BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c28990_g1_i1 len=416 path=[1:0-415]

Length=416
                                                                      Score     E

ref|XP_010111987.1|  Exocyst complex component 7                        114   1e-26   
ref|XP_007214942.1|  hypothetical protein PRUPE_ppa002868mg             114   2e-26   
ref|XP_008228355.1|  PREDICTED: exocyst complex component EXO70A1...    112   4e-26   
ref|XP_010261780.1|  PREDICTED: exocyst complex component EXO70A1...    112   1e-25   
ref|XP_009350858.1|  PREDICTED: exocyst complex component EXO70A1       111   2e-25   
ref|XP_008380786.1|  PREDICTED: exocyst complex component EXO70A1...    111   2e-25   
ref|XP_004305761.1|  PREDICTED: exocyst complex component 7-like        110   2e-25   
ref|XP_008341817.1|  PREDICTED: exocyst complex component EXO70A1...    110   3e-25   
ref|XP_002532729.1|  protein binding protein, putative                  109   5e-25   Ricinus communis
ref|XP_006369121.1|  exocyst subunit EXO70 family protein               109   5e-25   
ref|XP_007024675.1|  Exocyst subunit exo70 family protein D2            109   6e-25   
emb|CDO97829.1|  unnamed protein product                                109   9e-25   
ref|XP_006465885.1|  PREDICTED: exocyst complex component EXO70A1...    108   1e-24   
gb|KDP40675.1|  hypothetical protein JCGZ_24674                         108   1e-24   
ref|XP_002303234.2|  exocyst subunit EXO70 family protein               108   1e-24   Populus trichocarpa [western balsam poplar]
gb|KHG28684.1|  Exocyst complex component 7                             108   1e-24   
gb|KDO64960.1|  hypothetical protein CISIN_1g036615mg                   108   2e-24   
ref|XP_006426703.1|  hypothetical protein CICLE_v10025154mg             108   2e-24   
ref|XP_011012017.1|  PREDICTED: exocyst complex component EXO70A1...    108   2e-24   
gb|KEH18494.1|  exocyst subunit exo70 family protein                    107   3e-24   
ref|XP_011036476.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...    107   4e-24   
ref|XP_004510526.1|  PREDICTED: exocyst complex component 7-like        106   8e-24   
ref|XP_011072658.1|  PREDICTED: exocyst complex component EXO70B1...    104   2e-23   
gb|KCW68861.1|  hypothetical protein EUGRSUZ_F02455                     104   6e-23   
gb|KHN39610.1|  Exocyst complex component 7                             103   8e-23   
ref|XP_009788385.1|  PREDICTED: exocyst complex component EXO70A1...    102   2e-22   
ref|XP_009613007.1|  PREDICTED: exocyst complex component EXO70A1...    102   3e-22   
ref|XP_007135417.1|  hypothetical protein PHAVU_010G127600g             101   5e-22   
ref|XP_009622141.1|  PREDICTED: exocyst complex component EXO70A1...    100   6e-22   
ref|XP_009778564.1|  PREDICTED: exocyst complex component EXO70A1...    100   7e-22   
ref|XP_006342931.1|  PREDICTED: exocyst complex component 7-like ...    100   8e-22   
ref|XP_011079560.1|  PREDICTED: exocyst complex component EXO70A1       100   8e-22   
ref|XP_004235556.1|  PREDICTED: exocyst complex component EXO70A1       100   1e-21   
ref|XP_010322822.1|  PREDICTED: exocyst complex component EXO70A1       100   1e-21   
ref|XP_010487196.1|  PREDICTED: exocyst complex component EXO70A1...    100   1e-21   
gb|KHN01430.1|  Exocyst complex component 7                             100   1e-21   
ref|XP_006357409.1|  PREDICTED: exocyst complex component 7-like ...    100   1e-21   
ref|XP_003548369.2|  PREDICTED: exocyst complex component EXO70A1...    100   1e-21   
gb|AGV75881.1|  exocyst 70                                            99.8    2e-21   
ref|XP_003529840.2|  PREDICTED: exocyst complex component EXO70A1...    100   2e-21   
gb|EYU21299.1|  hypothetical protein MIMGU_mgv1a003166mg              99.0    3e-21   
ref|XP_010501618.1|  PREDICTED: exocyst complex component EXO70A1...  98.6    4e-21   
ref|XP_010465291.1|  PREDICTED: exocyst complex component EXO70A1...  99.0    4e-21   
ref|XP_006297223.1|  hypothetical protein CARUB_v10013231mg           98.6    5e-21   
ref|XP_010537632.1|  PREDICTED: exocyst complex component EXO70A1     98.2    7e-21   
gb|AAL07238.2|  unknown protein                                       96.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885012.1|  ATEXO70D3                                        97.1    2e-20   
ref|NP_566477.2|  exocyst subunit exo70 family protein D3             97.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CBI35844.3|  unnamed protein product                              96.7    2e-20   
ref|XP_002272396.2|  PREDICTED: exocyst complex component EXO70A1     96.7    3e-20   Vitis vinifera
ref|XP_010428131.1|  PREDICTED: exocyst complex component EXO70A1...  95.5    6e-20   
ref|XP_002887435.1|  ATEXO70D1                                        95.5    6e-20   
gb|EYU45895.1|  hypothetical protein MIMGU_mgv1a003731mg              95.1    7e-20   
ref|XP_010471274.1|  PREDICTED: exocyst complex component EXO70A1...  95.5    7e-20   
ref|XP_010415997.1|  PREDICTED: exocyst complex component EXO70A1...  95.5    7e-20   
ref|XP_006300828.1|  hypothetical protein CARUB_v10019917mg           95.1    9e-20   
ref|NP_177391.1|  exocyst subunit exo70-D1                            95.1    9e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00941.1|  hypothetical protein                                 95.1    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357411.1|  PREDICTED: exocyst complex component 7-like ...  93.2    1e-19   
ref|XP_010932390.1|  PREDICTED: exocyst complex component EXO70B1...  94.4    2e-19   
ref|XP_009417543.1|  PREDICTED: exocyst complex component EXO70A1...  93.6    3e-19   
ref|XP_010685281.1|  PREDICTED: exocyst complex component EXO70A1...  93.2    4e-19   
ref|XP_010542385.1|  PREDICTED: exocyst complex component EXO70A1...  92.0    1e-18   
ref|XP_010917447.1|  PREDICTED: exocyst complex component EXO70A1     92.0    1e-18   
ref|XP_006392721.1|  hypothetical protein EUTSA_v10011317mg           91.7    2e-18   
ref|NP_001147016.1|  protein binding protein                          91.3    2e-18   Zea mays [maize]
ref|XP_009419884.1|  PREDICTED: exocyst complex component EXO70A1...  91.3    2e-18   
ref|XP_004144432.1|  PREDICTED: exocyst complex component 7-like      90.9    2e-18   
emb|CDY52262.1|  BnaC05g52060D                                        91.3    2e-18   
ref|XP_009106941.1|  PREDICTED: exocyst complex component EXO70A1     89.0    1e-17   
ref|XP_010502014.1|  PREDICTED: exocyst complex component EXO70A1...  88.2    2e-17   
ref|XP_010479990.1|  PREDICTED: exocyst complex component EXO70B1...  88.2    3e-17   
ref|XP_008460316.1|  PREDICTED: exocyst complex component EXO70A1     87.4    4e-17   
ref|XP_006306998.1|  hypothetical protein CARUB_v10008575mg           87.4    4e-17   
ref|XP_002891787.1|  ATEXO70D2                                        86.7    8e-17   
ref|XP_010462309.1|  PREDICTED: exocyst complex component EXO70A1...  86.7    8e-17   
gb|KFK35661.1|  hypothetical protein AALP_AA4G020800                  85.9    1e-16   
gb|EMT20824.1|  Exocyst complex component 7                           84.7    2e-16   
gb|EMS58791.1|  Exocyst complex component 7                           84.3    2e-16   
ref|NP_175811.1|  exocyst subunit exo70 family protein D2             85.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EEC84642.1|  hypothetical protein OsI_31520                        84.7    4e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001168330.1|  hypothetical protein                             84.3    4e-16   Zea mays [maize]
emb|CDX97543.1|  BnaA05g25360D                                        84.3    4e-16   
ref|XP_009146417.1|  PREDICTED: exocyst complex component EXO70A1     84.3    4e-16   
ref|NP_001063276.1|  Os09g0439600                                     84.3    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69792.1|  hypothetical protein OsJ_29514                        84.0    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973612.1|  PREDICTED: uncharacterized protein LOC101775446  84.0    7e-16   
ref|XP_003578177.1|  PREDICTED: exocyst complex component EXO70A1     83.6    9e-16   
ref|XP_004956927.1|  PREDICTED: exocyst complex protein exo70-like    83.2    1e-15   
ref|NP_001145869.1|  uncharacterized protein LOC100279383             82.8    2e-15   Zea mays [maize]
ref|XP_003574584.1|  PREDICTED: exocyst complex component EXO70B1...  82.8    2e-15   
gb|KFK41667.1|  hypothetical protein AALP_AA2G157100                  82.0    3e-15   
emb|CDX68265.1|  BnaA07g23050D                                        80.9    8e-15   
emb|CDY50639.1|  BnaC06g24320D                                        80.9    8e-15   
ref|XP_006390653.1|  hypothetical protein EUTSA_v10019854mg           80.5    1e-14   
gb|EMS67507.1|  Exocyst complex component 7                           79.0    1e-14   
gb|EAZ07217.1|  hypothetical protein OsI_29462                        80.1    1e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001061962.1|  Os08g0455700                                     80.1    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104856.1|  PREDICTED: exocyst complex component EXO70B1...  79.7    2e-14   
ref|XP_009104855.1|  PREDICTED: exocyst complex component EXO70B1...  79.7    2e-14   
ref|XP_008652770.1|  PREDICTED: exocyst complex component EXO70B1...  78.6    5e-14   
gb|EMT09664.1|  Exocyst complex component 7                           77.4    7e-14   
ref|XP_002460270.1|  hypothetical protein SORBIDRAFT_02g025750        77.4    1e-13   Sorghum bicolor [broomcorn]
ref|XP_008670223.1|  PREDICTED: exocyst complex component EXO70B1...  76.6    2e-13   
dbj|BAJ85668.1|  predicted protein                                    76.3    3e-13   
ref|XP_009381616.1|  PREDICTED: exocyst complex component EXO70B1...  76.3    3e-13   
ref|XP_002274342.2|  PREDICTED: exocyst complex component EXO70B1...  73.9    2e-12   Vitis vinifera
emb|CBI32662.3|  unnamed protein product                              73.9    2e-12   
emb|CAN80963.1|  hypothetical protein VITISV_005607                   73.6    2e-12   Vitis vinifera
emb|CDO97840.1|  unnamed protein product                              73.2    3e-12   
ref|XP_008461614.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...  72.4    7e-12   
gb|KGN50503.1|  hypothetical protein Csa_5G178700                     71.2    7e-12   
emb|CDO97839.1|  unnamed protein product                              72.0    8e-12   
ref|XP_004150962.1|  PREDICTED: uncharacterized protein LOC101221801  71.2    2e-11   
ref|XP_004171016.1|  PREDICTED: uncharacterized LOC101221801          71.2    2e-11   
ref|XP_007027133.1|  Exocyst subunit exo70 family protein H4          71.2    2e-11   
emb|CDO97837.1|  unnamed protein product                              70.5    2e-11   
emb|CDY02484.1|  BnaA08g00910D                                        68.6    4e-11   
ref|XP_002976483.1|  hypothetical protein SELMODRAFT_232778           70.1    4e-11   
ref|XP_009604963.1|  PREDICTED: exocyst complex component EXO70A1...  70.1    4e-11   
ref|XP_010043604.1|  PREDICTED: exocyst complex component EXO70A1...  68.9    8e-11   
emb|CAN66786.1|  hypothetical protein VITISV_037767                   68.9    1e-10   Vitis vinifera
ref|XP_002281519.2|  PREDICTED: exocyst complex component EXO70A1...  68.9    1e-10   Vitis vinifera
gb|AFW62832.1|  hypothetical protein ZEAMMB73_935848                  69.3    1e-10   
ref|XP_008233543.1|  PREDICTED: exocyst complex component EXO70A1     68.6    1e-10   
gb|ABK24268.1|  unknown                                               68.6    1e-10   Picea sitchensis
ref|XP_009765156.1|  PREDICTED: exocyst complex component EXO70A1...  68.2    2e-10   
ref|XP_001764751.1|  predicted protein                                67.8    2e-10   
ref|XP_009377118.1|  PREDICTED: exocyst complex component EXO70A1...  67.8    3e-10   
ref|XP_002531610.1|  protein binding protein, putative                67.4    3e-10   Ricinus communis
ref|XP_008369835.1|  PREDICTED: exocyst complex component EXO70A1...  67.4    3e-10   
ref|XP_003547470.1|  PREDICTED: exocyst complex component EXO70B1...  67.0    4e-10   
ref|XP_006373358.1|  hypothetical protein POPTR_0017s12950g           67.0    4e-10   
emb|CDY61474.1|  BnaC03g78240D                                        66.6    4e-10   
gb|KDP44175.1|  hypothetical protein JCGZ_05642                       66.2    4e-10   
ref|XP_010258046.1|  PREDICTED: exocyst complex component EXO70B1     67.0    5e-10   
ref|XP_001771767.1|  predicted protein                                66.6    5e-10   
ref|XP_006836607.1|  hypothetical protein AMTR_s00131p00111490        66.6    6e-10   
ref|XP_002308485.2|  exocyst subunit EXO70 family protein             66.6    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006350742.1|  PREDICTED: exocyst complex component 7-like      66.6    6e-10   
ref|XP_001777840.1|  predicted protein                                66.6    6e-10   
ref|XP_011019259.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    9e-10   
ref|XP_006486008.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    9e-10   
gb|KDO67805.1|  hypothetical protein CISIN_1g007630mg                 65.9    9e-10   
gb|KHN33420.1|  hypothetical protein glysoja_005462                   65.9    1e-09   
ref|XP_003539098.1|  PREDICTED: exocyst complex component EXO70B1...  65.9    1e-09   
ref|XP_006436133.1|  hypothetical protein CICLE_v10030942mg           65.9    1e-09   
ref|XP_010253358.1|  PREDICTED: exocyst complex component EXO70B1...  65.9    1e-09   
gb|KDP44174.1|  hypothetical protein JCGZ_05641                       65.9    1e-09   
ref|XP_006383280.1|  hypothetical protein POPTR_0005s13350g           65.9    1e-09   
ref|XP_008222767.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...  65.5    1e-09   
ref|XP_002973424.1|  hypothetical protein SELMODRAFT_98911            65.5    1e-09   
ref|XP_008448357.1|  PREDICTED: exocyst complex component EXO70B1...  65.1    2e-09   
ref|XP_002276070.1|  PREDICTED: exocyst complex component EXO70B1...  65.1    2e-09   Vitis vinifera
ref|XP_011000080.1|  PREDICTED: exocyst complex component EXO70B1...  65.1    2e-09   
gb|KHN05687.1|  Exocyst complex component 7                           65.1    2e-09   
ref|XP_003539758.1|  PREDICTED: exocyst complex component EXO70B1...  65.1    2e-09   
ref|XP_004241253.1|  PREDICTED: exocyst complex component EXO70A1...  65.1    2e-09   
ref|XP_007208031.1|  hypothetical protein PRUPE_ppa002946mg           64.7    2e-09   
ref|XP_004294620.1|  PREDICTED: uncharacterized protein LOC101308554  64.7    2e-09   
gb|KEH42330.1|  exocyst subunit exo70 family protein                  64.7    3e-09   
ref|XP_009600986.1|  PREDICTED: exocyst complex component EXO70A1...  64.7    3e-09   
ref|XP_009764850.1|  PREDICTED: exocyst complex component EXO70A1...  64.7    3e-09   
ref|XP_008385184.1|  PREDICTED: exocyst complex component EXO70B1...  63.9    4e-09   
ref|XP_011020377.1|  PREDICTED: exocyst complex component EXO70A1...  63.9    5e-09   
ref|XP_004505905.1|  PREDICTED: uncharacterized protein LOC101512865  63.9    5e-09   
gb|ABK25032.1|  unknown                                               63.9    5e-09   Picea sitchensis
ref|XP_011027091.1|  PREDICTED: exocyst complex component EXO70A1...  63.9    5e-09   
emb|CAN62485.1|  hypothetical protein VITISV_010813                   63.9    5e-09   Vitis vinifera
ref|XP_010250741.1|  PREDICTED: exocyst complex component EXO70B1     63.9    5e-09   
ref|XP_002279988.1|  PREDICTED: exocyst complex component EXO70B1     63.5    6e-09   Vitis vinifera
ref|XP_007016546.1|  Exocyst subunit exo70 family protein H7, put...  63.5    6e-09   
ref|XP_007132126.1|  hypothetical protein PHAVU_011G068800g           63.5    7e-09   
ref|XP_010486524.1|  PREDICTED: exocyst complex component EXO70B1...  63.5    7e-09   
gb|KDP35571.1|  hypothetical protein JCGZ_09009                       63.5    7e-09   
ref|XP_009630690.1|  PREDICTED: exocyst complex component EXO70B1...  63.2    8e-09   
ref|XP_007163944.1|  hypothetical protein PHAVU_L003900g              63.2    9e-09   
ref|XP_007209880.1|  hypothetical protein PRUPE_ppa003933mg           62.8    1e-08   
gb|EPS72115.1|  hypothetical protein M569_02643                       62.8    1e-08   
ref|XP_002298379.2|  hypothetical protein POPTR_0001s24130g           62.8    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008239462.1|  PREDICTED: exocyst complex component EXO70B1     62.8    1e-08   
ref|XP_010473847.1|  PREDICTED: exocyst complex component EXO70B1...  62.8    1e-08   
ref|XP_009771930.1|  PREDICTED: exocyst complex component EXO70B1...  62.4    1e-08   
ref|XP_004148221.1|  PREDICTED: uncharacterized protein LOC101212978  62.4    2e-08   
ref|XP_011090083.1|  PREDICTED: exocyst complex component EXO70A1     62.4    2e-08   
ref|XP_004305227.1|  PREDICTED: exocyst complex component 7-like      62.4    2e-08   
ref|XP_004240606.1|  PREDICTED: exocyst complex component EXO70A1...  62.0    2e-08   
ref|XP_011000313.1|  PREDICTED: exocyst complex component EXO70B1...  62.0    2e-08   
ref|XP_011014426.1|  PREDICTED: exocyst complex component EXO70B1...  62.0    2e-08   
gb|KGN64408.1|  hypothetical protein Csa_1G050470                     62.0    2e-08   
ref|XP_004166665.1|  PREDICTED: exocyst complex component 7-like      62.0    2e-08   
gb|EYU33194.1|  hypothetical protein MIMGU_mgv1a002824mg              62.0    2e-08   
ref|XP_009354556.1|  PREDICTED: exocyst complex component EXO70B1...  62.0    2e-08   
ref|XP_004152595.1|  PREDICTED: exocyst complex component 7-like      62.0    2e-08   
ref|XP_010096691.1|  Exocyst complex component 7                      61.6    3e-08   
gb|KFK32275.1|  hypothetical protein AALP_AA6G221200                  60.8    3e-08   
ref|XP_010558310.1|  PREDICTED: exocyst complex component EXO70A1...  61.2    3e-08   
ref|XP_010464598.1|  PREDICTED: exocyst complex component EXO70B1...  61.2    3e-08   
ref|XP_008446222.1|  PREDICTED: exocyst complex component EXO70B1     61.2    4e-08   
ref|XP_010032272.1|  PREDICTED: exocyst complex component EXO70A1...  61.2    4e-08   
ref|XP_009598246.1|  PREDICTED: exocyst complex component EXO70A1...  60.8    4e-08   
ref|XP_001783772.1|  predicted protein                                60.8    5e-08   
ref|XP_010501071.1|  PREDICTED: exocyst complex component EXO70B1...  60.8    5e-08   
emb|CDP10608.1|  unnamed protein product                              60.5    6e-08   
ref|XP_006378741.1|  hypothetical protein POPTR_0010s21920g           60.1    6e-08   
ref|XP_002312061.2|  exocyst subunit EXO70 family protein             60.5    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010443748.1|  PREDICTED: exocyst complex component EXO70B1...  60.5    7e-08   
ref|XP_010536629.1|  PREDICTED: exocyst complex component EXO70B1     60.5    7e-08   
ref|XP_009359437.1|  PREDICTED: exocyst complex component EXO70B1...  60.1    8e-08   
ref|XP_006409898.1|  hypothetical protein EUTSA_v10017781mg           60.1    9e-08   
gb|AGW45468.1|  hypothetical protein                                  59.7    9e-08   
gb|KDO49819.1|  hypothetical protein CISIN_1g044027mg                 60.1    1e-07   
ref|XP_002315254.2|  exocyst subunit EXO70 family protein             60.1    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006428994.1|  hypothetical protein CICLE_v10011115mg           60.1    1e-07   
ref|XP_007027955.1|  Exocyst subunit exo70 family protein A2 isof...  59.7    1e-07   
ref|XP_011077417.1|  PREDICTED: exocyst complex component EXO70A1...  60.1    1e-07   
ref|XP_011091478.1|  PREDICTED: exocyst complex component EXO70A1     59.7    1e-07   
ref|XP_006480724.1|  PREDICTED: exocyst complex component EXO70A1...  59.7    1e-07   
ref|XP_004251304.1|  PREDICTED: exocyst complex component EXO70A1     59.7    1e-07   
dbj|BAF01920.1|  hypothetical protein                                 58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027954.1|  Exocyst subunit exo70 family protein A2 isof...  59.3    1e-07   
ref|XP_010462310.1|  PREDICTED: exocyst complex component EXO70B1...  59.3    2e-07   
ref|XP_004307455.1|  PREDICTED: uncharacterized protein LOC101293927  59.3    2e-07   
ref|XP_002534730.1|  protein binding protein, putative                59.3    2e-07   Ricinus communis
ref|XP_008230879.1|  PREDICTED: exocyst complex component EXO70B1     59.3    2e-07   
ref|XP_010555667.1|  PREDICTED: exocyst complex component EXO70A1...  59.3    2e-07   
ref|XP_009798500.1|  PREDICTED: exocyst complex component EXO70A1...  59.3    2e-07   
ref|XP_004302800.1|  PREDICTED: uncharacterized protein LOC101312264  58.9    2e-07   
ref|XP_009788652.1|  PREDICTED: exocyst complex component EXO70B1     58.9    2e-07   
ref|XP_009761942.1|  PREDICTED: exocyst complex component EXO70A1...  58.9    2e-07   
ref|XP_009608742.1|  PREDICTED: exocyst complex component EXO70B1     58.9    2e-07   
gb|KHG11246.1|  Exocyst complex component 7                           58.9    2e-07   
ref|XP_002892415.1|  ATEXO70H6                                        58.9    2e-07   
ref|NP_683286.2|  exocyst subunit exo70 family protein H6             58.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009601489.1|  PREDICTED: exocyst complex component EXO70A1...  58.5    3e-07   
ref|XP_009375245.1|  PREDICTED: exocyst complex component EXO70B1...  58.5    3e-07   
gb|KCW65316.1|  hypothetical protein EUGRSUZ_G02769                   58.5    3e-07   
ref|XP_010068853.1|  PREDICTED: exocyst complex component EXO70A1...  58.5    3e-07   
ref|XP_003597314.1|  Exocyst complex component                        58.2    3e-07   
ref|XP_008374246.1|  PREDICTED: exocyst complex component EXO70B1...  58.2    3e-07   
ref|XP_006400924.1|  hypothetical protein EUTSA_v10016083mg           58.2    3e-07   
ref|XP_007204602.1|  hypothetical protein PRUPE_ppa002792mg           58.2    4e-07   
gb|EYU38484.1|  hypothetical protein MIMGU_mgv1a022387mg              58.2    4e-07   
ref|XP_006293428.1|  hypothetical protein CARUB_v10025404mg           58.2    4e-07   
ref|XP_006409897.1|  hypothetical protein EUTSA_v10017620mg           58.2    4e-07   
emb|CDP08984.1|  unnamed protein product                              58.2    4e-07   
ref|XP_009409718.1|  PREDICTED: exocyst complex component EXO70A1...  58.2    4e-07   
ref|XP_008392777.1|  PREDICTED: exocyst complex component EXO70B1...  58.2    4e-07   
ref|XP_003519931.1|  PREDICTED: exocyst complex component EXO70B1...  58.2    5e-07   
gb|KHN13555.1|  Exocyst complex component 7                           58.2    5e-07   
ref|XP_006602938.1|  PREDICTED: exocyst complex component EXO70B1...  58.2    5e-07   
ref|XP_008462929.1|  PREDICTED: exocyst complex component EXO70B1     57.8    5e-07   
ref|XP_008387721.1|  PREDICTED: exocyst complex component EXO70B1...  57.8    5e-07   
ref|XP_006366926.1|  PREDICTED: uncharacterized protein LOC102580853  57.8    5e-07   
ref|XP_007009575.1|  Exocyst subunit exo70 family protein H2          57.8    5e-07   
ref|XP_010475543.1|  PREDICTED: exocyst complex component EXO70B1...  57.8    6e-07   
ref|XP_008241041.1|  PREDICTED: exocyst complex component EXO70A1     57.8    6e-07   
ref|XP_010942405.1|  PREDICTED: exocyst complex component EXO70A1...  57.8    6e-07   
ref|XP_010319057.1|  PREDICTED: exocyst complex component EXO70B1     57.8    6e-07   
gb|KFK27511.1|  hypothetical protein AALP_AA8G392700                  57.8    6e-07   
ref|XP_009146924.1|  PREDICTED: exocyst complex component EXO70A1     57.4    6e-07   
ref|XP_008813458.1|  PREDICTED: exocyst complex component EXO70A1...  57.4    6e-07   
ref|XP_009368523.1|  PREDICTED: exocyst complex component EXO70B1...  57.4    7e-07   
ref|XP_009419954.1|  PREDICTED: exocyst complex component EXO70A1...  57.4    7e-07   
gb|AES88795.2|  exocyst subunit exo70 family protein                  57.4    7e-07   
ref|XP_003606598.1|  Exocyst complex component                        57.4    7e-07   
ref|XP_010929780.1|  PREDICTED: exocyst complex component EXO70B1...  57.4    7e-07   
gb|KHN41580.1|  Exocyst complex component 7                           57.4    7e-07   
ref|XP_010059110.1|  PREDICTED: exocyst complex component EXO70A1...  57.4    7e-07   
gb|KGN53679.1|  hypothetical protein Csa_4G101790                     57.4    7e-07   
ref|XP_004137283.1|  PREDICTED: uncharacterized protein LOC101204348  57.4    8e-07   
ref|XP_004154783.1|  PREDICTED: uncharacterized LOC101204348          57.4    8e-07   
ref|XP_010059105.1|  PREDICTED: exocyst complex component EXO70A1...  57.4    8e-07   
ref|XP_009787256.1|  PREDICTED: exocyst complex component EXO70B1...  57.0    8e-07   
ref|XP_009360521.1|  PREDICTED: exocyst complex component EXO70B1...  57.0    9e-07   
ref|XP_002866344.1|  ATEXO70H7                                        57.0    9e-07   
ref|XP_009131976.1|  PREDICTED: exocyst complex component EXO70A1...  57.0    9e-07   
ref|XP_009599080.1|  PREDICTED: exocyst complex component EXO70A1...  57.0    9e-07   
ref|XP_006585778.1|  PREDICTED: exocyst complex component EXO70B1...  57.0    9e-07   
ref|XP_003525708.1|  PREDICTED: exocyst complex component EXO70B1...  57.0    1e-06   
gb|EEE64065.1|  hypothetical protein OsJ_18895                        57.0    1e-06   
gb|EAY98398.1|  hypothetical protein OsI_20311                        57.0    1e-06   
ref|XP_011094794.1|  PREDICTED: exocyst complex component EXO70A1...  57.0    1e-06   
ref|XP_003549852.1|  PREDICTED: exocyst complex component EXO70B1...  57.0    1e-06   
ref|XP_010510597.1|  PREDICTED: exocyst complex component EXO70A1     56.6    1e-06   
ref|XP_006351471.1|  PREDICTED: exocyst complex component 7-like      56.6    1e-06   
ref|XP_008798863.1|  PREDICTED: exocyst complex component EXO70A1...  56.6    1e-06   
ref|XP_001759861.1|  predicted protein                                56.6    1e-06   
ref|XP_006343154.1|  PREDICTED: exocyst complex component 7-like      56.6    1e-06   
gb|KDO72993.1|  hypothetical protein CISIN_1g009180mg                 56.6    1e-06   
ref|XP_002881652.1|  ATEXO70H2                                        56.6    1e-06   
ref|XP_006589346.1|  PREDICTED: exocyst complex component EXO70A1...  56.6    1e-06   
gb|KHN14104.1|  Exocyst complex component 7                           56.2    1e-06   
ref|XP_002864165.1|  predicted protein                                56.2    1e-06   
ref|XP_003536279.1|  PREDICTED: exocyst complex component EXO70A1...  56.2    1e-06   
ref|XP_002313454.2|  hypothetical protein POPTR_0009s03200g           56.2    2e-06   
ref|XP_009126671.1|  PREDICTED: exocyst complex component EXO70A1...  56.2    2e-06   
ref|XP_008360595.1|  PREDICTED: exocyst complex component EXO70A1...  56.2    2e-06   
ref|XP_009602592.1|  PREDICTED: exocyst complex component EXO70A1...  56.2    2e-06   
ref|XP_006488241.1|  PREDICTED: exocyst complex component EXO70B1...  56.2    2e-06   
ref|XP_009349077.1|  PREDICTED: exocyst complex component EXO70A1...  56.2    2e-06   
ref|XP_006424734.1|  hypothetical protein CICLE_v10027998mg           56.2    2e-06   
ref|XP_010260020.1|  PREDICTED: exocyst complex component EXO70B1...  55.8    2e-06   
ref|XP_004303435.1|  PREDICTED: exocyst complex component 7-like      55.8    2e-06   
gb|KDO43037.1|  hypothetical protein CISIN_1g0426211mg                53.1    2e-06   
emb|CDX93621.1|  BnaA06g04270D                                        55.8    2e-06   
ref|XP_009613008.1|  PREDICTED: exocyst complex component EXO70B1...  55.5    2e-06   
emb|CDX71629.1|  BnaC09g26700D                                        55.8    2e-06   
ref|XP_007155545.1|  hypothetical protein PHAVU_003G210700g           55.8    2e-06   
ref|XP_009758704.1|  PREDICTED: exocyst complex component EXO70A1...  55.8    2e-06   
ref|XP_009624114.1|  PREDICTED: exocyst complex component EXO70A1...  55.8    2e-06   
ref|NP_200047.3|  exocyst subunit exo70-A2                            55.8    2e-06   
gb|KEH42331.1|  exocyst subunit exo70 family protein                  55.8    2e-06   
ref|XP_006654536.1|  PREDICTED: exocyst complex component EXO70B1...  55.8    2e-06   
ref|XP_010487924.1|  PREDICTED: exocyst complex component EXO70B1...  55.8    2e-06   
ref|XP_006407669.1|  hypothetical protein EUTSA_v10020295mg           55.5    3e-06   
ref|XP_008781888.1|  PREDICTED: exocyst complex component EXO70B1     55.8    3e-06   
ref|XP_010090496.1|  Exocyst complex component 7                      55.5    3e-06   
emb|CDX95128.1|  BnaC05g05430D                                        55.5    3e-06   
ref|XP_010660602.1|  PREDICTED: exocyst complex component EXO70B1     55.5    3e-06   
ref|XP_009599079.1|  PREDICTED: exocyst complex component EXO70A1...  55.5    3e-06   
ref|XP_006346010.1|  PREDICTED: uncharacterized protein LOC102597723  55.5    3e-06   
ref|XP_002456856.1|  hypothetical protein SORBIDRAFT_03g044110        55.5    3e-06   
emb|CDY05812.1|  BnaA10g06080D                                        55.5    3e-06   
ref|XP_009127247.1|  PREDICTED: exocyst complex component EXO70A1...  55.5    3e-06   
ref|XP_004236807.1|  PREDICTED: exocyst complex component EXO70A1...  55.5    3e-06   
emb|CDX74850.1|  BnaA05g05960D                                        55.5    3e-06   
gb|KHN34416.1|  Exocyst complex component 7                           55.1    3e-06   
gb|EMS56594.1|  Exocyst complex component 7                           54.7    3e-06   
ref|XP_006345719.1|  PREDICTED: exocyst complex protein EXO70-like    55.5    3e-06   
ref|XP_010319288.1|  PREDICTED: exocyst complex component EXO70A1...  55.5    3e-06   
ref|XP_006357412.1|  PREDICTED: exocyst complex component 7-like ...  54.7    3e-06   
ref|XP_006280174.1|  hypothetical protein CARUB_v10026076mg           55.5    3e-06   
ref|XP_006401836.1|  hypothetical protein EUTSA_v10015542mg           55.5    3e-06   
ref|XP_004495266.1|  PREDICTED: uncharacterized protein LOC101497388  55.1    3e-06   
gb|AAU44238.1|  putative leucine zipper protein                       55.1    3e-06   
gb|KHN00969.1|  Exocyst complex component 7                           55.1    3e-06   
ref|XP_006606315.1|  PREDICTED: exocyst complex component EXO70A1...  55.1    4e-06   
gb|EMT07245.1|  Exocyst complex component 7                           54.7    4e-06   
ref|XP_006282043.1|  hypothetical protein CARUB_v10028285mg           55.1    4e-06   
ref|XP_004970427.1|  PREDICTED: exocyst complex component 7-like      55.1    4e-06   
gb|EMS54843.1|  Exocyst complex component 7                           54.7    4e-06   
emb|CDY41604.1|  BnaC05g43410D                                        55.1    4e-06   
ref|NP_001148051.1|  protein binding protein                          55.1    4e-06   
ref|XP_009107437.1|  PREDICTED: exocyst complex component EXO70B1     55.1    4e-06   
ref|NP_180432.2|  exocyst subunit exo70 family protein H5             55.1    4e-06   
ref|NP_001055822.1|  Os05g0473500                                     55.1    4e-06   
ref|XP_002534263.1|  Exocyst complex component, putative              54.7    4e-06   
ref|XP_004978733.1|  PREDICTED: exocyst complex component 7-like ...  55.1    4e-06   
gb|EMT22492.1|  Exocyst complex component 7                           54.7    4e-06   
ref|XP_010457977.1|  PREDICTED: exocyst complex component EXO70B1...  55.1    4e-06   
gb|AAD24371.1|  unknown protein                                       55.1    4e-06   
ref|XP_006365689.1|  PREDICTED: exocyst complex component 7-like      55.1    4e-06   
ref|XP_010554564.1|  PREDICTED: exocyst complex component EXO70B1...  55.1    4e-06   
ref|XP_004249947.1|  PREDICTED: exocyst complex component EXO70A1...  55.1    4e-06   
ref|XP_007010469.1|  Exocyst subunit exo70 family protein A1          55.1    4e-06   
gb|KCW50565.1|  hypothetical protein EUGRSUZ_J00280                   55.1    4e-06   
ref|XP_009148021.1|  PREDICTED: exocyst complex component EXO70B1     55.1    4e-06   
ref|XP_010031304.1|  PREDICTED: exocyst complex component EXO70A1     55.1    4e-06   
gb|KDO70599.1|  hypothetical protein CISIN_1g0368062mg                54.3    4e-06   
ref|XP_010520296.1|  PREDICTED: exocyst complex component EXO70B1...  55.1    5e-06   
ref|XP_003568256.1|  PREDICTED: exocyst complex component EXO70B1...  54.7    5e-06   
emb|CDM84822.1|  unnamed protein product                              54.7    5e-06   
dbj|BAJ87250.1|  predicted protein                                    54.7    5e-06   
ref|XP_006481587.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    5e-06   
ref|XP_010504360.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    5e-06   
ref|XP_010418815.1|  PREDICTED: exocyst complex component EXO70B1...  54.7    5e-06   
ref|XP_009374086.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    5e-06   
gb|KGN52176.1|  hypothetical protein Csa_5G613540                     54.3    5e-06   
ref|XP_009341664.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    5e-06   
ref|XP_006430076.1|  hypothetical protein CICLE_v10011277mg           54.7    5e-06   
ref|XP_006653901.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    6e-06   
ref|XP_011077803.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    6e-06   
ref|NP_181470.1|  exocyst subunit exo70 family protein H2             54.7    6e-06   
ref|XP_009368630.1|  PREDICTED: exocyst complex component EXO70B1...  54.7    6e-06   
ref|XP_011098745.1|  PREDICTED: exocyst complex component EXO70B1     54.7    6e-06   
gb|KDP31351.1|  hypothetical protein JCGZ_11727                       54.7    6e-06   
ref|XP_010483617.1|  PREDICTED: exocyst complex component EXO70A1...  54.3    6e-06   
emb|CDX88720.1|  BnaA03g09290D                                        54.3    6e-06   
emb|CDX80235.1|  BnaC09g35070D                                        54.3    6e-06   
ref|XP_009378235.1|  PREDICTED: exocyst complex component EXO70A1...  54.3    6e-06   
ref|NP_001032105.1|  exocyst subunit exo70 family protein H7          54.3    7e-06   
ref|XP_009407615.1|  PREDICTED: exocyst complex component EXO70A1...  54.3    7e-06   
ref|NP_200781.1|  exocyst subunit exo70 family protein H7             54.3    7e-06   
ref|XP_004135040.1|  PREDICTED: exocyst complex component 7-like      54.3    7e-06   
gb|KFK36832.1|  hypothetical protein AALP_AA4G177100                  54.3    7e-06   
ref|NP_001044681.1|  Os01g0827500                                     54.3    7e-06   
ref|XP_009378236.1|  PREDICTED: exocyst complex component EXO70A1...  54.3    7e-06   
gb|KHN30211.1|  hypothetical protein glysoja_010589                   53.9    7e-06   
ref|XP_009120489.1|  PREDICTED: exocyst complex component EXO70A1...  54.3    7e-06   
gb|EAY76347.1|  hypothetical protein OsI_04282                        54.3    8e-06   
gb|EMT16239.1|  Exocyst complex component 7                           54.3    8e-06   
ref|XP_009140928.1|  PREDICTED: exocyst complex component EXO70B1     54.3    8e-06   
gb|EYU18924.1|  hypothetical protein MIMGU_mgv1a003114mg              53.9    8e-06   
ref|XP_010521810.1|  PREDICTED: exocyst complex component EXO70A1     53.9    8e-06   
ref|XP_003543496.1|  PREDICTED: exocyst complex component EXO70A1...  53.9    8e-06   
gb|AAN31926.1|  unknown protein                                       53.9    8e-06   
ref|XP_004162733.1|  PREDICTED: exocyst complex component 7-like      53.9    8e-06   
ref|XP_006279445.1|  hypothetical protein CARUB_v10007909mg           53.9    9e-06   
ref|XP_002532543.1|  protein binding protein, putative                53.9    9e-06   
ref|XP_010427273.1|  PREDICTED: exocyst complex component EXO70A1...  53.9    9e-06   
gb|KHG26941.1|  Exocyst complex component 7                           53.9    1e-05   
ref|XP_007208042.1|  hypothetical protein PRUPE_ppa002738mg           53.9    1e-05   
ref|XP_006850618.1|  hypothetical protein AMTR_s00034p00164510        53.9    1e-05   
ref|XP_010034603.1|  PREDICTED: exocyst complex component EXO70A1...  53.9    1e-05   
ref|XP_009402622.1|  PREDICTED: exocyst complex component EXO70A1...  53.9    1e-05   
gb|EPS63454.1|  hypothetical protein M569_11330                       53.9    1e-05   
ref|XP_002311935.2|  exocyst subunit EXO70 family protein             53.5    1e-05   
ref|XP_009122692.1|  PREDICTED: exocyst complex component EXO70A1     53.5    1e-05   
ref|XP_010426049.1|  PREDICTED: exocyst complex component EXO70A1...  53.5    1e-05   
gb|AEI26267.1|  Exo70A1                                               53.5    1e-05   
ref|XP_004246928.1|  PREDICTED: exocyst complex component EXO70A1...  53.5    1e-05   
gb|ACV92697.1|  exocyst subunit EXO70 A1                              53.5    1e-05   
emb|CDX70300.1|  BnaA10g26490D                                        53.5    1e-05   
ref|XP_009143321.1|  PREDICTED: exocyst complex component EXO70A1...  53.5    1e-05   
dbj|BAJ96547.1|  predicted protein                                    53.5    1e-05   
gb|EAZ30488.1|  hypothetical protein OsJ_14532                        53.5    1e-05   
ref|XP_006345123.1|  PREDICTED: uncharacterized protein LOC102590396  53.5    1e-05   
ref|XP_006403488.1|  hypothetical protein EUTSA_v10010195mg           53.5    1e-05   
ref|NP_001052606.1|  Os04g0382200                                     53.5    1e-05   
ref|XP_002318723.1|  hypothetical protein POPTR_0012s09910g           53.5    1e-05   
ref|XP_002456567.1|  hypothetical protein SORBIDRAFT_03g038570        53.5    1e-05   
emb|CBI25018.3|  unnamed protein product                              53.5    1e-05   
ref|XP_010908201.1|  PREDICTED: exocyst complex component EXO70A1...  53.5    1e-05   
ref|XP_002268110.1|  PREDICTED: exocyst complex component EXO70A1     53.5    1e-05   
emb|CAE03459.1|  OSJNBa0088H09.17                                     53.5    1e-05   
gb|EAY93849.1|  hypothetical protein OsI_15625                        53.5    1e-05   
ref|XP_006417770.1|  hypothetical protein EUTSA_v10007118mg           53.5    1e-05   
ref|XP_009623413.1|  PREDICTED: exocyst complex component EXO70A1...  53.5    1e-05   
ref|XP_008365424.1|  PREDICTED: exocyst complex component EXO70B1...  53.5    1e-05   
ref|XP_006345672.1|  PREDICTED: exocyst complex protein EXO70-like    53.5    1e-05   
ref|XP_007214655.1|  hypothetical protein PRUPE_ppa002633mg           53.5    1e-05   
ref|XP_008446747.1|  PREDICTED: exocyst complex component EXO70A1     53.5    1e-05   
emb|CDY64629.1|  BnaCnng44430D                                        53.5    1e-05   
emb|CDX74849.1|  BnaA05g05950D                                        53.5    1e-05   
ref|XP_009792795.1|  PREDICTED: exocyst complex component EXO70A1...  53.5    1e-05   
ref|XP_010524241.1|  PREDICTED: exocyst complex component EXO70B1...  53.1    2e-05   
ref|XP_008231810.1|  PREDICTED: exocyst complex component EXO70A1     53.1    2e-05   
ref|XP_011044156.1|  PREDICTED: exocyst complex component EXO70B1...  53.1    2e-05   
ref|XP_003535948.1|  PREDICTED: exocyst complex component EXO70A1...  53.1    2e-05   
ref|XP_010927723.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...  53.1    2e-05   
ref|XP_007032747.1|  Exocyst subunit exo70 family protein E1          53.1    2e-05   
ref|XP_010482595.1|  PREDICTED: exocyst complex component EXO70A1...  53.1    2e-05   
ref|XP_010243483.1|  PREDICTED: exocyst complex component EXO70B1     53.1    2e-05   
ref|XP_009123322.1|  PREDICTED: exocyst complex component EXO70B1...  53.1    2e-05   
ref|XP_011024027.1|  PREDICTED: exocyst complex component EXO70B1...  53.1    2e-05   
ref|XP_007139484.1|  hypothetical protein PHAVU_008G033400g           53.1    2e-05   
ref|XP_006854674.1|  hypothetical protein AMTR_s00030p00210320        53.1    2e-05   
emb|CDX71078.1|  BnaC03g11620D                                        53.1    2e-05   
ref|XP_001774512.1|  predicted protein                                53.1    2e-05   
ref|XP_004496114.1|  PREDICTED: exocyst complex component 7-like      53.1    2e-05   
ref|XP_011089411.1|  PREDICTED: exocyst complex component EXO70A1     53.1    2e-05   
ref|XP_010444749.1|  PREDICTED: exocyst complex component EXO70A1...  53.1    2e-05   
ref|XP_006293038.1|  hypothetical protein CARUB_v10019317mg           53.1    2e-05   
ref|XP_011041957.1|  PREDICTED: exocyst complex component EXO70B1...  53.1    2e-05   
emb|CDY41297.1|  BnaA01g32220D                                        52.8    2e-05   
ref|XP_010442761.1|  PREDICTED: exocyst complex component EXO70A1...  52.8    2e-05   
ref|XP_004516388.1|  PREDICTED: uncharacterized protein LOC101498057  53.1    2e-05   
ref|XP_002450318.1|  hypothetical protein SORBIDRAFT_05g003650        52.8    2e-05   
ref|XP_008379423.1|  PREDICTED: LOW QUALITY PROTEIN: exocyst comp...  52.8    2e-05   
dbj|BAB09457.1|  unnamed protein product                              52.8    2e-05   
ref|XP_002980967.1|  hypothetical protein SELMODRAFT_154195           52.8    2e-05   
ref|NP_199849.2|  exocyst subunit exo70 family protein F1             52.8    2e-05   
ref|XP_009596937.1|  PREDICTED: exocyst complex component EXO70B1...  52.8    2e-05   
ref|XP_002989287.1|  hypothetical protein SELMODRAFT_184479           52.8    2e-05   
ref|XP_008799697.1|  PREDICTED: exocyst complex component EXO70A1...  52.8    2e-05   
ref|XP_009390049.1|  PREDICTED: exocyst complex component EXO70A1...  52.8    2e-05   
ref|XP_004304229.1|  PREDICTED: exocyst complex component 7-like      52.8    2e-05   
ref|XP_009390048.1|  PREDICTED: exocyst complex component EXO70A1...  52.8    2e-05   
dbj|BAF00847.1|  hypothetical protein                                 52.8    2e-05   
ref|XP_009596950.1|  PREDICTED: exocyst complex component EXO70B1...  52.8    2e-05   
ref|XP_009768765.1|  PREDICTED: exocyst complex component EXO70A1...  52.8    2e-05   
ref|XP_009596955.1|  PREDICTED: exocyst complex component EXO70B1...  52.8    2e-05   
ref|XP_006445773.1|  hypothetical protein CICLE_v10014543mg           52.8    2e-05   
gb|KHN13248.1|  Exocyst complex component 7                           52.4    2e-05   
emb|CDY44645.1|  BnaC04g06170D                                        52.8    2e-05   
ref|XP_011024156.1|  PREDICTED: exocyst complex component EXO70A1...  52.4    3e-05   
ref|XP_002315422.2|  exocyst subunit EXO70 family protein             52.4    3e-05   
ref|XP_006297189.1|  hypothetical protein CARUB_v10013194mg           52.4    3e-05   
ref|XP_009143322.1|  PREDICTED: exocyst complex component EXO70A1...  52.4    3e-05   
ref|XP_010248978.1|  PREDICTED: exocyst complex component EXO70B1...  52.4    3e-05   
ref|XP_006845844.1|  hypothetical protein AMTR_s00154p00032290        52.4    3e-05   
ref|XP_011024157.1|  PREDICTED: exocyst complex component EXO70A1...  52.4    3e-05   
ref|XP_002871042.1|  predicted protein                                52.4    3e-05   
ref|XP_010442071.1|  PREDICTED: exocyst complex component EXO70B1...  52.4    3e-05   
ref|XP_003543668.1|  PREDICTED: exocyst complex component EXO70A1...  52.4    3e-05   
gb|EPS59557.1|  hypothetical protein M569_15248                       52.4    3e-05   
ref|XP_002322790.2|  hypothetical protein POPTR_0016s07170g           52.4    3e-05   
ref|XP_006287255.1|  hypothetical protein CARUB_v10000445mg           52.4    3e-05   
ref|NP_195974.2|  exocyst subunit exo70 family protein A1             52.4    3e-05   
ref|NP_001190216.1|  exocyst subunit exo70 family protein A1          52.4    3e-05   
ref|XP_010452234.1|  PREDICTED: exocyst complex component EXO70A1     52.4    3e-05   
ref|XP_008790784.1|  PREDICTED: exocyst complex component EXO70A1...  52.4    3e-05   
ref|NP_001119162.1|  exocyst subunit exo70 family protein A1          52.4    3e-05   
ref|XP_010423699.1|  PREDICTED: exocyst complex component EXO70A1...  52.4    3e-05   
ref|XP_010490839.1|  PREDICTED: exocyst complex component EXO70A1...  52.0    3e-05   
ref|XP_004306310.1|  PREDICTED: uncharacterized protein LOC101308117  52.4    3e-05   
gb|EYU45691.1|  hypothetical protein MIMGU_mgv1a002973mg              52.4    3e-05   
gb|KHN25495.1|  Exocyst complex component 7                           52.4    3e-05   
gb|ACF86891.1|  unknown                                               52.0    3e-05   



