE E++ ++E ++ +PV
Sbjct  184   KEFELLRIYEGCKEGEEENFYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHPKPV  243

Query  783   LAIGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELA  962
             + +G LP      +     T+  +W E   WLD Q    V++V FGSE K+  +++ EL+
Sbjct  244   IPVGQLPT----TSYEDDNTDIDAWREIKLWLDKQEKGKVIYVAFGSEAKLSQNELTELS  299

Query  963   SALELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGG  1142
               LELS +PF W+LR    ++      +P  F  RT  +G V   W PQ  IL+H ++GG
Sbjct  300   LGLELSGLPFFWVLRTKRGESDNELIQVPEGFEERTKERGIVYTSWVPQLKILSHDSVGG  359

Query  1143  CLFHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRRE-DGSFSRDMVA  1319
              L H+GW +I+E++ F  PL+LL  +ADQG+NA+LL EK++ Y +PR + DGSF+   V 
Sbjct  360   FLTHAGWSSIVEAIQFEKPLLLLTFLADQGINARLLEEKKVAYLIPRNDWDGSFTHKAVV  419

Query  1320  NSIRSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQS  1454
              S+  V+  +EGE  + K  ++ N+  +    D+Y++  I + Q+
Sbjct  420   ESLYLVLLEKEGEIYQKKIKEVKNLCCDKKRQDDYVENLIRFLQN  464



>gb|AES79436.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=434

 Score =   328 bits (841),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/464 (36%), Positives = 262/464 (56%), Gaps = 40/464 (9%)
 Frame = +3

Query  69    EQCHVMIFPWLAFGHMLPMLEFAKKLAAKGFRVSFVSTPKNLQRLPPIPASFTERLSLRE  248
             ++ H+ +FPWLAFGH+ P  E +K +A KG ++SF+STP+N++RLP +P++    ++  E
Sbjct  6     KKLHIAVFPWLAFGHISPFFELSKLIAQKGHKISFISTPRNIERLPKLPSNLQPLVNFVE  65

Query  249   IALPSVPGLPENCEATVDLEQQEQVQFLKTAYDRMGPPFEELVRRDLPELILVDFATHWV  428
             ++LP +  LPE+ EAT+D+       +LK A+D +  P  E + +  P+ ++ DFA +W+
Sbjct  66    LSLPHIDQLPEHAEATMDIPSHIG-SYLKKAFDGLQQPLVEFLEKSNPDCVIYDFAPYWL  124

Query  429   PEIAKRYGVATVFLSVYTAATLAYLGSPEELRSGKLRPSPEHFTVPPGWFNFHSLVAHRP  608
             P +  ++G+ +++ S+++A  ++                          F    LV    
Sbjct  125   PPVLSKFGILSIYFSIFSAIGMS--------------------------FGVEFLVGKSN  158

Query  609   DYAPTMMRNTHTPDASGVSSGQRLSSVIEGCDFVIVRSCKEFEGEYIDLLEKLYKRPVLA  788
             D    +       + SGV+   R+  ++ G DF+  RSC E EG+Y++L+E L K+ V+ 
Sbjct  159   DEENIISDVYLEQNESGVTDMFRVKKILFGADFIAARSCMEIEGKYLELIENLCKKKVIP  218

Query  789   IGLLPPRLNLNTAIQPGTNSSSWSEAFEWLDNQRPKSVVFVGFGSEYKMPIHQIHELASA  968
             +GLLPP L +        N  +W    +WLD    +SVV+V FGSE  +   +  E+A  
Sbjct  219   VGLLPPSLQIGEE----KNDENWDTILKWLDKHEKRSVVYVAFGSEVILSDEEFTEIAKG  274

Query  969   LELSRMPFLWILRKPGIDNPGYPALLPTDFVNRTSNQGRVILGWAPQQNILAHPAIGGCL  1148
             LELS  P+LWIL+    D+            N+++ +G +   WAPQ  ILAH +IG  L
Sbjct  275   LELSSFPYLWILKNQVKDDWLVE--------NQSNKKGLIWSNWAPQLRILAHESIGRFL  326

Query  1149  FHSGWGTIIESLGFGHPLILLPMVADQGLNAKLLVEKEIGYEVPRREDGSFSRDMVANSI  1328
              H GW T+IESL  G PLI+LP   +Q L A+L+ E+ +G  V +R DG F+RD VA ++
Sbjct  327   THCGWSTVIESLQVGCPLIMLPFHNEQSLVARLMEERMVGVMV-QRNDGKFTRDSVAKAL  385

Query  1329  RSVMASREGEGIRLKAAQMANIFGNHNLHDNYIDQFIEYFQSKI  1460
             RSVM   EGE  R KA +M+ IFG+  LH  Y+D F++Y +  I
Sbjct  386   RSVMVEEEGESYRNKAVEMSKIFGDKELHQKYLDDFVDYMELHI  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4188154807536