>ref|XP_010111987.1| Exocyst complex component 7 [Morus notabilis]
 gb|EXC32298.1| Exocyst complex component 7 [Morus notabilis]
Length=611

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  303  IPDIDAVFESKSSESIRIQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  362

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F +RE ++PLA HL+WII
Sbjct  363  RYVMNYIS-LISDYKQTLNELIVSKPSTGSRYSGDPTTPDMEFAEREGKTPLALHLIWII  421

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  422  VILQFNLDGKSKHYKDA  438



>ref|XP_007214942.1| hypothetical protein PRUPE_ppa002868mg [Prunus persica]
 gb|EMJ16141.1| hypothetical protein PRUPE_ppa002868mg [Prunus persica]
Length=626

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  318  MPDIESVFESKSSESIRIQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  377

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E +SPLA HL+WII
Sbjct  378  RYVMNYIS-LISDYKQTLNELIVSKPSTGSRYSGDPTTPDMEFAELEGKSPLALHLIWII  436

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  437  VILQFNLDGKSKHYKDA  453



>ref|XP_008228355.1| PREDICTED: exocyst complex component EXO70A1-like [Prunus mume]
Length=613

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  305  MPDIESVFESKSSESIRIQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  364

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII
Sbjct  365  RYVMNYIS-LISDYKQTLNELIVSKPSTGSRYSGDPTTPDMEFAELEGKTPLALHLIWII  423

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  424  VILQFNLDGKSKHYKDA  440



>ref|XP_010261780.1| PREDICTED: exocyst complex component EXO70A1-like [Nelumbo nucifera]
Length=618

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +FG+KSSE V++QA   LS+LA+A R I+  FE++V      V      +HPLT
Sbjct  310  LPDVDAVFGSKSSESVRVQAAEILSRLAEAVRGIVSEFENAVQREPSKVPVPGGTIHPLT  369

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + EN+SPLA HLVWII
Sbjct  370  RYVMNYIS-LIADYKQTLVELIVSKPSTGSRYSGDPTTPDMDFPELENRSPLALHLVWII  428

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ K+K +KD 
Sbjct  429  VILEFNLEGKAKHYKDA  445



>ref|XP_009350858.1| PREDICTED: exocyst complex component EXO70A1 [Pyrus x bretschneideri]
Length=644

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F ++SSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  336  MPDIESVFDSESSESIRIQAVEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  395

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII
Sbjct  396  RYVMNYIS-LISDYKQTLNELIVSKPSTGSRYSGDPTTPDMEFAELEGKTPLALHLIWII  454

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  455  VILQFNLDGKSKHYKDA  471



>ref|XP_008380786.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
Length=627

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  319  MPDIESVFESKSSESIRIQAVEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  378

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII
Sbjct  379  RYVMNYIS-LISDYKQTLHELIVSKPSTGSRYSGDPTTPDMEFAELEEKTPLALHLIWII  437

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  438  VILQFNLDGKSKHYKDA  454



>ref|XP_004305761.1| PREDICTED: exocyst complex component 7-like [Fragaria vesca subsp. 
vesca]
Length=623

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  315  IPDIDSVFESKSSESIRIQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  374

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y+  ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII
Sbjct  375  RYVMNYIA-LISDYKQTLNELIVSKPSTGSRYSGDPTTPDMEFAELEGKTPLALHLIWII  433

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  434  VILQFNLDGKSKHYKDA  450



>ref|XP_008341817.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
 ref|XP_008341818.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
Length=627

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSSE ++IQA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  319  MPDIESVFDSKSSESIRIQAVEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  378

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP        D T  D  F + E ++PLA HL+WII
Sbjct  379  RYVMNYIS-LISDYKQTLNELIVSKPSTGSRYSSDPTTPDMEFAELEGKTPLALHLIWII  437

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  438  VILQFNLDGKSKHYKDA  454



>ref|XP_002532729.1| protein binding protein, putative [Ricinus communis]
 gb|EEF29660.1| protein binding protein, putative [Ricinus communis]
Length=616

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            +PDIE +F +KS++ +++QA   LS+LA+AAR IL  FEH+VL    S+  V  G +HPL
Sbjct  308  MPDIEMVFESKSADLIRVQAAEILSRLAEAARGILSEFEHAVLREP-SLVPVPGGTIHPL  366

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WI
Sbjct  367  TRYVMNYIS-LISDYKQTLIELILSKPSTGSRYSGDSTTPDMEFAELEGKTPLALHLIWI  425

Query  357  IASLHCNLKIKSKQHKD  407
            I  L  NL  KSK +KD
Sbjct  426  IVILQFNLDGKSKHYKD  442



>ref|XP_006369121.1| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|ERP65690.1| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=610

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F +KS++ +++QA   LS+LA+AAR IL  FE +VL     V      +HPLT
Sbjct  302  LPDIEVVFESKSADSIRVQAAEILSRLAEAARGILSEFESAVLREPSRVPVPGGTIHPLT  361

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII
Sbjct  362  RYVMNYIS-LISDYKQTLIELIMSKPSTGSRYSGDPTTPDMEFAELEGKTPLALHLIWII  420

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +KD 
Sbjct  421  VILQFNLEGKSKHYKDA  437



>ref|XP_007024675.1| Exocyst subunit exo70 family protein D2 [Theobroma cacao]
 gb|EOY27297.1| Exocyst subunit exo70 family protein D2 [Theobroma cacao]
Length=620

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F +KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  312  LPDIEAVFNSKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  371

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD +  D  F + E ++PLA HL+WII
Sbjct  372  RYVMNYIS-LISDYKQTLIELIMSKPSTGSRYSGDPSTPDMEFAELEGKTPLALHLIWII  430

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK ++D 
Sbjct  431  VILQFNLDGKSKHYRDA  447



>emb|CDO97829.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  321  LPDIEVVFESKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  380

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD    D    + E ++PLA HL+WII
Sbjct  381  RYVMNYIS-LISDYKQTLIELIVSKPSTGSRYSGDPNTPDMDLTEFEGKTPLALHLIWII  439

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  440  VILQFNLDAKSKHYKDA  456



>ref|XP_006465885.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
Length=630

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  322  MPDIEIVFDSKSSDSIRVQAAEILSRLAEAARGILSEFENAVLKEPSKVPVPGGTIHPLT  381

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD +  D  F + E ++PLA HL+W+I
Sbjct  382  RYVMNYIS-LISDYKQTLIELIMSKPSTGSRYSGDPSTPDMDFAELEGKTPLALHLIWVI  440

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  441  VILQFNLDGKSKHYKDA  457



>gb|KDP40675.1| hypothetical protein JCGZ_24674 [Jatropha curcas]
Length=620

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            +PDIE +F +KS++ +++QA   LS+LA+AAR IL  FE++VL    S+  V  G +HPL
Sbjct  312  MPDIEVVFESKSADSIRVQAAEILSRLAEAARGILSEFENAVLREP-SLVPVPGGTIHPL  370

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WI
Sbjct  371  TRYVMNYIS-LISDYKQTLIELILSKPSTGSRYSGDSTTPDMEFAELEGKTPLALHLIWI  429

Query  357  IASLHCNLKIKSKQHKD  407
            I  L  NL+ KSK +KD
Sbjct  430  IVILQFNLEGKSKHYKD  446



>ref|XP_002303234.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEE78213.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=629

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 2/136 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDI+ +F +KS++ V++QA   LS+LA+AAR IL  FE +VL    +V      +HPLT 
Sbjct  322  PDIDVVFESKSADSVRVQAAEILSRLAEAARGILSEFESAVLREPSTVAVPGGTIHPLTR  381

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWIIA  362
            YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII 
Sbjct  382  YVMNYIS-LISDYKQTLIELIMSKPSTGSRYSGDPTTPDMEFAELEGKTPLALHLIWIIV  440

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK +KD 
Sbjct  441  ILQFNLEGKSKHYKDA  456



>gb|KHG28684.1| Exocyst complex component 7 [Gossypium arboreum]
Length=659

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F +KSS+ +++QA   LS+LA+AAR IL  FE +VL     V      +HPLT
Sbjct  319  LPDIEAVFDSKSSDSIRVQAAEILSRLAEAARGILSEFESAVLREPSRVPVPGGTIHPLT  378

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII
Sbjct  379  RYVMNYIS-LISDYKQTLIELIMSKPSSGSRYSGDQTTPDMEFAELEGKTPLALHLIWII  437

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK ++D 
Sbjct  438  VVLQFNLDGKSKHYRDA  454



>gb|KDO64960.1| hypothetical protein CISIN_1g036615mg [Citrus sinensis]
Length=600

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  292  MPDIEIVFDSKSSDLIRVQAAEILSRLAEAARGILSEFENAVLKEPSKVPVPGGTIHPLT  351

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD +  D  F + E ++PLA HL+W+I
Sbjct  352  RYVMNYIS-LISDYKQTLIELIMSKPSTGSRYSGDPSTPDMDFAELEGKTPLALHLIWVI  410

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  411  VILQFNLDGKSKHYKDA  427



>ref|XP_006426703.1| hypothetical protein CICLE_v10025154mg [Citrus clementina]
 gb|ESR39943.1| hypothetical protein CICLE_v10025154mg [Citrus clementina]
Length=630

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  322  MPDIEIVFDSKSSDLIRVQAAEILSRLAEAARGILSEFENAVLKEPSKVPVPGGTIHPLT  381

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI SKP       GD +  D  F + E ++PLA HL+W+I
Sbjct  382  RYVMNYIS-LISDYKQTLIELIMSKPSTGSRYSGDPSTPDMDFAELEGKTPLALHLIWVI  440

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  441  VILQFNLDGKSKHYKDA  457



>ref|XP_011012017.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=635

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE +F +KS++ +++QA   LS+LA+AAR IL  FE +VL     V      +HPLT 
Sbjct  328  PDIEVVFESKSADSIRVQAAEILSRLAEAARGILSEFESAVLREPSRVPVPGGTIHPLTR  387

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWIIA  362
            YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII 
Sbjct  388  YVMNYIS-LISDYKQTLIGLIMSKPSTGSRYSGDPTTPDMEFTELEGKTPLALHLIWIIV  446

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK +KD 
Sbjct  447  ILQFNLEGKSKHYKDA  462



>gb|KEH18494.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=617

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  309  IPDIDVVFDSKSSESIRVQAAEILSRLAEAARGILSEFENAVLKEPSKVPVPGGTIHPLT  368

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q L  LI S+P       GD +  D  F + E + PLA HL+WII
Sbjct  369  RYVMNYIS-LISDYKQTLYELIVSRPSTGSRYSGDPSTPDMEFDELEGKPPLAIHLIWII  427

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  428  VILQFNLDGKSKHYKDA  444



>ref|XP_011036476.1| PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70A1 
[Populus euphratica]
Length=629

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDI+ +F +KS++ V++QA   LS+LA+AAR IL  FE +VL     V      +HPLT 
Sbjct  322  PDIDVVFESKSADSVRVQAAEILSRLAEAARGILSEFESAVLREPSRVPVPGGTIHPLTR  381

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWIIA  362
            YVM Y++ ++  Y Q L  LI SKP       GD T  D  F + E ++PLA HL+WII 
Sbjct  382  YVMNYIS-LISDYKQTLIGLIMSKPSTGSRYSGDPTTPDMEFTELEGKTPLALHLIWIIV  440

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK +KD 
Sbjct  441  ILQFNLEGKSKHYKDA  456



>ref|XP_004510526.1| PREDICTED: exocyst complex component 7-like [Cicer arietinum]
Length=628

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  320  IPDIDVVFDSKSSESIRVQAAEILSRLAEAARGILSEFENAVLKEPSKVPVPGGTIHPLT  379

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP       GD +  D  F + E + PLA HL+WII
Sbjct  380  RYVMNYIS-LISDYKMTLNELIVSKPSTGSRCSGDPSTPDMDFDELEGKQPLAIHLIWII  438

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  439  VILQFNLDGKSKHYKDA  455



>ref|XP_011072658.1| PREDICTED: exocyst complex component EXO70B1-like [Sesamum indicum]
Length=532

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  295  LPDIETVFESKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  354

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQ-SPLASHLVWI  356
             YVM Y++ ++  Y Q L  LI SKP        D TV D  F + E Q S LA HL+WI
Sbjct  355  RYVMNYIS-LISDYKQTLIELIVSKPSTGPRYSSDPTVPDMDFSEFEGQASTLALHLIWI  413

Query  357  IASLHCNLKIKSKQHKDG  410
            I  L  NL  KSK +KD 
Sbjct  414  IVILQFNLDGKSKHYKDA  431



>gb|KCW68861.1| hypothetical protein EUGRSUZ_F02455 [Eucalyptus grandis]
Length=634

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F  KS+E +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  326  IPDIDVVFQCKSAESIRVQAAEILSRLGEAARGILSEFENAVLREPSQVPVPGGTIHPLT  385

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y   L+ LI SKP       GD T+ D  F + E +S LA HL+WII
Sbjct  386  RYVMNYIS-LISDYKPTLSELIVSKPSTGSRYSGDPTIPDMEFAEFEGKSALALHLIWII  444

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK ++D
Sbjct  445  VILQFNLEGKSKHYRD  460



>gb|KHN39610.1| Exocyst complex component 7 [Glycine soja]
Length=563

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 80/137 (58%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  255  MPDIDVVFDSKSSESIRVQAAEILSRLGEAARGILSEFENAVLKEPSRVPVPGGTIHPLT  314

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++ GY   L  LI SKP       GD  + D    + E ++PL  HL+WII
Sbjct  315  RYVMNYIS-LISGYKVTLNELIVSKPSTGSRYSGDVGIPDMDLSEYEEKTPLDVHLIWII  373

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK ++D 
Sbjct  374  VILQFNLDGKSKHYRDA  390



>ref|XP_009788385.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=604

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 79/136 (58%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  296  LTDIEIVFESKSSESIRVQAVEILSRLGEAARGILSEFENAVLREPSRVPVPGGTIHPLT  355

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q +  LI SKP        D    D  F + E Q+PLA HL+WII
Sbjct  356  RYVMNYIS-LISDYKQTMVELIVSKPSTGSRYSSDPNTPDMDFSELEGQTPLALHLIWII  414

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL  KSK +KD
Sbjct  415  VILQFNLDGKSKHYKD  430



>ref|XP_009613007.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Nicotiana tomentosiformis]
Length=596

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  288  LLDIEIVFDSKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  347

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q +  LI SKP        D    D  F + E+Q+PLA HL+WI 
Sbjct  348  RYVMNYIS-LISDYNQTMLELIVSKPSTGSRYSSDPNTPDMDFGELESQTPLALHLIWIT  406

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK +KD
Sbjct  407  VILQFNLEGKSKYYKD  422



>ref|XP_007135417.1| hypothetical protein PHAVU_010G127600g [Phaseolus vulgaris]
 gb|ESW07411.1| hypothetical protein PHAVU_010G127600g [Phaseolus vulgaris]
Length=604

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  296  MPDIDVVFDSKSSESIRVQAAEILSRLGEAARGILSEFENAVLKEPSRVPVPGGTIHPLT  355

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP       GD  + D    + E ++PL  HL+WII
Sbjct  356  RYVMNYIS-LISDYKVTLNELIVSKPSTGSRYSGDPGIPDLDLTEFEEKTPLDVHLIWII  414

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK +KD 
Sbjct  415  VILQFNLDGKSKHYKDA  431



>ref|XP_009622141.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=604

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++Q+   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  296  LTDIEIVFESKSSESIRVQSVEILSRLGEAARGILSEFENAVLREPSRVPVPGGTIHPLT  355

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q +  LI SKP        D    D  F + E Q+PLA HL+WII
Sbjct  356  RYVMNYIS-LISDYKQTMVELIVSKPSTGSRYSSDPNTPDMDFSELEGQTPLALHLIWII  414

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL  KSK +KD
Sbjct  415  VILQFNLDGKSKHYKD  430



>ref|XP_009778564.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=598

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  290  LLDIEIVFDSKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  349

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q +  LI SKP        D    D  F + E+Q+PLA HL+WI 
Sbjct  350  RYVMNYIS-LISDYKQTMLELIVSKPSTGSRYSSDPNTPDMDFGELESQTPLALHLIWIT  408

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK +KD
Sbjct  409  VILQFNLEGKSKFYKD  424



>ref|XP_006342931.1| PREDICTED: exocyst complex component 7-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342932.1| PREDICTED: exocyst complex component 7-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006342933.1| PREDICTED: exocyst complex component 7-like isoform X3 [Solanum 
tuberosum]
Length=608

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD+E +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  300  LPDVEIVFESKSSESIRVQAVEILSRLGEAARGILSEFENAVLREPSKVPVPGGTIHPLT  359

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y + +  LI S+P        D    D  F D E  +PLA HL+WII
Sbjct  360  RYVMNYIS-LISDYKKTMGELIVSQPSTGSRYSSDPNTPDMDFADLEGLTPLALHLIWII  418

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK ++D
Sbjct  419  VILQFNLEGKSKHYRD  434



>ref|XP_011079560.1| PREDICTED: exocyst complex component EXO70A1 [Sesamum indicum]
Length=602

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  293  LPDIESVFESKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  352

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQ-SPLASHLVWI  356
             YVM Y++ ++  Y Q L  LI SKP        D  V D    + E Q S LA HL+WI
Sbjct  353  RYVMNYIS-LISDYKQTLIELIVSKPSTGSRYSSDPNVPDMDLSEYEGQTSTLALHLIWI  411

Query  357  IASLHCNLKIKSKQHKDG  410
            I  L  NL  KSK +KD 
Sbjct  412  IVILQFNLDGKSKHYKDA  429



>ref|XP_004235556.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=608

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD+E +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  300  LPDVEIVFESKSSESIRVQAVEILSRLGEAARGILSEFENAVLREPSKVPVPGGTIHPLT  359

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y + L  LI S+P        D    D  F D +  +PLA HL+WII
Sbjct  360  RYVMNYIS-LISDYKKTLGDLIVSQPSTGSRYSSDPNTPDMDFADLDGLTPLALHLIWII  418

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK ++D
Sbjct  419  VILQFNLEGKSKHYRD  434



>ref|XP_010322822.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=596

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++Q    LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  288  LVDIEIVFDSKSSESIRVQTVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  347

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q ++ LI SKP        D    D  F + E+Q+PLA HL+WI 
Sbjct  348  RYVMNYIS-LISDYKQTMSELIVSKPSTGSRYSSDPNTPDMDFAELESQTPLALHLIWIA  406

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK ++D
Sbjct  407  VILQFNLEGKSKCYRD  422



>ref|XP_010487196.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=624

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 82/136 (60%), Gaps = 5/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ +++QA    S+LAQAAR IL  FE++VL    S+  V  G +HPL
Sbjct  321  LPDIEAIFDSDSSDTIRVQAIEIQSRLAQAARGILSEFENAVLREP-SIVPVPGGTIHPL  379

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P           +D  F + E++SPL  HL+W+I
Sbjct  380  TRYVMNYIV-MISDYKQTLDDLIMSNPSSTGSDPNTPDMD--FTELESKSPLDLHLIWLI  436

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KSK ++D
Sbjct  437  VVLHFNLEEKSKHYRD  452



>gb|KHN01430.1| Exocyst complex component 7 [Glycine soja]
Length=554

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  246  MPDIDVVFDSKSSESIRVQAAEILSRLGEAARGILSEFENAVLREPSRVAVPGGTIHPLT  305

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP       GD  + D    + E ++PL  HL+WII
Sbjct  306  RYVMNYIS-LISDYKVTLNELIVSKPSTGSRYSGDPGIPDMDLSEFEEKTPLDVHLIWII  364

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK ++D 
Sbjct  365  VILQFNLDGKSKHYRDA  381



>ref|XP_006357409.1| PREDICTED: exocyst complex component 7-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006357410.1| PREDICTED: exocyst complex component 7-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  288  LVDIEIVFDSKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  347

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q ++ LI SKP        D    D  F + E+ +PLA HL+WI 
Sbjct  348  RYVMNYIS-LISDYKQTMSELIVSKPSTGSRYSSDPNTPDMDFAELESHTPLALHLIWIA  406

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK ++D
Sbjct  407  VILQFNLEGKSKCYRD  422



>ref|XP_003548369.2| PREDICTED: exocyst complex component EXO70A1-like [Glycine max]
Length=667

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  359  MPDIDVVFDSKSSESIRVQAAEILSRLGEAARGILSEFENAVLKEPSRVPVPGGTIHPLT  418

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP       GD  + D    + E ++PL  HL+WII
Sbjct  419  RYVMNYIS-LISDYKVTLNELIVSKPSTGSRYSGDVGIPDMDLSEYEEKTPLDVHLIWII  477

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK ++D 
Sbjct  478  VILQFNLDGKSKHYRDA  494



>gb|AGV75881.1| exocyst 70 [Nicotiana benthamiana]
Length=598

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (59%), Gaps = 2/136 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  290  LLDIEIVFDSKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  349

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q +  LI SKP        D    D    + E+Q+PLA HL+WI 
Sbjct  350  RYVMNYIS-LISDYKQTMLALIVSKPSTGSRYSSDPNTPDMDLCELESQTPLALHLIWIT  408

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KSK +KD
Sbjct  409  VILQFNLEGKSKFYKD  424



>ref|XP_003529840.2| PREDICTED: exocyst complex component EXO70A1-like [Glycine max]
Length=682

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ +F +KSSE +++QA   LS+L +AAR IL  FE++VL     V      +HPLT
Sbjct  374  MPDIDVVFDSKSSESIRVQAAEILSRLGEAARGILSEFENAVLREPSRVAVPGGTIHPLT  433

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP       GD  + D    + E ++PL  HL+WII
Sbjct  434  RYVMNYIS-LISDYKVTLNELIVSKPSTGSRYSGDPGIPDMDLSEFEEKTPLDVHLIWII  492

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL  KSK ++D 
Sbjct  493  VILQFNLDGKSKHYRDA  509



>gb|EYU21299.1| hypothetical protein MIMGU_mgv1a003166mg [Erythranthe guttata]
Length=603

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 80/137 (58%), Gaps = 3/137 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDIE +F +KSSE +++QA   LS+LA+AAR IL  FE +VL     V      +HPLT
Sbjct  294  MPDIENVFESKSSESIRVQAVEILSRLAEAARGILSEFESAVLREPSRVPVPGGTIHPLT  353

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQ-SPLASHLVWI  356
             YVM Y++ ++  Y Q L  LI SKP        D  V D  F + E+Q S LA HL+WI
Sbjct  354  RYVMNYIS-LISDYKQTLLELIVSKPSTGPRYSSDPNVPDMDFSEYEDQASTLALHLIWI  412

Query  357  IASLHCNLKIKSKQHKD  407
               L  NL  KSK +KD
Sbjct  413  TEILQFNLDGKSKHYKD  429



>ref|XP_010501618.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=534

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ +++QA    S+LA+AAR IL  FE++VL    S+  V  G +HPL
Sbjct  232  LPDIEAIFDSDSSDTIRVQAVEIQSRLAEAARGILSEFENAVLREP-SIVPVPGGTIHPL  290

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P    ++      D  F + E++SPL  HL+W+I
Sbjct  291  TRYVMNYIV-MISDYKQTLDDLIMSNPSTGSDQ---NTPDMDFTELESKSPLDLHLIWLI  346

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KS  ++D
Sbjct  347  VVLHFNLEEKSNHYRD  362



>ref|XP_010465291.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=633

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 82/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ +++QA    S+LA+AAR IL  FE++VL    SV  V  G +HPL
Sbjct  331  LPDIEAIFDSDSSDTIRVQAIEIQSRLAEAARGILSEFENAVLREP-SVVPVPGGTIHPL  389

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P    +       D  F + E++SPL  HL+W++
Sbjct  390  TRYVMNYIV-MISDYKQTLDDLIMSNPSTGSDA---NTPDMDFTELESKSPLDLHLIWLM  445

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KSK ++D
Sbjct  446  VVLHFNLEEKSKHYRD  461



>ref|XP_006297223.1| hypothetical protein CARUB_v10013231mg [Capsella rubella]
 gb|EOA30121.1| hypothetical protein CARUB_v10013231mg [Capsella rubella]
Length=621

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ +++QA    ++LA+AAR IL  FE++VL    S+  V  G +HPL
Sbjct  319  LPDIEAIFDSDSSDTIRVQAVEIQARLAEAARGILSEFENAVLREP-SIVPVPGGTIHPL  377

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P    +       D  F + E++SPL  HL+W+I
Sbjct  378  TRYVMNYIV-MISDYKQTLDELIMSNPATGSD---PNAPDMDFTELESKSPLDLHLIWLI  433

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KSK ++D
Sbjct  434  VVLHFNLEEKSKHYRD  449



>ref|XP_010537632.1| PREDICTED: exocyst complex component EXO70A1 [Tarenaya hassleriana]
Length=639

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  334  LPDIEAVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  393

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP            D  F + +++SPLA HL+WII 
Sbjct  394  RYVMNYIS-LISEYKPTLIDLIMSKPSRNPSDSNSPEFD--FSELDHKSPLALHLIWIIV  450

Query  363  SLHCNLKIKSKQHKDG  410
             L  N++ KSK ++D 
Sbjct  451  ILQFNVEGKSKHYRDA  466



>gb|AAL07238.2| unknown protein [Arabidopsis thaliana]
Length=503

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ ++ QA    S+LA+AAR IL  FE++VL    S+  V  G +HPL
Sbjct  201  LPDIEAIFDSDSSDAIRAQAVEIQSRLAEAARGILSEFENAVLREP-SIVPVPGGTIHPL  259

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P    +       D  F + +++SPL  HL+W+I
Sbjct  260  TRYVMNYIV-MISDYKQTLDDLIMSNPSTGSD---PNTPDMDFTELDSKSPLDLHLIWLI  315

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KSK ++D
Sbjct  316  VVLHFNLEEKSKHYRD  331



>ref|XP_002885012.1| ATEXO70D3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61271.1| ATEXO70D3 [Arabidopsis lyrata subsp. lyrata]
Length=609

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ ++ QA    S+LA+A+R IL  FE++VL    S+  V  G +HPL
Sbjct  307  LPDIEAIFDSDSSDAIRAQAVEIQSRLAEASRGILSEFENAVLREP-SIVPVPGGTIHPL  365

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P    +       D  F + E++SPL  HL+W+I
Sbjct  366  TRYVMNYIV-MISDYKQTLDDLIMSNPSTGSD---PNTPDMDFTELESKSPLDLHLIWLI  421

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KSK ++D
Sbjct  422  VVLHFNLEEKSKHYRD  437



>ref|NP_566477.2| exocyst subunit exo70 family protein D3 [Arabidopsis thaliana]
 dbj|BAB02973.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75467.1| exocyst subunit exo70 family protein D3 [Arabidopsis thaliana]
Length=623

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDIE IF + SS+ ++ QA    S+LA+AAR IL  FE++VL    S+  V  G +HPL
Sbjct  321  LPDIEAIFDSDSSDAIRAQAVEIQSRLAEAARGILSEFENAVLREP-SIVPVPGGTIHPL  379

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM Y+  M+  Y Q L  LI S P    +       D  F + +++SPL  HL+W+I
Sbjct  380  TRYVMNYIV-MISDYKQTLDDLIMSNPSTGSD---PNTPDMDFTELDSKSPLDLHLIWLI  435

Query  360  ASLHCNLKIKSKQHKD  407
              LH NL+ KSK ++D
Sbjct  436  VVLHFNLEEKSKHYRD  451



>emb|CBI35844.3| unnamed protein product [Vitis vinifera]
Length=582

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 79/131 (60%), Gaps = 2/131 (2%)
 Frame = +3

Query  21   IFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYVMEY  200
            +F ++ SE ++IQA   LS+LA+AAR IL  FE++VL+    V      +HPLT YVM Y
Sbjct  280  VFESELSESIRIQAAEILSRLAEAARGILSEFENAVLSEPSKVPVPGGTIHPLTRYVMNY  339

Query  201  LTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWIIASLHCN  377
            +  ++  Y Q L  LI SKP       GD T+ D  F + E ++PLA HL+WII  L  N
Sbjct  340  IN-LISDYKQTLIELIVSKPSTGSRYSGDQTMPDMDFAEFEGRTPLALHLIWIIVILQFN  398

Query  378  LKIKSKQHKDG  410
            ++ KSK ++D 
Sbjct  399  VEGKSKCYRDN  409



>ref|XP_002272396.2| PREDICTED: exocyst complex component EXO70A1 [Vitis vinifera]
Length=611

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 79/131 (60%), Gaps = 2/131 (2%)
 Frame = +3

Query  21   IFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYVMEY  200
            +F ++ SE ++IQA   LS+LA+AAR IL  FE++VL+    V      +HPLT YVM Y
Sbjct  309  VFESELSESIRIQAAEILSRLAEAARGILSEFENAVLSEPSKVPVPGGTIHPLTRYVMNY  368

Query  201  LTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWIIASLHCN  377
            +  ++  Y Q L  LI SKP       GD T+ D  F + E ++PLA HL+WII  L  N
Sbjct  369  IN-LISDYKQTLIELIVSKPSTGSRYSGDQTMPDMDFAEFEGRTPLALHLIWIIVILQFN  427

Query  378  LKIKSKQHKDG  410
            ++ KSK ++D 
Sbjct  428  VEGKSKCYRDN  438



>ref|XP_010428131.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=627

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  321  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  380

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  381  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNSTDSNTPDFDFSELENNKGPLALHLIWII  437

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  438  VILQFNLEGKSKYYKNA  454



>ref|XP_002887435.1| ATEXO70D1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63694.1| ATEXO70D1 [Arabidopsis lyrata subsp. lyrata]
Length=632

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  326  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  385

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  386  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNSTDSNTPDFDFSELENNKGPLALHLIWII  442

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  443  VILQFNLEGKSKYYKNA  459



>gb|EYU45895.1| hypothetical protein MIMGU_mgv1a003731mg [Erythranthe guttata]
Length=567

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPLT  182
            PDIE IF ++SSE +++++   +S LA AAR +L  FE+++L    S T V  G +HPLT
Sbjct  261  PDIESIFDSESSESIRLKSAEIVSNLADAARGVLSEFENAILLEP-SKTPVPGGTIHPLT  319

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSP-LASHLVWI  356
             YVM Y++ ++  Y + L  LI SKP       GD +V D    + ENQS  LA HL+WI
Sbjct  320  RYVMNYIS-LISDYKKTLIELIVSKPSAG---SGDPSVPDMDLSEYENQSSCLALHLIWI  375

Query  357  IASLHCNLKIKSKQHKDG  410
            IA L  NL+ KSK +KD 
Sbjct  376  IAILQFNLENKSKHYKDA  393



>ref|XP_010471274.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=628

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  322  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  381

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  382  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNATDSNTPDFDFSELENNKGPLALHLIWII  438

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  439  VILQFNLEGKSKYYKNA  455



>ref|XP_010415997.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=630

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  324  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  383

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  384  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNATDSNTPDFDFSELENNKGPLALHLIWII  440

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  441  VILQFNLEGKSKYYKNA  457



>ref|XP_006300828.1| hypothetical protein CARUB_v10019917mg, partial [Capsella rubella]
 gb|EOA33726.1| hypothetical protein CARUB_v10019917mg, partial [Capsella rubella]
Length=661

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  355  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  414

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  415  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNSTDSNTPDFDFSELESNKGPLALHLIWII  471

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  472  VILQFNLEGKSKYYKNA  488



>ref|NP_177391.1| exocyst subunit exo70-D1 [Arabidopsis thaliana]
 gb|AAG52591.1|AC016529_22 unknown protein; 29470-27569 [Arabidopsis thaliana]
 gb|AEE35328.1| exocyst subunit exo70-D1 [Arabidopsis thaliana]
Length=633

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  327  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  386

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  387  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNATDSNTPDFDFSELENNKGPLALHLIWII  443

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  444  VILQFNLEGKSKYYKNA  460



>dbj|BAF00941.1| hypothetical protein [Arabidopsis thaliana]
Length=633

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  327  LPDIESVFDLKSSDSIRVQAAGILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  386

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWII  359
             YVM Y++ ++  Y   L  LI SKP            D  F + E N+ PLA HL+WII
Sbjct  387  RYVMNYIS-LISEYRPTLIDLIMSKPS--RNATDSNTPDFDFSELENNKGPLALHLIWII  443

Query  360  ASLHCNLKIKSKQHKDG  410
              L  NL+ KSK +K+ 
Sbjct  444  VILQFNLEGKSKYYKNA  460



>ref|XP_006357411.1| PREDICTED: exocyst complex component 7-like isoform X3 [Solanum 
tuberosum]
Length=426

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 75/128 (59%), Gaps = 2/128 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +KSSE +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  288  LVDIEIVFDSKSSESIRVQAVEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLT  347

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWII  359
             YVM Y++ ++  Y Q ++ LI SKP        D    D  F + E+ +PLA HL+WI 
Sbjct  348  RYVMNYIS-LISDYKQTMSELIVSKPSTGSRYSSDPNTPDMDFAELESHTPLALHLIWIA  406

Query  360  ASLHCNLK  383
              L  NL+
Sbjct  407  VILQFNLE  414



>ref|XP_010932390.1| PREDICTED: exocyst complex component EXO70B1-like [Elaeis guineensis]
Length=633

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 77/139 (55%), Gaps = 5/139 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI  +F +KS E +  QA   LS+LA+A R IL   E++VL     +      +HPLT
Sbjct  322  LPDIAAVFCSKSCESIYTQAAEILSRLAEAIRGILSELENAVLRDPSKIPVPGGTIHPLT  381

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTV----LDRRFIDRENQSPLASHLV  350
             YVM Y++ ++  Y Q L  LI ++P       GD       +  F + ENQSPLASHL 
Sbjct  382  RYVMNYIS-LISDYKQTLVELIVTRPSASSRFSGDDSGAGGPEVDFPEPENQSPLASHLT  440

Query  351  WIIASLHCNLKIKSKQHKD  407
            WII  L  NL+ K+  +KD
Sbjct  441  WIIVILQHNLENKANLYKD  459



>ref|XP_009417543.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=638

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPDI  +F +KS+E +  QA   LS+LA+A R IL  FE++VL      T V  G +HPL
Sbjct  324  LPDIAAVFLSKSAESIYTQAAEILSRLAEAVRGILSEFENAVL-RDPPKTAVPGGTIHPL  382

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-------TVLDRRFIDRENQSPLA  338
            T YVM Y++ ++  Y   L  LI ++P       GD       T  +  F + ENQ+PLA
Sbjct  383  TRYVMNYIS-LISDYKPTLIELIITRPSASSRFSGDDQAAVGATPPEIEFPEAENQTPLA  441

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +HL+WII  L  NL+ K+  +KD
Sbjct  442  AHLIWIIVVLAHNLENKANLYKD  464



>ref|XP_010685281.1| PREDICTED: exocyst complex component EXO70A1-like [Beta vulgaris 
subsp. vulgaris]
Length=665

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DIE +F +K++E +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  354  LADIEVVFESKTAESIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  413

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD--TVLDRRFID-RENQSPLASHLVW  353
             YVM Y++ ++  Y Q L  LI SKP     R     +V D  F +  E ++ LA HL+W
Sbjct  414  RYVMNYIS-LISDYKQTLFELIVSKPSSSGTRYSGELSVPDFDFSELEEERTTLALHLIW  472

Query  354  IIASLHCNLKIKSKQHKD  407
            II  L  NL+ KS+ +KD
Sbjct  473  IIVILEFNLEGKSQHYKD  490



>ref|XP_010542385.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=643

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 3/137 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSS-ERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            LPD+E IF  KSS + +  QA   LS+LA+AAR IL  FE++VL    +V      +HPL
Sbjct  334  LPDMEAIFDYKSSPDSIPAQATEILSRLAEAARGILSEFENAVLREPSTVPVPGGTIHPL  393

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVL-DRRFIDRENQSPLASHLVWI  356
            T YVM Y+   +  Y + L  LI SKP     +  D+ + D    + E +S LA HL+WI
Sbjct  394  TRYVMNYIN-YISDYKETLDELIMSKPSTGSRQSDDSNMPDLDLTETEGKSALALHLIWI  452

Query  357  IASLHCNLKIKSKQHKD  407
            I  L  NL+ KSK ++D
Sbjct  453  IMILQFNLEEKSKHYRD  469



>ref|XP_010917447.1| PREDICTED: exocyst complex component EXO70A1 [Elaeis guineensis]
Length=642

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 56/140 (40%), Positives = 77/140 (55%), Gaps = 5/140 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI  +F + SS  +  QA    S+LA+A R IL  FE++VL     +      +HPLT
Sbjct  331  LPDIAAVFHSGSSGSIYTQATDIHSRLAEAVRGILSEFENAVLRDPSKIPVPGGTIHPLT  390

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVL----DRRFIDRENQSPLASHLV  350
             YVM Y++ ++  Y Q L  LI + P       GD       +  F + ENQSPLA+HL+
Sbjct  391  RYVMNYIS-LISDYKQTLVELIVTVPSASSRFAGDDPAAGGPEIEFPEPENQSPLAAHLI  449

Query  351  WIIASLHCNLKIKSKQHKDG  410
            WII  L  NL+ K+  +KDG
Sbjct  450  WIIVILQHNLENKANLYKDG  469



>ref|XP_006392721.1| hypothetical protein EUTSA_v10011317mg [Eutrema salsugineum]
 gb|ESQ30007.1| hypothetical protein EUTSA_v10011317mg [Eutrema salsugineum]
Length=628

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE+++     SV  V  G +HPL
Sbjct  320  LPDMEEIFNSSSSESILVQATEIQSRLAEAARGILVEFENAIFREP-SVVPVPGGTIHPL  378

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y Q L  LI SKP   ++   D    D    + + +SPLA H +WI
Sbjct  379  TRYVMNYLN-LISDYKQTLVELIMSKPCAGLKCTNDPNKPDMDLSELQGRSPLALHCIWI  437

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  438  MVMLQFNLEGKSLHYKD  454



>ref|NP_001147016.1| protein binding protein [Zea mays]
 gb|ACG25077.1| protein binding protein [Zea mays]
Length=618

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 8/140 (6%)
 Frame = +3

Query  3    LPDIEYIFGA--KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VH  173
            LPDIE IF +   SS  V +QA    ++LA+AAR IL  FE++VL    SV  V  G +H
Sbjct  312  LPDIEAIFDSDDSSSRAVYLQASEIQTRLAEAARGILSEFENAVLREP-SVVPVPGGTIH  370

Query  174  PLTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLV  350
            PLT YVM Y++ ++  Y Q L  LI S P    +   +  V+D  F + + +SPLA HL+
Sbjct  371  PLTRYVMNYIS-LISDYKQTLNNLIVSDPSTGSDPNPNAPVID--FTELDGKSPLALHLI  427

Query  351  WIIASLHCNLKIKSKQHKDG  410
            W+I  LH NL+ KS  ++D 
Sbjct  428  WLIMVLHFNLEEKSHHYRDA  447



>ref|XP_009419884.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=636

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 77/143 (54%), Gaps = 8/143 (6%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI  +F +KS+E +  QA   LS+LA+A R IL  FE++V             +HPLT
Sbjct  322  LPDIAVVFLSKSAESIYTQATEILSRLAEAVRGILSEFENAVFRDPPKTPVPGGTIHPLT  381

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-------TVLDRRFIDRENQSPLAS  341
             YVM Y++ ++  Y   L  LI ++P       GD        V +  F   ENQ+PLA+
Sbjct  382  RYVMNYIS-LISDYKPTLIELIVTRPSASSRFSGDDLAAAGAAVPELDFPVSENQTPLAA  440

Query  342  HLVWIIASLHCNLKIKSKQHKDG  410
            HL+WII  L  NL+ K+  +KD 
Sbjct  441  HLIWIIVVLEHNLENKANLYKDN  463



>ref|XP_004144432.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus]
 ref|XP_004169885.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus]
 gb|KGN58450.1| hypothetical protein Csa_3G645880 [Cucumis sativus]
Length=610

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 83/137 (61%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            +PDI+ IF +KS+E ++IQA   +S+LA+A R  L  FE++VL    S+  V  G +HPL
Sbjct  302  IPDIDVIFESKSAEYIRIQATEIVSRLAEAVRGTLSEFENAVLREP-SLHPVPGGTLHPL  360

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM Y++ ++  Y   L  LI SKP        D ++ D  F + E ++PLA HL+W 
Sbjct  361  TRYVMNYVS-LISDYKVTLDELIVSKPSTGSRYSADPSIPDMDFGELEGKTPLALHLIWS  419

Query  357  IASLHCNLKIKSKQHKD  407
            I  L  NL+ KS+ ++D
Sbjct  420  IVILQFNLEGKSRHYRD  436



>emb|CDY52262.1| BnaC05g52060D [Brassica napus]
Length=646

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 8/140 (6%)
 Frame = +3

Query  3    LPDIEYIFGA--KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VH  173
            LPDIE IF +   SS  V +QA    ++LA+AAR IL  FE++VL    SV  V  G +H
Sbjct  312  LPDIEAIFDSDDSSSRAVYLQASEIQTRLAEAARGILSEFENAVLREP-SVVPVPGGTIH  370

Query  174  PLTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASHLV  350
            PLT YVM Y++ ++  Y Q L  LI S P    +   +  V+D  F + + +SPLA HL+
Sbjct  371  PLTRYVMNYIS-LISDYKQTLNNLIVSDPSTGSDPNPNAPVID--FTELDGKSPLALHLI  427

Query  351  WIIASLHCNLKIKSKQHKDG  410
            W+I  LH NL+ KS  ++D 
Sbjct  428  WLIMVLHFNLEEKSHHYRDA  447



>ref|XP_009106941.1| PREDICTED: exocyst complex component EXO70A1 [Brassica rapa]
Length=633

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF ++SSE + +QA    S+LA+AAR  L  FE+++     SV  V  G +HPL
Sbjct  326  LPDMEEIFNSESSETILVQATEIQSRLAEAARGTLVEFENAIFREP-SVVPVPGGTIHPL  384

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVL-DRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y Q L  LI SKP   ++   D V  D      E  SPLA H +W 
Sbjct  385  TRYVMNYLN-LIADYKQTLVELIMSKPCAGLKCTNDPVKPDMDISQLEGCSPLALHCIWT  443

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  444  MVMLQFNLEGKSLHYKD  460



>ref|XP_010502014.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=512

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  276  LPDMEEIFDSSSSEAILVQATEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  334

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y + L  LI +KP   +E   D    D      E  SPLA H++W 
Sbjct  335  TRYVMNYLN-LISDYKETLIDLIMTKPCRGLECTNDRNNPDMDISQLEGISPLALHMIWT  393

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  394  MVMLQFNLEEKSLHYKD  410



>ref|XP_010479990.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=626

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  319  LPDMEEIFDSSSSEAILVQATEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  377

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y + L  LI +KP   +E   D    D      E  SPLA H++W 
Sbjct  378  TRYVMNYLN-LISDYKETLIDLIMTKPCRGLECTNDRNNPDMDISQLEGISPLALHMIWT  436

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  437  MVMLQFNLEEKSVHYKD  453



>ref|XP_008460316.1| PREDICTED: exocyst complex component EXO70A1 [Cucumis melo]
Length=610

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            + DI+ IF +KS+E ++IQA   +S+LA+A R  L  FE++VL    S+  V  G +HPL
Sbjct  302  ISDIDVIFESKSAEYIRIQAAEIVSRLAEAVRGTLSEFENAVLREP-SLHPVPGGTLHPL  360

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM Y++ ++  Y   L  LI SKP        D ++ D  F + E ++PLA HL+W 
Sbjct  361  TRYVMNYVS-LISDYKVTLDELIVSKPSTGSRYSADPSIPDMDFGELEGKTPLALHLIWS  419

Query  357  IASLHCNLKIKSKQHKD  407
            I  L  NL+ KS+ ++D
Sbjct  420  IVILQFNLEGKSRHYRD  436



>ref|XP_006306998.1| hypothetical protein CARUB_v10008575mg [Capsella rubella]
 gb|EOA39896.1| hypothetical protein CARUB_v10008575mg [Capsella rubella]
Length=629

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  322  LPDMEEIFDSSSSESILVQATEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  380

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y + L  LI +KP   ++   D    D      E  SPLA H++W 
Sbjct  381  TRYVMNYLN-LISDYKETLVDLIMTKPCRGLKCTNDPNNPDMDISQLEGMSPLALHMIWT  439

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  440  MVMLQFNLEEKSLHYKD  456



>ref|XP_002891787.1| ATEXO70D2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68046.1| ATEXO70D2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  318  LPDMEEIFDSSSSESILVQATEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  376

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y + L  LI +KP   ++   D    D      E  SPLA H++W 
Sbjct  377  TRYVMNYLN-LISDYKETLIDLIMTKPCRGLQCTNDPNNPDMDISQLEGISPLALHMIWT  435

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  436  MVMLQFNLEEKSLHYKD  452



>ref|XP_010462309.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Camelina sativa]
Length=627

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +Q+    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  320  LPDMEEIFDSSSSEAILVQSTEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  378

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y + L  LI +KP   +E   D    D      E  SPLA H++W 
Sbjct  379  TRYVMNYLN-LISDYKETLIDLIMTKPCRGLECTNDRNNPDMDISQLEGISPLALHMIWT  437

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  438  MVMLQFNLEEKSLHYKD  454



>gb|KFK35661.1| hypothetical protein AALP_AA4G020800 [Arabis alpina]
Length=623

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF  ++SE + +QA    S+L  A R IL  FE++V     SV  V  G +HPL
Sbjct  317  LPDMEEIFNTETSESILVQATGIQSRLGDAVRGILVEFENAVFREP-SVVPVPGGTIHPL  375

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y Q L  LI SKP   ++   D    D    + +  SPLA HL+W 
Sbjct  376  TRYVMNYLN-LISDYKQTLVDLIMSKPCAGLKCTNDPNKPDMDLTELQGLSPLALHLIWT  434

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  +KD
Sbjct  435  MVMLRFNLEEKSLHYKD  451



>gb|EMT20824.1| Exocyst complex component 7 [Aegilops tauschii]
Length=469

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 78/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K++E + +QA    S+LA A R IL  FE++VL      T V  G VHP
Sbjct  154  LPDVSDIFAASKAAESIYVQAVEIRSRLADAVRGILSEFENAVLRDP-PKTAVPGGTVHP  212

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMI------ERMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   LT LI S+P            +  ++      + ENQSPLA
Sbjct  213  LTRYVMNY-SSLISDYKATLTELIVSRPSASARLAAEGNELAPSLSCLELPEHENQSPLA  271

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +H++WII  L  NL+ K   +KD
Sbjct  272  AHIIWIIVVLEHNLESKVSLYKD  294



>gb|EMS58791.1| Exocyst complex component 7 [Triticum urartu]
Length=443

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 77/143 (54%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K++E + +QA    S+LA A R IL  FE++VL      T V  G VHP
Sbjct  128  LPDVSDIFAASKAAESIYVQAVEIRSRLADAVRGILSEFENAVLRDP-PKTAVPGGTVHP  186

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMI------ERMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   LT LI S+P            +   +      + ENQSPLA
Sbjct  187  LTRYVMNY-SSLISDYKATLTELIVSRPSASARLAAEGNELAPCLSCLELPEHENQSPLA  245

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +H++WII  L  NL+ K   +KD
Sbjct  246  AHIIWIIVVLEHNLESKVSLYKD  268



>ref|NP_175811.1| exocyst subunit exo70 family protein D2 [Arabidopsis thaliana]
 gb|AAD25781.1|AC006577_17 EST gb|R64848 comes from this gene [Arabidopsis thaliana]
 gb|AAM13195.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37751.1| At1g54090 [Arabidopsis thaliana]
 dbj|BAE99144.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33046.1| exocyst subunit exo70 family protein D2 [Arabidopsis thaliana]
Length=622

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (57%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  315  LPDMEEIFDSSSSESILVQATEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  373

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-TVLDRRFIDRENQSPLASHLVWI  356
            T YVM YL  ++  Y + L  L+ +KP   ++   D    D    + E  SPLA H++W 
Sbjct  374  TRYVMNYLN-LISDYRETLIDLVMTKPCRGLKCTNDRNDPDMDISELEGISPLALHMIWT  432

Query  357  IASLHCNLKIKSKQHKD  407
            +  L  NL+ KS  ++D
Sbjct  433  MVMLQFNLEEKSLHYRD  449



>gb|EEC84642.1| hypothetical protein OsI_31520 [Oryza sativa Indica Group]
Length=638

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 80/144 (56%), Gaps = 10/144 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K+ E + +QA    S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  323  LPDVSDIFAASKAGESIYVQAAEIRSRLADAVRGILSEFENAVL-RDPSKTPVPGGTIHP  381

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIM--IERMGD----TVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P     I   G+    +  D    D ++Q PLA
Sbjct  382  LTRYVMNY-SSLISDYKTTLSELIVSRPSACSRIAPEGNENAPSFPDLDLADPDSQLPLA  440

Query  339  SHLVWIIASLHCNLKIKSKQHKDG  410
            +HL+WII  L  NL+ K+  +KD 
Sbjct  441  AHLIWIIVVLEHNLESKASLYKDA  464



>ref|NP_001168330.1| hypothetical protein [Zea mays]
 gb|ACN27842.1| unknown [Zea mays]
 gb|AFW61877.1| hypothetical protein ZEAMMB73_809251 [Zea mays]
Length=626

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 58/143 (41%), Positives = 78/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K +E + +QA    S+LA A R I   FE++VL H    T V  G VHP
Sbjct  311  LPDVSDIFAASKVAESIYVQAVEIRSRLADAVRGIFSEFENAVL-HDPPKTAVPGGTVHP  369

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P        +      ++ D    + ENQ PLA
Sbjct  370  LTRYVMNY-SSLICDYKATLSELIVSRPSASARLAAEGNELVPSLADLELPELENQLPLA  428

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            SH+VWII  L  NL+ K+  +KD
Sbjct  429  SHIVWIIVILEHNLEGKATLYKD  451



>emb|CDX97543.1| BnaA05g25360D [Brassica napus]
Length=618

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 10/142 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSS----ERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-  167
            +PDIE IF +         V +QA    ++LA+AAR IL  FE++VL    SV  V  G 
Sbjct  309  MPDIEAIFDSDDDSSSSRAVYLQAGEIQTRLAEAARGILSEFENAVLREP-SVVPVPGGT  367

Query  168  VHPLTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASH  344
            +HPLT YVM Y++ ++  Y Q L  LI S P    +   +  V+D  F + + +SPLA H
Sbjct  368  IHPLTRYVMNYIS-LISDYKQTLNNLIVSDPSTGSDPNPNAPVID--FTELDGKSPLALH  424

Query  345  LVWIIASLHCNLKIKSKQHKDG  410
            L+W+I  LH NL+ KS  ++D 
Sbjct  425  LIWLIMVLHFNLEEKSHHYRDA  446



>ref|XP_009146417.1| PREDICTED: exocyst complex component EXO70A1 [Brassica rapa]
Length=618

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 10/142 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSS----ERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-  167
            +PDIE IF +         V +QA    ++LA+AAR IL  FE++VL    SV  V  G 
Sbjct  310  MPDIEAIFDSDDDSSSSRAVYLQAGEIQTRLAEAARGILSEFENAVLREP-SVVPVPGGT  368

Query  168  VHPLTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDT-VLDRRFIDRENQSPLASH  344
            +HPLT YVM Y++ ++  Y Q L  LI S P    +   +  V+D  F + + +SPLA H
Sbjct  369  IHPLTRYVMNYIS-LISDYKQTLNNLIVSDPSTGSDPNPNAPVID--FTELDGKSPLALH  425

Query  345  LVWIIASLHCNLKIKSKQHKDG  410
            L+W+I  LH NL+ KS  ++D 
Sbjct  426  LIWLIMVLHFNLEEKSHHYRDA  447



>ref|NP_001063276.1| Os09g0439600 [Oryza sativa Japonica Group]
 dbj|BAD36086.1| putative leucine zipper-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD36144.1| putative leucine zipper-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF25190.1| Os09g0439600 [Oryza sativa Japonica Group]
Length=638

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 80/145 (55%), Gaps = 12/145 (8%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K+ E + +QA    S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  323  LPDVSDIFAASKAGESIYVQAAEIRSRLADAVRGILSEFENAVL-RDPSKTPVPGGTIHP  381

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-------TVLDRRFIDRENQSPL  335
            LT YVM Y + ++  Y   L+ LI S+P +   R+         +  D    D ++Q PL
Sbjct  382  LTRYVMNY-SSLISDYKTTLSELIVSRP-LACSRIAPEGNENAPSFPDLDLADPDSQLPL  439

Query  336  ASHLVWIIASLHCNLKIKSKQHKDG  410
            A+HL+WII  L  NL+ K+  +KD 
Sbjct  440  AAHLIWIIVVLEHNLESKASLYKDA  464



>gb|EEE69792.1| hypothetical protein OsJ_29514 [Oryza sativa Japonica Group]
Length=638

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 80/145 (55%), Gaps = 12/145 (8%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K+ E + +QA    S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  323  LPDVSDIFAASKAGESIYVQAAEIRSRLADAVRGILSEFENAVL-RDPSKTPVPGGTIHP  381

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-------TVLDRRFIDRENQSPL  335
            LT YVM Y + ++  Y   L+ LI S+P +   R+         +  D    D ++Q PL
Sbjct  382  LTRYVMNY-SSLISDYKTTLSELIVSRP-LACSRIAPEGNENAPSFPDLDLADPDSQLPL  439

Query  336  ASHLVWIIASLHCNLKIKSKQHKDG  410
            A+HL+WII  L  NL+ K+  +KD 
Sbjct  440  AAHLIWIIVVLEHNLESKASLYKDA  464



>ref|XP_004973612.1| PREDICTED: uncharacterized protein LOC101775446 [Setaria italica]
Length=635

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 79/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K++E + +QA    S+LA A R IL  FE++VL      T V  G +HP
Sbjct  320  LPDVSDIFAASKAAESIYVQAVEIRSRLADAVRGILSEFENAVLRDP-PKTAVPGGTIHP  378

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P        +      ++ D    + ENQ PLA
Sbjct  379  LTRYVMNY-SSLICDYKVTLSELIVSRPSASARLAAEGNELVPSLADLELPELENQLPLA  437

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            SH+VWII  L  NL+ K+  +KD
Sbjct  438  SHIVWIIVVLEHNLEGKAALYKD  460



>ref|XP_003578177.1| PREDICTED: exocyst complex component EXO70A1 [Brachypodium distachyon]
Length=635

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 56/143 (39%), Positives = 79/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K+ E + +Q     S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  320  LPDVSDIFAASKAGESIYVQVAEIRSRLADAVRGILSEFENAVLRDP-SKTPVPGGTIHP  378

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y++ ++  Y   L+ LI S+P        +      +  D    D ++QSPLA
Sbjct  379  LTRYVMNYIS-LISDYKATLSELILSRPSSSSRNAAEGNDLTPSFPDLDLPDPDSQSPLA  437

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +HL+WII  L  NL+ K+  +KD
Sbjct  438  AHLIWIIVVLEHNLEGKASLYKD  460



>ref|XP_004956927.1| PREDICTED: exocyst complex protein exo70-like [Setaria italica]
Length=627

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 10/144 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPDI  IF A K++E + +QA    S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  312  LPDISDIFAASKAAESIYVQAAEIRSRLADAVRGILSEFENAVLRDP-SKTPVPGGTIHP  370

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKP----QIMIE--RMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P    +I  E         D    D ++Q PLA
Sbjct  371  LTRYVMNY-SSLISDYKTTLSELIISRPSASSRIATEGNEAAPAFPDLDLPDPDSQLPLA  429

Query  339  SHLVWIIASLHCNLKIKSKQHKDG  410
            +HL+WII  L  NL+ K+  +KD 
Sbjct  430  AHLIWIIVVLEHNLESKASLYKDA  453



>ref|NP_001145869.1| uncharacterized protein LOC100279383 [Zea mays]
 ref|XP_008672626.1| PREDICTED: uncharacterized protein LOC100279383 isoform X1 [Zea 
mays]
 ref|XP_008672628.1| PREDICTED: uncharacterized protein LOC100279383 isoform X1 [Zea 
mays]
 gb|ACL52760.1| unknown [Zea mays]
 tpg|DAA48808.1| TPA: hypothetical protein ZEAMMB73_501793 [Zea mays]
Length=631

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 57/143 (40%), Positives = 78/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K +E + +QA    S+LA A R IL  FE++VL      T V  G +HP
Sbjct  316  LPDVSDIFAASKVAESIYVQAVEIRSRLADAVRGILSEFENAVLRDP-PKTAVPGGTIHP  374

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIE------RMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P            +  ++ D    + ENQ PLA
Sbjct  375  LTRYVMNY-SSLICDYKVTLSELIISRPSASARLSAEGNELAPSLADLELPELENQLPLA  433

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            SH+VWII  L  NL+ K+  +KD
Sbjct  434  SHIVWIIVVLEHNLEGKAALYKD  456



>ref|XP_003574584.1| PREDICTED: exocyst complex component EXO70B1-like [Brachypodium 
distachyon]
Length=643

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 8/142 (6%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            LPD+  IF A K++E + +QA    S+LA A R IL  FE++VL            VHPL
Sbjct  328  LPDVSDIFAASKAAESIYVQAVEIRSRLADAVRGILSEFENAVLRDPPKTAVPGGNVHPL  387

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIE------RMGDTVLDRRFIDRENQSPLAS  341
            T YVM Y + ++  Y   L+ LI S+P            +  ++ +    + +NQSPL++
Sbjct  388  TRYVMNY-SSLISEYKATLSELIVSRPSASARLAAEGNELAPSLAELELPELDNQSPLSA  446

Query  342  HLVWIIASLHCNLKIKSKQHKD  407
            H++WII  L  NL+ K+  +KD
Sbjct  447  HIIWIIVVLEHNLEGKASLYKD  468



>gb|KFK41667.1| hypothetical protein AALP_AA2G157100 [Arabis alpina]
Length=623

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  318  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  377

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP           +D  F + EN++PLA HL+WII 
Sbjct  378  RYVMNYIS-LISEYRPTLIDLIMSKPSRNATDTNSPEID--FSELENKAPLALHLIWIIL  434

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK ++D 
Sbjct  435  ILQFNLEGKSKHYRDA  450



>emb|CDX68265.1| BnaA07g23050D [Brassica napus]
Length=609

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  303  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  362

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP           +D  F + EN+ PLA HL+WII 
Sbjct  363  RYVMNYIS-LISEYRPTLVDLIMSKPSRNATDTNAPEMD--FSEVENKGPLALHLIWIIL  419

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK ++D 
Sbjct  420  ILQFNLEGKSKYYRDA  435



>emb|CDY50639.1| BnaC06g24320D [Brassica napus]
Length=609

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  303  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  362

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP           +D  F + EN+ PLA HL+WII 
Sbjct  363  RYVMNYIS-LISEYRPTLVDLIMSKPSRNATDTNAPEMD--FSEVENKGPLALHLIWIIL  419

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK ++D 
Sbjct  420  ILQFNLEGKSKYYRDA  435



>ref|XP_006390653.1| hypothetical protein EUTSA_v10019854mg [Eutrema salsugineum]
 gb|ESQ27939.1| hypothetical protein EUTSA_v10019854mg [Eutrema salsugineum]
Length=625

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  322  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  381

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP     R      +  F + EN+ PLA HL+WII 
Sbjct  382  RYVMNYIS-LISEYRPTLIDLIMSKPS----RSDANTPEIDFSELENKGPLALHLIWIIL  436

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK ++D 
Sbjct  437  ILQFNLEGKSKYYRDA  452



>gb|EMS67507.1| Exocyst complex component 7 [Triticum urartu]
Length=362

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 80/143 (56%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K++E + +QA    ++LA A R IL  FE +VL    S T V  G +HP
Sbjct  47   LPDVSDIFAASKAAESIYVQATEIRARLADAVRGILSEFESAVL-RDPSKTPVPGGTIHP  105

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKP----QIMIE--RMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y+  ++  Y   L+ LI S+P    ++  E   +  +  D    D ++Q PL+
Sbjct  106  LTRYVMNYIV-LISDYKTTLSELIVSRPSASSRVSAEGNELRPSFPDLDLPDPDSQLPLS  164

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +HL+W I  L  NL+ K+  +KD
Sbjct  165  AHLIWTIVVLEHNLEGKASLYKD  187



>gb|EAZ07217.1| hypothetical protein OsI_29462 [Oryza sativa Indica Group]
Length=595

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K +E + +QA    S+LA A R IL  FE++VL      T V  G VHP
Sbjct  280  LPDVSDIFAASKVAESIYVQAAEIRSRLADAVRGILSEFENAVLRDP-PKTAVPGGTVHP  338

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIE------RMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P            +  ++ +    + +NQ+PLA
Sbjct  339  LTRYVMNY-SSLISDYKVTLSELIVSRPSASARLAAEGNELAPSLAELDLPEPDNQTPLA  397

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +H++WII  L  NL+ K+  ++D
Sbjct  398  AHIIWIIVVLEHNLEGKASLYRD  420



>ref|NP_001061962.1| Os08g0455700 [Oryza sativa Japonica Group]
 dbj|BAD10406.1| putative leucine zipper-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF23876.1| Os08g0455700 [Oryza sativa Japonica Group]
 gb|EAZ42963.1| hypothetical protein OsJ_27554 [Oryza sativa Japonica Group]
Length=632

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K +E + +QA    S+LA A R IL  FE++VL      T V  G VHP
Sbjct  317  LPDVSDIFAASKVAESIYVQAAEIRSRLADAVRGILSEFENAVLRDP-PKTAVPGGTVHP  375

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIE------RMGDTVLDRRFIDRENQSPLA  338
            LT YVM Y + ++  Y   L+ LI S+P            +  ++ +    + +NQ+PLA
Sbjct  376  LTRYVMNY-SSLISDYKVTLSELIVSRPSASARLAAEGNELAPSLAELDLPEPDNQTPLA  434

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +H++WII  L  NL+ K+  ++D
Sbjct  435  AHIIWIIVVLEHNLEGKASLYRD  457



>ref|XP_009104856.1| PREDICTED: exocyst complex component EXO70B1 isoform X2 [Brassica 
rapa]
Length=591

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  320  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  379

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP           +D  F + +N+ PLA HL+WII 
Sbjct  380  RYVMNYIS-LISEYRPTLVDLIMSKPSRNATDTNAPEMD--FSEVDNKGPLALHLIWIIL  436

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK ++D 
Sbjct  437  ILQFNLEGKSKYYRDA  452



>ref|XP_009104855.1| PREDICTED: exocyst complex component EXO70B1 isoform X1 [Brassica 
rapa]
Length=626

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE +F  KSS+ +++QA   LS+LA+AAR IL  FE++VL     V      +HPLT
Sbjct  320  LPDIESVFDLKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSRVPVPGGTIHPLT  379

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y++ ++  Y   L  LI SKP           +D  F + +N+ PLA HL+WII 
Sbjct  380  RYVMNYIS-LISEYRPTLVDLIMSKPSRNATDTNAPEMD--FSEVDNKGPLALHLIWIIL  436

Query  363  SLHCNLKIKSKQHKDG  410
             L  NL+ KSK ++D 
Sbjct  437  ILQFNLEGKSKYYRDA  452



>ref|XP_008652770.1| PREDICTED: exocyst complex component EXO70B1-like [Zea mays]
 tpg|DAA61646.1| TPA: hypothetical protein ZEAMMB73_192675 [Zea mays]
Length=638

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 80/144 (56%), Gaps = 10/144 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPDI  IF A K++E + +QA    S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  324  LPDISDIFAASKATESIYVQAAEIRSRLADAVRGILSEFENAVLRDP-SKTPVPGGTIHP  382

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y++ ++  Y   L+ L+ S+P        +      +  D    D ++Q PLA
Sbjct  383  LTRYVMNYIS-LISDYKATLSELVISRPSASSRTAAEGNEATPSFPDLDPPDPDSQLPLA  441

Query  339  SHLVWIIASLHCNLKIKSKQHKDG  410
            +HL+WII  L  NL+ K+  +KD 
Sbjct  442  AHLIWIIVVLEHNLESKASLYKDA  465



>gb|EMT09664.1| Exocyst complex component 7 [Aegilops tauschii]
Length=423

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 78/143 (55%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF A K+ E + +Q     ++LA A R IL  FE++VL    S T V  G +HP
Sbjct  108  LPDVSDIFAASKAGESIYVQTTEIRARLADAVRGILSEFENAVLCDP-SKTPVPGGTIHP  166

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQI--MIERMGDTVL----DRRFIDRENQSPLA  338
            LT YVM Y+  ++  Y   L+ LI S+P     +   G+ +     D    D ++Q PL+
Sbjct  167  LTRYVMNYIV-LISDYKTTLSELIVSRPSASSRVRAEGNELRPPFPDLDLPDPDSQLPLS  225

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +HL+W I  L  NL+ K+  +KD
Sbjct  226  AHLIWTIVVLEHNLEGKASLYKD  248



>ref|XP_002460270.1| hypothetical protein SORBIDRAFT_02g025750 [Sorghum bicolor]
 gb|EER96791.1| hypothetical protein SORBIDRAFT_02g025750 [Sorghum bicolor]
Length=622

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 59/144 (41%), Positives = 77/144 (53%), Gaps = 10/144 (7%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPDI  IF A K++E + +QA    S+LA A R IL  FE++VL    S T V  G +HP
Sbjct  306  LPDISDIFAASKAAESIYVQAAEIRSRLADAVRGILSEFENAVLRDP-SKTPVPGGTIHP  364

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y T ++  Y   L+ LI S+P                  D    D ++Q PLA
Sbjct  365  LTRYVMNYST-LISDYKATLSELIISRPSANSRTAAGGNEATPAFPDLDPPDPDSQLPLA  423

Query  339  SHLVWIIASLHCNLKIKSKQHKDG  410
            +HLVWII  L  NL+ K+  +KD 
Sbjct  424  THLVWIIVVLEHNLESKASLYKDA  447



>ref|XP_008670223.1| PREDICTED: exocyst complex component EXO70B1-like [Zea mays]
 tpg|DAA40159.1| TPA: hypothetical protein ZEAMMB73_798049 [Zea mays]
Length=637

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 57/144 (40%), Positives = 78/144 (54%), Gaps = 10/144 (7%)
 Frame = +3

Query  3    LPDIEYIFG-AKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPDI  IF  +K++E + +QA    S+L  A R IL  FE++VL    S T V  G +HP
Sbjct  322  LPDISDIFADSKAAESIYVQAAEIKSRLVDAVRGILSEFENAVLRDP-SKTPVPGGTIHP  380

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y T ++  Y   L+ LI S+P    +   +         D    D ++Q PLA
Sbjct  381  LTRYVMNYST-LISDYKATLSELIISRPSASPQTAAEENEATPAFPDLDPPDPDSQLPLA  439

Query  339  SHLVWIIASLHCNLKIKSKQHKDG  410
            +HLVWII  L  NL+ K+  +KD 
Sbjct  440  THLVWIIVVLEHNLESKASLYKDA  463



>dbj|BAJ85668.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 76/143 (53%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFG-AKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHP  176
            LPD+  IF  +K+ E + +Q+    ++LA A R IL  FE++VL    S T V  G +HP
Sbjct  314  LPDVSDIFAVSKAGESIYVQSTEIRARLADAVRGILSEFENAVLRDP-SKTPVPGGTIHP  372

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD------TVLDRRFIDRENQSPLA  338
            LT YVM Y+  ++  Y   L+ LI S+P        D      +  D    D ++Q PL+
Sbjct  373  LTRYVMNYIV-LISDYKATLSELIVSRPSASSRVSADGNELTPSFPDLDLADPDSQLPLS  431

Query  339  SHLVWIIASLHCNLKIKSKQHKD  407
            +HL+W I  L  NL+ K+   KD
Sbjct  432  AHLIWTIVVLEHNLEGKASLFKD  454



>ref|XP_009381616.1| PREDICTED: exocyst complex component EXO70B1-like [Musa acuminata 
subsp. malaccensis]
Length=554

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 70/141 (50%), Gaps = 7/141 (5%)
 Frame = +3

Query  3    LPDIEYIFGA-KSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            LPDI  +F    SS+ +  QA   L +L +A R+I+  FE +VL             HPL
Sbjct  239  LPDIAALFQCCPSSKPIYTQAAEILPKLTEAIREIISEFETAVLLDPPKTPVPGGNFHPL  298

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMI-----ERMGDTVLDRRFIDRENQSPLASH  344
            T YVM YL  ++  Y   L  LI + P         E            + ENQ+PLA+H
Sbjct  299  TRYVMNYLG-LISDYAPALVELIATSPSASSQFSDNEPAAAAAAQIDVPEPENQTPLAAH  357

Query  345  LVWIIASLHCNLKIKSKQHKD  407
            L WI+A+LH NL+ K+  +KD
Sbjct  358  LTWIVAALHNNLENKANLYKD  378



>ref|XP_002274342.2| PREDICTED: exocyst complex component EXO70B1-like [Vitis vinifera]
Length=694

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 67/134 (50%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE IF  +S+  V++ A TTLS+L ++ R +L  FE  +   S        G+HPLT 
Sbjct  385  PDIESIFSFESTSSVRLHALTTLSKLGESVRMMLSEFESVIQKDSSKSPVAGGGLHPLTQ  444

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM YL+ +   Y   L  +I   P  +   + +   +    D      ++  L WII  
Sbjct  445  YVMNYLSHLA-DYSSILGDIIGDSPPPVQSPLPEFYFESSDTDNTPAPAISVRLAWIILF  503

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+KQ+K+
Sbjct  504  LLCKLDGKAKQYKE  517



>emb|CBI32662.3| unnamed protein product [Vitis vinifera]
Length=687

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 67/134 (50%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE IF  +S+  V++ A TTLS+L ++ R +L  FE  +   S        G+HPLT 
Sbjct  386  PDIESIFSFESTSSVRLHALTTLSKLGESVRMMLSEFESVIQKDSSKSPVAGGGLHPLTQ  445

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM YL+ +   Y   L  +I   P  +   + +   +    D      ++  L WII  
Sbjct  446  YVMNYLSHLA-DYSSILGDIIGDSPPPVQSPLPEFYFESSDTDNTPAPAISVRLAWIILF  504

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+KQ+K+
Sbjct  505  LLCKLDGKAKQYKE  518



>emb|CAN80963.1| hypothetical protein VITISV_005607 [Vitis vinifera]
Length=591

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 67/134 (50%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE IF  +S+  V++ A TTLS+L ++ R +L  FE  +   S        G+HPLT 
Sbjct  282  PDIESIFSFESTSSVRLHALTTLSKLGESVRMMLSEFESVIQKDSSKSPVAGGGLHPLTQ  341

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM YL+ +   Y   L  +I   P  +   + +   +    D      ++  L WII  
Sbjct  342  YVMNYLSHLA-DYSSILGDIIGDSPPPVQSPLPEFYFESSDTDNTPAPAISVRLAWIILF  400

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+KQ+K+
Sbjct  401  LLCKLDGKAKQYKE  414



>emb|CDO97840.1| unnamed protein product [Coffea canephora]
Length=509

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 72/138 (52%), Gaps = 7/138 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQART--TLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHP  176
            + DI+  FGA   E   IQAR     S+L +  R  L +FE ++L         +  +H 
Sbjct  207  ISDIKAFFGASEEEIRSIQARADVIFSRLGEVVRLTLVDFEAAILGDLDECPAPDGAIHR  266

Query  177  LTTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDR-RFIDRENQSPLASHLVW  353
            LT YVM+Y+  +   + + L  LI SKP +     GD +  +    + E Q+PLA+HL+W
Sbjct  267  LTKYVMDYIIGLTD-FQESLMELILSKPSV---SSGDGLSSKLEVAELERQTPLAAHLLW  322

Query  354  IIASLHCNLKIKSKQHKD  407
             I  L  NL+ KSK ++D
Sbjct  323  TIIVLLNNLERKSKSYRD  340



>ref|XP_008461614.1| PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70B1 
[Cucumis melo]
Length=618

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 74/135 (55%), Gaps = 5/135 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE+IF + S+  ++ QA+T++++LA + RDIL  FE ++   S        G+HPLT
Sbjct  321  LPEIEFIFDSVSTSVIKTQAQTSMTKLADSIRDILSEFESTIQKDSSKNPTPGGGIHPLT  380

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
               M Y++  +  Y   L+ ++T +   +     +T+     +     SP+A+ L W+I 
Sbjct  381  RSAMSYIS-ALGDYAATLSDILTVENSPIPSSYMETIAAADAL----SSPVAAQLGWLIL  435

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ ++D
Sbjct  436  VLLCKLDTKAEVYRD  450



>gb|KGN50503.1| hypothetical protein Csa_5G178700 [Cucumis sativus]
Length=374

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IF + S+  ++ QA+T++++LA + RDIL  FE ++   S        G+HPLT
Sbjct  76   LPEIELIFDSVSTSVIRTQAQTSMTKLADSIRDILCEFESTIQKDSSKNPTPGGGIHPLT  135

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
               M Y++  +  Y   L+ ++T +   +     +T+      D    SP+A+ L W+I 
Sbjct  136  QSAMSYISS-LGDYASTLSDILTVENSPIPSSYMETIA----ADDALSSPVAAQLGWLIL  190

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ ++D
Sbjct  191  VLLCKLDTKAEVYRD  205



>emb|CDO97839.1| unnamed protein product [Coffea canephora]
Length=560

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLA-QAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            DI  +F +++ + ++++    LS+L  +     L +FE ++L    +       +H  T 
Sbjct  261  DINSVFESEAGQTIRVRTDCILSRLGGEVVSPALSDFEETLLRELCNYPIPGGAIHRSTE  320

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y+T ++    + LT LITSKP   I  +  + LD +  + E ++PLA+H +WII  
Sbjct  321  YVMGYVTSLVSESKETLTELITSKPSTTIGNLMISDLDVK--ELEGRAPLAAHFLWIIIV  378

Query  366  LHCNLKIKSKQHKD  407
            LH NL+ +SK ++D
Sbjct  379  LHLNLERRSKCYQD  392



>ref|XP_004150962.1| PREDICTED: uncharacterized protein LOC101221801 [Cucumis sativus]
Length=619

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IF + S+  ++ QA+T++++LA + RDIL  FE ++   S        G+HPLT
Sbjct  321  LPEIELIFDSVSTSVIRTQAQTSMTKLADSIRDILCEFESTIQKDSSKNPTPGGGIHPLT  380

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
               M Y++  +  Y   L+ ++T +   +     +T+      D    SP+A+ L W+I 
Sbjct  381  QSAMSYISS-LGDYASTLSDILTVENSPIPSSYMETIA----ADDALSSPVAAQLGWLIL  435

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ ++D
Sbjct  436  VLLCKLDTKAEVYRD  450



>ref|XP_004171016.1| PREDICTED: uncharacterized LOC101221801 [Cucumis sativus]
Length=604

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IF + S+  ++ QA+T++++LA + RDIL  FE ++   S        G+HPLT
Sbjct  306  LPEIELIFDSVSTSVIRTQAQTSMTKLADSIRDILCEFESTIQKDSSKNPTPGGGIHPLT  365

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
               M Y++  +  Y   L+ ++T +   +     +T+      D    SP+A+ L W+I 
Sbjct  366  QSAMSYISS-LGDYASTLSDILTVENSPIPSSYMETIA----ADDALSSPVAAQLGWLIL  420

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ ++D
Sbjct  421  VLLCKLDTKAEVYRD  435



>ref|XP_007027133.1| Exocyst subunit exo70 family protein H4 [Theobroma cacao]
 gb|EOY07635.1| Exocyst subunit exo70 family protein H4 [Theobroma cacao]
Length=729

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 69/133 (52%), Gaps = 1/133 (1%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF  +S+  V+ QA  +L +L+++ R +L +FE ++   S  V     G+H LT Y
Sbjct  423  EIETIFSFESTSAVRSQALNSLVRLSESVRSLLTDFESTIQKDSSKVMIPGGGLHSLTIY  482

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
             M YLT ++  Y   LT +I+  P      +  +  D  + D      ++ H+ W+I  L
Sbjct  483  SMNYLT-LLADYSNVLTDIISDWPPPAKSSLPKSYFDSPYSDDTPVPAISVHIAWLILVL  541

Query  369  HCNLKIKSKQHKD  407
             C L  K+K +KD
Sbjct  542  LCKLDGKAKHYKD  554



>emb|CDO97837.1| unnamed protein product [Coffea canephora]
Length=578

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 3/133 (2%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            D+  +F ++S++ +      TLS+L    R +L  FE++VL    +++     VHPLT +
Sbjct  259  DVGALFPSESAKAIPNGTAATLSRLEDEVRRMLSAFENAVLRDVTTISDDGGRVHPLTKH  318

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
            VM Y+  +M  + + L  LI S+P + I   G  V D    D  + SPLA HLV IIA L
Sbjct  319  VMGYVN-LMVVHRKNLVRLIVSRPSMTIR--GQNVPDSEVQDPTSLSPLALHLVLIIAVL  375

Query  369  HCNLKIKSKQHKD  407
              NL+ KS+  +D
Sbjct  376  QSNLENKSEYFED  388



>emb|CDY02484.1| BnaA08g00910D [Brassica napus]
Length=302

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF ++SSE + +QA    S+LA+AAR  L  FE+++     SV  V  G +HPL
Sbjct  42   LPDMEEIFNSESSETILVQATEIQSRLAEAARGTLVEFENAIFREP-SVVPVPGGTIHPL  100

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKP  260
            T YVM YL  ++  Y Q L  LI SKP
Sbjct  101  TRYVMNYLN-LIADYKQTLVELIMSKP  126



>ref|XP_002976483.1| hypothetical protein SELMODRAFT_232778 [Selaginella moellendorffii]
 gb|EFJ22152.1| hypothetical protein SELMODRAFT_232778 [Selaginella moellendorffii]
Length=634

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 63/135 (47%), Gaps = 10/135 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+I  IF  +S   V+ +A   L +L +AA+     FE++V             +HPLT
Sbjct  348  LPEIHSIFSGESCLSVREEASGVLLRLGEAAKGTFAEFENAVQRDPPKTPVPRGALHPLT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM YL R +  Y   L  L   KP + +            +  EN SPLA   +WII 
Sbjct  408  RYVMNYL-RFLLVYVDTLKKLFGEKPAVPVYSS---------VPAENTSPLAVQFIWIIH  457

Query  363  SLHCNLKIKSKQHKD  407
             L  NL  KSK +KD
Sbjct  458  LLEANLDNKSKLYKD  472



>ref|XP_009604963.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=630

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 70/135 (52%), Gaps = 4/135 (3%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IFG  S+  V+ QA +++ +L +AAR IL  FE ++   S  V     G+HPLT Y
Sbjct  319  EIELIFGFDSTAVVRSQAMSSMEKLREAARTILSEFESAIKKDSSKVVP-GGGIHPLTRY  377

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP--LASHLVWIIA  362
            VM YL   +  Y  P++ ++   P  M   + ++ L     D EN +   ++  L W+I 
Sbjct  378  VMNYLV-FLSDYSGPISEIVADMPVSMKSPLPESYLLSPIADDENSAACVVSVRLAWLIL  436

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K+  + D
Sbjct  437  VLLCKLDGKAGFYGD  451



>ref|XP_010043604.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
 gb|KCW85623.1| hypothetical protein EUGRSUZ_B02411 [Eucalyptus grandis]
Length=618

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF   SS  V+ QA   L +L+ AAR +L +FE ++            GVHPLT 
Sbjct  315  PEIESIFSYDSSSAVRSQAVNALVRLSDAARLMLADFEVAIQKDGSKAAVPGGGVHPLTR  374

Query  186  YVMEYLTRMMHGYGQPLTTLITSKP-QIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
            YVM YL  ++  Y + L+ ++   P +  +  +G            + SP+++ L W++ 
Sbjct  375  YVMNYLN-LLADYSEILSDIVADWPVEAAVSDLG-----------SDTSPISARLAWLVL  422

Query  363  SLHCNLKIKSKQHKD  407
             L C +  K++++KD
Sbjct  423  VLLCKINAKAERYKD  437



>emb|CAN66786.1| hypothetical protein VITISV_037767 [Vitis vinifera]
Length=621

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 69/134 (51%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IF  +S+  V  QA + L +L +A R +L +FE ++   S        GVHPLT 
Sbjct  314  PEIDSIFSFESTSAVLSQATSALIRLGEAVRTMLSDFEAAIQKDSSKTPIRGGGVHPLTR  373

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++  +  Y   L+ ++   P  +   M ++  +    D +  S ++  L W++  
Sbjct  374  YVMNYVS-FLSDYSGVLSVIVAEWPLTVQSSMPESYFENPKSDDDPTSAISLRLAWLVLV  432

Query  366  LHCNLKIKSKQHKD  407
            L C L  ++K +KD
Sbjct  433  LLCKLDGRAKLYKD  446



>ref|XP_002281519.2| PREDICTED: exocyst complex component EXO70A1-like [Vitis vinifera]
Length=621

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 69/134 (51%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IF  +S+  V  QA + L +L +A R +L +FE ++   S        GVHPLT 
Sbjct  314  PEIDSIFSFESTSAVLSQATSALIRLGEAVRTMLSDFEAAIQKDSSKTPIRGGGVHPLTR  373

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++  +  Y   L+ ++   P  +   M ++  +    D +  S ++  L W++  
Sbjct  374  YVMNYVS-FLSDYSGVLSVIVAEWPLTVQSSMPESYFENPKSDDDPTSAISLRLAWLVLV  432

Query  366  LHCNLKIKSKQHKD  407
            L C L  ++K +KD
Sbjct  433  LLCKLDGRAKLYKD  446



>gb|AFW62832.1| hypothetical protein ZEAMMB73_935848 [Zea mays]
Length=1241

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = +3

Query  75   SQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPLTTYVMEYLTRMMHGYGQPLTTLIT  251
            ++LA A R I   FE++VL      T V  G VHPLT YVM Y + ++  Y   L+ LI 
Sbjct  308  TRLADAVRGIFSEFENTVLRDP-PKTAVPGGTVHPLTRYVMNY-SSLICDYKATLSELIV  365

Query  252  SKPQIMI------ERMGDTVLDRRFIDRENQSPLASHLVWIIASLHCNLKIKSKQHKD  407
            S+P            +  ++ D    + ENQ PLASH+VWII  L  NL+ K+  +KD
Sbjct  366  SRPSASARLAAEGNELASSLADLELPELENQLPLASHIVWIIVILEHNLEGKAALYKD  423



>ref|XP_008233543.1| PREDICTED: exocyst complex component EXO70A1 [Prunus mume]
Length=638

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF ++S++ +++QA ++  +L+ + R IL +FE ++   S  +     G+HPLT 
Sbjct  332  PEIESIFDSESTQAIKLQALSSWLKLSDSVRTILSDFESTIQKDSSKILVFGGGIHPLTQ  391

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLD--RRFIDRENQSPLAS-HLVWI  356
             VM Y++ +   YG  L+ ++   P       G++     +  +  +  +P  S HL W+
Sbjct  392  SVMNYVSSLADYYGV-LSDILADHPP-----PGNSSFQEFKSVVSDDCSTPEVSVHLAWL  445

Query  357  IASLHCNLKIKSKQHKD  407
            I  L C L IK++ +KD
Sbjct  446  ILVLLCKLDIKAEIYKD  462



>gb|ABK24268.1| unknown [Picea sitchensis]
Length=627

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 14/136 (10%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            +PDI+ ++  +S   V+  A T   QL  +A  I+  FE+++ A + S T V  G + PL
Sbjct  341  MPDIDAVYCQESCASVRTLASTIFVQLGDSALGIMVVFENAIKAEN-SKTSVPGGTIDPL  399

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM+YL+  +  Y + LT ++ + P    + +G  V           S L+  L W I
Sbjct  400  TGYVMKYLS-FLSDYKETLTNMMANTPIDGHDELGSQV-----------SALSVRLGWTI  447

Query  360  ASLHCNLKIKSKQHKD  407
             +L CNL +KS  +KD
Sbjct  448  TNLQCNLDLKSNLYKD  463



>ref|XP_009765156.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=634

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/136 (34%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IFG  S+  V+ QA +++ +L +AAR IL  FE ++   S  V     G+HPLT Y
Sbjct  319  EIELIFGFDSTAVVRSQAMSSMEKLREAARAILSEFESAIKKDSSKVVS-GGGIHPLTRY  377

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP---LASHLVWII  359
            VM YL   +  Y  P++ ++   P  +   + ++ L     D EN SP   ++  L W+I
Sbjct  378  VMNYLV-FLSDYSGPISEIVADVPVSVKSPLPESYLLSPIADDEN-SPACAVSVRLAWLI  435

Query  360  ASLHCNLKIKSKQHKD  407
              L C L  K+  + D
Sbjct  436  LVLLCKLDGKAGFYGD  451



>ref|XP_001764751.1| predicted protein [Physcomitrella patens]
 gb|EDQ70450.1| predicted protein [Physcomitrella patens]
Length=662

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 9/135 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+++ +F   S   V+ +A   L +L +AAR     FE+++   +     +   VHPL 
Sbjct  362  LPELDVVFAGASGASVRSEAEGILMRLGEAARGTFGEFENAIQRDASKTPVLGGAVHPLN  421

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ +++  Y + L  L   K ++  + +GD          E  SPLA  + W++ 
Sbjct  422  RYVMNYI-KLLCDYTETLKLLFGKKKEVP-KLLGDD-------PEEELSPLAVQINWLMH  472

Query  363  SLHCNLKIKSKQHKD  407
             L  NL+ KSK HKD
Sbjct  473  VLQNNLETKSKIHKD  487



>ref|XP_009377118.1| PREDICTED: exocyst complex component EXO70A1-like [Pyrus x bretschneideri]
Length=652

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IFG +S+  V+ QA  +L +L ++ R ++ +FE +V   S        G+H LT 
Sbjct  349  PEIESIFGFESTAAVRSQALNSLIKLGESVRSLISDFESTVQKDSSKSVPTGGGIHDLTV  408

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
              M +L+ ++  Y   L  +IT  P+       ++  D  F D      ++  + W++  
Sbjct  409  RAMNHLS-LLTDYSNILADIITDWPRPAKSTPRESYFDSPFSDNSPAPAISVLMAWLVLV  467

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+K +KD
Sbjct  468  LLCKLDDKAKHYKD  481



>ref|XP_002531610.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30766.1| protein binding protein, putative [Ricinus communis]
Length=634

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 71/134 (53%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF ++S+  +++QA ++L +L  +   IL +FE ++   S     +  G+HPLT 
Sbjct  326  PEIELIFNSESTSAIKLQALSSLQKLGASVHAILSDFESTIQKDSSKTPVLGGGIHPLTR  385

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
              M Y++ +   Y   L+ +++  P +    + ++  +    D  +   ++  L W+I +
Sbjct  386  TAMSYISSLA-DYSGILSDIVSDSPSLRNTPLPESYFESPTSDDNSTPEVSVRLAWLILT  444

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  445  LLCKLDSKAEVYKD  458



>ref|XP_008369835.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
Length=650

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IFG +S+  V+ QA  +L +L ++ R ++ +FE +V   S        G+H LT 
Sbjct  347  PEIESIFGFESTXAVRSQALNSLIKLGESVRSLISDFESTVQKDSSKSVPTGGGIHDLTV  406

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
              M YL+ ++  Y   L  +IT  P      + ++  D    D      ++  + W++  
Sbjct  407  RGMNYLS-LLTDYSNILADIITDWPCPAKSTLPESYFDSPVSDNAPAPAISVRMAWLVLV  465

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+K +KD
Sbjct  466  LLCKLDDKAKHYKD  479



>ref|XP_003547470.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=593

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 68/132 (52%), Gaps = 3/132 (2%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            IE IF ++S+  ++ Q   + ++L +AAR +L NFE ++   S  +     G+HPLT YV
Sbjct  304  IESIFSSESTSCIRSQVTVSQARLGEAARTMLINFESAIQKESSKIPLPGGGIHPLTRYV  363

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASLH  371
            M Y+   +  YG  L  ++   PQ  +        DR   +R   S +A  + W+I  L 
Sbjct  364  MNYIA-FLADYGDALAEIVADWPQNSLPESYYRSPDREGKNR--SSEIAERMAWLILVLL  420

Query  372  CNLKIKSKQHKD  407
            C L  K++ +K+
Sbjct  421  CKLDGKAELYKE  432



>ref|XP_006373358.1| hypothetical protein POPTR_0017s12950g [Populus trichocarpa]
 ref|XP_006373359.1| exocyst subunit EXO70 family protein [Populus trichocarpa]
 ref|XP_006373360.1| hypothetical protein POPTR_0017s12950g [Populus trichocarpa]
 ref|XP_002324115.2| hypothetical protein POPTR_0017s12950g [Populus trichocarpa]
 gb|ERP51155.1| hypothetical protein POPTR_0017s12950g [Populus trichocarpa]
 gb|ERP51156.1| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|ERP51157.1| hypothetical protein POPTR_0017s12950g [Populus trichocarpa]
 gb|EEF04248.2| hypothetical protein POPTR_0017s12950g [Populus trichocarpa]
Length=644

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 70/143 (49%), Gaps = 10/143 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI+ ++  +   RV+I  R  L +L  + R +   FE+++  ++ +      GVHPLT
Sbjct  345  LPDIDSLYANEGGARVRIDCREVLRRLGDSVRAVFLEFENAISTNTSTNPIAGGGVHPLT  404

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQ-------SPLAS  341
             YVM YL  +  GY + L  L+  K Q   + M  +       + EN        SPLA 
Sbjct  405  KYVMNYLNALT-GYRETLNFLL--KDQDGEDTMSLSPDINPSTEEENAREGACDGSPLAL  461

Query  342  HLVWIIASLHCNLKIKSKQHKDG  410
            H   + + L CNL  K+K ++D 
Sbjct  462  HFRSVASILECNLDDKAKLYRDA  484



>emb|CDY61474.1| BnaC03g78240D [Brassica napus]
Length=508

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF ++SSE +  QA    S+LA+AAR  L  FE+++     SV  V  G +HPL
Sbjct  264  LPDMEEIFNSESSETILAQATEIQSRLAEAARGTLVEFENAIFREP-SVVPVPGGTIHPL  322

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKP  260
            T YVM YL  ++  Y Q L  L+ SKP
Sbjct  323  TRYVMNYLN-LIADYKQTLVELVMSKP  348



>gb|KDP44175.1| hypothetical protein JCGZ_05642 [Jatropha curcas]
Length=378

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 71/135 (53%), Gaps = 3/135 (2%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+ QA  +L +L +A R +L +FE S ++   S T    GVHPLT 
Sbjct  90   PEIESIFNDESTSTVRSQAVNSLIKLGEAVRTMLTDFE-SAISKDNSKTPPGGGVHPLTR  148

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWIIA  362
            YVM Y++  +  Y   L+ ++   P      + +        D++ N S ++  L W+I 
Sbjct  149  YVMNYIS-FLSDYSGILSDIVADWPLTNQSPLPEFYFGSPEPDQDGNSSAISLRLAWLIL  207

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +KD
Sbjct  208  VLLCKLDGKAELYKD  222



>ref|XP_010258046.1| PREDICTED: exocyst complex component EXO70B1 [Nelumbo nucifera]
Length=657

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 70/144 (49%), Gaps = 11/144 (8%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +F   +   +Q + R  L +L  + R  L  FE++V +++ +      G+HP+T
Sbjct  348  LPDVDALFSDDTGSSIQFECREGLKRLGDSVRGTLLEFENAVRSNTSTNPFAGGGIHPMT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE--------NQSPLA  338
             YVM ++ + +  Y   L  ++  K  + +E +   V     I+ E        N  P+A
Sbjct  408  RYVMNFI-KALTDYSDTLNFILKDKDGVDLESLSPNV--NPVIEEEKDTESSSYNTCPMA  464

Query  339  SHLVWIIASLHCNLKIKSKQHKDG  410
             HL  I + L  NL  KSK +KD 
Sbjct  465  HHLQSITSILESNLDGKSKLYKDA  488



>ref|XP_001771767.1| predicted protein [Physcomitrella patens]
 gb|EDQ63375.1| predicted protein [Physcomitrella patens]
Length=660

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 70/139 (50%), Gaps = 7/139 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +P++E IF   S   V+ +A   LS+L +A R  +  FE+++L  S  V  +   VHPLT
Sbjct  352  IPELEVIFSGTSGSSVRSEANGILSRLGEAIRGTISEFENAILRDSSKVPVMGGSVHPLT  411

Query  183  TYVMEYLTRMMHGYGQPLTTLI----TSKPQIMIERMGDTVLDRRFIDRENQSPLASHLV  350
             YVM Y+ ++   Y   L  +      S+      +  D   DR    RE  SPLAS + 
Sbjct  412  RYVMNYI-KLACDYSDTLKQVYGERDNSEGPGRATQSPDEGDDR--YTREESSPLASQVC  468

Query  351  WIIASLHCNLKIKSKQHKD  407
             +  +L  NL+ KSK +KD
Sbjct  469  RLAEALQNNLEGKSKLYKD  487



>ref|XP_006836607.1| hypothetical protein AMTR_s00131p00111490 [Amborella trichopoda]
 gb|ERM99460.1| hypothetical protein AMTR_s00131p00111490 [Amborella trichopoda]
Length=621

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 71/140 (51%), Gaps = 6/140 (4%)
 Frame = +3

Query  3    LPDIEYIF-GAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            +PDI  +F G   S+ V++QA   L++L +AAR  L  FE+++   +         +HPL
Sbjct  309  VPDISLVFQGGGPSDSVRVQASEILTRLGEAARGTLSEFENAIQRENSRAPMPGGTIHPL  368

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQ----SPLASHL  347
            T YVM Y T ++  Y + L+ LI + P       G+ + +      E+      PL  HL
Sbjct  369  TRYVMNY-TNLISLYQETLSKLIVTNPSPRNVPGGEPLPELDLPSPESDVPMPPPLTVHL  427

Query  348  VWIIASLHCNLKIKSKQHKD  407
             WI   L  NL+ K++ ++D
Sbjct  428  KWITTILQHNLEGKAQLYRD  447



>ref|XP_002308485.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEE92008.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=630

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (52%), Gaps = 1/133 (1%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF  +S+  V+ QA ++L +L+++   +L +FE SV  HS        GVH LT+ 
Sbjct  324  EIESIFSFESTSPVRTQALSSLVKLSESIYSMLSDFESSVQKHSSKALVPGGGVHSLTSN  383

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
             M YL+ ++  Y   LT +I+  P      + ++  D    D    + +++   W++  L
Sbjct  384  AMNYLS-LLADYSNVLTDIISDWPPPTKPSLPESYFDSPDSDDPPAAAISTRFAWLVLYL  442

Query  369  HCNLKIKSKQHKD  407
             C L  K+K +KD
Sbjct  443  LCKLDGKAKYYKD  455



>ref|XP_006350742.1| PREDICTED: exocyst complex component 7-like [Solanum tuberosum]
Length=624

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 6/138 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L +IE IFG  S+  V+ QA T++++L  AAR +L  FE ++   S  V     G+HPLT
Sbjct  304  LSEIEVIFGFDSTVAVKSQALTSMAKLRDAARAMLAEFESAIKKDSSKVVA-GGGIHPLT  362

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP---LASHLVW  353
             YVM YL   +  Y  P++ +I     ++   + ++ L     D + +SP   ++  L W
Sbjct  363  RYVMNYLI-FLSDYSGPVSDIIADWKAVVKSPLPESYLLSPIAD-DGESPSCIVSVRLTW  420

Query  354  IIASLHCNLKIKSKQHKD  407
            +I  L C L  K+  + D
Sbjct  421  LILVLLCKLDGKAGFYGD  438



>ref|XP_001777840.1| predicted protein [Physcomitrella patens]
 gb|EDQ57378.1| predicted protein [Physcomitrella patens]
Length=642

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 66/134 (49%), Gaps = 9/134 (7%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+++ +F   S   V+ +A   L +L +AA      FE+++L  +  +   +  VH L  
Sbjct  355  PELDAMFAGASGASVRSEAEEILCRLGEAAVGTFGEFENAILRDASKLPNRDGDVHILNR  414

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y+ +++ GY   L  L   K Q++     DT        +E  SPL   ++ +I  
Sbjct  415  YVMNYI-KLLSGYTDTLQQLFEDKKQVLKLSGDDT--------KEENSPLGVQIICLIHI  465

Query  366  LHCNLKIKSKQHKD  407
            L  NL+ KSK +KD
Sbjct  466  LRNNLEAKSKSYKD  479



>ref|XP_011019259.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=630

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (52%), Gaps = 1/133 (1%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF  +S+  V+ QA ++L +L+++   +L +FE SV  HS        GVH LT+ 
Sbjct  324  EIESIFSFESTSPVRTQALSSLVKLSESIYSMLSHFESSVQKHSSKALVPGGGVHSLTSN  383

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
             M YL+ ++  Y   LT +I+  P      + ++  D    D    + +++   W++  L
Sbjct  384  AMNYLS-LLADYSNVLTDIISDWPPPTKSSLPESYFDSPDSDDPPAAAISTRFAWLVLYL  442

Query  369  HCNLKIKSKQHKD  407
             C L  K+K +KD
Sbjct  443  LCKLDGKAKYYKD  455



>ref|XP_006486008.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
Length=637

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (50%), Gaps = 1/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
             P+IE IF ++++  V++QA +++ +L  + R I+ +FE ++   S     V  G+H LT
Sbjct  326  FPEIELIFNSEATSAVKLQALSSMHKLGDSVRAIISDFESTLHKDSSKTQAVGGGIHQLT  385

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
              VM Y+T +   +G  L  ++   P        ++  +         S ++ HL W+I 
Sbjct  386  RSVMSYITSLGE-HGNILADIVADHPPPCTSSFPESYFESPSSHNSRGSAVSLHLAWLIL  444

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K+  +KD
Sbjct  445  VLLCKLDRKAALYKD  459



>gb|KDO67805.1| hypothetical protein CISIN_1g007630mg [Citrus sinensis]
Length=595

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (50%), Gaps = 1/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
             P+IE IF ++++  V++QA +++ +L  + R I+ +FE ++   S     V  G+H LT
Sbjct  321  FPEIELIFNSEATSAVKLQALSSMHKLGDSVRAIISDFESTLHKDSSKTQAVGGGIHQLT  380

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
              VM Y+T +   +G  L  ++   P        ++  +         S ++ HL W+I 
Sbjct  381  RSVMSYITSLGE-HGNILADIVADHPPPCTSSFPESYFESPSSHNSRGSAVSLHLAWLIL  439

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K+  +KD
Sbjct  440  VLLCKLDRKAALYKD  454



>gb|KHN33420.1| hypothetical protein glysoja_005462 [Glycine soja]
Length=580

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 68/132 (52%), Gaps = 3/132 (2%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            IE IF ++S+  ++ Q   + ++L +AAR +L NFE ++   S  +     G+HP+T YV
Sbjct  291  IESIFSSESTSCIRSQVTVSQARLGEAARTMLINFESAIQKESSKIPLPGGGIHPVTRYV  350

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASLH  371
            M Y+   +  YG  L  ++   PQ  +        DR   +R   S +A  + W+I  L 
Sbjct  351  MNYIA-FLADYGDALAEIVADWPQNSLPESYYRSPDREGKNR--SSEIAERMAWLILVLL  407

Query  372  CNLKIKSKQHKD  407
            C L  K++ +K+
Sbjct  408  CKLDGKAELYKE  419



>ref|XP_003539098.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=609

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 7/136 (5%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P IE+IF  +S+  ++ Q  T++ +L  A R +L +FE ++   S        GVHPLT 
Sbjct  308  PQIEFIFSFESTVNIRTQTVTSMVKLGDAVRTMLTDFETAIQKESSKKPVPGGGVHPLTR  367

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWII  359
            YVM YLT  +  Y   L  +I   PQ  +         R  +  EN   S L+  + WII
Sbjct  368  YVMNYLT-FLADYSGVLVDIIADLPQSPLPES----YYRSPMREENPPASELSERIAWII  422

Query  360  ASLHCNLKIKSKQHKD  407
              + C L  K++ +KD
Sbjct  423  LVVLCKLDGKAELYKD  438



>ref|XP_006436133.1| hypothetical protein CICLE_v10030942mg [Citrus clementina]
 gb|ESR49373.1| hypothetical protein CICLE_v10030942mg [Citrus clementina]
Length=637

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (50%), Gaps = 1/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
             P+IE IF ++++  V++QA +++ +L  + R I+ +FE ++   S     V  G+H LT
Sbjct  326  FPEIELIFNSEATSAVKLQALSSMHKLGDSVRAIISDFESTLHKDSSKTQAVGGGIHQLT  385

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
              VM Y+T +   +G  L  ++   P        ++  +         S ++ HL W+I 
Sbjct  386  RSVMSYITSLGE-HGNILADIVADHPPPCTSSFPESYFESPSSHNSRGSAVSLHLAWLIL  444

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K+  +KD
Sbjct  445  VLLCKLDRKAALYKD  459



>ref|XP_010253358.1| PREDICTED: exocyst complex component EXO70B1-like [Nelumbo nucifera]
Length=623

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 75/135 (56%), Gaps = 3/135 (2%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+ QA ++L +L  A R +L +FE ++       +    G+HPLT 
Sbjct  316  PEIETIFFFESTAAVRSQALSSLIRLGDAVRAMLSDFESAIQKDPARSSVPGGGLHPLTR  375

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDR-RFIDRENQSPLASHLVWIIA  362
            YVM YL+ ++  Y   L+ +I + P  +   + ++      ++D ++ S ++  LVWII 
Sbjct  376  YVMNYLS-LLADYSGSLSDIIANGPAPVQSPLPESYYSSPSWVDNQS-SAISVRLVWIIL  433

Query  363  SLHCNLKIKSKQHKD  407
             + C L  K++ +KD
Sbjct  434  VVLCKLDGKAELYKD  448



>gb|KDP44174.1| hypothetical protein JCGZ_05641 [Jatropha curcas]
Length=597

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 71/135 (53%), Gaps = 3/135 (2%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+ QA  +L +L +A R +L +FE S ++   S T    GVHPLT 
Sbjct  309  PEIESIFNDESTSTVRSQAVNSLIKLGEAVRTMLTDFE-SAISKDNSKTPPGGGVHPLTR  367

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRE-NQSPLASHLVWIIA  362
            YVM Y++  +  Y   L+ ++   P      + +        D++ N S ++  L W+I 
Sbjct  368  YVMNYIS-FLSDYSGILSDIVADWPLTNQSPLPEFYFGSPEPDQDGNSSAISLRLAWLIL  426

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +KD
Sbjct  427  VLLCKLDGKAELYKD  441



>ref|XP_006383280.1| hypothetical protein POPTR_0005s13350g [Populus trichocarpa]
 gb|ERP61077.1| hypothetical protein POPTR_0005s13350g [Populus trichocarpa]
Length=644

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 66/149 (44%), Gaps = 22/149 (15%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI+ ++  ++  RV+I  R  L +L  + R     FE+++   + +      G+HPLT
Sbjct  345  LPDIDSLYADEAGARVRIDCREVLRRLGDSVRAAFLEFENAISTSTSTNPIAGGGIHPLT  404

Query  183  TYVMEYLTRMMHGYGQPLTTLITSK-------------PQIMIERMGDTVLDRRFIDREN  323
             YVM YL  +  GY + L  L+  +             P    E   D   D        
Sbjct  405  KYVMNYLNALT-GYRETLNFLLKDQDGEDTMSLSPDINPSTEEENARDGACD--------  455

Query  324  QSPLASHLVWIIASLHCNLKIKSKQHKDG  410
             SPLA H   + + L CNL  K+K ++D 
Sbjct  456  GSPLALHFRSVASILECNLDDKAKLYRDA  484



>ref|XP_008222767.1| PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70A1 
[Prunus mume]
Length=627

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+  A  +L +L +A R +L +FE ++   S        GVHPLT 
Sbjct  321  PEIESIFSFESTSAVRSLAVNSLIKLGEAVRTMLTDFESAIQKDSSKTPVPSGGVHPLTR  380

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++  +  Y + L  ++   P  +   + +        D E +SP++  L W++  
Sbjct  381  YVMNYIS-FLADYSEILGDIVFDWPLTISTPLPEAYFG--CYDAE-ESPISIRLAWLVLV  436

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+K +KD
Sbjct  437  LLCKLDGKAKLYKD  450



>ref|XP_002973424.1| hypothetical protein SELMODRAFT_98911 [Selaginella moellendorffii]
 gb|EFJ25798.1| hypothetical protein SELMODRAFT_98911 [Selaginella moellendorffii]
Length=633

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (47%), Gaps = 3/135 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+I  IF  +S   V+ +A   L +L +AA+     FE++V             +HPLT
Sbjct  340  LPEIHSIFSGESCLSVREEASGVLLRLGEAAKGTFAEFENAVQRDPPKTPVPRGALHPLT  399

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             +VM YL R +  Y   L  L   KP + +            +  EN SPLA   +WII 
Sbjct  400  RFVMNYL-RFLLVYVDTLKKLFGEKPAVPVYYHHHHQYSS--VPAENTSPLAVQFIWIIH  456

Query  363  SLHCNLKIKSKQHKD  407
             L  NL  KSK +KD
Sbjct  457  LLEANLDNKSKLYKD  471



>ref|XP_008448357.1| PREDICTED: exocyst complex component EXO70B1-like [Cucumis melo]
Length=626

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 65/134 (49%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+YIF + ++  VQ QA ++L +L +  R ++  FE ++   S        GVHPLT 
Sbjct  315  PEIDYIFSSTATSMVQSQAVSSLIKLGENIRTLISEFEMAIQKESSKTPIPRGGVHPLTR  374

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++  +  Y   L  ++   P      M ++        ++  SP+     W+I  
Sbjct  375  YVMNYIS-FLSDYSGILNDIVADWPLATKLSMPESYYG---TPKQEDSPITLRFAWLILV  430

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ + D
Sbjct  431  LLCKLDGKAEHYND  444



>ref|XP_002276070.1| PREDICTED: exocyst complex component EXO70B1-like [Vitis vinifera]
Length=622

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 3/136 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IF  +S+  V++Q  ++L +L++A R  L  FE  V   S        G+HPLT
Sbjct  311  LPEIELIFSFESTSAVRLQVSSSLQKLSEAVRATLSEFESVVQKDSSKTLVTGGGIHPLT  370

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDR-RFIDRENQSPLASHLVWII  359
               M Y++ + + Y   L+ ++   P  +     ++  D  + ID    S +A  L W+I
Sbjct  371  ESAMNYISSLAN-YSGVLSEILADWPLPVQSPFPESYFDSPKSIDNP-PSAMAMRLAWLI  428

Query  360  ASLHCNLKIKSKQHKD  407
              L C L  K++ +KD
Sbjct  429  LVLLCRLDCKAELYKD  444



>ref|XP_011000080.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
 ref|XP_011000081.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
 ref|XP_011000082.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
Length=644

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 69/142 (49%), Gaps = 10/142 (7%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI+ ++  ++  RV+I  R  L +L  + R     FE+++   + +      G+HPLT
Sbjct  345  LPDIDSLYADEAGARVRIDCREVLRRLGDSVRAAFLEFENAISTSTSTNPIAGGGIHPLT  404

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQ-------SPLAS  341
             YVM YL  +  GY + L  L+  K Q   + M  +       + EN        SPLA 
Sbjct  405  KYVMNYLNALT-GYRETLNFLL--KDQDGEDTMSLSPDINPSTEEENAREGACDGSPLAL  461

Query  342  HLVWIIASLHCNLKIKSKQHKD  407
            H   + + L CNL  K+K +KD
Sbjct  462  HFRSVASILECNLDDKAKLYKD  483



>gb|KHN05687.1| Exocyst complex component 7 [Glycine soja]
Length=614

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 7/137 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP IE IF  +S+  ++ QA T++ +L  A R +L + E ++   S        GVHPLT
Sbjct  312  LPQIESIFSFESTSNIRSQAVTSMVKLGDAVRTMLTDLETAIQKESSKKPVPGGGVHPLT  371

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWI  356
             YVM YLT  +  Y   L  +I   PQ  +         R  +  EN   S L+  + WI
Sbjct  372  RYVMNYLT-FLADYSGVLVDIIADLPQSPLPES----YYRSPMREENPPASELSERIAWI  426

Query  357  IASLHCNLKIKSKQHKD  407
            I  + C L  K++ +KD
Sbjct  427  ILVVLCKLDGKAELYKD  443



>ref|XP_003539758.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=614

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 7/137 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP IE IF  +S+  ++ QA T++ +L  A R +L + E ++   S        GVHPLT
Sbjct  312  LPQIESIFSFESTSNIRSQAVTSMVKLGDAVRTMLTDLETAIQKESSKKPVPGGGVHPLT  371

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWI  356
             YVM YLT  +  Y   L  +I   PQ  +         R  +  EN   S L+  + WI
Sbjct  372  RYVMNYLT-FLADYSGVLVDIIADLPQSPLPES----YYRSPMREENPPASELSERIAWI  426

Query  357  IASLHCNLKIKSKQHKD  407
            I  + C L  K++ +KD
Sbjct  427  ILVVLCKLDGKAELYKD  443



>ref|XP_004241253.1| PREDICTED: exocyst complex component EXO70A1-like [Solanum lycopersicum]
Length=623

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 6/138 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L +IE IFG  S   V+ QA T++++L  AAR +L  FE ++   S  V     G+HPLT
Sbjct  304  LSEIEVIFGFDSMVAVKSQALTSMAKLRDAARAMLAEFESAIKKDSSKVVA-GGGIHPLT  362

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP---LASHLVW  353
             YVM YL   +  Y  P++ +I     ++   + ++ L     D +  SP   ++  L W
Sbjct  363  RYVMNYLI-FLSDYSGPISDIIADWKAVVKSPLPESYLLSPIAD-DGDSPSCIVSVRLTW  420

Query  354  IIASLHCNLKIKSKQHKD  407
            +I  L C L  K+  + D
Sbjct  421  LILVLLCKLDGKAGFYGD  438



>ref|XP_007208031.1| hypothetical protein PRUPE_ppa002946mg [Prunus persica]
 gb|EMJ09230.1| hypothetical protein PRUPE_ppa002946mg [Prunus persica]
Length=619

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P++E IF  +S+  V+  A  +L +L +A R +L +FE ++   S        GVHPLT 
Sbjct  315  PEMESIFSFESTSAVRSLAVNSLIKLGEAVRTMLMDFESAIQKDSSKTPVPAGGVHPLTR  374

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++  +  Y + L  ++   P  +   + +        D E +SP++  L W++  
Sbjct  375  YVMNYIS-FLADYSEILGDIVVDWPLTISTPLPEAYFG--CYDAE-ESPISIRLAWLVLV  430

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+K +KD
Sbjct  431  LLCKLDGKAKLYKD  444



>ref|XP_004294620.1| PREDICTED: uncharacterized protein LOC101308554 [Fragaria vesca 
subsp. vesca]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 67/134 (50%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+     +L +L +A R +L++FE ++            GVHPLT 
Sbjct  319  PEIESIFSFESTSAVRSSGVNSLIKLGEAVRTMLEDFEAAIQKDHSKTAVPAGGVHPLTR  378

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y+T  +  Y + L  +    P  +   + +       +D   +SP++  + W++  
Sbjct  379  YVMNYIT-FLTDYTEILADIFADYPLTLQTPLPEAYFGCYDVD---ESPISVRIAWLVLV  434

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  435  LLCKLDGKAELYKD  448



>gb|KEH42330.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=608

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 69/138 (50%), Gaps = 4/138 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP++E IF   S+  V+ QA  +  +L ++ R+I   FE ++L  S        G+H LT
Sbjct  311  LPEVESIFSFNSTSGVKSQAYNSQQRLVESVRNIFSEFESAILKDSSKSLANFGGIHSLT  370

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVL---DRRFIDRENQSPLASHLVW  353
            T  M+YLT++   Y   L+ +    P  +   + ++ L   +      E ++  +  + W
Sbjct  371  TQTMQYLTKLT-DYSNVLSEIFFDIPPSLNSPLPESYLYSPESSNYSTEIETEFSIRIAW  429

Query  354  IIASLHCNLKIKSKQHKD  407
            +I  L C + +KSKQ K+
Sbjct  430  LILVLLCKIDVKSKQCKN  447



>ref|XP_009600986.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=646

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/135 (30%), Positives = 67/135 (50%), Gaps = 1/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IF  +S   V++QA +TL +L  + +  L +FE S+  +S        G+HPLT
Sbjct  336  LPEIESIFSYESISAVKVQALSTLHKLKASIQTTLSDFESSIQKNSLRTPIPGGGIHPLT  395

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
              V++Y+  + + Y   L+ +I            ++  D    +    S +++ L WII 
Sbjct  396  NSVLDYVCSLAN-YSGVLSDIICDSAPAAQSPFPESYFDSPSANETPTSAVSARLAWIIL  454

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K+K + D
Sbjct  455  VLLCKLDSKAKLYND  469



>ref|XP_009764850.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=646

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 67/135 (50%), Gaps = 1/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IF  +S   V++QA +TL +L  + +  L +FE S+  +S        G+HPLT
Sbjct  336  LPEIESIFSYESISAVKVQALSTLHKLKASIQTTLSDFESSIQKNSLRKPIPGGGIHPLT  395

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
              V++Y+  + + Y   L+ +I            ++  D    +    S +++ L WII 
Sbjct  396  NSVLDYVCSLAN-YSGILSDIICDSAPAAQSPFPESYFDSPSANETPTSAVSARLAWIIL  454

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K+K + D
Sbjct  455  VLLCKLDSKAKLYND  469



>ref|XP_008385184.1| PREDICTED: exocyst complex component EXO70B1-like [Malus domestica]
Length=632

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+  A  +L +L +A R +L+ FE ++   +        GVHPLT 
Sbjct  321  PEIESIFSFESTSAVRSLAVNSLVKLGEAVRSMLEEFESAIQKETSKTPVPAGGVHPLTR  380

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM YLT  +  Y + LT ++   P  +   + +        D E +S L+  + W++  
Sbjct  381  YVMNYLT-FLTDYTEVLTDIVADWPLAISTPLPEAYFG--CYDAE-ESQLSIRVAWLVLV  436

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+  +KD
Sbjct  437  LLCKLDGKAALYKD  450



>ref|XP_011020377.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=622

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 69/134 (51%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P++E IF ++S+  +++Q  ++L  L ++ R IL +FE ++   S     V  G+HPLT 
Sbjct  324  PEVELIFNSESTSDIKLQVASSLHGLGESIRAILSDFESTIQKDSSKNLIVGGGIHPLTQ  383

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             V  Y++ +   Y + L+ +++  P      + +   +    D      ++ HL W+I  
Sbjct  384  KVTSYISSLA-DYSRILSDIVSDSPPPRNTALPEAYFESPTSDSGLTPAVSVHLAWLIFV  442

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  443  LLCKLDRKAEVYKD  456



>ref|XP_004505905.1| PREDICTED: uncharacterized protein LOC101512865 [Cicer arietinum]
Length=626

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 68/134 (51%), Gaps = 7/134 (5%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            I+ IF  +S+  V++QA T+L +L +A R +L +FE ++   S        GVHPLT YV
Sbjct  325  IQSIFSFESTANVRLQAVTSLVKLKEAVRTMLTDFETAIQKDSSKKQVPGGGVHPLTRYV  384

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPL--ASHLVWIIAS  365
            M Y+T  +  Y   LT ++   PQ  +         R  +  ENQ  L  +  + W+I  
Sbjct  385  MNYIT-FLADYSGVLTDIVADLPQSPLPES----YYRSPVRGENQKSLEISEKIAWLILV  439

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++  KD
Sbjct  440  LLCKLDGKAELCKD  453



>gb|ABK25032.1| unknown [Picea sitchensis]
Length=647

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 69/139 (50%), Gaps = 25/139 (18%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP+IE IFG K+S  ++  A +   +LAQ A+D   +FE +V   +   + ++  VHPLT
Sbjct  353  LPEIEVIFGGKASAEMREAALSLTKRLAQTAQDTFGDFEEAVEKDATKTSILDGTVHPLT  412

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP----LASHLV  350
            +YV+ Y+ + +  Y   L  L                    F +  N  P    LA+  +
Sbjct  413  SYVINYV-KFLFDYQSTLKQL--------------------FQENGNGGPSNSQLAAATM  451

Query  351  WIIASLHCNLKIKSKQHKD  407
             I+++L  NL  KSKQ+KD
Sbjct  452  RIMSALQTNLDGKSKQYKD  470



>ref|XP_011027091.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=634

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 67/134 (50%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PD+E IF ++S+ + + QA ++L  L ++ R IL +FE ++   S     V  G+HPLT 
Sbjct  335  PDLELIFDSESTSKTKQQAVSSLHGLGESIRAILSDFESTIQKDSSKTLIVGGGIHPLTQ  394

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             V  Y++ +   Y + L+ ++            +   +    D  +   ++ HL W+I  
Sbjct  395  KVTSYISSLAD-YSRILSDIVADSSPPRNTAFPEAYFESPNYDASSTPAVSVHLAWLILV  453

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  454  LLCKLDRKAEGYKD  467



>emb|CAN62485.1| hypothetical protein VITISV_010813 [Vitis vinifera]
Length=657

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 13/141 (9%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E +F  +S + V  +AR  L+ L +AA+     FE++V + + S   ++ G +HPL
Sbjct  355  LPDLEALFSDESGQFVWSEARGVLAGLGEAAKGTFAEFENAVRSET-SRRPIQGGEIHPL  413

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQI----MIERMGDTVLDRRFIDRENQSPLASHL  347
            T YVM Y+ +++  Y + L TL+ S+       +  R GD       +   N  P+   L
Sbjct  414  TRYVMNYV-KLVVDYSETLNTLLESEDDDESAHLQNRDGDN------LQLGNTPPIGRRL  466

Query  348  VWIIASLHCNLKIKSKQHKDG  410
            + +++ L  NL  KSK ++D 
Sbjct  467  LLLMSCLESNLTEKSKLYEDN  487



>ref|XP_010250741.1| PREDICTED: exocyst complex component EXO70B1 [Nelumbo nucifera]
Length=654

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +F  +S   V  +AR  L+ L +AA+     FE++V + +   T     VHPLT
Sbjct  350  LPDLQSLFSDESCNFVYGEARGILAGLGEAAKGTFAEFENAVQSETSRKTIQGGEVHPLT  409

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ R++  Y   L  L+           GD   +   +   + SP+ + L  +I+
Sbjct  410  RYVMNYI-RLLVDYSDSLNFLLEGSTDDTDRFDGD---NDEALKLGSTSPIGNRLRSLIS  465

Query  363  SLHCNLKIKSKQHKD  407
            SL  NL+ KSK ++D
Sbjct  466  SLESNLEEKSKYYED  480



>ref|XP_002279988.1| PREDICTED: exocyst complex component EXO70B1 [Vitis vinifera]
Length=657

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 13/141 (9%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E +F  +S + V  +AR  L+ L +AA+     FE++V + + S   ++ G +HPL
Sbjct  355  LPDLEALFSDESGQFVWSEARGVLAGLGEAAKGTFAEFENAVRSET-SRRPIQGGEIHPL  413

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQI----MIERMGDTVLDRRFIDRENQSPLASHL  347
            T YVM Y+ +++  Y + L TL+ S+       +  R GD       +   N  P+   L
Sbjct  414  TRYVMNYV-KLVVDYSETLNTLLESEDDDESAHLQNRDGDN------LQLGNTPPIGRRL  466

Query  348  VWIIASLHCNLKIKSKQHKDG  410
            + +++ L  NL  KSK ++D 
Sbjct  467  LLLMSCLESNLTEKSKLYEDN  487



>ref|XP_007016546.1| Exocyst subunit exo70 family protein H7, putative [Theobroma 
cacao]
 gb|EOY34165.1| Exocyst subunit exo70 family protein H7, putative [Theobroma 
cacao]
Length=623

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 68/134 (51%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  + +  V+  +  +L +L +A R +L +FE ++   S   T    G+HPLT 
Sbjct  318  PEIESIFSFELTSTVRSTSVNSLIRLGEAVRTMLTDFEMAIQKDSSKSTLAGGGIHPLTR  377

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++ ++  Y   L+ ++   P  +   + ++       +    SP++  L W+I  
Sbjct  378  YVMNYISFLVD-YSGSLSDILADWPLTIPSPLPESYFGSPDNEESISSPISVRLAWLILV  436

Query  366  LHCNLKIKSKQHKD  407
            + C L  K+  +KD
Sbjct  437  MLCKLDGKAAMYKD  450



>ref|XP_007132126.1| hypothetical protein PHAVU_011G068800g [Phaseolus vulgaris]
 gb|ESW04120.1| hypothetical protein PHAVU_011G068800g [Phaseolus vulgaris]
Length=616

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L  IE IF ++S+  ++ QA T+L +L +A R +L +FE ++   S   T    GVHPLT
Sbjct  311  LSQIESIFSSESTSVIRSQAITSLVRLGEAVRAMLVDFESAIQKDSSKTTIPGGGVHPLT  370

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWI  356
             YVM YLT  +  Y   L  +I   PQ     M ++   R  +  EN   S L+  + W+
Sbjct  371  RYVMNYLT-FLADYSGVLIDIIPDLPQ---SPMPESYY-RSPMRGENTPASELSEKIAWL  425

Query  357  IASLHCNLKIKSKQHKD  407
            I  + C L  K++ +K+
Sbjct  426  ILVVLCKLDGKAEFYKN  442



>ref|XP_010486524.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=636

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 61/132 (46%), Gaps = 1/132 (1%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            IE IF   S   V+ QA  +L  L ++ R +L +FE  +   S  V     GVHPLT  V
Sbjct  319  IESIFSFDSISVVRAQALKSLISLGESVRSLLADFESGIQKDSSKVVVPGGGVHPLTISV  378

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASLH  371
            M++LT ++  Y   L  ++   P      + +T  +    D    S LA    W+I  L 
Sbjct  379  MDHLT-LLADYSNVLVDILAGSPPPDRSLLPETYFNVSETDDSPSSELALRFAWLILVLL  437

Query  372  CNLKIKSKQHKD  407
            C +  KS  +KD
Sbjct  438  CKIDHKSNHYKD  449



>gb|KDP35571.1| hypothetical protein JCGZ_09009 [Jatropha curcas]
Length=638

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 64/133 (48%), Gaps = 1/133 (1%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF   S   V+ QA  +L +L+++   +L +FE S+   S        G+HPLT Y
Sbjct  329  EIESIFSFDSLSIVRSQALASLVRLSESVLVMLSDFESSIQKDSSKTPVQGGGLHPLTIY  388

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
             M YL+ ++  Y   LT +I+  P      +  +  D    D     P++    W+I  L
Sbjct  389  SMNYLS-LLGDYSYVLTDIISDWPPPAKSSLPKSYFDSPDSDDSPAPPISVRFAWLILVL  447

Query  369  HCNLKIKSKQHKD  407
             C L  K+K +KD
Sbjct  448  LCKLDGKAKHYKD  460



>ref|XP_009630690.1| PREDICTED: exocyst complex component EXO70B1-like [Nicotiana 
tomentosiformis]
Length=657

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 5/139 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ ++   +   V+ + +  L  LA  AR     FE++V +   +      G+HPLT
Sbjct  354  IPDIDALYSDDAGLCVRTECQDILGSLADCARTTFLEFENAVASSISTNPFPGGGIHPLT  413

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQ----SPLASHLV  350
             YVM Y+ + +  Y + L  L+    Q  +  +   +   R  D  N+    SPLA H  
Sbjct  414  RYVMNYM-KTLTDYSKILNKLLKDNEQEDLVAISPEMTPDREEDNSNRICYISPLAQHFR  472

Query  351  WIIASLHCNLKIKSKQHKD  407
               + L CNL  KSK +KD
Sbjct  473  SFTSILECNLDDKSKLYKD  491



>ref|XP_007163944.1| hypothetical protein PHAVU_L003900g [Phaseolus vulgaris]
 gb|ESW35938.1| hypothetical protein PHAVU_L003900g [Phaseolus vulgaris]
Length=593

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 70/135 (52%), Gaps = 5/135 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P IE IF ++S+  +++Q   + ++L +A R +L NFE ++   S  +     G+HPLT 
Sbjct  307  PQIESIFSSESTFSIRLQVCASQARLGEAIRTMLINFECAIQKESSKIPVPGGGIHPLTR  366

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP-LASHLVWIIA  362
            YVM Y+   +  Y   L  ++   PQ     + ++       + +N+S  LA  + W+I 
Sbjct  367  YVMNYIA-FLGDYNDALPEIVADWPQ---NPLPESYYRSSHGEGKNRSSELAERIAWLIL  422

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +K+
Sbjct  423  VLLCKLDAKAELYKE  437



>ref|XP_007209880.1| hypothetical protein PRUPE_ppa003933mg [Prunus persica]
 gb|EMJ11079.1| hypothetical protein PRUPE_ppa003933mg [Prunus persica]
Length=539

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 72/136 (53%), Gaps = 7/136 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +    + E V I+AR  L +L  AA+     FE++V + +     +   +HPLT
Sbjct  241  LPDLQQMV---TDEYVVIEARGVLDELGDAAKGTFAEFENAVQSEASKKPMLSGEIHPLT  297

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ R++  Y   L +L+ +  + +    G   L    +  E+ SP+   L+ +I+
Sbjct  298  RYVMNYV-RLLVDYSHTLNSLLDTGEEELQRLQG---LPNDDLGIESMSPIGHRLLLLIS  353

Query  363  SLHCNLKIKSKQHKDG  410
            +L  NL+ KS+ + DG
Sbjct  354  NLESNLEEKSRVYDDG  369



>gb|EPS72115.1| hypothetical protein M569_02643, partial [Genlisea aurea]
Length=617

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 66/139 (47%), Gaps = 12/139 (9%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE  F ++S++ ++ Q   +L +L    R  + NFE S+  HS   T    G+HPLT 
Sbjct  320  PEIEITFSSESTKTIRSQTIDSLIKLRGFIRAAVDNFESSIQKHSSKATVPGAGIHPLTI  379

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDR----ENQSPLASHLVW  353
              M+YL  ++  Y   L       P I+I+        + F +      N SPL + + W
Sbjct  380  DSMDYLINLIE-YSNIL-------PHILIDSPAQAQTKKSFPESYSGAANDSPLTAKITW  431

Query  354  IIASLHCNLKIKSKQHKDG  410
            +  +L C L  K + ++D 
Sbjct  432  LTFNLLCKLDDKGRYYRDA  450



>ref|XP_002298379.2| hypothetical protein POPTR_0001s24130g [Populus trichocarpa]
 gb|EEE83184.2| hypothetical protein POPTR_0001s24130g [Populus trichocarpa]
Length=581

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 2/136 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+ QA  +L +L +A R IL  FE ++            G+HPLT 
Sbjct  281  PEIESIFDLESTSTVKQQAINSLIKLGEAVRAILIEFESAISKDHSKAAVPGGGIHPLTR  340

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN-QSPLASHLVWIIA  362
            YVM Y+T  +  Y   L  ++   P  ++  + +      F D     S +++ L W+I 
Sbjct  341  YVMNYVT-FLADYSGILADILADWPLPVLSSLPEAYFGSPFSDDGTINSAISTRLAWLIL  399

Query  363  SLHCNLKIKSKQHKDG  410
             + C L   +  +KD 
Sbjct  400  VMLCKLDGGAAIYKDA  415



>ref|XP_008239462.1| PREDICTED: exocyst complex component EXO70B1 [Prunus mume]
Length=649

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 72/136 (53%), Gaps = 7/136 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +    + E V I+AR  L +L  AA+     FE++V + +     +   +HPLT
Sbjct  351  LPDLQQMV---TDEYVVIEARGVLDELGDAAKGTFAEFENAVQSEASKKPMLSGEIHPLT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ R++  Y   L +L+ +  + +    G   L    +  E+ SP+   L+ +I+
Sbjct  408  RYVMNYV-RLLVDYSHTLNSLLDTGEEELQRLQG---LPNDDLGIESMSPIGHRLLLLIS  463

Query  363  SLHCNLKIKSKQHKDG  410
            +L  NL+ KS+ + DG
Sbjct  464  NLESNLEEKSRVYDDG  479



>ref|XP_010473847.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=636

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 61/132 (46%), Gaps = 1/132 (1%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            IE IF   S   V+ QA  +L  L ++ R +L +FE  +   S  V     GVHPLT  V
Sbjct  319  IESIFSFDSISVVRSQALKSLISLGESVRSLLADFESGIQKDSSKVVVPGGGVHPLTISV  378

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASLH  371
            M++LT ++  Y   L  ++   P      + +T  +    D    S LA    W+I  L 
Sbjct  379  MDHLT-LLADYSNVLVDILAGSPPPDRSLLPETYFNVSETDDSPSSELALRFAWLILVLL  437

Query  372  CNLKIKSKQHKD  407
            C +  KS  +KD
Sbjct  438  CKIDHKSNHYKD  449



>ref|XP_009771930.1| PREDICTED: exocyst complex component EXO70B1-like [Nicotiana 
sylvestris]
Length=667

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 65/139 (47%), Gaps = 5/139 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ ++   +   V+ + +  L  LA  AR     FE++V +   +      G+HPLT
Sbjct  364  IPDIDAMYSDDAGLCVRTKCQDILESLADCARTTFLEFENAVASSISTNPFPGGGIHPLT  423

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQS----PLASHLV  350
             YVM Y+ + +  Y + L  L+    Q  +  +   +   R  D  N S    PLA H  
Sbjct  424  RYVMNYM-KTLTDYSKILNELLKDNEQEDLVAISPEMTPDREEDNSNTSCYISPLAQHFR  482

Query  351  WIIASLHCNLKIKSKQHKD  407
               + L CNL  KSK +KD
Sbjct  483  TFTSMLECNLDDKSKLYKD  501



>ref|XP_004148221.1| PREDICTED: uncharacterized protein LOC101212978 [Cucumis sativus]
 ref|XP_004166482.1| PREDICTED: uncharacterized LOC101212978 [Cucumis sativus]
 gb|KGN47351.1| hypothetical protein Csa_6G302190 [Cucumis sativus]
Length=631

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 64/134 (48%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+YIF + ++  +Q QA ++L +L +  R +L  FE ++   S        GVHPLT 
Sbjct  320  PEIDYIFSSTATSMIQSQAVSSLIKLGENIRTLLSEFEMAIQKESSKTPVPRGGVHPLTR  379

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y++  +  Y   L  ++          M ++        ++  SP+     W+I  
Sbjct  380  YVMNYIS-FLSDYSGILNDIVADWSLATKLSMPESYYG---TPKQEDSPITLRFAWLILV  435

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ + D
Sbjct  436  LLCKLDGKAEHYND  449



>ref|XP_011090083.1| PREDICTED: exocyst complex component EXO70A1 [Sesamum indicum]
Length=634

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/138 (30%), Positives = 68/138 (49%), Gaps = 5/138 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE +F +K    V+ QA    +++ +A R IL  FE ++   S S + V  GVHPLT 
Sbjct  326  PEIESLFASKFFTSVRAQATAAQAKMGEAVRTILGQFEAAIQKDS-SKSPVAGGVHPLTR  384

Query  186  YVMEYLTRMMHGYGQPLTTLITS---KPQIMIERMGDTVLDRRFIDRENQSPLASHLVWI  356
            YVM YL   +  Y   ++ ++      PQ  +     + L     +  + +P++  L W+
Sbjct  385  YVMNYLV-FLSDYSVHISNIVKDGPVNPQTPLPEPQFSSLTAVSEEDPSATPISRRLAWL  443

Query  357  IASLHCNLKIKSKQHKDG  410
            I  L  NL  K+ Q+ + 
Sbjct  444  ILVLFSNLDSKAAQYNNA  461



>ref|XP_004305227.1| PREDICTED: exocyst complex component 7-like [Fragaria vesca subsp. 
vesca]
Length=633

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 3/134 (2%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IF   S+  V+ QA  +L ++ +  R +L +FE S+   S        GVHPLT 
Sbjct  335  PEIDSIFSFDSTATVRTQALNSLIKIGETVRSMLSDFEASIQKESSKTPVAGGGVHPLTQ  394

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             VM YL+ ++  Y   L  +    P      + +   D    +  +  P+   + WI+  
Sbjct  395  RVMNYLS-ILTDYSNVLADIFVDCPPPAKGLLPE--FDSPNSEESSAPPICHIMAWIVLI  451

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+K +KD
Sbjct  452  LICKLDGKAKNYKD  465



>ref|XP_004240606.1| PREDICTED: exocyst complex component EXO70A1-like [Solanum lycopersicum]
Length=598

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            ++E IF   S   V+ QA  +LS+L  A R +L  FE +V   S  V  V  G+HPLT Y
Sbjct  288  ELESIFTFDSMAVVKAQAMASLSKLGDAIRAMLSEFEIAVQKDSSKVV-VGGGIHPLTRY  346

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTV-LDRRFIDREN-QSPLASHLVWIIA  362
            VM YL   +  Y   ++ +I     + I+ + ++  L     D ++  SP+   L W++ 
Sbjct  347  VMNYLV-FLGDYSGAISDIIVDYSPMSIQMLSESCYLSPTSGDGDSPSSPIVVRLTWLVL  405

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +KD
Sbjct  406  VLLCKLDGKAQLYKD  420



>ref|XP_011000313.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
Length=620

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 6/138 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSV-LAHS-WSVTGVEEGVHPL  179
            P+IE IF  +S+  V+ QA  +L +L +A R IL  FE ++   HS  +V G   GVHPL
Sbjct  306  PEIESIFDLESTSAVKQQAINSLIKLGEAVRAILTEFESAISKVHSKAAVPG--GGVHPL  363

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN-QSPLASHLVWI  356
            T YVM Y+T  +  Y   L  ++   P  ++  + +      F D     S +++ L W+
Sbjct  364  TRYVMNYVT-FLTDYSGILADILADWPLPVLSSLPEAYFGSPFSDDGPVNSAISTRLAWL  422

Query  357  IASLHCNLKIKSKQHKDG  410
            I  + C L   +  +KD 
Sbjct  423  ILVMLCKLDGGAAIYKDA  440



>ref|XP_011014426.1| PREDICTED: exocyst complex component EXO70B1-like [Populus euphratica]
Length=620

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 6/138 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSV-LAHS-WSVTGVEEGVHPL  179
            P+IE IF  +S+  V+ QA  +L +L +A R IL  FE ++   HS  +V G   GVHPL
Sbjct  306  PEIESIFDLESTSAVKQQAINSLIKLGEAVRAILTEFESAISKVHSKAAVPG--GGVHPL  363

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN-QSPLASHLVWI  356
            T YVM Y+T  +  Y   L  ++   P  ++  + +      F D     S +++ L W+
Sbjct  364  TRYVMNYVT-FLTDYSGILADILADWPLPVLSSLPEAYFGSPFSDDGPINSAISTRLAWL  422

Query  357  IASLHCNLKIKSKQHKDG  410
            I  + C L   +  +KD 
Sbjct  423  ILVMLCKLDGGAAIYKDA  440



>gb|KGN64408.1| hypothetical protein Csa_1G050470 [Cucumis sativus]
Length=665

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +3

Query  12   IEYIF----GAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            +EY+F       + E V  +AR  LS+L +AA+     FE++V + +   T +   +HPL
Sbjct  361  LEYVFPELQAMVTDEFVIEEARGVLSRLGEAAKGTFVEFENAVRSETSKKTMLNAEIHPL  420

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM YLT ++  Y + L  L+    + +   +G    D   ++ E  SPL   L  +I
Sbjct  421  TRYVMNYLT-LVVVYSKTLDALLEGDDEDL-HHLGVDGADN--LELETMSPLGRRLFSLI  476

Query  360  ASLHCNLKIKSKQHKD  407
            A+L  NL+ KSK + D
Sbjct  477  ANLETNLERKSKLYGD  492



>ref|XP_004166665.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus]
Length=669

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +3

Query  12   IEYIF----GAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            +EY+F       + E V  +AR  LS+L +AA+     FE++V + +   T +   +HPL
Sbjct  365  LEYVFPELQAMVTDEFVIEEARGVLSRLGEAAKGTFVEFENAVRSETSKKTMLNAEIHPL  424

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM YLT ++  Y + L  L+    + +   +G    D   ++ E  SPL   L  +I
Sbjct  425  TRYVMNYLT-LVVVYSKTLDALLEGDDEDL-HHLGVDGADN--LELETMSPLGRRLFSLI  480

Query  360  ASLHCNLKIKSKQHKD  407
            A+L  NL+ KSK + D
Sbjct  481  ANLETNLERKSKLYGD  496



>gb|EYU33194.1| hypothetical protein MIMGU_mgv1a002824mg [Erythranthe guttata]
Length=634

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 6/137 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S   V++QA + + +L  +A+ I+  F  SV  +S        GVHPLT 
Sbjct  310  PEIESIFSYESLSPVKLQALSAMHKLGDSAQTIISEFVLSVQKNSSKTVVSGGGVHPLTC  369

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP---LASHLVWI  356
             VM Y+  +    G  L+ ++ S  +   ER   +     + D    +P   ++S L WI
Sbjct  370  SVMSYVALLAENSG-VLSDILNSDEE--GERAAQSPFPESYFDGSPTAPATGVSSRLAWI  426

Query  357  IASLHCNLKIKSKQHKD  407
            +  L C L  K++ +KD
Sbjct  427  VLVLLCKLDSKAELYKD  443



>ref|XP_009354556.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=632

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 66/134 (49%), Gaps = 4/134 (3%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  V+  A  +L +L +A R +L+ FE ++   +        G HPLT 
Sbjct  321  PEIESIFSFESTSAVRSLAVNSLVKLGEAVRSMLEKFESAIQKETSKTPVPAGGAHPLTR  380

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM Y+T  +  Y + LT ++   P  +   + +        D E +S L+    W++  
Sbjct  381  YVMNYIT-FLSDYTEVLTDIVADWPLAISTPLPEAYFG--CYDAE-ESQLSIRFAWLVLV  436

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+  +KD
Sbjct  437  LLCKLDGKAALYKD  450



>ref|XP_004152595.1| PREDICTED: exocyst complex component 7-like, partial [Cucumis 
sativus]
Length=655

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +3

Query  12   IEYIF----GAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            +EY+F       + E V  +AR  LS+L +AA+     FE++V + +   T +   +HPL
Sbjct  351  LEYVFPELQAMVTDEFVIEEARGVLSRLGEAAKGTFVEFENAVRSETSKKTMLNAEIHPL  410

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM YLT ++  Y + L  L+    + +   +G    D   ++ E  SPL   L  +I
Sbjct  411  TRYVMNYLT-LVVVYSKTLDALLEGDDEDL-HHLGVDGADN--LELETMSPLGRRLFSLI  466

Query  360  ASLHCNLKIKSKQHKD  407
            A+L  NL+ KSK + D
Sbjct  467  ANLETNLERKSKLYGD  482



>ref|XP_010096691.1| Exocyst complex component 7 [Morus notabilis]
 gb|EXB65359.1| Exocyst complex component 7 [Morus notabilis]
Length=648

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 71/137 (52%), Gaps = 3/137 (2%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDIE IF ++S+  ++ QA ++  +L  +   ILQ FE  +  +S        G+HP+T
Sbjct  333  LPDIESIFSSESTSAIRSQALSSSLKLRDSIPSILQEFESKIQKNSSKTLIFGGGIHPVT  392

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLAS--HLVWI  356
              V++Y++ +    G  L+ ++   P      + ++  +      ++ +P A+  HL W+
Sbjct  393  QSVVDYISSLADHSGV-LSGILAHYPPPGNSPLNESFFESLTTSSDSPAPDAASVHLAWL  451

Query  357  IASLHCNLKIKSKQHKD  407
            I  L C L  K++ +KD
Sbjct  452  ILVLLCKLDCKAELYKD  468



>gb|KFK32275.1| hypothetical protein AALP_AA6G221200 [Arabis alpina]
Length=399

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 69/139 (50%), Gaps = 7/139 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +P IE IF   S+  V++QA  +L+ L ++   ++  FE S+   S   +    GVH LT
Sbjct  89   VPKIENIFSYDSTSAVRLQASDSLTNLGESINSMVAEFESSITKESSKSSIPGGGVHQLT  148

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIER-MGDTVLDRRFIDREN---QSPLASHLV  350
             YVM ++   +  Y +PL  ++T     + E  +G+   D+  + +      SP+ +   
Sbjct  149  RYVMNFIV-FLADYNEPLANILTESTLPLPEDYLGNNEDDK--VGKPGSSSSSPVTTRFA  205

Query  351  WIIASLHCNLKIKSKQHKD  407
            W+I  L C +  KS+ + D
Sbjct  206  WLILVLLCKIDTKSRIYND  224



>ref|XP_010558310.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=632

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 62/133 (47%), Gaps = 1/133 (1%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF  +S   V+ QA  +L +L  + R +L++FE  +   S        GVHPLT  
Sbjct  309  EIESIFSFESISMVRTQALNSLIRLGDSIRSLLEDFESGIQKDSSKTVVSGGGVHPLTIS  368

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
             M YL+ ++  Y   L  ++   P      + ++  D    D    S L   + W+I  L
Sbjct  369  TMNYLS-LLSDYNTVLADILIGSPPPEKSLLPESYFDAAESDDSPASQLTVRIAWLILVL  427

Query  369  HCNLKIKSKQHKD  407
             C +  K+K +KD
Sbjct  428  LCKVDHKAKHYKD  440



>ref|XP_010464598.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=632

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 1/132 (1%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            IE IF   S   V+ QA  +L  L ++ R +L +FE  +   S  V     GVHPLT  V
Sbjct  319  IESIFSFDSISVVRSQALKSLISLGESVRSLLADFESGIQKDSSKVVVPGGGVHPLTISV  378

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASLH  371
            M++L+ ++  Y   L  ++   P      + +T  +    D    S LA    W+I  L 
Sbjct  379  MDHLS-LLADYSNVLVDILAGSPPPDRSLLPETYFNVSETDDSPSSELALRFAWLILVLL  437

Query  372  CNLKIKSKQHKD  407
            C +  KS  +KD
Sbjct  438  CKIDHKSNHYKD  449



>ref|XP_008446222.1| PREDICTED: exocyst complex component EXO70B1, partial [Cucumis 
melo]
Length=645

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +3

Query  12   IEYIF----GAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPL  179
            +EY+F       + E V  +AR  LS+L +AA+     FE++V + +   T +   +HPL
Sbjct  341  LEYVFPELQAMVTDEFVIEEARGVLSRLGEAAKGTFVEFENAVRSETSKKTMLNAEIHPL  400

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T YVM YLT ++  Y + L  L+    + +   +G  V     ++ E  SPL   L  +I
Sbjct  401  TRYVMNYLT-LVVVYSKTLDALLEGDDEDL-HHLG--VDGAENLELETMSPLGRRLFSLI  456

Query  360  ASLHCNLKIKSKQHKD  407
            A+L  NL+ KSK + D
Sbjct  457  ATLETNLERKSKLYGD  472



>ref|XP_010032272.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=617

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 70/134 (52%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE IF  +S+  V +QA ++L  L +   +I+  FE ++  +S   T    GVHPLT 
Sbjct  310  PDIESIFSYESTSGVNLQALSSLVSLGKTIHNIIAEFESTIQNNSSRTTVPGGGVHPLTQ  369

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             VM +++ ++  Y + L+ +++  P      M ++  +    +    + +  HLV +I  
Sbjct  370  SVMAFISSLVD-YSEILSEVLSDHPLPNNFTMPESNFESPGQEDGPTTAVPVHLVRLILV  428

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  429  LLCKLDTKAELYKD  442



>ref|XP_009598246.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=634

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (50%), Gaps = 4/135 (3%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF   S   V+ QA T+L +L +AAR +L  FE ++   S S      G+HPLT Y
Sbjct  319  EIELIFSFNSLTAVKSQAVTSLVKLGEAARFMLSEFESAIQKDS-SKAVAGGGIHPLTRY  377

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWIIA  362
            VM YL   +  Y    + +I   P  +   + ++       D ++   S ++  L W++ 
Sbjct  378  VMNYLV-FLSDYSGAFSEIIVDWPLSIQSPLPESYFLSPTPDDDDSPSSAVSVRLAWLVL  436

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +KD
Sbjct  437  VLLCKLDGKAQHYKD  451



>ref|XP_001783772.1| predicted protein [Physcomitrella patens]
 gb|EDQ51424.1| predicted protein [Physcomitrella patens]
Length=659

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 71/145 (49%), Gaps = 19/145 (13%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +P++E IF  KS   V+ +A   L +L +A R  +  FE+++  HS  V      VHPLT
Sbjct  348  IPELEVIFSGKSGLSVRSEASGILFRLGEAIRGTISEFENAIQRHSSKVPVTGGAVHPLT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGD-----TVL-----DRRFIDRENQSP  332
             YVM Y+ ++   Y   L        Q+ +ER        +VL     D RF  R+  S 
Sbjct  408  RYVMNYI-KLACEYSDTL-------KQVYVERDNSEASERSVLSPDKRDDRF-SRDECST  458

Query  333  LASHLVWIIASLHCNLKIKSKQHKD  407
            LAS +  +  +L  NL  K+K +KD
Sbjct  459  LASLIGRLARALQNNLDGKAKMYKD  483



>ref|XP_010501071.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=595

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 64/136 (47%), Gaps = 36/136 (26%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +QA    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  322  LPDMEEIFDSSSSEAILVQATEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  380

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T                       + P + I ++            E  SPLA H++W +
Sbjct  381  TR----------------------NNPDMDISQL------------EGISPLALHMIWTM  406

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KS  +KD
Sbjct  407  VMLQFNLEEKSLHYKD  422



>emb|CDP10608.1| unnamed protein product [Coffea canephora]
Length=583

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 18/134 (13%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IFG+K    V+  A     +LAQ A++   +FE +V   +   T ++  VHPLT+
Sbjct  293  PEIDIIFGSKYCGEVREAAAVLSKRLAQTAQETFVDFEEAVEKDATKTTVLDGTVHPLTS  352

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YV+ Y+ + +  Y   L  L                  + F D + +  LAS    I+ +
Sbjct  353  YVINYV-KFLFDYQSTLKLLF-----------------QEFGDDDVEEKLASLTTRIMQA  394

Query  366  LHCNLKIKSKQHKD  407
            L  NL  KSKQ+KD
Sbjct  395  LQSNLDGKSKQYKD  408



>ref|XP_006378741.1| hypothetical protein POPTR_0010s21920g [Populus trichocarpa]
 gb|ERP56538.1| hypothetical protein POPTR_0010s21920g [Populus trichocarpa]
Length=441

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 63/129 (49%), Gaps = 1/129 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PD+E IF ++S+ +++ QA ++L  L ++ R IL  FE ++   S     V  G+HPLT 
Sbjct  141  PDVELIFDSESTSKIKQQAVSSLHGLGESIRAILSEFESTIQKDSSKTLIVGGGIHPLTQ  200

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             V  Y++ +   Y + L+ ++            +   +    D  +   ++ HL W+I  
Sbjct  201  KVTSYISSLAD-YSRILSDIVADSSPPRNTAFPEAYFESPNYDASSTPAVSVHLAWLILV  259

Query  366  LHCNLKIKS  392
            L C L  K+
Sbjct  260  LLCKLDRKA  268



>ref|XP_002312061.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEE89428.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=622

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 68/134 (51%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P++E IF ++S+  +++Q  ++L  L ++ R +L +F  ++   S     V  G+HPLT 
Sbjct  324  PEVELIFNSESTSDIKLQVVSSLHGLGESIRALLSDFVSTIQNDSSKTLIVGGGIHPLTQ  383

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             V  Y++ +   Y + L+ +++  P      + +   +    D      ++ HL W+I  
Sbjct  384  KVTSYISSLA-DYSRILSDIVSDSPPPRNTALPEAYFESPTSDSGLTPAVSVHLAWLIFV  442

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  443  LLCKLDRKAEVYKD  456



>ref|XP_010443748.1| PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa]
Length=638

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 72/142 (51%), Gaps = 15/142 (11%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF  +S   V+ Q   +L++L  AAR ++ +FE ++   +   T V  GVHPLT Y
Sbjct  314  EIESIFYFESGAPVRSQVINSLARLGDAARSMMNDFESAIQKETSKTTVVGGGVHPLTRY  373

Query  189  VMEYLTRMMHGYGQPLTTLITS-KPQIMIERMGDTVLDRRFIDRENQ--------SPLAS  341
            VM YL+  +  Y + +  +  + +P + +      + D  +I   ++        SP++ 
Sbjct  374  VMNYLS-FLADYDESIAAIFENWQPTVAV-----PLPDSLYISGGDEAHPADLYSSPVSV  427

Query  342  HLVWIIASLHCNLKIKSKQHKD  407
             + W+I    C +  K++ +KD
Sbjct  428  RIAWVILLTLCKIDGKAQPYKD  449



>ref|XP_010536629.1| PREDICTED: exocyst complex component EXO70B1 [Tarenaya hassleriana]
 ref|XP_010536630.1| PREDICTED: exocyst complex component EXO70B1 [Tarenaya hassleriana]
 ref|XP_010536631.1| PREDICTED: exocyst complex component EXO70B1 [Tarenaya hassleriana]
Length=694

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 6/119 (5%)
 Frame = +3

Query  57   QARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYVMEYLTRMMHGYGQPL  236
            +AR  L+ LA A R     FE++VL  +     +   VHP+  YVM Y+ +++  Y + L
Sbjct  402  EARVVLAALADAVRGTFVAFENNVLYETSKRPTINGEVHPMIRYVMNYV-KLIVDYAETL  460

Query  237  TTLITSKPQIMIERM-GDTVLDRRFIDRENQSPLASHLVWIIASLHCNLKIKSKQHKDG  410
             +L+ +     +E + GD   +      EN SPLA  L+ +I SL  NL+ KSK ++DG
Sbjct  461  NSLLENDEDNELEGISGDDANNLP----ENMSPLAKRLLRLITSLELNLEEKSKLYEDG  515



>ref|XP_009359437.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=649

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +    S E V  +AR  L +L  AAR     FE++V + +     +   +HPLT
Sbjct  351  LPDLQQMM---SDEYVVDEARGVLDRLGDAARGTFAEFENAVQSEASKKPMLSGEIHPLT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ +++  Y   L +L+ +  +  +ER+  +  D   I   + SP+   L+ +I+
Sbjct  408  RYVMNYV-KLLVDYSVTLNSLLDTGEE-ELERLQGSPNDDLGIG--SMSPIGHRLLLLIS  463

Query  363  SLHCNLKIKSKQHKDG  410
            +L  NL+ KS+ + DG
Sbjct  464  NLESNLEEKSRVYDDG  479



>ref|XP_006409898.1| hypothetical protein EUTSA_v10017781mg [Eutrema salsugineum]
 gb|ESQ51351.1| hypothetical protein EUTSA_v10017781mg [Eutrema salsugineum]
Length=578

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP IE +F   S+  V+ Q   TL+ L +    +L  FE S+   S        G+H LT
Sbjct  287  LPVIEEVFSYDSTSPVKSQIDVTLTDLEEGVISMLDEFESSIAKESSKSLISGGGIHQLT  346

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQS-PLASHLVWII  359
             YVM ++   +  Y  PL  +I+  P       GD       +D  + S PLA  + W+I
Sbjct  347  RYVMNFIV-FLADYSDPLADIISKTPSSFT---GD-------VDSSSSSSPLAKRISWLI  395

Query  360  ASLHCNLKIKSKQHKD  407
              L C +  KS+ + D
Sbjct  396  LFLLCKIDAKSRLYND  411



>gb|AGW45468.1| hypothetical protein, partial [Reaumuria trigyna]
Length=415

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 65/138 (47%), Gaps = 8/138 (6%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IF  KS+  V  QA TTL+++A + + +L  FE ++   S        G+HPLT 
Sbjct  220  PEIQSIFKFKSTSSVTSQAETTLNKIADSIKTMLTEFESAIQKDSSKTLMPGGGIHPLTR  279

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN----QSPLASHLVW  353
            YVM YL   +  Y   LT ++ S             L  ++ D       +S L+    W
Sbjct  280  YVMNYLC-FLSQYSDSLTDIMASDSTTSPSS---PTLPEKYFDSPTTNGPKSKLSEKFAW  335

Query  354  IIASLHCNLKIKSKQHKD  407
            +I  L C L  K++ + D
Sbjct  336  LILILLCKLDRKAELYGD  353



>gb|KDO49819.1| hypothetical protein CISIN_1g044027mg [Citrus sinensis]
Length=638

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 20/148 (14%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P IE IF  +S+  V+ +A T+L ++ ++AR ++ +FE  +   S        GVH LT 
Sbjct  327  PVIESIFSFESTSAVRSKALTSLIKIGESARQMILDFETHIQKDSSKTQVPGGGVHHLTI  386

Query  186  YVMEYLTRMMHGYGQPLTTLI---------TSKPQIMIERMGDTVLDRRFIDRENQSPLA  338
             VM YLT  +  Y   L  ++         TS P +      +T  D       N SP  
Sbjct  387  DVMNYLTS-LGDYSNILGDILADWDPPAKSTSSPLVSYFESPETTAD-------NDSPAP  438

Query  339  S---HLVWIIASLHCNLKIKSKQHKDGY  413
            +   H+ W+I SL C L  K+K +KD +
Sbjct  439  AVTLHVAWLIVSLLCKLDAKAKHYKDAH  466



>ref|XP_002315254.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEF01425.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=618

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 63/129 (49%), Gaps = 1/129 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PD+E IF ++S+ +++ QA ++L  L ++ R IL  FE ++   S     V  G+HPLT 
Sbjct  318  PDVELIFDSESTSKIKQQAVSSLHGLGESIRAILSEFESTIQKDSSKTLIVGGGIHPLTQ  377

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             V  Y++ +   Y + L+ ++            +   +    D  +   ++ HL W+I  
Sbjct  378  KVTSYISSLA-DYSRILSDIVADSSPPRNTAFPEAYFESPNYDASSTPAVSVHLAWLILV  436

Query  366  LHCNLKIKS  392
            L C L  K+
Sbjct  437  LLCKLDRKA  445



>ref|XP_006428994.1| hypothetical protein CICLE_v10011115mg [Citrus clementina]
 gb|ESR42234.1| hypothetical protein CICLE_v10011115mg [Citrus clementina]
Length=778

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 6/141 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  ++ +A T+L ++ ++AR ++ +FE  +   S        GVH LT 
Sbjct  459  PEIESIFSFESTSALRSKALTSLIKIGESARQMILDFETHIQKDSSKTQVPGGGVHHLTI  518

Query  186  YVMEYLTRMMHGYGQPLTTLIT--SKPQIMIERMGDTVLDRRFIDRENQSPLAS---HLV  350
             VM YLT +   Y   L  ++   + P      +  +  +      +N+SP  +   H+ 
Sbjct  519  DVMNYLTSLA-DYSNILGDILADWAPPAKSTSSLLVSYFESPETTADNESPAPAVTLHVA  577

Query  351  WIIASLHCNLKIKSKQHKDGY  413
            W+I SL C L  K+K +KD +
Sbjct  578  WLIVSLLCKLDAKAKHYKDAH  598



>ref|XP_007027955.1| Exocyst subunit exo70 family protein A2 isoform 2 [Theobroma 
cacao]
 gb|EOY08457.1| Exocyst subunit exo70 family protein A2 isoform 2 [Theobroma 
cacao]
Length=501

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 18/133 (14%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IEY+FG+KS   ++  A++   +LAQ A++   +FE +V   +     ++  VHPLT+Y
Sbjct  352  EIEYLFGSKSCIEMRESAQSLTKRLAQTAQETFGDFEEAVEKDATKTAVLDGTVHPLTSY  411

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
            V+ Y+ + +  Y   L  L                  + F D +  + L +    I+ +L
Sbjct  412  VINYV-KFLFDYQSTLKQLF-----------------QEFDDGDADAQLTNVTTRIMQAL  453

Query  369  HCNLKIKSKQHKD  407
              NL  KSKQ+KD
Sbjct  454  QTNLDGKSKQYKD  466



>ref|XP_011077417.1| PREDICTED: exocyst complex component EXO70A1-like [Sesamum indicum]
Length=638

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 63/134 (47%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IF  +S+  ++ QA T+L +L +  R  L +FE  +L  S        G+H LT 
Sbjct  324  PEIDSIFSFESTTNIKSQALTSLIKLGEFVRSALNDFESVILKDSSKSPVAGAGIHYLTI  383

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
              M YL+ ++  Y   L+ ++   P      + ++       D      ++  + W+I  
Sbjct  384  DAMNYLS-ILSDYSNILSDILADSPPPAKNLLPESYFGFSDSDESPAPAISLKMAWLILV  442

Query  366  LHCNLKIKSKQHKD  407
            L C L  K+K +KD
Sbjct  443  LLCKLDTKAKYYKD  456



>ref|XP_011091478.1| PREDICTED: exocyst complex component EXO70A1 [Sesamum indicum]
Length=612

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 68/135 (50%), Gaps = 6/135 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+ E IF  +    +++QA +++ +L+ AA+ IL  F  S+  +S        G+HPL  
Sbjct  308  PETESIFSYEPLSPIKLQALSSMHKLSDAAQTILSEFVSSIQKNSSKTPIPGGGIHPLNC  367

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFID-RENQSPLASHLVWIIA  362
             VM Y++ +    G  L+ ++  +P    E +  +     + D R   S +AS L WII 
Sbjct  368  SVMNYVSLLADNSGI-LSDILADEP----ETVARSPFPESYFDSRSPTSRVASQLAWIIL  422

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ ++D
Sbjct  423  VLLCKLDSKAEIYRD  437



>ref|XP_006480724.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
Length=646

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 6/141 (4%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE IF  +S+  ++ +A T+L ++ ++AR ++ +FE  +   S        GVH LT 
Sbjct  327  PEIESIFSFESTSALRSKALTSLIKIGESARQMILDFETHIQKDSSKTQVPGGGVHHLTI  386

Query  186  YVMEYLTRMMHGYGQPLTTLIT--SKPQIMIERMGDTVLDRRFIDRENQSP---LASHLV  350
             VM YLT +   Y   L  ++   + P      +  +  +      +N+SP   +  H+ 
Sbjct  387  DVMNYLTSLA-DYSNILGDILADWAPPAKSTSSLLVSYFESPETTADNESPEPAVTLHVA  445

Query  351  WIIASLHCNLKIKSKQHKDGY  413
            W+I SL C L  K+K +KD +
Sbjct  446  WLIVSLLCKLDAKAKHYKDAH  466



>ref|XP_004251304.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=634

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 4/135 (3%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF   S + V+ QA  +L +L +AAR +L  FE ++   + S      GVHPLT Y
Sbjct  319  EIELIFSFNSFDIVKSQAMASLVKLGEAARLMLSEFESAIQKDT-SKAKAGGGVHPLTRY  377

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWIIA  362
            VM YL   +  Y      +I   P  +   + ++       D ++   S ++  L W++ 
Sbjct  378  VMNYLV-FLGDYSGAFAEIIGDFPLSVQSPLPESYFMSPIPDEDDSPSSAVSVRLAWLVL  436

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +KD
Sbjct  437  VLLCKLDGKAQLYKD  451



>dbj|BAF01920.1| hypothetical protein [Arabidopsis thaliana]
Length=319

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 65/134 (49%), Gaps = 2/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P I+ IF   S+  V++QA  +L +L+++   ++  F+ S+   S        GVH LT 
Sbjct  19   PKIDQIFSYDSTAAVRLQANESLEKLSESVNAMMTEFQSSITKESSKSAISGGGVHQLTR  78

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YVM ++   +  Y   L T++      + E    +  +       ++SP+A+ L W+I  
Sbjct  79   YVMNFIV-FLADYSDSLATILKESSLPLPEDYFSSSGEEN-PGSGDRSPMAARLAWLILV  136

Query  366  LHCNLKIKSKQHKD  407
            L C +  KS+ + D
Sbjct  137  LLCKIDAKSRLYND  150



>ref|XP_007027954.1| Exocyst subunit exo70 family protein A2 isoform 1 [Theobroma 
cacao]
 gb|EOY08456.1| Exocyst subunit exo70 family protein A2 isoform 1 [Theobroma 
cacao]
Length=643

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 18/133 (14%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IEY+FG+KS   ++  A++   +LAQ A++   +FE +V   +     ++  VHPLT+Y
Sbjct  352  EIEYLFGSKSCIEMRESAQSLTKRLAQTAQETFGDFEEAVEKDATKTAVLDGTVHPLTSY  411

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
            V+ Y+ + +  Y   L  L                  + F D +  + L +    I+ +L
Sbjct  412  VINYV-KFLFDYQSTLKQLF-----------------QEFDDGDADAQLTNVTTRIMQAL  453

Query  369  HCNLKIKSKQHKD  407
              NL  KSKQ+KD
Sbjct  454  QTNLDGKSKQYKD  466



>ref|XP_010462310.1| PREDICTED: exocyst complex component EXO70B1-like isoform X2 
[Camelina sativa]
Length=593

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 36/136 (26%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPL  179
            LPD+E IF + SSE + +Q+    S+LA+AAR IL  FE++V     SV  V  G +HPL
Sbjct  320  LPDMEEIFDSSSSEAILVQSTEIQSRLAEAARGILTEFENAVFREP-SVVPVPGGTIHPL  378

Query  180  TTYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
            T                       + P + I ++            E  SPLA H++W +
Sbjct  379  TR----------------------NNPDMDISQL------------EGISPLALHMIWTM  404

Query  360  ASLHCNLKIKSKQHKD  407
              L  NL+ KS  +KD
Sbjct  405  VMLQFNLEEKSLHYKD  420



>ref|XP_004307455.1| PREDICTED: uncharacterized protein LOC101293927 [Fragaria vesca 
subsp. vesca]
Length=642

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 66/134 (49%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+ E +F ++S+   ++QA + L +L  + R IL +FE ++   S  +     GVHPLT 
Sbjct  336  PETEAVFCSESTSGSKLQALSLLLKLGDSVRSILSDFESTIQKDSTKILVPGGGVHPLTQ  395

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             VM YLT +   Y   L  ++   P        +T       D  +   ++ HL W+I  
Sbjct  396  KVMNYLTSLAD-YSIILCDILADYPPPANSSFHETSFKSSMPDEGSTPAVSVHLAWLILV  454

Query  366  LHCNLKIKSKQHKD  407
            L C L IK++ +KD
Sbjct  455  LLCKLDIKAEIYKD  468



>ref|XP_002534730.1| protein binding protein, putative [Ricinus communis]
 gb|EEF27653.1| protein binding protein, putative [Ricinus communis]
Length=630

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 65/133 (49%), Gaps = 1/133 (1%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF  +S+  V+ QA T+L +L +  R +L +FE ++   +        GVHPLT Y
Sbjct  321  EIESIFNFESTSTVRTQAVTSLIKLGEGVRTMLSDFEAAISKDNSKTPVPGAGVHPLTRY  380

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
            VM Y+   +  Y   L+ ++   P      + ++       +    + ++  L W+I  L
Sbjct  381  VMNYIA-FLADYSGVLSDIVADWPLTSQSPLPESYFGSPEHEDGAATAISVRLAWLILVL  439

Query  369  HCNLKIKSKQHKD  407
             C L  K++ +KD
Sbjct  440  LCKLDGKAELYKD  452



>ref|XP_008230879.1| PREDICTED: exocyst complex component EXO70B1 [Prunus mume]
Length=655

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 72/148 (49%), Gaps = 19/148 (13%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPDI+ ++  ++   V+ +    L +L  + +     FE+++ +++ +      G+HPLT
Sbjct  351  LPDIDGLYVDEAGSSVRNECHEVLMRLGDSVKATFSEFENAIASNASTNPVAGGGIHPLT  410

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVL-----------DRRFIDRENQ-  326
             YVM YL R +  YG+ L  L+    +      GD++            + + ID   + 
Sbjct  411  RYVMNYL-RTLTDYGETLNVLLDDSDE------GDSISLSPDTSPTTEEENKSIDTSGRI  463

Query  327  SPLASHLVWIIASLHCNLKIKSKQHKDG  410
            SP+  H   ++++L  NL  KSK +KD 
Sbjct  464  SPMLRHYRSLVSTLESNLDDKSKLYKDA  491



>ref|XP_010555667.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=637

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 65/134 (49%), Gaps = 18/134 (13%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE +FG+K+   ++  A+    +LA+ A++   +FE +V   +     ++  VHPLT+
Sbjct  352  PEIELVFGSKACTEMKESAQNLTKRLAKTAQETFSDFEEAVEKDATRTAVMDGTVHPLTS  411

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YV+ Y+ + +  Y   L  L                  + F   +  S LAS    I+ +
Sbjct  412  YVINYV-KFLFDYQSTLRLLF-----------------QEFDSNDPDSELASVTTRIMQA  453

Query  366  LHCNLKIKSKQHKD  407
            L  NL  KSKQ+KD
Sbjct  454  LQNNLDGKSKQYKD  467



>ref|XP_009798500.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=634

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 4/135 (3%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF   S   V+ QA T+L +L +AAR +L  FE ++   S        GVHPLT Y
Sbjct  319  EIELIFSFNSLTVVKSQAVTSLVKLGEAARFMLSEFESAIQKDSSKAVACG-GVHPLTRY  377

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN--QSPLASHLVWIIA  362
            VM YL   +  Y    + +I   P  +   + ++       D  +   S ++  L W++ 
Sbjct  378  VMNYLV-FLGDYSGAFSEIIVDWPLSIQSPLPESYFLSPTPDDYDSPSSAVSVRLAWLVL  436

Query  363  SLHCNLKIKSKQHKD  407
             L C L  K++ +KD
Sbjct  437  VLLCKLDGKAQHYKD  451



>ref|XP_004302800.1| PREDICTED: uncharacterized protein LOC101312264 [Fragaria vesca 
subsp. vesca]
Length=610

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P IE IFG +S+  V+ +A  +L +L+++ R +L  FE S+   S        GVHPLT 
Sbjct  332  PGIESIFGFESTATVRSEAINSLVRLSESVRSMLSEFEISIQKDSSKSAVAGGGVHPLTL  391

Query  186  YVMEYLTRMMHGYGQPLTTLIT--SKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWII  359
             VM YL+ ++  Y   L  +    + P  + +   +        D    + ++  +VW+I
Sbjct  392  RVMSYLS-LLTDYSNVLADIFIDWTPPAKLPQPESE--------DTSVSTAISLRMVWLI  442

Query  360  ASLHCNLKIKSKQHKD  407
              L C L  K+KQ+K+
Sbjct  443  LVLVCKLDEKAKQYKE  458



>ref|XP_009788652.1| PREDICTED: exocyst complex component EXO70B1 [Nicotiana sylvestris]
Length=665

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 2/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DI+ ++  +S E V  +A+  L  L +AA      FE++V   +         +HPLT
Sbjct  362  LSDIDLLYNDESGEMVCSEAKGVLDGLGEAAIGTFVEFENAVQREASKKPTQGGEIHPLT  421

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ +++  Y   L  L+  K +   E     + +   ++ EN  PLA  L+ +I 
Sbjct  422  RYVMNYV-KLLVDYSDTLNGLL-EKVESECEPDSSRIENGDNLEFENVPPLARRLMLLIK  479

Query  363  SLHCNLKIKSKQHKD  407
            SL  NL+ KS+ ++D
Sbjct  480  SLEANLEGKSRMYED  494



>ref|XP_009761942.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=627

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 6/136 (4%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAH-SWSVTGVEEGVHPLTTY  188
            IE IF   S E V+ QA  +L +L  AAR +L  FE +V    S +V G   GVHPLT Y
Sbjct  312  IELIFCFDSMEVVKSQAMISLVKLGDAARAMLSEFESAVQKDTSKAVPG--GGVHPLTRY  369

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP--LASHLVWIIA  362
            VM YL   +  Y   ++ +I   P  +   + ++       +  +  P  +A  L W++ 
Sbjct  370  VMNYLV-YLGDYSDAISEIIVDLPISLQTSLPESYYLSMTTEDGDPPPSVVALRLAWLVL  428

Query  363  SLHCNLKIKSKQHKDG  410
             L C L  K++ +KD 
Sbjct  429  VLLCKLDGKAQLYKDA  444



>ref|XP_009608742.1| PREDICTED: exocyst complex component EXO70B1 [Nicotiana tomentosiformis]
Length=665

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 67/135 (50%), Gaps = 2/135 (1%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            L DI+ +F  +S E V  +A+  L  L +AA      FE++V   +         +HPLT
Sbjct  362  LSDIDLLFNDESGEMVCSEAKGVLDGLGEAAIGTFVEFENAVQREASKKPTQGGEIHPLT  421

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ +++  Y   L  L+  K +   E     + +   ++ EN  PL   L+ +I 
Sbjct  422  RYVMNYV-KLLVDYSDTLNGLL-EKVESECEPDSSRIDNGDNLEFENVPPLGRRLMLLIK  479

Query  363  SLHCNLKIKSKQHKD  407
            SL  NL+ KS+ ++D
Sbjct  480  SLEANLEGKSRMYED  494



>gb|KHG11246.1| Exocyst complex component 7 [Gossypium arboreum]
Length=618

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 69/134 (51%), Gaps = 20/134 (15%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEG-VHPLTT  185
            +I+Y+FG KS   ++  A++   +LAQ A++   +FE +V A   + T V +G VHPLT+
Sbjct  350  EIDYLFGTKSCTEMRESAQSLTKRLAQTAQETFGDFEEAV-AKDATKTAVLDGTVHPLTS  408

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
            YV+ Y+ + +  Y   L  L                  + F + + ++ L +    I+ +
Sbjct  409  YVINYV-KFLFDYKTTLEQLF-----------------QEFEESDTEAQLKTLTTRIMDA  450

Query  366  LHCNLKIKSKQHKD  407
            L  NL  KSKQ+KD
Sbjct  451  LQTNLDGKSKQYKD  464



>ref|XP_002892415.1| ATEXO70H6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68674.1| ATEXO70H6 [Arabidopsis lyrata subsp. lyrata]
Length=613

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 67/144 (47%), Gaps = 20/144 (14%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +P I+ IF   S+  V++QA  +L +L+++   ++  F+ S+   S        GVH LT
Sbjct  312  IPKIDQIFSYDSTAAVRLQANESLEKLSESVNAMMTEFQSSITKESSKSAISGGGVHQLT  371

Query  183  TYVMEYLTRMMHGYGQPLTTLITSK----PQIMIERMGDTVLDRRFIDREN-----QSPL  335
             YVM ++   +  Y   L T++       P+      G+          EN     +SP+
Sbjct  372  RYVMNFIV-FLADYSDSLATILKESSLPLPEDYFSSSGE----------ENPGSGGRSPM  420

Query  336  ASHLVWIIASLHCNLKIKSKQHKD  407
            A+ L W+I  L C +  KS+ + D
Sbjct  421  AARLAWLILVLLCKVDAKSRLYND  444



>ref|NP_683286.2| exocyst subunit exo70 family protein H6 [Arabidopsis thaliana]
 gb|AAF75081.1|AC007583_17 It contains a interferon alpha/beta domain PF|00143. EST gb|N96176 
comes from this gene [Arabidopsis thaliana]
 gb|AEE28170.1| exocyst subunit exo70 family protein H6 [Arabidopsis thaliana]
Length=615

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 65/138 (47%), Gaps = 10/138 (7%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P I+ IF   S+  V++QA  +L +L+++   ++  F+ S+   S        GVH LT 
Sbjct  315  PKIDQIFSYDSTAAVRLQANESLEKLSESVNAMMTEFQSSITKESSKSAISGGGVHQLTR  374

Query  186  YVMEYLTRMMHGYGQPLTTLITSK----PQIMIERMGDTVLDRRFIDRENQSPLASHLVW  353
            YVM ++   +  Y   L T++       P+      G+           ++SP+A+ L W
Sbjct  375  YVMNFIV-FLADYSDSLATILKESSLPLPEDYFSSSGE-----ENPGSGDRSPMAARLAW  428

Query  354  IIASLHCNLKIKSKQHKD  407
            +I  L C +  KS+ + D
Sbjct  429  LILVLLCKIDAKSRLYND  446



>ref|XP_009601489.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=627

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 66/136 (49%), Gaps = 8/136 (6%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAH-SWSVTGVEEGVHPLTTY  188
            IE IF   S E V+ QA   L +L  AAR +L  FE +V    S +V G   GVHPLT Y
Sbjct  311  IELIFSFDSMEVVKSQAMILLVKLGNAARAMLSEFESAVQKDTSKAVPG--GGVHPLTRY  368

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP---LASHLVWII  359
            VM YL   +  Y   ++ +I   P  +   + ++         +  SP   +A  L W++
Sbjct  369  VMNYLV-YLGDYSDAISEIIVDLPISLQTSLPESYY-LSLTTEDGDSPPSAVALRLAWLV  426

Query  360  ASLHCNLKIKSKQHKD  407
              L C L  K++ +KD
Sbjct  427  LVLLCKLDGKAQLYKD  442



>ref|XP_009375245.1| PREDICTED: exocyst complex component EXO70B1-like [Pyrus x bretschneideri]
Length=597

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 7/136 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +    +   V  +AR  L  L  AAR     FE++V   +     +   +HPLT
Sbjct  299  LPDLQQMI---TDAYVVGEARGVLDALGDAARGTFAEFENAVQTEASKKPMLSGEIHPLT  355

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ R++  Y   L +L+ +  +  ++R+     D   ID  + SP+   L+ +I+
Sbjct  356  RYVMNYV-RLLVDYSDTLNSLLDTGEE-ELQRLQGLPNDDLGID--SMSPIGRRLLLLIS  411

Query  363  SLHCNLKIKSKQHKDG  410
            +L  NL+ KS+ + DG
Sbjct  412  NLEANLEEKSRVYDDG  427



>gb|KCW65316.1| hypothetical protein EUGRSUZ_G02769, partial [Eucalyptus grandis]
Length=602

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE IF   S+  V++QA + L +L    + IL N+E ++   S  +     G+H LT 
Sbjct  306  PDIESIFKFDSTLDVKLQALSALVKLGNMVQVILSNYEATIQKDSSKILPEGGGIHSLTR  365

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             VME+ T +       L+ ++   P      + ++  +         SP++  L W+I  
Sbjct  366  SVMEFATSLTK-CSSTLSDILMDHPPPGNLNLPESYFNGLSAGDIPMSPVSVRLAWLILG  424

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  425  LLCKLDAKAELYKD  438



>ref|XP_010068853.1| PREDICTED: exocyst complex component EXO70A1-like [Eucalyptus 
grandis]
Length=622

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 1/134 (1%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            PDIE IF   S+  V++QA + L +L    + IL N+E ++   S  +     G+H LT 
Sbjct  311  PDIESIFKFDSTLDVKLQALSALVKLGNMVQVILSNYEATIQKDSSKILPEGGGIHSLTR  370

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIAS  365
             VME+ T +       L+ ++   P      + ++  +         SP++  L W+I  
Sbjct  371  SVMEFATSLTK-CSSTLSDILMDHPPPGNLNLPESYFNGLSAGDIPMSPVSVRLAWLILG  429

Query  366  LHCNLKIKSKQHKD  407
            L C L  K++ +KD
Sbjct  430  LLCKLDAKAELYKD  443



>ref|XP_003597314.1| Exocyst complex component [Medicago truncatula]
 gb|AES67565.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=588

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = +3

Query  12   IEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTYV  191
            IE IF ++S+  ++ Q   +  +L +  R +L +FE ++   S  +     G+HPLT YV
Sbjct  309  IESIFSSESNSPIRSQVVASQVRLGETVRTMLTDFESAIQKESSKIPVPGGGIHPLTRYV  368

Query  192  MEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDREN-QSPLASHLVWIIASL  368
            M Y+  ++  Y + +  +++  PQ  +    ++       D +N  S +A  L W+I  +
Sbjct  369  MNYIA-LLADYSEAIGDIVSDWPQTPVP---ESYYKSPIHDEDNPPSEIAKRLSWLILVV  424

Query  369  HCNLKIKSKQHKD  407
             C L  K++ +KD
Sbjct  425  LCKLDGKAEFYKD  437



>ref|XP_008374246.1| PREDICTED: exocyst complex component EXO70B1-like [Malus domestica]
Length=649

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 7/136 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +    + E V  +AR  L  L  AAR     FE++V   +     +   +HPLT
Sbjct  351  LPDLQQMM---TDEYVVGEARGVLDALGDAARGTFAEFENAVQTEASKKPMLSGEIHPLT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ R++  Y   L +L+ +  +  ++R+     D   ID  + SP+   L+ +I+
Sbjct  408  RYVMNYV-RLLVDYSDTLNSLLDTGEE-ELQRLQGLPNDDLGID--SMSPIGHRLLLLIS  463

Query  363  SLHCNLKIKSKQHKDG  410
            +L  NL+  S+ + DG
Sbjct  464  NLEANLEEXSRVYDDG  479



>ref|XP_006400924.1| hypothetical protein EUTSA_v10016083mg [Eutrema salsugineum]
 gb|ESQ42377.1| hypothetical protein EUTSA_v10016083mg [Eutrema salsugineum]
Length=630

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (50%), Gaps = 5/137 (4%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE IF   S+  V+ Q   +L++L +AAR ++ +FE ++   +     +  GVHPLT Y
Sbjct  309  EIESIFYFDSAAAVRSQVINSLARLGEAARSMMTDFESAIQKETSKTPIIGGGVHPLTRY  368

Query  189  VMEYLTRMMHGYGQPLTTLIT----SKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWI  356
            VM YL+  +  Y + +  +      S P  + + +  +  D         SP++  + W+
Sbjct  369  VMNYLS-FLADYSESIAAIFENWKLSVPSPLPDSLFISGGDEAHPQDLYSSPVSVRIAWV  427

Query  357  IASLHCNLKIKSKQHKD  407
            I    C +  K++ +KD
Sbjct  428  ILLTLCKIDGKAQPYKD  444



>ref|XP_007204602.1| hypothetical protein PRUPE_ppa002792mg [Prunus persica]
 gb|EMJ05801.1| hypothetical protein PRUPE_ppa002792mg [Prunus persica]
Length=633

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 18/133 (14%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            +IE +FG+K+   ++  A +   +LAQ A++   +FE +V   +   T ++  VHPLT+Y
Sbjct  350  EIELLFGSKACMEMRESAVSLTKRLAQTAQETFGDFEEAVEKDATKTTVLDGTVHPLTSY  409

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIASL  368
            V+ Y+ + +  Y   L  L                  + F D +++S L +    I+ +L
Sbjct  410  VINYV-KFLFDYQSTLKQLF-----------------QEFDDGDSESQLTAVTTRIMQAL  451

Query  369  HCNLKIKSKQHKD  407
              NL  KSKQ+KD
Sbjct  452  QNNLDGKSKQYKD  464



>gb|EYU38484.1| hypothetical protein MIMGU_mgv1a022387mg [Erythranthe guttata]
Length=635

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 7/137 (5%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+I+ IF  +S+  ++ QA T+L +L +  R  L +FE ++   S        G H LT 
Sbjct  322  PEIDSIFSFESTIPIKSQALTSLVKLGEFVRAALHDFESAIQKDSTKSPVAGAGNHNLTI  381

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP---LASHLVWI  356
              MEYLT +   Y   L+ ++   P    + M ++     F D E +SP   ++  + W+
Sbjct  382  DAMEYLTNLA-DYSSILSDILADSPPETKKLMPESYFG--FSDTE-ESPAPAISLKMAWL  437

Query  357  IASLHCNLKIKSKQHKD  407
            I  L C L  K+K +KD
Sbjct  438  ILVLLCKLDTKAKYYKD  454



>ref|XP_006293428.1| hypothetical protein CARUB_v10025404mg [Capsella rubella]
 gb|EOA26326.1| hypothetical protein CARUB_v10025404mg [Capsella rubella]
Length=609

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 5/139 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP IE IF   S+  V++QA  +L  L +A   ++  FE S+   +        GVH LT
Sbjct  297  LPQIEEIFSYNSTSAVRLQAADSLKNLGEAINSMVAEFEASITKEASKSLIPGGGVHQLT  356

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIER-MGDTVLDRRF---IDRENQSPLASHLV  350
             YVM ++   +  Y + L  ++T     + E   G+   D          + SP+ +   
Sbjct  357  RYVMNFIV-FLADYNECLAGVLTESTLPLPEDYFGNNDEDNNKGGETGTSSSSPVTTRFA  415

Query  351  WIIASLHCNLKIKSKQHKD  407
            W+I  L C +  KS+ + D
Sbjct  416  WLILVLLCKIDTKSRMYSD  434



>ref|XP_006409897.1| hypothetical protein EUTSA_v10017620mg [Eutrema salsugineum]
 gb|ESQ51350.1| hypothetical protein EUTSA_v10017620mg [Eutrema salsugineum]
Length=600

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 64/139 (46%), Gaps = 13/139 (9%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LP IE IF   S+  V++QA  +L+ LA A   ++  FE S+   S   +    GVH LT
Sbjct  297  LPQIEEIFSYDSTSAVRLQAADSLNSLAGAINSMVAEFEASITKESSKSSIPGGGVHQLT  356

Query  183  TYVMEYLTRMMHGYGQPLTTLITSK----PQIMIERMGDTVLDRRFIDRENQSPLASHLV  350
             YVM ++   +  Y + L  ++T      P+     +G            + SP+ +   
Sbjct  357  RYVMNFVV-FLADYNESLAGVLTESTLPLPEDYAGELGSLS--------SSSSPVTTRFA  407

Query  351  WIIASLHCNLKIKSKQHKD  407
            W+I  L C +  KS+ + D
Sbjct  408  WLILVLLCKIDTKSRVYND  426



>emb|CDP08984.1| unnamed protein product [Coffea canephora]
Length=652

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 63/138 (46%), Gaps = 6/138 (4%)
 Frame = +3

Query  9    DIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTTY  188
            DI  IF   S   V+ QA T+L +L +A R +L  FE ++   S        GVHPL  Y
Sbjct  336  DIGMIFSFDSLSGVRAQAMTSLLKLGEAVRTMLLQFESAIEKDSSKTAVPGGGVHPLARY  395

Query  189  VMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFI--DRENQSPLAS---HLVW  353
            VM YL   +  Y   L  ++   P  +   + ++ L       D ++ SP ++    L W
Sbjct  396  VMNYLV-FLTDYSGALADIVADWPTSVQTSLPESYLSSPISANDVDDDSPASTISVRLAW  454

Query  354  IIASLHCNLKIKSKQHKD  407
            II  L C L  K+  + D
Sbjct  455  IILVLLCKLDGKAGCYGD  472



>ref|XP_009409718.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=664

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 42/156 (27%), Positives = 71/156 (46%), Gaps = 29/156 (19%)
 Frame = +3

Query  6    PDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLTT  185
            P+IE +F  +S+  V+ QA  +LS+LA+ A   L +FE ++L  S  +     GVHP+T 
Sbjct  352  PEIELVFSFESTAVVRAQALASLSKLAETACATLADFESAILRESSRLAVPGGGVHPMTR  411

Query  186  YVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP-----------  332
            Y M Y++ ++  Y   L  +    P      + D  LD       +Q+P           
Sbjct  412  YTMNYIS-LLADYESSLAEIFADCPLQTPSPIPDFFLD------TSQAPAVHPPASCPSS  464

Query  333  -----------LASHLVWIIASLHCNLKIKSKQHKD  407
                       +A  L W++ +L C L  K++ ++D
Sbjct  465  PGTTTSSYISAVAEKLAWLVFALLCKLDGKTETYQD  500



>ref|XP_008392777.1| PREDICTED: exocyst complex component EXO70B1-like [Malus domestica]
Length=649

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 72/136 (53%), Gaps = 7/136 (5%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            LPD++ +    + E V  +AR  L  L  AAR     FE++V + +     +   +HPLT
Sbjct  351  LPDLQQMM---TDEYVVGEARGVLDGLGDAARGTFAEFENAVQSEASKKPMLSGEIHPLT  407

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSPLASHLVWIIA  362
             YVM Y+ +++  Y   L +L+ +  +  +ER+  +  D   I   + SP+   L+ +I+
Sbjct  408  RYVMNYV-KLLVDYSVTLNSLLDTGEE-ELERLQGSPNDDLGIG--SMSPIGHRLLLLIS  463

Query  363  SLHCNLKIKSKQHKDG  410
            +L  NL+ KS+ + DG
Sbjct  464  NLESNLEEKSRVYDDG  479



>ref|XP_003519931.1| PREDICTED: exocyst complex component EXO70B1-like [Glycine max]
Length=709

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 72/148 (49%), Gaps = 22/148 (15%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQ--LAQAARDILQNFEHSVLAHSWSVTGVEEGVHP  176
            +PD+E +F A   E   I+A TT ++  L +AA  I  + E+S+ + +         VHP
Sbjct  407  IPDMESLFPADDGE---IKAETTSAKCRLGEAAVLIFCDLENSIKSETGKTPVAGGAVHP  463

Query  177  LTTYVMEYLTRMMHGYGQPLTTLI-----------TSKPQIMIERMGDTVLDRRFIDREN  323
            LT Y+M YL R+   Y   L  +            TS+PQ       DT  +     +EN
Sbjct  464  LTRYIMNYL-RLACEYKDTLEEVFKEHSKMERADSTSRPQYE-----DTKPNNNNKQKEN  517

Query  324  QSPLASHLVWIIASLHCNLKIKSKQHKD  407
             SP A+ L+ ++  L  NL+ K+K +K+
Sbjct  518  VSPFAAQLMRVMELLDTNLEGKAKLYKE  545



>gb|KHN13555.1| Exocyst complex component 7 [Glycine soja]
Length=680

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (46%), Gaps = 6/140 (4%)
 Frame = +3

Query  3    LPDIEYIFGAKSSERVQIQARTTLSQLAQAARDILQNFEHSVLAHSWSVTGVEEGVHPLT  182
            +PDI+ ++  +    V+I+    L +L    R     FE+++  +  S   V  G+HPLT
Sbjct  377  MPDIDALYSDEVGSSVKIECHEVLKRLGDCVRVTFLEFENAIATNVSSTPFVGGGIHPLT  436

Query  183  TYVMEYLTRMMHGYGQPLTTLITSKPQIMIERMGDTVLDRRFIDRENQSP-----LASHL  347
             YVM YL R +  Y   L  L+  + +  I    D        +R   SP     +A H 
Sbjct  437  KYVMNYL-RALTDYSDILNLLLKDQDEDAISLSPDMSPGTEEDNRSQGSPSRVSSMALHF  495

Query  348  VWIIASLHCNLKIKSKQHKD  407
              I + L  NL+ KSK +K+
Sbjct  496  RSIASILESNLEEKSKLYKE  515



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517347226690